F483996
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 865 | 460 | 751 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300026121|Ga0207683_10685783|Ga0207683_106857832 |
| Length | 176 |
| Sequence | MRVHIGSDHAGLELKDHLLNWLADHGHEVVDHGPFVYDAADDYPVFCLRAAEGVAADWQDGQESLGVVVGGSGNGEQISANKVKGVRAVLAWSEETARLGREHNNANVISVGGRMHALEDMVSFVAEFLSTPFSGDPRHARRIEMLGDYEKTGNLPPLPDSAIGRQPGGPGHPGDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 2 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 3 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 4 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 5 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 6 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 7 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 8 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 9 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 10 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 11 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 12 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 13 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 14 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 15 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 16 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 17 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 18 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 19 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 20 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 21 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 22 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 23 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 24 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 25 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 26 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 27 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 28 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 29 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 30 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 31 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 32 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 33 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 34 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 35 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 36 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 37 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 38 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 39 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 40 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 41 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 42 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 43 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 44 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 45 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 46 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 47 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 48 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 49 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 50 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 51 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 52 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 53 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 54 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 55 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 56 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 57 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 58 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 59 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 60 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 61 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 62 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 63 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 64 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 65 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 66 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 67 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 68 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 69 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 70 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 71 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 72 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 73 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 74 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 75 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 76 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 77 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 78 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 79 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 80 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 81 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 82 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 83 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 84 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 85 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 86 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 87 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 88 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 89 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 90 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 91 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 92 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 93 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 94 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 95 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 96 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 97 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 98 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 99 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 101 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 115 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 116 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 117 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 118 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 120 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 122 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 123 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 124 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 125 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 126 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 127 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 128 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 129 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 130 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 131 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 132 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 133 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 134 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 135 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 136 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 137 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 138 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 139 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 141 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 159 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 162 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 163 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 164 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 165 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 205 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 206 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 207 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 208 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 209 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 210 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 211 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 212 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 213 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 214 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 215 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 216 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 217 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 218 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 219 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 222 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 223 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 224 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 225 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 226 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 227 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 228 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 232 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 235 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 236 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 237 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 243 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 244 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 245 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 246 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 247 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 248 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 249 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 250 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 251 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 252 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 253 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 254 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 255 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 256 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 257 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 258 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 259 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 260 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 261 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 262 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 263 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 264 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 265 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 266 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 267 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 268 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 269 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 270 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 271 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 353 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 354 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 355 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 358 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 359 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 360 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 361 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 362 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 363 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 364 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 365 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 392 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 393 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 399 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 400 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 401 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 402 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 406 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 409 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 411 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 412 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 413 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 414 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 415 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 416 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 417 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 418 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 419 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 420 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 422 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 423 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 424 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 425 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 426 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 427 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 428 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 429 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 430 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 431 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 432 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 435 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 436 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 437 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 438 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 439 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 440 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 441 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 442 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 443 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 444 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 445 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 446 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 447 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 448 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 449 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 450 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 451 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 452 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 453 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 454 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 455 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 456 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 457 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 458 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 459 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 460 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.36 |
| Metatranscriptomes | 0.46 |
| Isolates | 13.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.97 |
| Nodule | 2.43 |
| Rhizoplane | 2.43 |
| Rhizosphere | 80.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10068568 | 3300001979 | Bacteria | 956 |
| 2 | JGI24739J22299_10022301 | 3300001989 | Bacteria | 2246 |
| 3 | JGI24739J22299_10182026 | 3300001989 | Bacteria | 618 |
| 4 | JGI24737J22298_10008180 | 3300001990 | Bacteria | 3512 |
| 5 | JGI24735J21928_10188688 | 3300002067 | Bacteria | 597 |
| 6 | rootH2_10171867 | 3300003320 | Bacteria | 1388 |
| 7 | rootH1_10027836 | 3300003323 | Bacteria | 1598 |
| 8 | JGI25160J50197_1020109 | 3300003354 | Bacteria | 2026 |
| 9 | Ga0006562J51391_1094426 | 3300003578 | Bacteria | 2695 |
| 10 | Ga0006562J51391_1109822 | 3300003578 | Bacteria | 754 |
| 11 | Ga0058692_1048845 | 3300003856 | Bacteria | 708 |
| 12 | Ga0070683_100262476 | 3300005329 | Bacteria | 1643 |
| 13 | Ga0070683_100366079 | 3300005329 | Bacteria | 1373 |
| 14 | Ga0068869_101124483 | 3300005334 | Bacteria | 688 |
| 15 | Ga0070666_10003675 | 3300005335 | Bacteria | 9296 |
| 16 | Ga0070661_100766311 | 3300005344 | Bacteria | 790 |
| 17 | Ga0070668_100405861 | 3300005347 | Bacteria | 1164 |
| 18 | Ga0070668_100829628 | 3300005347 | Bacteria | 823 |
| 19 | Ga0070675_101085642 | 3300005354 | Bacteria | 736 |
| 20 | Ga0070671_100241920 | 3300005355 | Bacteria | 1532 |
| 21 | Ga0070659_100859924 | 3300005366 | Bacteria | 791 |
| 22 | Ga0070667_100018295 | 3300005367 | Bacteria | 5809 |
| 23 | Ga0070713_100895120 | 3300005436 | Bacteria | 853 |
| 24 | Ga0070710_10214923 | 3300005437 | Bacteria | 1220 |
| 25 | Ga0070711_100884605 | 3300005439 | Bacteria | 761 |
| 26 | Ga0070708_100059206 | 3300005445 | Bacteria | 3414 |
| 27 | Ga0070663_100024525 | 3300005455 | Bacteria | 4062 |
| 28 | Ga0070663_100141730 | 3300005455 | Bacteria | 1836 |
| 29 | Ga0070706_101168259 | 3300005467 | Bacteria | 708 |
| 30 | Ga0070707_101067006 | 3300005468 | Bacteria | 773 |
| 31 | Ga0070698_100143021 | 3300005471 | Bacteria | 2342 |
| 32 | Ga0068853_100111278 | 3300005539 | Bacteria | 2433 |
| 33 | Ga0068853_100588571 | 3300005539 | Bacteria | 1056 |
| 34 | Ga0070686_100465872 | 3300005544 | Bacteria | 974 |
| 35 | Ga0070665_100025085 | 3300005548 | Bacteria | 6009 |
| 36 | Ga0070665_100030936 | 3300005548 | Bacteria | 5387 |
| 37 | Ga0070665_100103226 | 3300005548 | Bacteria | 2854 |
| 38 | Ga0070665_100993081 | 3300005548 | Bacteria | 852 |
| 39 | Ga0068855_100002515 | 3300005563 | Bacteria | 22580 |
| 40 | Ga0070664_100739406 | 3300005564 | Bacteria | 918 |
| 41 | Ga0068857_100018695 | 3300005577 | Bacteria | 6083 |
| 42 | Ga0068854_100004644 | 3300005578 | Bacteria | 8668 |
| 43 | Ga0068856_100037419 | 3300005614 | Bacteria | 4762 |
| 44 | Ga0068856_100076400 | 3300005614 | Bacteria | 3319 |
| 45 | Ga0068856_100342594 | 3300005614 | Bacteria | 1513 |
| 46 | Ga0068856_100442064 | 3300005614 | Bacteria | 1321 |
| 47 | Ga0068856_100832558 | 3300005614 | Bacteria | 942 |
| 48 | Ga0068856_101565129 | 3300005614 | Bacteria | 673 |
| 49 | Ga0068852_100040818 | 3300005616 | Bacteria | 3918 |
| 50 | Ga0068859_100000091 | 3300005617 | Bacteria | 82527 |
| 51 | Ga0068859_101838933 | 3300005617 | Bacteria | 669 |
| 52 | Ga0068851_10152574 | 3300005834 | Bacteria | 1264 |
| 53 | Ga0068851_10186590 | 3300005834 | Bacteria | 1151 |
| 54 | Ga0068870_10556417 | 3300005840 | Bacteria | 773 |
| 55 | Ga0068863_100000271 | 3300005841 | Bacteria | 53894 |
| 56 | Ga0068863_101103109 | 3300005841 | Bacteria | 798 |
| 57 | Ga0068858_100000074 | 3300005842 | Bacteria | 104483 |
| 58 | Ga0068858_100002463 | 3300005842 | Bacteria | 18687 |
| 59 | Ga0068860_100000017 | 3300005843 | Bacteria | 307083 |
| 60 | Ga0068862_100000145 | 3300005844 | Bacteria | 80544 |
| 61 | Ga0081455_10000038 | 3300005937 | Bacteria | 135510 |
| 62 | Ga0081455_10064031 | 3300005937 | Bacteria | 3081 |
| 63 | Ga0075368_10003220 | 3300006042 | Bacteria | 5429 |
| 64 | Ga0075363_100096824 | 3300006048 | Bacteria | 1630 |
| 65 | Ga0075363_100374840 | 3300006048 | Bacteria | 834 |
| 66 | Ga0070715_10420532 | 3300006163 | Bacteria | 747 |
| 67 | Ga0070716_100108207 | 3300006173 | Bacteria | 1717 |
| 68 | Ga0070716_100740614 | 3300006173 | Bacteria | 755 |
| 69 | Ga0070712_100138932 | 3300006175 | Bacteria | 1851 |
| 70 | Ga0075367_10004802 | 3300006178 | Bacteria | 6652 |
| 71 | Ga0097620_100000091 | 3300006931 | Bacteria | 82527 |
| 72 | Ga0097620_101838457 | 3300006931 | Bacteria | 669 |
| 73 | Ga0099795_10067347 | 3300007788 | Bacteria | 1343 |
| 74 | Ga0105244_10382601 | 3300009036 | Bacteria | 648 |
| 75 | Ga0105240_10076806 | 3300009093 | Bacteria | 4117 |
| 76 | Ga0105245_10503484 | 3300009098 | Bacteria | 1227 |
| 77 | Ga0105245_10928749 | 3300009098 | Bacteria | 912 |
| 78 | Ga0105245_11574576 | 3300009098 | Bacteria | 709 |
| 79 | Ga0105247_10000102 | 3300009101 | Bacteria | 90969 |
| 80 | Ga0114129_10127582 | 3300009147 | Bacteria | 3497 |
| 81 | Ga0105241_10001550 | 3300009174 | Bacteria | 17612 |
| 82 | Ga0105241_10915110 | 3300009174 | Bacteria | 815 |
| 83 | Ga0105248_10000329 | 3300009177 | Bacteria | 55993 |
| 84 | Ga0105248_10000892 | 3300009177 | Bacteria | 33382 |
| 85 | Ga0105248_10042603 | 3300009177 | Bacteria | 5092 |
| 86 | Ga0105248_10657488 | 3300009177 | Bacteria | 1182 |
| 87 | Ga0105237_10041436 | 3300009545 | Bacteria | 4643 |
| 88 | Ga0105238_10063772 | 3300009551 | Bacteria | 3686 |
| 89 | Ga0105238_10699710 | 3300009551 | Bacteria | 1025 |
| 90 | Ga0105238_10791931 | 3300009551 | Bacteria | 963 |
| 91 | Ga0105249_10008763 | 3300009553 | Bacteria | 8828 |
| 92 | Ga0105249_10992092 | 3300009553 | Bacteria | 908 |
| 93 | Ga0105249_11484714 | 3300009553 | Bacteria | 750 |
| 94 | Ga0105249_11666359 | 3300009553 | Bacteria | 710 |
| 95 | Ga0105239_10233827 | 3300010375 | Bacteria | 2062 |
| 96 | Ga0105239_10381729 | 3300010375 | Bacteria | 1593 |
| 97 | Ga0105239_11405164 | 3300010375 | Bacteria | 806 |
| 98 | Ga0105239_11542198 | 3300010375 | Bacteria | 768 |
| 99 | Ga0105246_10021803 | 3300011119 | Bacteria | 4126 |
| 100 | Ga0105246_10118602 | 3300011119 | Bacteria | 1957 |
| 101 | Ga0105246_11089237 | 3300011119 | Bacteria | 729 |
| 102 | Ga0157369_10089205 | 3300013105 | Bacteria | 3292 |
| 103 | Ga0157369_10291546 | 3300013105 | Bacteria | 1699 |
| 104 | Ga0157369_10586593 | 3300013105 | Bacteria | 1151 |
| 105 | Ga0157369_10819480 | 3300013105 | Bacteria | 956 |
| 106 | Ga0157374_10417021 | 3300013296 | Bacteria | 1341 |
| 107 | Ga0157374_11363244 | 3300013296 | Bacteria | 732 |
| 108 | Ga0163162_11282725 | 3300013306 | Bacteria | 832 |
| 109 | Ga0157372_10105482 | 3300013307 | Bacteria | 3223 |
| 110 | Ga0157372_10517806 | 3300013307 | Bacteria | 1391 |
| 111 | Ga0157372_11625625 | 3300013307 | Bacteria | 744 |
| 112 | Ga0163163_10011655 | 3300014325 | Bacteria | 7986 |
| 113 | Ga0163163_10063765 | 3300014325 | Bacteria | 3655 |
| 114 | Ga0182008_10004862 | 3300014497 | Bacteria | 7764 |
| 115 | Ga0157379_10000011 | 3300014968 | Bacteria | 111920 |
| 116 | Ga0157379_10005095 | 3300014968 | Bacteria | 11269 |
| 117 | Ga0157376_10613314 | 3300014969 | Bacteria | 1084 |
| 118 | Ga0157376_11377170 | 3300014969 | Bacteria | 737 |
| 119 | Ga0182006_1042073 | 3300015261 | Bacteria | 1791 |
| 120 | Ga0182007_10017762 | 3300015262 | Bacteria | 2590 |
| 121 | Ga0182005_1048093 | 3300015265 | Bacteria | 1159 |
| 122 | Ga0183367_1006 | 3300015688 | Bacteria | 648044 |
| 123 | Ga0206356_11015788 | 3300020070 | Bacteria | 1343 |
| 124 | Ga0207426_1003154 | 3300025302 | Bacteria | 9351 |
| 125 | Ga0207426_1010499 | 3300025302 | Bacteria | 3590 |
| 126 | Ga0207426_1011444 | 3300025302 | Bacteria | 3379 |
| 127 | Ga0207426_1011888 | 3300025302 | Bacteria | 3294 |
| 128 | Ga0207656_10550560 | 3300025321 | Bacteria | 588 |
| 129 | Ga0207713_1115213 | 3300025735 | Bacteria | 908 |
| 130 | Ga0207710_10000029 | 3300025900 | Bacteria | 289155 |
| 131 | Ga0207688_10283449 | 3300025901 | Bacteria | 1010 |
| 132 | Ga0207680_10009015 | 3300025903 | Bacteria | 4927 |
| 133 | Ga0207680_10816304 | 3300025903 | Bacteria | 669 |
| 134 | Ga0207647_10001305 | 3300025904 | Bacteria | 19192 |
| 135 | Ga0207647_10015896 | 3300025904 | Bacteria | 5148 |
| 136 | Ga0207699_10228239 | 3300025906 | Bacteria | 1274 |
| 137 | Ga0207695_10002038 | 3300025913 | Bacteria | 30975 |
| 138 | Ga0207671_10000773 | 3300025914 | Bacteria | 40536 |
| 139 | Ga0207693_10154321 | 3300025915 | Bacteria | 1806 |
| 140 | Ga0207693_10197015 | 3300025915 | Bacteria | 1584 |
| 141 | Ga0207694_10001277 | 3300025924 | Bacteria | 21698 |
| 142 | Ga0207694_10386338 | 3300025924 | Bacteria | 1162 |
| 143 | Ga0207687_10313309 | 3300025927 | Bacteria | 1268 |
| 144 | Ga0207700_10896748 | 3300025928 | Bacteria | 793 |
| 145 | Ga0207700_11151744 | 3300025928 | Bacteria | 693 |
| 146 | Ga0207664_10035146 | 3300025929 | Bacteria | 3865 |
| 147 | Ga0207690_10011468 | 3300025932 | Bacteria | 5299 |
| 148 | Ga0207665_10058996 | 3300025939 | Bacteria | 2596 |
| 149 | Ga0207691_10889878 | 3300025940 | Bacteria | 746 |
| 150 | Ga0207711_10000270 | 3300025941 | Bacteria | 56050 |
| 151 | Ga0207711_10020076 | 3300025941 | Bacteria | 5568 |
| 152 | Ga0207711_10025120 | 3300025941 | Bacteria | 4999 |
| 153 | Ga0207661_10246711 | 3300025944 | Bacteria | 1586 |
| 154 | Ga0207679_10930653 | 3300025945 | Bacteria | 796 |
| 155 | Ga0207667_10184168 | 3300025949 | Bacteria | 2144 |
| 156 | Ga0207712_10010620 | 3300025961 | Bacteria | 5845 |
| 157 | Ga0207668_10030636 | 3300025972 | Bacteria | 3537 |
| 158 | Ga0207640_10487002 | 3300025981 | Bacteria | 1024 |
| 159 | Ga0207658_11084071 | 3300025986 | Bacteria | 731 |
| 160 | Ga0207703_10000066 | 3300026035 | Bacteria | 125891 |
| 161 | Ga0207703_10010385 | 3300026035 | Bacteria | 7283 |
| 162 | Ga0207639_10067698 | 3300026041 | Bacteria | 2779 |
| 163 | Ga0207639_10147455 | 3300026041 | Bacteria | 1967 |
| 164 | Ga0207678_10035871 | 3300026067 | Bacteria | 4318 |
| 165 | Ga0207678_11117127 | 3300026067 | Bacteria | 698 |
| 166 | Ga0207702_10068391 | 3300026078 | Bacteria | 3051 |
| 167 | Ga0207702_10187468 | 3300026078 | Bacteria | 1909 |
| 168 | Ga0207702_10318700 | 3300026078 | Bacteria | 1480 |
| 169 | Ga0207641_10006406 | 3300026088 | Bacteria | 9922 |
| 170 | Ga0207674_10015589 | 3300026116 | Bacteria | 8345 |
| 171 | Ga0207683_10685783 | 3300026121 | Bacteria | 950 |
| 172 | Ga0207698_10025948 | 3300026142 | Bacteria | 4138 |
| 173 | Ga0207698_10111307 | 3300026142 | Bacteria | 2295 |
| 174 | Ga0209371_1010292 | 3300027312 | Bacteria | 2891 |
| 175 | Ga0268266_10003027 | 3300028379 | Bacteria | 17268 |
| 176 | Ga0268266_10028709 | 3300028379 | Bacteria | 4729 |
| 177 | Ga0268266_10465160 | 3300028379 | Bacteria | 1204 |
| 178 | Ga0268265_10000057 | 3300028380 | Bacteria | 155346 |
| 179 | Ga0268264_10000033 | 3300028381 | Bacteria | 404123 |
| 180 | Ga0307517_10003800 | 3300028786 | Bacteria | 23438 |
| 181 | Ga0307517_10018307 | 3300028786 | Bacteria | 9067 |
| 182 | Ga0307515_10002026 | 3300028794 | Bacteria | 44830 |
| 183 | Ga0307511_10001267 | 3300030521 | Bacteria | 26758 |
| 184 | Ga0307511_10067233 | 3300030521 | Bacteria | 2661 |
| 185 | Ga0307511_10131991 | 3300030521 | Bacteria | 1501 |
| 186 | Ga0307512_10004012 | 3300030522 | Bacteria | 16446 |
| 187 | Ga0307512_10120662 | 3300030522 | Bacteria | 1686 |
| 188 | Ga0316178_1131002 | 3300030735 | Bacteria | 670 |
| 189 | Ga0316183_1211421 | 3300030742 | Bacteria | 1143 |
| 190 | Ga0316181_1147835 | 3300030744 | Bacteria | 2343 |
| 191 | Ga0316182_1358891 | 3300030745 | Bacteria | 1259 |
| 192 | Ga0265327_10000836 | 3300031251 | Bacteria | 45980 |
| 193 | Ga0307513_10000001 | 3300031456 | Bacteria | 1660464 |
| 194 | Ga0307513_10069728 | 3300031456 | Bacteria | 3678 |
| 195 | Ga0307509_10008457 | 3300031507 | Bacteria | 13110 |
| 196 | Ga0307509_10015152 | 3300031507 | Bacteria | 9019 |
| 197 | Ga0307509_10155262 | 3300031507 | Bacteria | 2196 |
| 198 | Ga0307508_10005831 | 3300031616 | Bacteria | 11637 |
| 199 | Ga0307508_10056008 | 3300031616 | Bacteria | 3492 |
| 200 | Ga0307514_10014502 | 3300031649 | Bacteria | 6521 |
| 201 | Ga0307514_10092567 | 3300031649 | Bacteria | 2198 |
| 202 | Ga0307514_10132056 | 3300031649 | Bacteria | 1717 |
| 203 | Ga0316576_10016048 | 3300031727 | Bacteria | 5048 |
| 204 | Ga0316578_10636815 | 3300031728 | Bacteria | 623 |
| 205 | Ga0307516_10052872 | 3300031730 | Bacteria | 3975 |
| 206 | Ga0307516_10069322 | 3300031730 | Bacteria | 3392 |
| 207 | Ga0307516_10120977 | 3300031730 | Bacteria | 2408 |
| 208 | Ga0307405_11573266 | 3300031731 | Bacteria | 579 |
| 209 | Ga0307413_10554152 | 3300031824 | Bacteria | 933 |
| 210 | Ga0307518_10119709 | 3300031838 | Bacteria | 1865 |
| 211 | Ga0307410_10606659 | 3300031852 | Bacteria | 913 |
| 212 | Ga0307416_100073304 | 3300032002 | Bacteria | 2854 |
| 213 | Ga0307416_100547280 | 3300032002 | Bacteria | 1230 |
| 214 | Ga0307507_10061631 | 3300033179 | Bacteria | 3491 |
| 215 | Ga0307510_10010159 | 3300033180 | Bacteria | 11194 |
| 216 | Ga0307510_10036555 | 3300033180 | Bacteria | 5464 |
| 217 | Ga0307510_10093465 | 3300033180 | Bacteria | 2838 |
| 218 | Ga0307510_10271494 | 3300033180 | Bacteria | 1172 |
| 219 | Ga0316574_0001605 | 3300035398 | Bacteria | 10837 |
| 220 | Ga0373924_0465525 | 3300035410 | Bacteria | 567 |
| 221 | Ga0373947_0128621 | 3300035725 | Bacteria | 1615 |
| 222 | Ga0373947_0212576 | 3300035725 | Bacteria | 1269 |
| 223 | Ga0373937_0407256 | 3300036401 | Bacteria | 1290 |
| 224 | Ga0395898_0002956 | 3300037466 | Bacteria | 19318 |
| 225 | Ga0395898_0007126 | 3300037466 | Bacteria | 11871 |
| 226 | Ga0436364_0039243 | 3300037853 | Bacteria | 739 |
| 227 | Ga0436364_0260305 | 3300037853 | Bacteria | 7779 |
| 228 | Ga0395901_0017720 | 3300038443 | Bacteria | 7271 |
| 229 | Ga0395901_0662331 | 3300038443 | Bacteria | 1046 |
| 230 | Ga0439436_0001661 | 3300041404 | Bacteria | 6494 |
| 231 | Ga0439436_0003853 | 3300041404 | Bacteria | 4594 |
| 232 | Ga0439439_0004962 | 3300041406 | Bacteria | 3020 |
| 233 | Ga0439466_0015240 | 3300041411 | Bacteria | 2793 |
| 234 | Ga0451791_0799676 | 3300041451 | Bacteria | 1861 |
| 235 | Ga0451797_0186243 | 3300041453 | Bacteria | 576 |
| 236 | Ga0451795_1505047 | 3300041456 | Bacteria | 1008 |
| 237 | Ga0451800_0748042 | 3300041459 | Bacteria | 830 |
| 238 | Ga0451807_1733353 | 3300041486 | Bacteria | 1508 |
| 239 | Ga0451841_0755329 | 3300041498 | Bacteria | 2221 |
| 240 | Ga0451845_0686953 | 3300041501 | Bacteria | 727 |
| 241 | Ga0451843_0142188 | 3300041509 | Bacteria | 1307 |
| 242 | Ga0451843_1009812 | 3300041509 | Bacteria | 1463 |
| 243 | Ga0451853_0881640 | 3300041512 | Bacteria | 2212 |
| 244 | Ga0451853_2835984 | 3300041512 | Bacteria | 1577 |
| 245 | Ga0439433_0013258 | 3300041999 | Bacteria | 1809 |
| 246 | Ga0439442_029566 | 3300042002 | Bacteria | 1143 |
| 247 | Ga0439442_038173 | 3300042002 | Bacteria | 1007 |
| 248 | Ga0439442_042325 | 3300042002 | Bacteria | 958 |
| 249 | Ga0439442_098709 | 3300042002 | Bacteria | 631 |
| 250 | Ga0439448_0011297 | 3300042005 | Bacteria | 2660 |
| 251 | Ga0439449_0001026 | 3300042007 | Bacteria | 10997 |
| 252 | Ga0439449_0006120 | 3300042007 | Bacteria | 4598 |
| 253 | Ga0439449_0014464 | 3300042007 | Bacteria | 2967 |
| 254 | Ga0439449_0014736 | 3300042007 | Bacteria | 2937 |
| 255 | Ga0439455_0010021 | 3300042012 | Bacteria | 2072 |
| 256 | Ga0439455_0035974 | 3300042012 | Bacteria | 1251 |
| 257 | Ga0439457_004751 | 3300042014 | Bacteria | 3503 |
| 258 | Ga0439457_022509 | 3300042014 | Bacteria | 1395 |
| 259 | Ga0439462_0005725 | 3300042015 | Bacteria | 3073 |
| 260 | Ga0450903_000082 | 3300042138 | Bacteria | 19506 |
| 261 | Ga0450903_008844 | 3300042138 | Bacteria | 1645 |
| 262 | Ga0450906_062960 | 3300042145 | Bacteria | 660 |
| 263 | Ga0439458_0002493 | 3300042157 | Bacteria | 4471 |
| 264 | Ga0466969_0003067 | 3300044656 | Bacteria | 8901 |
| 265 | Ga0466969_0016217 | 3300044656 | Bacteria | 3902 |
| 266 | Ga0466969_0128213 | 3300044656 | Bacteria | 1177 |
| 267 | Ga0466969_0215357 | 3300044656 | Bacteria | 874 |
| 268 | Ga0466972_0001201 | 3300044658 | Bacteria | 12458 |
| 269 | Ga0466972_0003162 | 3300044658 | Bacteria | 8177 |
| 270 | Ga0466972_0518533 | 3300044658 | Bacteria | 561 |
| 271 | Ga0466965_0000676 | 3300044683 | Bacteria | 12553 |
| 272 | Ga0466965_0247607 | 3300044683 | Bacteria | 955 |
| 273 | Ga0466965_0351491 | 3300044683 | Bacteria | 807 |
| 274 | Ga0466966_0002187 | 3300044684 | Bacteria | 12691 |
| 275 | Ga0466966_0006304 | 3300044684 | Bacteria | 7848 |
| 276 | Ga0466966_0010729 | 3300044684 | Bacteria | 6091 |
| 277 | Ga0466966_0320383 | 3300044684 | Bacteria | 931 |
| 278 | Ga0466961_0002111 | 3300044693 | Bacteria | 12377 |
| 279 | Ga0466961_0009728 | 3300044693 | Bacteria | 6120 |
| 280 | Ga0466961_0052837 | 3300044693 | Bacteria | 2593 |
| 281 | Ga0466961_0066048 | 3300044693 | Bacteria | 2298 |
| 282 | Ga0466961_0154866 | 3300044693 | Bacteria | 1430 |
| 283 | Ga0466961_0189307 | 3300044693 | Bacteria | 1276 |
| 284 | Ga0466963_0000826 | 3300044694 | Bacteria | 15507 |
| 285 | Ga0466963_0059468 | 3300044694 | Bacteria | 2550 |
| 286 | Ga0466963_0231550 | 3300044694 | Bacteria | 1295 |
| 287 | Ga0466964_0003907 | 3300044706 | Bacteria | 5476 |
| 288 | Ga0466964_0134692 | 3300044706 | Bacteria | 1129 |
| 289 | Ga0466964_0367195 | 3300044706 | Bacteria | 744 |
| 290 | Ga0466971_0000710 | 3300044719 | Bacteria | 13318 |
| 291 | Ga0466971_0019236 | 3300044719 | Bacteria | 3031 |
| 292 | Ga0466971_0053943 | 3300044719 | Bacteria | 1812 |
| 293 | Ga0466971_0071863 | 3300044719 | Bacteria | 1571 |
| 294 | Ga0466968_0160230 | 3300044735 | Bacteria | 1038 |
| 295 | Ga0466968_0282624 | 3300044735 | Bacteria | 794 |
| 296 | Ga0466970_0001444 | 3300044765 | Bacteria | 11496 |
| 297 | Ga0466970_0002527 | 3300044765 | Bacteria | 8826 |
| 298 | Ga0466970_0039654 | 3300044765 | Bacteria | 2500 |
| 299 | Ga0466970_0120152 | 3300044765 | Bacteria | 1439 |
| 300 | Ga0466970_0437382 | 3300044765 | Bacteria | 749 |
| 301 | Ga0466957_0000835 | 3300044842 | Bacteria | 15739 |
| 302 | Ga0466960_0001092 | 3300044901 | Bacteria | 9749 |
| 303 | Ga0466960_0830493 | 3300044901 | Bacteria | 561 |
| 304 | Ga0466959_0002801 | 3300045049 | Bacteria | 11227 |
| 305 | Ga0466959_0023538 | 3300045049 | Bacteria | 4557 |
| 306 | Ga0466959_0038264 | 3300045049 | Bacteria | 3545 |
| 307 | Ga0466959_0068438 | 3300045049 | Bacteria | 2573 |
| 308 | Ga0466958_0000131 | 3300045836 | Bacteria | 24937 |
| 309 | Ga0466958_0040078 | 3300045836 | Bacteria | 2815 |
| 310 | Ga0466958_0094738 | 3300045836 | Bacteria | 1850 |
| 311 | Ga0466958_0195262 | 3300045836 | Bacteria | 1287 |
| 312 | Ga0466958_0591695 | 3300045836 | Bacteria | 721 |
| 313 | Ga0466967_0004265 | 3300045976 | Bacteria | 9607 |
| 314 | Ga0466967_0037002 | 3300045976 | Bacteria | 4172 |
| 315 | Ga0466967_0182323 | 3300045976 | Bacteria | 1981 |
| 316 | Ga0466967_0587664 | 3300045976 | Bacteria | 1098 |
| 317 | Ga0466967_0600736 | 3300045976 | Bacteria | 1086 |
| 318 | Ga0466967_0745825 | 3300045976 | Bacteria | 971 |
| 319 | Ga0466967_0759544 | 3300045976 | Bacteria | 962 |
| 320 | Ga0495592_0016180 | 3300046454 | Bacteria | 5658 |
| 321 | Ga0495592_0025554 | 3300046454 | Bacteria | 4482 |
| 322 | Ga0495592_0060863 | 3300046454 | Bacteria | 2776 |
| 323 | Ga0495592_0066916 | 3300046454 | Bacteria | 2627 |
| 324 | Ga0495603_0000262 | 3300046455 | Bacteria | 27718 |
| 325 | Ga0495603_0005677 | 3300046455 | Bacteria | 7455 |
| 326 | Ga0495603_0011907 | 3300046455 | Bacteria | 5263 |
| 327 | Ga0495603_0013959 | 3300046455 | Bacteria | 4857 |
| 328 | Ga0495603_0208648 | 3300046455 | Bacteria | 1128 |
| 329 | Ga0495603_0659725 | 3300046455 | Bacteria | 598 |
| 330 | Ga0495629_0000568 | 3300046459 | Bacteria | 29992 |
| 331 | Ga0495629_0020591 | 3300046459 | Bacteria | 4710 |
| 332 | Ga0495629_0030504 | 3300046459 | Bacteria | 3821 |
| 333 | Ga0495629_0044422 | 3300046459 | Bacteria | 3118 |
| 334 | Ga0495629_0064829 | 3300046459 | Bacteria | 2550 |
| 335 | Ga0495629_0077264 | 3300046459 | Bacteria | 2324 |
| 336 | Ga0495629_0125074 | 3300046459 | Bacteria | 1791 |
| 337 | Ga0495629_0530563 | 3300046459 | Bacteria | 791 |
| 338 | Ga0495629_0568082 | 3300046459 | Bacteria | 760 |
| 339 | Ga0495638_0103740 | 3300046460 | Bacteria | 1697 |
| 340 | Ga0495638_0169866 | 3300046460 | Bacteria | 1252 |
| 341 | Ga0495638_0373842 | 3300046460 | Bacteria | 746 |
| 342 | Ga0495651_0002804 | 3300046462 | Bacteria | 13516 |
| 343 | Ga0495651_0005834 | 3300046462 | Bacteria | 9394 |
| 344 | Ga0495651_0014386 | 3300046462 | Bacteria | 6118 |
| 345 | Ga0495651_0073443 | 3300046462 | Bacteria | 2596 |
| 346 | Ga0495651_0077267 | 3300046462 | Bacteria | 2520 |
| 347 | Ga0495651_0259486 | 3300046462 | Bacteria | 1183 |
| 348 | Ga0495651_0761966 | 3300046462 | Bacteria | 600 |
| 349 | Ga0495653_0006299 | 3300046463 | Bacteria | 9733 |
| 350 | Ga0495653_0208905 | 3300046463 | Bacteria | 1320 |
| 351 | Ga0495580_0078450 | 3300046472 | Bacteria | 2303 |
| 352 | Ga0495582_0208112 | 3300046473 | Bacteria | 1118 |
| 353 | Ga0495605_0156828 | 3300046474 | Bacteria | 1012 |
| 354 | Ga0495639_0128546 | 3300046475 | Bacteria | 1212 |
| 355 | Ga0495662_0003168 | 3300046476 | Bacteria | 8305 |
| 356 | Ga0495662_0023317 | 3300046476 | Bacteria | 2988 |
| 357 | Ga0495662_0028494 | 3300046476 | Bacteria | 2695 |
| 358 | Ga0495662_0069514 | 3300046476 | Bacteria | 1705 |
| 359 | Ga0495662_0086708 | 3300046476 | Bacteria | 1524 |
| 360 | Ga0495664_0016373 | 3300046477 | Bacteria | 4221 |
| 361 | Ga0495664_0038406 | 3300046477 | Bacteria | 2826 |
| 362 | Ga0495664_0258661 | 3300046477 | Bacteria | 1052 |
| 363 | Ga0495584_0222531 | 3300046491 | Bacteria | 959 |
| 364 | Ga0495585_0007532 | 3300046492 | Bacteria | 6658 |
| 365 | Ga0495585_0121389 | 3300046492 | Bacteria | 1382 |
| 366 | Ga0495585_0257069 | 3300046492 | Bacteria | 870 |
| 367 | Ga0495594_0010108 | 3300046499 | Bacteria | 4890 |
| 368 | Ga0495594_0040807 | 3300046499 | Bacteria | 2541 |
| 369 | Ga0495594_0060770 | 3300046499 | Bacteria | 2090 |
| 370 | Ga0495607_0085096 | 3300046501 | Bacteria | 1728 |
| 371 | Ga0495583_0050899 | 3300046506 | Bacteria | 1890 |
| 372 | Ga0495606_0012769 | 3300046507 | Bacteria | 6696 |
| 373 | Ga0495608_0004021 | 3300046511 | Bacteria | 10553 |
| 374 | Ga0495608_0452370 | 3300046511 | Bacteria | 781 |
| 375 | Ga0495610_0047656 | 3300046512 | Bacteria | 2107 |
| 376 | Ga0495610_0110806 | 3300046512 | Bacteria | 1216 |
| 377 | Ga0495616_0024623 | 3300046513 | Bacteria | 3226 |
| 378 | Ga0495618_0088917 | 3300046514 | Bacteria | 1975 |
| 379 | Ga0495618_0103514 | 3300046514 | Bacteria | 1822 |
| 380 | Ga0495620_0004889 | 3300046515 | Bacteria | 7524 |
| 381 | Ga0495620_0048083 | 3300046515 | Bacteria | 1833 |
| 382 | Ga0495628_0000688 | 3300046516 | Bacteria | 31177 |
| 383 | Ga0495628_0171284 | 3300046516 | Bacteria | 1646 |
| 384 | Ga0495628_0974992 | 3300046516 | Bacteria | 584 |
| 385 | Ga0495630_0021554 | 3300046517 | Bacteria | 4757 |
| 386 | Ga0495630_0074723 | 3300046517 | Bacteria | 2553 |
| 387 | Ga0495630_0832233 | 3300046517 | Bacteria | 704 |
| 388 | Ga0495631_0010353 | 3300046518 | Bacteria | 4615 |
| 389 | Ga0495632_0006703 | 3300046519 | Bacteria | 7362 |
| 390 | Ga0495637_0074465 | 3300046520 | Bacteria | 1363 |
| 391 | Ga0495643_0005069 | 3300046522 | Bacteria | 9014 |
| 392 | Ga0495643_0008442 | 3300046522 | Bacteria | 6517 |
| 393 | Ga0495648_0086870 | 3300046524 | Bacteria | 1763 |
| 394 | Ga0495648_0250205 | 3300046524 | Bacteria | 856 |
| 395 | Ga0495666_0010110 | 3300046526 | Bacteria | 4706 |
| 396 | Ga0495666_0079575 | 3300046526 | Bacteria | 1552 |
| 397 | Ga0495666_0344170 | 3300046526 | Bacteria | 672 |
| 398 | Ga0495642_0257685 | 3300046528 | Bacteria | 762 |
| 399 | Ga0495652_0004375 | 3300046529 | Bacteria | 13514 |
| 400 | Ga0495652_0092433 | 3300046529 | Bacteria | 2471 |
| 401 | Ga0495652_0141907 | 3300046529 | Bacteria | 1888 |
| 402 | Ga0495652_0346537 | 3300046529 | Bacteria | 1065 |
| 403 | Ga0495654_0059565 | 3300046530 | Bacteria | 1838 |
| 404 | Ga0495665_0000429 | 3300046531 | Bacteria | 21413 |
| 405 | Ga0495640_0002937 | 3300046533 | Bacteria | 13724 |
| 406 | Ga0495640_0003552 | 3300046533 | Bacteria | 12522 |
| 407 | Ga0495640_0014341 | 3300046533 | Bacteria | 6000 |
| 408 | Ga0495640_0082137 | 3300046533 | Bacteria | 2141 |
| 409 | Ga0495640_0119518 | 3300046533 | Bacteria | 1714 |
| 410 | Ga0495587_0009674 | 3300046536 | Bacteria | 6165 |
| 411 | Ga0495609_0029135 | 3300046538 | Bacteria | 2515 |
| 412 | Ga0495645_0008311 | 3300046543 | Bacteria | 7245 |
| 413 | Ga0495645_0043616 | 3300046543 | Bacteria | 3272 |
| 414 | Ga0495645_0165037 | 3300046543 | Bacteria | 1528 |
| 415 | Ga0495622_0090717 | 3300046557 | Bacteria | 1404 |
| 416 | Ga0495622_0097238 | 3300046557 | Bacteria | 1350 |
| 417 | Ga0495622_0445511 | 3300046557 | Bacteria | 555 |
| 418 | Ga0495633_0182608 | 3300046558 | Bacteria | 965 |
| 419 | Ga0495667_0007764 | 3300046559 | Bacteria | 7267 |
| 420 | Ga0495667_0219352 | 3300046559 | Bacteria | 1214 |
| 421 | Ga0495667_0244270 | 3300046559 | Bacteria | 1143 |
| 422 | Ga0495668_0079133 | 3300046616 | Bacteria | 1804 |
| 423 | Ga0495668_0390754 | 3300046616 | Bacteria | 764 |
| 424 | Ga0495634_0002265 | 3300046642 | Bacteria | 16131 |
| 425 | Ga0495634_0167490 | 3300046642 | Bacteria | 1382 |
| 426 | Ga0495634_0177293 | 3300046642 | Bacteria | 1336 |
| 427 | Ga0495625_0046473 | 3300046660 | Bacteria | 3133 |
| 428 | Ga0495625_0084323 | 3300046660 | Bacteria | 2207 |
| 429 | Ga0495625_0286788 | 3300046660 | Bacteria | 1057 |
| 430 | Ga0495625_0344996 | 3300046660 | Bacteria | 942 |
| 431 | Ga0495625_0345081 | 3300046660 | Bacteria | 942 |
| 432 | Ga0495635_0047065 | 3300046663 | Bacteria | 2975 |
| 433 | Ga0495635_0369918 | 3300046663 | Bacteria | 955 |
| 434 | Ga0495635_0468489 | 3300046663 | Bacteria | 831 |
| 435 | Ga0495635_0533518 | 3300046663 | Bacteria | 770 |
| 436 | Ga0495661_0085658 | 3300046665 | Bacteria | 1805 |
| 437 | Ga0495588_0009916 | 3300046674 | Bacteria | 4414 |
| 438 | Ga0495588_0011624 | 3300046674 | Bacteria | 4137 |
| 439 | Ga0495588_0049565 | 3300046674 | Bacteria | 2159 |
| 440 | Ga0495588_0169828 | 3300046674 | Bacteria | 1153 |
| 441 | Ga0495657_0020033 | 3300046675 | Bacteria | 4815 |
| 442 | Ga0495657_0022714 | 3300046675 | Bacteria | 4488 |
| 443 | Ga0495657_0111715 | 3300046675 | Bacteria | 1730 |
| 444 | Ga0495657_0125896 | 3300046675 | Bacteria | 1609 |
| 445 | Ga0495599_0029257 | 3300046678 | Bacteria | 3452 |
| 446 | Ga0495599_0108560 | 3300046678 | Bacteria | 1729 |
| 447 | Ga0495623_0148191 | 3300046679 | Bacteria | 1389 |
| 448 | Ga0495623_0179819 | 3300046679 | Bacteria | 1230 |
| 449 | Ga0495646_0060550 | 3300046680 | Bacteria | 2257 |
| 450 | Ga0495646_0104401 | 3300046680 | Bacteria | 1620 |
| 451 | Ga0495646_0113806 | 3300046680 | Bacteria | 1538 |
| 452 | Ga0495658_0057104 | 3300046683 | Bacteria | 2228 |
| 453 | Ga0495658_0207499 | 3300046683 | Bacteria | 1223 |
| 454 | Ga0495613_0001287 | 3300046689 | Bacteria | 19142 |
| 455 | Ga0495613_0007095 | 3300046689 | Bacteria | 8340 |
| 456 | Ga0495613_0051170 | 3300046689 | Bacteria | 3045 |
| 457 | Ga0495613_0137924 | 3300046689 | Bacteria | 1744 |
| 458 | Ga0495613_0165642 | 3300046689 | Bacteria | 1570 |
| 459 | Ga0495613_0548080 | 3300046689 | Bacteria | 774 |
| 460 | Ga0495613_0725837 | 3300046689 | Bacteria | 653 |
| 461 | Ga0495624_0046459 | 3300046690 | Bacteria | 2760 |
| 462 | Ga0495624_0109284 | 3300046690 | Bacteria | 1701 |
| 463 | Ga0495624_0124359 | 3300046690 | Bacteria | 1583 |
| 464 | Ga0495670_0026460 | 3300046691 | Bacteria | 2871 |
| 465 | Ga0495670_0505265 | 3300046691 | Bacteria | 657 |
| 466 | Ga0495671_0008724 | 3300046692 | Bacteria | 5693 |
| 467 | Ga0495671_0095564 | 3300046692 | Bacteria | 1454 |
| 468 | Ga0495671_0104635 | 3300046692 | Bacteria | 1382 |
| 469 | Ga0495671_0173720 | 3300046692 | Bacteria | 1047 |
| 470 | Ga0495649_0022229 | 3300046694 | Bacteria | 3549 |
| 471 | Ga0495649_0378465 | 3300046694 | Bacteria | 712 |
| 472 | Ga0495589_0001579 | 3300046794 | Bacteria | 13077 |
| 473 | Ga0495589_0035849 | 3300046794 | Bacteria | 2486 |
| 474 | Ga0495589_0091701 | 3300046794 | Bacteria | 1475 |
| 475 | Ga0495589_0109077 | 3300046794 | Bacteria | 1337 |
| 476 | Ga0495600_0003072 | 3300046809 | Bacteria | 9756 |
| 477 | Ga0495600_0143717 | 3300046809 | Bacteria | 1547 |
| 478 | Ga0495600_0162653 | 3300046809 | Bacteria | 1442 |
| 479 | Ga0495600_0302208 | 3300046809 | Bacteria | 1009 |
| 480 | Ga0495600_0628982 | 3300046809 | Bacteria | 650 |
| 481 | Ga0495660_0198131 | 3300046810 | Bacteria | 960 |
| 482 | Ga0495581_0017936 | 3300047315 | Bacteria | 4113 |
| 483 | Ga0495581_0037365 | 3300047315 | Bacteria | 2810 |
| 484 | Ga0495581_0041107 | 3300047315 | Bacteria | 2675 |
| 485 | Ga0495581_0109941 | 3300047315 | Bacteria | 1603 |
| 486 | Ga0495581_0174347 | 3300047315 | Bacteria | 1258 |
| 487 | Ga0495581_0190859 | 3300047315 | Bacteria | 1198 |
| 488 | Ga0495581_0192963 | 3300047315 | Bacteria | 1191 |
| 489 | Ga0495604_0001544 | 3300047317 | Bacteria | 18967 |
| 490 | Ga0495604_0002658 | 3300047317 | Bacteria | 14345 |
| 491 | Ga0495604_0006701 | 3300047317 | Bacteria | 9131 |
| 492 | Ga0495604_0008240 | 3300047317 | Bacteria | 8246 |
| 493 | Ga0495604_0095678 | 3300047317 | Bacteria | 2193 |
| 494 | Ga0495604_0103562 | 3300047317 | Bacteria | 2087 |
| 495 | Ga0495604_0130910 | 3300047317 | Bacteria | 1803 |
| 496 | Ga0495604_0483254 | 3300047317 | Bacteria | 805 |
| 497 | Ga0495636_0015287 | 3300047318 | Bacteria | 3059 |
| 498 | Ga0495636_0065064 | 3300047318 | Bacteria | 1548 |
| 499 | Ga0495636_0097440 | 3300047318 | Bacteria | 1282 |
| 500 | Ga0495636_0425013 | 3300047318 | Bacteria | 635 |
| 501 | Ga0495674_0073300 | 3300047319 | Bacteria | 2951 |
| 502 | Ga0495672_0418907 | 3300047320 | Bacteria | 609 |
| 503 | Ga0495676_0004653 | 3300047321 | Bacteria | 12570 |
| 504 | Ga0495676_0005038 | 3300047321 | Bacteria | 12118 |
| 505 | Ga0495676_0010943 | 3300047321 | Bacteria | 8201 |
| 506 | Ga0495676_0016651 | 3300047321 | Bacteria | 6513 |
| 507 | Ga0495676_0129550 | 3300047321 | Bacteria | 1823 |
| 508 | Ga0495676_0510078 | 3300047321 | Bacteria | 788 |
| 509 | Ga0495680_0169626 | 3300047322 | Bacteria | 1580 |
| 510 | Ga0495683_0063116 | 3300047323 | Bacteria | 1831 |
| 511 | Ga0495683_0149261 | 3300047323 | Bacteria | 1089 |
| 512 | Ga0495687_003543 | 3300047443 | Bacteria | 11232 |
| 513 | Ga0495687_006208 | 3300047443 | Bacteria | 7379 |
| 514 | Ga0495687_055720 | 3300047443 | Bacteria | 1651 |
| 515 | Ga0495675_0020228 | 3300047444 | Bacteria | 4231 |
| 516 | Ga0495675_0022281 | 3300047444 | Bacteria | 4037 |
| 517 | Ga0495675_0029780 | 3300047444 | Bacteria | 3482 |
| 518 | Ga0495675_0052064 | 3300047444 | Bacteria | 2599 |
| 519 | Ga0495675_0076561 | 3300047444 | Bacteria | 2109 |
| 520 | Ga0495675_0156950 | 3300047444 | Bacteria | 1403 |
| 521 | Ga0495675_0249975 | 3300047444 | Bacteria | 1065 |
| 522 | Ga0495675_0565220 | 3300047444 | Bacteria | 647 |
| 523 | Ga0495685_005480 | 3300047447 | Bacteria | 4145 |
| 524 | Ga0495685_017229 | 3300047447 | Bacteria | 2473 |
| 525 | Ga0495685_020765 | 3300047447 | Bacteria | 2258 |
| 526 | Ga0495685_038200 | 3300047447 | Bacteria | 1645 |
| 527 | Ga0495685_043185 | 3300047447 | Bacteria | 1538 |
| 528 | Ga0495681_0004834 | 3300047470 | Bacteria | 9118 |
| 529 | Ga0495681_0020908 | 3300047470 | Bacteria | 3538 |
| 530 | Ga0495684_0140251 | 3300047471 | Bacteria | 1812 |
| 531 | Ga0495686_0036838 | 3300047472 | Bacteria | 3138 |
| 532 | Ga0495593_0020472 | 3300047673 | Bacteria | 3705 |
| 533 | Ga0495593_0057431 | 3300047673 | Bacteria | 2043 |
| 534 | Ga0495593_0175221 | 3300047673 | Bacteria | 1080 |
| 535 | Ga0495593_0188085 | 3300047673 | Bacteria | 1039 |
| 536 | Ga0495602_0004329 | 3300048088 | Bacteria | 14797 |
| 537 | Ga0495602_0157623 | 3300048088 | Bacteria | 1776 |
| 538 | Ga0495602_0204795 | 3300048088 | Bacteria | 1502 |
| 539 | Ga0495614_0022740 | 3300048089 | Bacteria | 2703 |
| 540 | Ga0495614_0033987 | 3300048089 | Bacteria | 2192 |
| 541 | Ga0495614_0056536 | 3300048089 | Bacteria | 1684 |
| 542 | Ga0495626_0025073 | 3300048091 | Bacteria | 2919 |
| 543 | Ga0495626_0310079 | 3300048091 | Bacteria | 622 |
| 544 | Ga0496100_0324726 | 3300048903 | Bacteria | 1157 |
| 545 | Ga0496101_0132276 | 3300048904 | Bacteria | 1895 |
| 546 | Ga0496102_0591295 | 3300048905 | Bacteria | 1033 |
| 547 | Ga0496104_0260008 | 3300048907 | Bacteria | 1649 |
| 548 | Ga0496104_0472179 | 3300048907 | Bacteria | 1166 |
| 549 | Ga0496105_1235970 | 3300048908 | Bacteria | 548 |
| 550 | Ga0496108_0053272 | 3300048911 | Bacteria | 3393 |
| 551 | Ga0496109_0441593 | 3300048912 | Bacteria | 1229 |
| 552 | Ga0496110_0835610 | 3300048913 | Bacteria | 826 |
| 553 | Ga0496111_0718134 | 3300048914 | Bacteria | 726 |
| 554 | Ga0496111_1085344 | 3300048914 | Bacteria | 571 |
| 555 | Ga0496113_0462902 | 3300048916 | Bacteria | 1019 |
| 556 | Ga0496113_1139383 | 3300048916 | Bacteria | 611 |
| 557 | Ga0496114_0054832 | 3300048917 | Bacteria | 3324 |
| 558 | Ga0496118_0023433 | 3300048921 | Bacteria | 5361 |
| 559 | Ga0496119_0000784 | 3300048922 | Bacteria | 42478 |
| 560 | Ga0496119_0009833 | 3300048922 | Bacteria | 8131 |
| 561 | Ga0496120_0006188 | 3300048923 | Bacteria | 9257 |
| 562 | Ga0496126_0000048 | 3300048929 | Bacteria | 317977 |
| 563 | Ga0495678_107839 | 3300049459 | Bacteria | 954 |
| 564 | Ga0501323_043062 | 3300049539 | Bacteria | 667 |
| 565 | Ga0501031_0011192 | 3300049568 | Bacteria | 5846 |
| 566 | Ga0501031_0029774 | 3300049568 | Bacteria | 3562 |
| 567 | Ga0501031_0063701 | 3300049568 | Bacteria | 2401 |
| 568 | Ga0501031_0700510 | 3300049568 | Bacteria | 650 |
| 569 | Ga0501032_0003050 | 3300049569 | Bacteria | 12975 |
| 570 | Ga0501032_0017046 | 3300049569 | Bacteria | 5103 |
| 571 | Ga0501032_0023051 | 3300049569 | Bacteria | 4309 |
| 572 | Ga0501032_0141625 | 3300049569 | Bacteria | 1583 |
| 573 | Ga0501032_0211887 | 3300049569 | Bacteria | 1263 |
| 574 | Ga0501032_0312514 | 3300049569 | Bacteria | 1015 |
| 575 | Ga0501033_0009749 | 3300049570 | Bacteria | 7377 |
| 576 | Ga0501033_0022267 | 3300049570 | Bacteria | 4781 |
| 577 | Ga0501033_0041517 | 3300049570 | Bacteria | 3432 |
| 578 | Ga0501033_0044508 | 3300049570 | Bacteria | 3304 |
| 579 | Ga0501033_0067663 | 3300049570 | Bacteria | 2626 |
| 580 | Ga0501033_0069497 | 3300049570 | Bacteria | 2588 |
| 581 | Ga0501033_0302497 | 3300049570 | Bacteria | 1126 |
| 582 | Ga0501034_0002857 | 3300049571 | Bacteria | 20131 |
| 583 | Ga0501034_0003189 | 3300049571 | Bacteria | 18861 |
| 584 | Ga0501034_0011990 | 3300049571 | Bacteria | 8957 |
| 585 | Ga0501034_0021523 | 3300049571 | Bacteria | 6570 |
| 586 | Ga0501034_0028508 | 3300049571 | Bacteria | 5682 |
| 587 | Ga0501034_0029497 | 3300049571 | Bacteria | 5576 |
| 588 | Ga0501034_0082761 | 3300049571 | Bacteria | 3211 |
| 589 | Ga0501034_0126182 | 3300049571 | Bacteria | 2544 |
| 590 | Ga0501034_0147569 | 3300049571 | Bacteria | 2329 |
| 591 | Ga0501034_0166411 | 3300049571 | Bacteria | 2173 |
| 592 | Ga0501034_0591604 | 3300049571 | Bacteria | 1016 |
| 593 | Ga0501036_0000627 | 3300049572 | Bacteria | 25739 |
| 594 | Ga0501036_0004155 | 3300049572 | Bacteria | 11652 |
| 595 | Ga0501036_0005036 | 3300049572 | Bacteria | 10692 |
| 596 | Ga0501036_0010604 | 3300049572 | Bacteria | 7615 |
| 597 | Ga0501036_0025455 | 3300049572 | Bacteria | 4991 |
| 598 | Ga0501036_0035885 | 3300049572 | Bacteria | 4195 |
| 599 | Ga0501036_0177362 | 3300049572 | Bacteria | 1794 |
| 600 | Ga0501036_0267770 | 3300049572 | Bacteria | 1431 |
| 601 | Ga0501037_0000644 | 3300049573 | Bacteria | 26982 |
| 602 | Ga0501037_0006911 | 3300049573 | Bacteria | 8285 |
| 603 | Ga0501037_0042196 | 3300049573 | Bacteria | 3353 |
| 604 | Ga0501037_0056596 | 3300049573 | Bacteria | 2863 |
| 605 | Ga0501037_0078706 | 3300049573 | Bacteria | 2392 |
| 606 | Ga0501037_0664753 | 3300049573 | Bacteria | 695 |
| 607 | Ga0501038_0001482 | 3300049574 | Bacteria | 21611 |
| 608 | Ga0501038_0013836 | 3300049574 | Bacteria | 7353 |
| 609 | Ga0501038_0017684 | 3300049574 | Bacteria | 6444 |
| 610 | Ga0501038_0078854 | 3300049574 | Bacteria | 2778 |
| 611 | Ga0501038_0326465 | 3300049574 | Bacteria | 1199 |
| 612 | Ga0501038_0707311 | 3300049574 | Bacteria | 754 |
| 613 | Ga0501038_0938209 | 3300049574 | Bacteria | 637 |
| 614 | Ga0501039_0026796 | 3300049575 | Bacteria | 4429 |
| 615 | Ga0501039_0034037 | 3300049575 | Bacteria | 3931 |
| 616 | Ga0501039_0036312 | 3300049575 | Bacteria | 3802 |
| 617 | Ga0501039_0054450 | 3300049575 | Bacteria | 3097 |
| 618 | Ga0501039_0150948 | 3300049575 | Bacteria | 1825 |
| 619 | Ga0501039_1012596 | 3300049575 | Bacteria | 645 |
| 620 | Ga0501041_0003388 | 3300049577 | Bacteria | 9172 |
| 621 | Ga0501042_0003012 | 3300049578 | Bacteria | 10481 |
| 622 | Ga0501042_0033787 | 3300049578 | Bacteria | 3626 |
| 623 | Ga0501042_0036871 | 3300049578 | Bacteria | 3469 |
| 624 | Ga0501043_0002045 | 3300049579 | Bacteria | 17217 |
| 625 | Ga0501043_0012717 | 3300049579 | Bacteria | 6580 |
| 626 | Ga0501043_0017130 | 3300049579 | Bacteria | 5682 |
| 627 | Ga0501043_0018811 | 3300049579 | Bacteria | 5422 |
| 628 | Ga0501043_0044121 | 3300049579 | Bacteria | 3505 |
| 629 | Ga0501043_0052803 | 3300049579 | Bacteria | 3192 |
| 630 | Ga0501043_0095141 | 3300049579 | Bacteria | 2341 |
| 631 | Ga0501043_0108234 | 3300049579 | Bacteria | 2183 |
| 632 | Ga0501043_0153098 | 3300049579 | Bacteria | 1804 |
| 633 | Ga0501046_0037593 | 3300049580 | Bacteria | 3890 |
| 634 | Ga0501046_0174741 | 3300049580 | Bacteria | 1609 |
| 635 | Ga0501047_0000025 | 3300049581 | Bacteria | 225560 |
| 636 | Ga0501047_0000084 | 3300049581 | Bacteria | 121007 |
| 637 | Ga0501047_0001101 | 3300049581 | Bacteria | 26872 |
| 638 | Ga0501047_0009755 | 3300049581 | Bacteria | 9071 |
| 639 | Ga0501047_0019088 | 3300049581 | Bacteria | 6578 |
| 640 | Ga0501047_0044875 | 3300049581 | Bacteria | 4272 |
| 641 | Ga0501047_0075142 | 3300049581 | Bacteria | 3252 |
| 642 | Ga0501047_0114311 | 3300049581 | Bacteria | 2581 |
| 643 | Ga0501047_0140125 | 3300049581 | Bacteria | 2297 |
| 644 | Ga0501047_0484364 | 3300049581 | Bacteria | 1064 |
| 645 | Ga0501047_0518446 | 3300049581 | Bacteria | 1018 |
| 646 | Ga0501047_0899853 | 3300049581 | Bacteria | 698 |
| 647 | Ga0501048_0003714 | 3300049582 | Bacteria | 11633 |
| 648 | Ga0501048_0019385 | 3300049582 | Bacteria | 4991 |
| 649 | Ga0501048_0023824 | 3300049582 | Bacteria | 4470 |
| 650 | Ga0501067_0006058 | 3300049583 | Bacteria | 6704 |
| 651 | Ga0501067_0304829 | 3300049583 | Bacteria | 887 |
| 652 | Ga0501068_0009848 | 3300049584 | Bacteria | 5353 |
| 653 | Ga0501068_0042882 | 3300049584 | Bacteria | 2721 |
| 654 | Ga0501069_0008664 | 3300049585 | Bacteria | 5356 |
| 655 | Ga0501069_0202091 | 3300049585 | Bacteria | 1152 |
| 656 | Ga0501070_0003688 | 3300049586 | Bacteria | 13237 |
| 657 | Ga0501070_0058067 | 3300049586 | Bacteria | 3207 |
| 658 | Ga0501070_0137328 | 3300049586 | Bacteria | 2019 |
| 659 | Ga0501070_0209834 | 3300049586 | Bacteria | 1599 |
| 660 | Ga0501070_0442447 | 3300049586 | Bacteria | 1048 |
| 661 | Ga0501070_1049262 | 3300049586 | Bacteria | 630 |
| 662 | Ga0501071_0000759 | 3300049587 | Bacteria | 17111 |
| 663 | Ga0501072_0004361 | 3300049588 | Bacteria | 10737 |
| 664 | Ga0501072_1011734 | 3300049588 | Bacteria | 648 |
| 665 | Ga0501073_0044192 | 3300049589 | Bacteria | 3139 |
| 666 | Ga0501073_0173247 | 3300049589 | Bacteria | 1494 |
| 667 | Ga0501073_0799803 | 3300049589 | Bacteria | 650 |
| 668 | Ga0501074_0000296 | 3300049590 | Bacteria | 28700 |
| 669 | Ga0501074_0002291 | 3300049590 | Bacteria | 13309 |
| 670 | Ga0501074_0066303 | 3300049590 | Bacteria | 2596 |
| 671 | Ga0501076_0009593 | 3300049592 | Bacteria | 7148 |
| 672 | Ga0501076_0585960 | 3300049592 | Bacteria | 920 |
| 673 | Ga0501077_0013524 | 3300049593 | Bacteria | 5119 |
| 674 | Ga0501223_058837 | 3300049663 | Bacteria | 750 |
| 675 | Ga0501235_028837 | 3300049669 | Bacteria | 1248 |
| 676 | Ga0501080_0030534 | 3300049742 | Bacteria | 5021 |
| 677 | Ga0501080_1084503 | 3300049742 | Bacteria | 692 |
| 678 | Ga0501083_0014645 | 3300049744 | Bacteria | 5482 |
| 679 | Ga0501035_0007013 | 3300049822 | Bacteria | 10527 |
| 680 | Ga0501035_0022321 | 3300049822 | Bacteria | 5811 |
| 681 | Ga0501035_0040956 | 3300049822 | Bacteria | 4183 |
| 682 | Ga0501035_0080509 | 3300049822 | Bacteria | 2876 |
| 683 | Ga0501035_0173536 | 3300049822 | Bacteria | 1861 |
| 684 | Ga0501035_0224064 | 3300049822 | Bacteria | 1604 |
| 685 | Ga0501035_0802890 | 3300049822 | Bacteria | 751 |
| 686 | Ga0501044_0019610 | 3300049823 | Bacteria | 7229 |
| 687 | Ga0501044_0025758 | 3300049823 | Bacteria | 6235 |
| 688 | Ga0501044_0046168 | 3300049823 | Bacteria | 4511 |
| 689 | Ga0501044_0046661 | 3300049823 | Bacteria | 4484 |
| 690 | Ga0501044_0052883 | 3300049823 | Bacteria | 4181 |
| 691 | Ga0501044_0062712 | 3300049823 | Bacteria | 3799 |
| 692 | Ga0501044_0086845 | 3300049823 | Bacteria | 3160 |
| 693 | Ga0501044_0245699 | 3300049823 | Bacteria | 1732 |
| 694 | Ga0501044_0265864 | 3300049823 | Bacteria | 1652 |
| 695 | Ga0501044_0779036 | 3300049823 | Bacteria | 837 |
| 696 | Ga0501044_0912929 | 3300049823 | Bacteria | 753 |
| 697 | Ga0501044_1080562 | 3300049823 | Bacteria | 672 |
| 698 | Ga0501045_0070710 | 3300049824 | Bacteria | 2568 |
| 699 | Ga0501045_0077517 | 3300049824 | Bacteria | 2449 |
| 700 | Ga0501045_0209060 | 3300049824 | Bacteria | 1454 |
| 701 | Ga0501045_0269191 | 3300049824 | Bacteria | 1268 |
| 702 | Ga0501045_0371228 | 3300049824 | Bacteria | 1065 |
| 703 | nmdc:mga03n38_20804_c1 | 3300050490 | Bacteria | 2631 |
| 704 | nmdc:mga06z11_208166_c1 | 3300050494 | Bacteria | 1139 |
| 705 | nmdc:mga04h51_32266_c1 | 3300050495 | Bacteria | 1660 |
| 706 | nmdc:mga07m45_186073_c1 | 3300050496 | Bacteria | 1207 |
| 707 | nmdc:mga05p37_1096738_c1 | 3300050507 | Bacteria | 834 |
| 708 | Ga0495601_0033677 | 3300053077 | Bacteria | 3193 |
| 709 | Ga0495612_0416590 | 3300053078 | Bacteria | 612 |
| 710 | Ga0500610_0031224 | 3300053079 | Bacteria | 2705 |
| 711 | Ga0495655_0004158 | 3300053083 | Bacteria | 2454 |
| 712 | Ga0495619_0128099 | 3300053085 | Bacteria | 1743 |
| 713 | Ga0495619_0214026 | 3300053085 | Bacteria | 1335 |
| 714 | Ga0495619_0243872 | 3300053085 | Bacteria | 1245 |
| 715 | Ga0495619_0520271 | 3300053085 | Bacteria | 817 |
| 716 | Ga0500578_0009710 | 3300053086 | Bacteria | 6250 |
| 717 | Ga0500578_0072990 | 3300053086 | Bacteria | 2186 |
| 718 | Ga0500644_0070789 | 3300053088 | Bacteria | 1256 |
| 719 | Ga0500646_0021663 | 3300053090 | Bacteria | 1714 |
| 720 | Ga0500566_0155992 | 3300053094 | Bacteria | 1195 |
| 721 | Ga0500640_033131 | 3300053095 | Bacteria | 2269 |
| 722 | Ga0500641_0023300 | 3300053096 | Bacteria | 2380 |
| 723 | Ga0500654_108906 | 3300053099 | Bacteria | 1144 |
| 724 | Ga0500660_069730 | 3300053100 | Bacteria | 1654 |
| 725 | Ga0500553_142862 | 3300053101 | Bacteria | 939 |
| 726 | Ga0500560_006362 | 3300053107 | Bacteria | 2697 |
| 727 | Ga0500569_013156 | 3300053109 | Bacteria | 2019 |
| 728 | Ga0500652_073838 | 3300053131 | Bacteria | 1415 |
| 729 | Ga0500658_0028250 | 3300053134 | Bacteria | 2175 |
| 730 | Ga0500559_0218339 | 3300053136 | Bacteria | 899 |
| 731 | Ga0500561_0009085 | 3300053137 | Bacteria | 2005 |
| 732 | Ga0500573_0058933 | 3300053140 | Bacteria | 2201 |
| 733 | Ga0500573_0073692 | 3300053140 | Bacteria | 1945 |
| 734 | Ga0500573_0098584 | 3300053140 | Bacteria | 1646 |
| 735 | Ga0500573_0393437 | 3300053140 | Bacteria | 658 |
| 736 | Ga0500579_017070 | 3300053143 | Bacteria | 4693 |
| 737 | Ga0500588_0310319 | 3300053146 | Bacteria | 597 |
| 738 | Ga0500600_0009525 | 3300053149 | Bacteria | 5863 |
| 739 | Ga0500600_0196664 | 3300053149 | Bacteria | 954 |
| 740 | Ga0500616_0052585 | 3300053153 | Bacteria | 2141 |
| 741 | Ga0500633_0005923 | 3300053160 | Bacteria | 2953 |
| 742 | Ga0500634_0000949 | 3300053161 | Bacteria | 10434 |
| 743 | Ga0500656_001651 | 3300053732 | Bacteria | 1944 |
| 744 | Ga0500587_004984 | 3300053739 | Bacteria | 1806 |
| 745 | Ga0501084_0012357 | 3300054114 | Bacteria | 7073 |
| 746 | Ga0501082_0005799 | 3300060353 | Bacteria | 10720 |
| 747 | Ga0466962_0004456 | 3300061719 | Bacteria | 6710 |
| 748 | Ga0466962_0030053 | 3300061719 | Bacteria | 2601 |
| 749 | Ga0466962_0048655 | 3300061719 | Bacteria | 2026 |
| 750 | Ga0466962_0075601 | 3300061719 | Bacteria | 1609 |
| 751 | Ga0530510_0033810 | 3300061734 | Bacteria | 3681 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048929 | Ga0496126_0000048 | Ga0496126_0000048_52931_53407 | 139 |
| 2 | 3300005617 | Ga0068859_100000091 | Ga0068859_10000009113 | 140 |
| 3 | 3300005844 | Ga0068862_100000145 | Ga0068862_10000014522 | 140 |
| 4 | 3300006931 | Ga0097620_100000091 | Ga0097620_10000009154 | 140 |
| 5 | 3300009553 | Ga0105249_10008763 | Ga0105249_100087636 | 140 |
| 6 | 3300014325 | Ga0163163_10011655 | Ga0163163_100116556 | 140 |
| 7 | 3300025961 | Ga0207712_10010620 | Ga0207712_100106204 | 140 |
| 8 | 3300028380 | Ga0268265_10000057 | Ga0268265_1000005741 | 140 |
| 9 | 3300005614 | Ga0068856_100442064 | Ga0068856_1004420643 | 141 |
| 10 | 3300048922 | Ga0496119_0009833 | Ga0496119_0009833_5454_5960 | 141 |
| 11 | 3300010375 | Ga0105239_11542198 | Ga0105239_115421981 | 142 |
| 12 | 3300013307 | Ga0157372_11625625 | Ga0157372_116256252 | 142 |
| 13 | 3300014969 | Ga0157376_11377170 | Ga0157376_113771701 | 142 |
| 14 | 3300005841 | Ga0068863_101103109 | Ga0068863_1011031091 | 145 |
| 15 | 3300009101 | Ga0105247_10000102 | Ga0105247_1000010235 | 145 |
| 16 | 3300009177 | Ga0105248_10000892 | Ga0105248_1000089215 | 145 |
| 17 | 3300014968 | Ga0157379_10005095 | Ga0157379_100050952 | 145 |
| 18 | 3300025735 | Ga0207713_1115213 | Ga0207713_11152131 | 145 |
| 19 | 3300025900 | Ga0207710_10000029 | Ga0207710_1000002977 | 145 |
| 20 | 3300025941 | Ga0207711_10020076 | Ga0207711_100200762 | 145 |
| 21 | 3300048922 | Ga0496119_0000784 | Ga0496119_0000784_5124_5612 | 145 |
| 22 | 3300048923 | Ga0496120_0006188 | Ga0496120_0006188_3480_3968 | 145 |
| 23 | 3300046491 | Ga0495584_0222531 | Ga0495584_0222531_37_477 | 146 |
| 24 | 3300020070 | Ga0206356_11015788 | Ga0206356_110157883 | 148 |
| 25 | 3300026041 | Ga0207639_10147455 | Ga0207639_101474553 | 148 |
| 26 | 3300026142 | Ga0207698_10111307 | Ga0207698_101113073 | 148 |
| 27 | 3300038443 | Ga0395901_0662331 | Ga0395901_0662331_294_743 | 148 |
| 28 | 3300042012 | Ga0439455_0010021 | Ga0439455_0010021_1345_1794 | 148 |
| 29 | 3300005354 | Ga0070675_101085642 | Ga0070675_1010856422 | 149 |
| 30 | 3300009036 | Ga0105244_10382601 | Ga0105244_103826011 | 149 |
| 31 | 3300041451 | Ga0451791_0799676 | Ga0451791_0799676_615_1064 | 149 |
| 32 | 3300041453 | Ga0451797_0186243 | Ga0451797_0186243_75_524 | 149 |
| 33 | 3300041459 | Ga0451800_0748042 | Ga0451800_0748042_175_624 | 149 |
| 34 | 3300041486 | Ga0451807_1733353 | Ga0451807_1733353_309_758 | 149 |
| 35 | 3300041509 | Ga0451843_0142188 | Ga0451843_0142188_419_868 | 149 |
| 36 | 3300041509 | Ga0451843_1009812 | Ga0451843_1009812_968_1417 | 149 |
| 37 | 3300041512 | Ga0451853_2835984 | Ga0451853_2835984_31_480 | 149 |
| 38 | 3300046663 | Ga0495635_0369918 | Ga0495635_0369918_154_603 | 149 |
| 39 | 3300048917 | Ga0496114_0054832 | Ga0496114_0054832_2371_2820 | 149 |
| 40 | 3300049571 | Ga0501034_0002857 | Ga0501034_0002857_1352_1801 | 149 |
| 41 | 3300049571 | Ga0501034_0147569 | Ga0501034_0147569_1155_1604 | 149 |
| 42 | iso_pu_bacteria | 2554235005 | 2554258559 | 149 |
| 43 | iso_pu_bacteria | 2808606982 | 2811848300 | 149 |
| 44 | 3300005842 | Ga0068858_100000074 | Ga0068858_10000007446 | 150 |
| 45 | 3300009177 | Ga0105248_10000329 | Ga0105248_1000032961 | 150 |
| 46 | 3300014325 | Ga0163163_10063765 | Ga0163163_100637653 | 150 |
| 47 | 3300014968 | Ga0157379_10000011 | Ga0157379_1000001157 | 150 |
| 48 | 3300025941 | Ga0207711_10000270 | Ga0207711_100002704 | 150 |
| 49 | 3300026035 | Ga0207703_10000066 | Ga0207703_1000006670 | 150 |
| 50 | 3300026067 | Ga0207678_11117127 | Ga0207678_111171271 | 150 |
| 51 | 3300033180 | Ga0307510_10271494 | Ga0307510_102714942 | 150 |
| 52 | iso_pu_bacteria | 2508501039 | 2508676229 | 151 |
| 53 | iso_pu_bacteria | 2517572101 | 2517763441 | 151 |
| 54 | iso_pu_bacteria | 2527291627 | 2528204410 | 151 |
| 55 | iso_pu_bacteria | 2527291629 | 2528214137 | 151 |
| 56 | iso_pu_bacteria | 2546825537 | 2546948247 | 151 |
| 57 | iso_pu_bacteria | 2547132111 | 2547406862 | 151 |
| 58 | iso_pu_bacteria | 2576861822 | 2579749137 | 151 |
| 59 | iso_pu_bacteria | 2579778521 | 2579852140 | 151 |
| 60 | iso_pu_bacteria | 2582581313 | 2585304796 | 151 |
| 61 | iso_pu_bacteria | 2582581314 | 2585319476 | 151 |
| 62 | iso_pu_bacteria | 2616644814 | 2616700762 | 151 |
| 63 | iso_pu_bacteria | 2619618881 | 2619854737 | 151 |
| 64 | iso_pu_bacteria | 2619619003 | 2620351174 | 151 |
| 65 | iso_pu_bacteria | 2626541554 | 2626637774 | 151 |
| 66 | iso_pu_bacteria | 2643221548 | 2643759780 | 151 |
| 67 | iso_pu_bacteria | 2643221578 | 2643897905 | 151 |
| 68 | iso_pu_bacteria | 2643221587 | 2643944658 | 151 |
| 69 | iso_pu_bacteria | 2643221601 | 2644018666 | 151 |
| 70 | iso_pu_bacteria | 2643221631 | 2644179801 | 151 |
| 71 | iso_pu_bacteria | 2643221647 | 2644269282 | 151 |
| 72 | iso_pu_bacteria | 2643221670 | 2644385419 | 151 |
| 73 | iso_pu_bacteria | 2643221673 | 2644409050 | 151 |
| 74 | iso_pu_bacteria | 2643221677 | 2644431556 | 151 |
| 75 | iso_pu_bacteria | 2643221678 | 2644436414 | 151 |
| 76 | iso_pu_bacteria | 2643221714 | 2644625740 | 151 |
| 77 | iso_pu_bacteria | 2671180195 | 2671834005 | 151 |
| 78 | iso_pu_bacteria | 2684623035 | 2686535859 | 151 |
| 79 | iso_pu_bacteria | 2684623036 | 2686542538 | 151 |
| 80 | iso_pu_bacteria | 2687453737 | 2689961512 | 151 |
| 81 | iso_pu_bacteria | 2687453743 | 2689992878 | 151 |
| 82 | iso_pu_bacteria | 2710264753 | 2710603151 | 151 |
| 83 | iso_pu_bacteria | 2767802112 | 2768646020 | 151 |
| 84 | iso_pu_bacteria | 2773857922 | 2774852161 | 151 |
| 85 | iso_pu_bacteria | 2773857924 | 2774865275 | 151 |
| 86 | iso_pu_bacteria | 2784132148 | 2784587889 | 151 |
| 87 | iso_pu_bacteria | 2784746768 | 2785368612 | 151 |
| 88 | iso_pu_bacteria | 2786546132 | 2786669718 | 151 |
| 89 | iso_pu_bacteria | 2791355406 | 2793976122 | 151 |
| 90 | iso_pu_bacteria | 2802429296 | 2804844904 | 151 |
| 91 | iso_pu_bacteria | 2808606359 | 2808841298 | 151 |
| 92 | iso_pu_bacteria | 2808606375 | 2808919819 | 151 |
| 93 | iso_pu_bacteria | 2808606448 | 2809231476 | 151 |
| 94 | iso_pu_bacteria | 2811994879 | 2812358958 | 151 |
| 95 | iso_pu_bacteria | 2811994917 | 2812481208 | 151 |
| 96 | iso_pu_bacteria | 2816332119 | 2816424473 | 151 |
| 97 | iso_pu_bacteria | 2818991463 | 2819693648 | 151 |
| 98 | iso_pu_bacteria | 2818991472 | 2819742828 | 151 |
| 99 | iso_pu_bacteria | 2852635781 | 2852642197 | 151 |
| 100 | iso_pu_bacteria | 2862178590 | 2862184870 | 151 |
| 101 | iso_pu_bacteria | 2862281513 | 2862288117 | 151 |
| 102 | iso_pu_bacteria | 2862290372 | 2862291916 | 151 |
| 103 | iso_pu_bacteria | 2862574272 | 2862579973 | 151 |
| 104 | iso_pu_bacteria | 2862705112 | 2862711041 | 151 |
| 105 | iso_pu_bacteria | 2867428634 | 2867437316 | 151 |
| 106 | iso_pu_bacteria | 2867475112 | 2867479693 | 151 |
| 107 | iso_pu_bacteria | 2873151551 | 2873156531 | 151 |
| 108 | iso_pu_bacteria | 2875391855 | 2875393816 | 151 |
| 109 | iso_pu_bacteria | 2877676314 | 2877681899 | 151 |
| 110 | iso_pu_bacteria | 2895880812 | 2895888554 | 151 |
| 111 | iso_pu_bacteria | 2912715099 | 2912720872 | 151 |
| 112 | iso_pu_bacteria | 2912723979 | 2912724988 | 151 |
| 113 | iso_pu_bacteria | 2918501144 | 2918503846 | 151 |
| 114 | iso_pu_bacteria | 2919468124 | 2919468697 | 151 |
| 115 | iso_pu_bacteria | 2946045630 | 2946050836 | 151 |
| 116 | iso_pu_bacteria | 2946064051 | 2946066919 | 151 |
| 117 | iso_pu_bacteria | 2946072368 | 2946075243 | 151 |
| 118 | iso_pu_bacteria | 2947224130 | 2947230316 | 151 |
| 119 | iso_pu_bacteria | 2954002825 | 2954003631 | 151 |
| 120 | iso_pu_bacteria | 2954380949 | 2954387037 | 151 |
| 121 | iso_pu_bacteria | 2954673503 | 2954676143 | 151 |
| 122 | iso_pu_bacteria | 2954682443 | 2954688024 | 151 |
| 123 | iso_pu_bacteria | 2954691527 | 2954697874 | 151 |
| 124 | iso_pu_bacteria | 2954701450 | 2954704342 | 151 |
| 125 | iso_pu_bacteria | 2954711539 | 2954716986 | 151 |
| 126 | iso_pu_bacteria | 2954721474 | 2954726937 | 151 |
| 127 | iso_pu_bacteria | 2954731030 | 2954734860 | 151 |
| 128 | iso_pu_bacteria | 2954740390 | 2954745858 | 151 |
| 129 | iso_pu_bacteria | 2954749733 | 2954753732 | 151 |
| 130 | iso_pu_bacteria | 2954759201 | 2954764831 | 151 |
| 131 | iso_pu_bacteria | 2966598605 | 2966603260 | 151 |
| 132 | iso_pu_bacteria | 2990044586 | 2990046530 | 151 |
| 133 | iso_pu_bacteria | 2990059506 | 2990061856 | 151 |
| 134 | iso_pu_bacteria | 2997451912 | 2997456572 | 151 |
| 135 | iso_pu_bacteria | 2997600082 | 2997608142 | 151 |
| 136 | iso_pu_bacteria | 3006321560 | 3006321807 | 151 |
| 137 | iso_pu_bacteria | 3006393351 | 3006399662 | 151 |
| 138 | iso_pu_bacteria | 3006493962 | 3006501796 | 151 |
| 139 | iso_pu_bacteria | 637000116 | 637878494 | 151 |
| 140 | iso_pu_bacteria | 8002775197 | 8002776629 | 151 |
| 141 | iso_pu_bacteria | 8008485437 | 8008488812 | 151 |
| 142 | iso_pu_bacteria | 8008574985 | 8008579589 | 151 |
| 143 | iso_pu_bacteria | 8023623736 | 8023629294 | 151 |
| 144 | iso_pu_bacteria | 8025413630 | 8025419342 | 151 |
| 145 | iso_pu_bacteria | 8025478263 | 8025485389 | 151 |
| 146 | iso_pu_bacteria | 8025524527 | 8025528295 | 151 |
| 147 | iso_pu_bacteria | 8033684223 | 8033686342 | 151 |
| 148 | iso_pu_bacteria | 8047893842 | 8047898923 | 151 |
| 149 | iso_pu_bacteria | 8048127548 | 8048127715 | 151 |
| 150 | iso_pu_bacteria | 8048356638 | 8048359996 | 151 |
| 151 | iso_pu_bacteria | 8048369669 | 8048375881 | 151 |
| 152 | iso_pu_bacteria | 8048379754 | 8048382326 | 151 |
| 153 | iso_pu_bacteria | 8054913762 | 8054914030 | 151 |
| 154 | iso_pu_bacteria | 8054920844 | 8054925481 | 151 |
| 155 | iso_pu_bacteria | 8055066027 | 8055074328 | 151 |
| 156 | iso_pu_bacteria | 8055157932 | 8055163185 | 151 |
| 157 | iso_pu_bacteria | 8056054917 | 8056054946 | 151 |
| 158 | iso_pu_bacteria | 8056447290 | 8056452366 | 151 |
| 159 | iso_pu_bacteria | 8056667051 | 8056667508 | 151 |
| 160 | iso_pu_bacteria | 8056829672 | 8056833929 | 151 |
| 161 | 3300035410 | Ga0373924_0465525 | Ga0373924_0465525_27_485 | 152 |
| 162 | 3300035725 | Ga0373947_0212576 | Ga0373947_0212576_546_1004 | 152 |
| 163 | 3300036401 | Ga0373937_0407256 | Ga0373937_0407256_118_576 | 152 |
| 164 | 3300046459 | Ga0495629_0568082 | Ga0495629_0568082_112_570 | 152 |
| 165 | 3300005335 | Ga0070666_10003675 | Ga0070666_100036757 | 153 |
| 166 | 3300005347 | Ga0070668_100405861 | Ga0070668_1004058612 | 153 |
| 167 | 3300005355 | Ga0070671_100241920 | Ga0070671_1002419201 | 153 |
| 168 | 3300005367 | Ga0070667_100018295 | Ga0070667_1000182954 | 153 |
| 169 | 3300005445 | Ga0070708_100059206 | Ga0070708_1000592063 | 153 |
| 170 | 3300005544 | Ga0070686_100465872 | Ga0070686_1004658721 | 153 |
| 171 | 3300005548 | Ga0070665_100103226 | Ga0070665_1001032262 | 153 |
| 172 | 3300005841 | Ga0068863_100000271 | Ga0068863_1000002714 | 153 |
| 173 | 3300005842 | Ga0068858_100002463 | Ga0068858_1000024634 | 153 |
| 174 | 3300005843 | Ga0068860_100000017 | Ga0068860_10000001777 | 153 |
| 175 | 3300009177 | Ga0105248_10657488 | Ga0105248_106574883 | 153 |
| 176 | 3300025903 | Ga0207680_10009015 | Ga0207680_100090155 | 153 |
| 177 | 3300025972 | Ga0207668_10030636 | Ga0207668_100306364 | 153 |
| 178 | 3300025986 | Ga0207658_11084071 | Ga0207658_110840711 | 153 |
| 179 | 3300026035 | Ga0207703_10010385 | Ga0207703_100103855 | 153 |
| 180 | 3300026088 | Ga0207641_10006406 | Ga0207641_1000640610 | 153 |
| 181 | 3300028379 | Ga0268266_10003027 | Ga0268266_100030275 | 153 |
| 182 | 3300028381 | Ga0268264_10000033 | Ga0268264_10000033165 | 153 |
| 183 | 3300044656 | Ga0466969_0215357 | Ga0466969_0215357_365_859 | 153 |
| 184 | 3300044901 | Ga0466960_0830493 | Ga0466960_0830493_28_489 | 153 |
| 185 | 3300048903 | Ga0496100_0324726 | Ga0496100_0324726_615_1106 | 153 |
| 186 | 3300048904 | Ga0496101_0132276 | Ga0496101_0132276_1353_1844 | 153 |
| 187 | 3300048905 | Ga0496102_0591295 | Ga0496102_0591295_464_925 | 153 |
| 188 | 3300048907 | Ga0496104_0472179 | Ga0496104_0472179_61_552 | 153 |
| 189 | 3300048912 | Ga0496109_0441593 | Ga0496109_0441593_609_1100 | 153 |
| 190 | 3300048913 | Ga0496110_0835610 | Ga0496110_0835610_137_628 | 153 |
| 191 | 3300048914 | Ga0496111_0718134 | Ga0496111_0718134_54_545 | 153 |
| 192 | 3300048916 | Ga0496113_1139383 | Ga0496113_1139383_49_531 | 153 |
| 193 | iso_pu_bacteria | 8054160619 | 8054165027 | 153 |
| 194 | 3300005937 | Ga0081455_10000038 | Ga0081455_10000038134 | 154 |
| 195 | 3300009177 | Ga0105248_10042603 | Ga0105248_100426033 | 154 |
| 196 | 3300025941 | Ga0207711_10025120 | Ga0207711_100251204 | 154 |
| 197 | 3300031852 | Ga0307410_10606659 | Ga0307410_106066592 | 154 |
| 198 | 3300044694 | Ga0466963_0231550 | Ga0466963_0231550_303_767 | 154 |
| 199 | 3300044735 | Ga0466968_0160230 | Ga0466968_0160230_88_552 | 154 |
| 200 | 3300044765 | Ga0466970_0437382 | Ga0466970_0437382_50_514 | 154 |
| 201 | 3300045976 | Ga0466967_0759544 | Ga0466967_0759544_63_527 | 154 |
| 202 | 3300048921 | Ga0496118_0023433 | Ga0496118_0023433_2921_3415 | 154 |
| 203 | 3300049569 | Ga0501032_0211887 | Ga0501032_0211887_645_1109 | 154 |
| 204 | 3300049571 | Ga0501034_0021523 | Ga0501034_0021523_4900_5364 | 154 |
| 205 | 3300049572 | Ga0501036_0000627 | Ga0501036_0000627_22770_23234 | 154 |
| 206 | 3300049573 | Ga0501037_0006911 | Ga0501037_0006911_5876_6340 | 154 |
| 207 | 3300049574 | Ga0501038_0017684 | Ga0501038_0017684_4732_5196 | 154 |
| 208 | 3300049575 | Ga0501039_0034037 | Ga0501039_0034037_3401_3865 | 154 |
| 209 | 3300049578 | Ga0501042_0003012 | Ga0501042_0003012_2953_3417 | 154 |
| 210 | 3300049579 | Ga0501043_0002045 | Ga0501043_0002045_3651_4115 | 154 |
| 211 | 3300049581 | Ga0501047_0009755 | Ga0501047_0009755_1790_2254 | 154 |
| 212 | 3300049582 | Ga0501048_0003714 | Ga0501048_0003714_6665_7129 | 154 |
| 213 | 3300049589 | Ga0501073_0799803 | Ga0501073_0799803_72_536 | 154 |
| 214 | 3300049590 | Ga0501074_0000296 | Ga0501074_0000296_25225_25689 | 154 |
| 215 | 3300049592 | Ga0501076_0585960 | Ga0501076_0585960_84_548 | 154 |
| 216 | 3300049742 | Ga0501080_1084503 | Ga0501080_1084503_123_587 | 154 |
| 217 | 3300049823 | Ga0501044_0086845 | Ga0501044_0086845_952_1416 | 154 |
| 218 | 3300049824 | Ga0501045_0070710 | Ga0501045_0070710_1132_1596 | 154 |
| 219 | iso_pu_bacteria | 8055172936 | 8055179552 | 154 |
| 220 | 3300001979 | JGI24740J21852_10068568 | JGI24740J21852_100685682 | 155 |
| 221 | 3300001989 | JGI24739J22299_10022301 | JGI24739J22299_100223012 | 155 |
| 222 | 3300001989 | JGI24739J22299_10182026 | JGI24739J22299_101820262 | 155 |
| 223 | 3300001990 | JGI24737J22298_10008180 | JGI24737J22298_100081803 | 155 |
| 224 | 3300002067 | JGI24735J21928_10188688 | JGI24735J21928_101886881 | 155 |
| 225 | 3300003320 | rootH2_10171867 | rootH2_101718672 | 155 |
| 226 | 3300003323 | rootH1_10027836 | rootH1_100278362 | 155 |
| 227 | 3300003354 | JGI25160J50197_1020109 | JGI25160J50197_10201092 | 155 |
| 228 | 3300003578 | Ga0006562J51391_1094426 | Ga0006562J51391_10944262 | 155 |
| 229 | 3300003578 | Ga0006562J51391_1109822 | Ga0006562J51391_11098221 | 155 |
| 230 | 3300003856 | Ga0058692_1048845 | Ga0058692_10488451 | 155 |
| 231 | 3300005329 | Ga0070683_100262476 | Ga0070683_1002624762 | 155 |
| 232 | 3300005329 | Ga0070683_100366079 | Ga0070683_1003660792 | 155 |
| 233 | 3300005334 | Ga0068869_101124483 | Ga0068869_1011244831 | 155 |
| 234 | 3300005344 | Ga0070661_100766311 | Ga0070661_1007663111 | 155 |
| 235 | 3300005347 | Ga0070668_100829628 | Ga0070668_1008296281 | 155 |
| 236 | 3300005366 | Ga0070659_100859924 | Ga0070659_1008599241 | 155 |
| 237 | 3300005436 | Ga0070713_100895120 | Ga0070713_1008951202 | 155 |
| 238 | 3300005437 | Ga0070710_10214923 | Ga0070710_102149233 | 155 |
| 239 | 3300005439 | Ga0070711_100884605 | Ga0070711_1008846052 | 155 |
| 240 | 3300005455 | Ga0070663_100024525 | Ga0070663_1000245252 | 155 |
| 241 | 3300005455 | Ga0070663_100141730 | Ga0070663_1001417302 | 155 |
| 242 | 3300005467 | Ga0070706_101168259 | Ga0070706_1011682591 | 155 |
| 243 | 3300005468 | Ga0070707_101067006 | Ga0070707_1010670062 | 155 |
| 244 | 3300005471 | Ga0070698_100143021 | Ga0070698_1001430212 | 155 |
| 245 | 3300005539 | Ga0068853_100111278 | Ga0068853_1001112782 | 155 |
| 246 | 3300005539 | Ga0068853_100588571 | Ga0068853_1005885711 | 155 |
| 247 | 3300005548 | Ga0070665_100025085 | Ga0070665_1000250854 | 155 |
| 248 | 3300005548 | Ga0070665_100030936 | Ga0070665_1000309364 | 155 |
| 249 | 3300005548 | Ga0070665_100993081 | Ga0070665_1009930812 | 155 |
| 250 | 3300005563 | Ga0068855_100002515 | Ga0068855_10000251517 | 155 |
| 251 | 3300005564 | Ga0070664_100739406 | Ga0070664_1007394062 | 155 |
| 252 | 3300005577 | Ga0068857_100018695 | Ga0068857_1000186951 | 155 |
| 253 | 3300005578 | Ga0068854_100004644 | Ga0068854_1000046443 | 155 |
| 254 | 3300005614 | Ga0068856_100037419 | Ga0068856_1000374194 | 155 |
| 255 | 3300005614 | Ga0068856_100076400 | Ga0068856_1000764005 | 155 |
| 256 | 3300005614 | Ga0068856_100342594 | Ga0068856_1003425942 | 155 |
| 257 | 3300005614 | Ga0068856_100832558 | Ga0068856_1008325581 | 155 |
| 258 | 3300005614 | Ga0068856_101565129 | Ga0068856_1015651292 | 155 |
| 259 | 3300005616 | Ga0068852_100040818 | Ga0068852_1000408183 | 155 |
| 260 | 3300005617 | Ga0068859_101838933 | Ga0068859_1018389332 | 155 |
| 261 | 3300005834 | Ga0068851_10152574 | Ga0068851_101525743 | 155 |
| 262 | 3300005834 | Ga0068851_10186590 | Ga0068851_101865902 | 155 |
| 263 | 3300005840 | Ga0068870_10556417 | Ga0068870_105564172 | 155 |
| 264 | 3300005937 | Ga0081455_10064031 | Ga0081455_100640313 | 155 |
| 265 | 3300006042 | Ga0075368_10003220 | Ga0075368_100032202 | 155 |
| 266 | 3300006048 | Ga0075363_100096824 | Ga0075363_1000968242 | 155 |
| 267 | 3300006048 | Ga0075363_100374840 | Ga0075363_1003748401 | 155 |
| 268 | 3300006163 | Ga0070715_10420532 | Ga0070715_104205321 | 155 |
| 269 | 3300006173 | Ga0070716_100108207 | Ga0070716_1001082072 | 155 |
| 270 | 3300006173 | Ga0070716_100740614 | Ga0070716_1007406142 | 155 |
| 271 | 3300006175 | Ga0070712_100138932 | Ga0070712_1001389323 | 155 |
| 272 | 3300006178 | Ga0075367_10004802 | Ga0075367_100048022 | 155 |
| 273 | 3300006931 | Ga0097620_101838457 | Ga0097620_1018384572 | 155 |
| 274 | 3300007788 | Ga0099795_10067347 | Ga0099795_100673472 | 155 |
| 275 | 3300009093 | Ga0105240_10076806 | Ga0105240_100768061 | 155 |
| 276 | 3300009098 | Ga0105245_10503484 | Ga0105245_105034842 | 155 |
| 277 | 3300009098 | Ga0105245_10928749 | Ga0105245_109287492 | 155 |
| 278 | 3300009098 | Ga0105245_11574576 | Ga0105245_115745762 | 155 |
| 279 | 3300009147 | Ga0114129_10127582 | Ga0114129_101275823 | 155 |
| 280 | 3300009174 | Ga0105241_10001550 | Ga0105241_100015502 | 155 |
| 281 | 3300009174 | Ga0105241_10915110 | Ga0105241_109151102 | 155 |
| 282 | 3300009545 | Ga0105237_10041436 | Ga0105237_100414361 | 155 |
| 283 | 3300009551 | Ga0105238_10063772 | Ga0105238_100637723 | 155 |
| 284 | 3300009551 | Ga0105238_10699710 | Ga0105238_106997102 | 155 |
| 285 | 3300009551 | Ga0105238_10791931 | Ga0105238_107919312 | 155 |
| 286 | 3300009553 | Ga0105249_10992092 | Ga0105249_109920922 | 155 |
| 287 | 3300009553 | Ga0105249_11484714 | Ga0105249_114847141 | 155 |
| 288 | 3300009553 | Ga0105249_11666359 | Ga0105249_116663591 | 155 |
| 289 | 3300010375 | Ga0105239_10233827 | Ga0105239_102338272 | 155 |
| 290 | 3300010375 | Ga0105239_10381729 | Ga0105239_103817291 | 155 |
| 291 | 3300010375 | Ga0105239_11405164 | Ga0105239_114051641 | 155 |
| 292 | 3300011119 | Ga0105246_10021803 | Ga0105246_100218034 | 155 |
| 293 | 3300011119 | Ga0105246_10118602 | Ga0105246_101186022 | 155 |
| 294 | 3300011119 | Ga0105246_11089237 | Ga0105246_110892372 | 155 |
| 295 | 3300013105 | Ga0157369_10089205 | Ga0157369_100892052 | 155 |
| 296 | 3300013105 | Ga0157369_10291546 | Ga0157369_102915462 | 155 |
| 297 | 3300013105 | Ga0157369_10586593 | Ga0157369_105865932 | 155 |
| 298 | 3300013105 | Ga0157369_10819480 | Ga0157369_108194802 | 155 |
| 299 | 3300013296 | Ga0157374_10417021 | Ga0157374_104170212 | 155 |
| 300 | 3300013296 | Ga0157374_11363244 | Ga0157374_113632441 | 155 |
| 301 | 3300013306 | Ga0163162_11282725 | Ga0163162_112827251 | 155 |
| 302 | 3300013307 | Ga0157372_10105482 | Ga0157372_101054822 | 155 |
| 303 | 3300013307 | Ga0157372_10517806 | Ga0157372_105178062 | 155 |
| 304 | 3300014497 | Ga0182008_10004862 | Ga0182008_100048629 | 155 |
| 305 | 3300014969 | Ga0157376_10613314 | Ga0157376_106133141 | 155 |
| 306 | 3300015261 | Ga0182006_1042073 | Ga0182006_10420732 | 155 |
| 307 | 3300015262 | Ga0182007_10017762 | Ga0182007_100177622 | 155 |
| 308 | 3300015265 | Ga0182005_1048093 | Ga0182005_10480932 | 155 |
| 309 | 3300015688 | Ga0183367_1006 | Ga0183367_1006456 | 155 |
| 310 | 3300025302 | Ga0207426_1003154 | Ga0207426_10031543 | 155 |
| 311 | 3300025302 | Ga0207426_1010499 | Ga0207426_10104993 | 155 |
| 312 | 3300025302 | Ga0207426_1011444 | Ga0207426_10114442 | 155 |
| 313 | 3300025302 | Ga0207426_1011888 | Ga0207426_10118882 | 155 |
| 314 | 3300025321 | Ga0207656_10550560 | Ga0207656_105505602 | 155 |
| 315 | 3300025901 | Ga0207688_10283449 | Ga0207688_102834492 | 155 |
| 316 | 3300025903 | Ga0207680_10816304 | Ga0207680_108163041 | 155 |
| 317 | 3300025904 | Ga0207647_10001305 | Ga0207647_1000130513 | 155 |
| 318 | 3300025904 | Ga0207647_10015896 | Ga0207647_100158963 | 155 |
| 319 | 3300025906 | Ga0207699_10228239 | Ga0207699_102282392 | 155 |
| 320 | 3300025913 | Ga0207695_10002038 | Ga0207695_100020381 | 155 |
| 321 | 3300025914 | Ga0207671_10000773 | Ga0207671_1000077311 | 155 |
| 322 | 3300025915 | Ga0207693_10154321 | Ga0207693_101543212 | 155 |
| 323 | 3300025915 | Ga0207693_10197015 | Ga0207693_101970153 | 155 |
| 324 | 3300025924 | Ga0207694_10001277 | Ga0207694_1000127713 | 155 |
| 325 | 3300025924 | Ga0207694_10386338 | Ga0207694_103863382 | 155 |
| 326 | 3300025927 | Ga0207687_10313309 | Ga0207687_103133092 | 155 |
| 327 | 3300025928 | Ga0207700_10896748 | Ga0207700_108967482 | 155 |
| 328 | 3300025928 | Ga0207700_11151744 | Ga0207700_111517442 | 155 |
| 329 | 3300025929 | Ga0207664_10035146 | Ga0207664_100351462 | 155 |
| 330 | 3300025932 | Ga0207690_10011468 | Ga0207690_100114684 | 155 |
| 331 | 3300025939 | Ga0207665_10058996 | Ga0207665_100589962 | 155 |
| 332 | 3300025940 | Ga0207691_10889878 | Ga0207691_108898781 | 155 |
| 333 | 3300025944 | Ga0207661_10246711 | Ga0207661_102467112 | 155 |
| 334 | 3300025945 | Ga0207679_10930653 | Ga0207679_109306531 | 155 |
| 335 | 3300025949 | Ga0207667_10184168 | Ga0207667_101841682 | 155 |
| 336 | 3300025981 | Ga0207640_10487002 | Ga0207640_104870021 | 155 |
| 337 | 3300026041 | Ga0207639_10067698 | Ga0207639_100676983 | 155 |
| 338 | 3300026067 | Ga0207678_10035871 | Ga0207678_100358712 | 155 |
| 339 | 3300026078 | Ga0207702_10068391 | Ga0207702_100683912 | 155 |
| 340 | 3300026078 | Ga0207702_10187468 | Ga0207702_101874682 | 155 |
| 341 | 3300026078 | Ga0207702_10318700 | Ga0207702_103187001 | 155 |
| 342 | 3300026116 | Ga0207674_10015589 | Ga0207674_100155896 | 155 |
| 343 | 3300026121 | Ga0207683_10685783 | Ga0207683_106857832 | 155 |
| 344 | 3300026142 | Ga0207698_10025948 | Ga0207698_100259482 | 155 |
| 345 | 3300027312 | Ga0209371_1010292 | Ga0209371_10102923 | 155 |
| 346 | 3300028379 | Ga0268266_10028709 | Ga0268266_100287094 | 155 |
| 347 | 3300028379 | Ga0268266_10465160 | Ga0268266_104651602 | 155 |
| 348 | 3300028786 | Ga0307517_10003800 | Ga0307517_1000380011 | 155 |
| 349 | 3300028786 | Ga0307517_10018307 | Ga0307517_100183073 | 155 |
| 350 | 3300028794 | Ga0307515_10002026 | Ga0307515_1000202621 | 155 |
| 351 | 3300030521 | Ga0307511_10001267 | Ga0307511_1000126716 | 155 |
| 352 | 3300030521 | Ga0307511_10067233 | Ga0307511_100672333 | 155 |
| 353 | 3300030521 | Ga0307511_10131991 | Ga0307511_101319913 | 155 |
| 354 | 3300030522 | Ga0307512_10004012 | Ga0307512_100040123 | 155 |
| 355 | 3300030522 | Ga0307512_10120662 | Ga0307512_101206622 | 155 |
| 356 | 3300030735 | Ga0316178_1131002 | Ga0316178_11310022 | 155 |
| 357 | 3300030742 | Ga0316183_1211421 | Ga0316183_12114212 | 155 |
| 358 | 3300030744 | Ga0316181_1147835 | Ga0316181_11478353 | 155 |
| 359 | 3300030745 | Ga0316182_1358891 | Ga0316182_13588912 | 155 |
| 360 | 3300031251 | Ga0265327_10000836 | Ga0265327_1000083625 | 155 |
| 361 | 3300031456 | Ga0307513_10000001 | Ga0307513_100000011203 | 155 |
| 362 | 3300031456 | Ga0307513_10069728 | Ga0307513_100697283 | 155 |
| 363 | 3300031507 | Ga0307509_10008457 | Ga0307509_100084574 | 155 |
| 364 | 3300031507 | Ga0307509_10015152 | Ga0307509_100151523 | 155 |
| 365 | 3300031507 | Ga0307509_10155262 | Ga0307509_101552622 | 155 |
| 366 | 3300031616 | Ga0307508_10005831 | Ga0307508_100058318 | 155 |
| 367 | 3300031616 | Ga0307508_10056008 | Ga0307508_100560082 | 155 |
| 368 | 3300031649 | Ga0307514_10014502 | Ga0307514_100145021 | 155 |
| 369 | 3300031649 | Ga0307514_10092567 | Ga0307514_100925672 | 155 |
| 370 | 3300031649 | Ga0307514_10132056 | Ga0307514_101320562 | 155 |
| 371 | 3300031727 | Ga0316576_10016048 | Ga0316576_100160482 | 155 |
| 372 | 3300031728 | Ga0316578_10636815 | Ga0316578_106368151 | 155 |
| 373 | 3300031730 | Ga0307516_10052872 | Ga0307516_100528722 | 155 |
| 374 | 3300031730 | Ga0307516_10069322 | Ga0307516_100693222 | 155 |
| 375 | 3300031730 | Ga0307516_10120977 | Ga0307516_101209772 | 155 |
| 376 | 3300031731 | Ga0307405_11573266 | Ga0307405_115732661 | 155 |
| 377 | 3300031824 | Ga0307413_10554152 | Ga0307413_105541521 | 155 |
| 378 | 3300031838 | Ga0307518_10119709 | Ga0307518_101197091 | 155 |
| 379 | 3300032002 | Ga0307416_100073304 | Ga0307416_1000733042 | 155 |
| 380 | 3300032002 | Ga0307416_100547280 | Ga0307416_1005472802 | 155 |
| 381 | 3300033179 | Ga0307507_10061631 | Ga0307507_100616313 | 155 |
| 382 | 3300033180 | Ga0307510_10010159 | Ga0307510_100101599 | 155 |
| 383 | 3300033180 | Ga0307510_10036555 | Ga0307510_100365554 | 155 |
| 384 | 3300033180 | Ga0307510_10093465 | Ga0307510_100934652 | 155 |
| 385 | 3300035398 | Ga0316574_0001605 | Ga0316574_0001605_4605_5081 | 155 |
| 386 | 3300035725 | Ga0373947_0128621 | Ga0373947_0128621_510_983 | 155 |
| 387 | 3300037466 | Ga0395898_0002956 | Ga0395898_0002956_11101_11595 | 155 |
| 388 | 3300037466 | Ga0395898_0007126 | Ga0395898_0007126_8622_9107 | 155 |
| 389 | 3300037853 | Ga0436364_0039243 | Ga0436364_0039243_85_588 | 155 |
| 390 | 3300037853 | Ga0436364_0260305 | Ga0436364_0260305_6992_7480 | 155 |
| 391 | 3300038443 | Ga0395901_0017720 | Ga0395901_0017720_6279_6773 | 155 |
| 392 | 3300041404 | Ga0439436_0001661 | Ga0439436_0001661_3789_4256 | 155 |
| 393 | 3300041404 | Ga0439436_0003853 | Ga0439436_0003853_2655_3140 | 155 |
| 394 | 3300041406 | Ga0439439_0004962 | Ga0439439_0004962_2294_2761 | 155 |
| 395 | 3300041411 | Ga0439466_0015240 | Ga0439466_0015240_287_754 | 155 |
| 396 | 3300041456 | Ga0451795_1505047 | Ga0451795_1505047_15_500 | 155 |
| 397 | 3300041498 | Ga0451841_0755329 | Ga0451841_0755329_1557_2042 | 155 |
| 398 | 3300041501 | Ga0451845_0686953 | Ga0451845_0686953_125_613 | 155 |
| 399 | 3300041512 | Ga0451853_0881640 | Ga0451853_0881640_619_1107 | 155 |
| 400 | 3300041999 | Ga0439433_0013258 | Ga0439433_0013258_377_844 | 155 |
| 401 | 3300042002 | Ga0439442_029566 | Ga0439442_029566_166_633 | 155 |
| 402 | 3300042002 | Ga0439442_038173 | Ga0439442_038173_211_678 | 155 |
| 403 | 3300042002 | Ga0439442_042325 | Ga0439442_042325_434_919 | 155 |
| 404 | 3300042002 | Ga0439442_098709 | Ga0439442_098709_117_602 | 155 |
| 405 | 3300042005 | Ga0439448_0011297 | Ga0439448_0011297_1867_2352 | 155 |
| 406 | 3300042007 | Ga0439449_0001026 | Ga0439449_0001026_8591_9076 | 155 |
| 407 | 3300042007 | Ga0439449_0006120 | Ga0439449_0006120_3171_3638 | 155 |
| 408 | 3300042007 | Ga0439449_0014464 | Ga0439449_0014464_2144_2629 | 155 |
| 409 | 3300042007 | Ga0439449_0014736 | Ga0439449_0014736_1042_1509 | 155 |
| 410 | 3300042012 | Ga0439455_0035974 | Ga0439455_0035974_35_520 | 155 |
| 411 | 3300042014 | Ga0439457_004751 | Ga0439457_004751_2763_3248 | 155 |
| 412 | 3300042014 | Ga0439457_022509 | Ga0439457_022509_902_1369 | 155 |
| 413 | 3300042015 | Ga0439462_0005725 | Ga0439462_0005725_1250_1735 | 155 |
| 414 | 3300042138 | Ga0450903_000082 | Ga0450903_000082_11270_11755 | 155 |
| 415 | 3300042138 | Ga0450903_008844 | Ga0450903_008844_671_1162 | 155 |
| 416 | 3300042145 | Ga0450906_062960 | Ga0450906_062960_87_554 | 155 |
| 417 | 3300042157 | Ga0439458_0002493 | Ga0439458_0002493_418_903 | 155 |
| 418 | 3300044656 | Ga0466969_0003067 | Ga0466969_0003067_6518_7000 | 155 |
| 419 | 3300044656 | Ga0466969_0016217 | Ga0466969_0016217_3102_3587 | 155 |
| 420 | 3300044656 | Ga0466969_0128213 | Ga0466969_0128213_328_816 | 155 |
| 421 | 3300044658 | Ga0466972_0001201 | Ga0466972_0001201_3864_4349 | 155 |
| 422 | 3300044658 | Ga0466972_0003162 | Ga0466972_0003162_3291_3779 | 155 |
| 423 | 3300044658 | Ga0466972_0518533 | Ga0466972_0518533_26_517 | 155 |
| 424 | 3300044683 | Ga0466965_0000676 | Ga0466965_0000676_1218_1703 | 155 |
| 425 | 3300044683 | Ga0466965_0247607 | Ga0466965_0247607_62_550 | 155 |
| 426 | 3300044683 | Ga0466965_0351491 | Ga0466965_0351491_85_570 | 155 |
| 427 | 3300044684 | Ga0466966_0002187 | Ga0466966_0002187_10847_11332 | 155 |
| 428 | 3300044684 | Ga0466966_0006304 | Ga0466966_0006304_2805_3290 | 155 |
| 429 | 3300044684 | Ga0466966_0010729 | Ga0466966_0010729_71_559 | 155 |
| 430 | 3300044684 | Ga0466966_0320383 | Ga0466966_0320383_79_561 | 155 |
| 431 | 3300044693 | Ga0466961_0002111 | Ga0466961_0002111_10797_11282 | 155 |
| 432 | 3300044693 | Ga0466961_0009728 | Ga0466961_0009728_5315_5800 | 155 |
| 433 | 3300044693 | Ga0466961_0052837 | Ga0466961_0052837_92_574 | 155 |
| 434 | 3300044693 | Ga0466961_0066048 | Ga0466961_0066048_798_1271 | 155 |
| 435 | 3300044693 | Ga0466961_0154866 | Ga0466961_0154866_282_758 | 155 |
| 436 | 3300044693 | Ga0466961_0189307 | Ga0466961_0189307_276_755 | 155 |
| 437 | 3300044694 | Ga0466963_0000826 | Ga0466963_0000826_4179_4664 | 155 |
| 438 | 3300044694 | Ga0466963_0059468 | Ga0466963_0059468_232_717 | 155 |
| 439 | 3300044706 | Ga0466964_0003907 | Ga0466964_0003907_4795_5280 | 155 |
| 440 | 3300044706 | Ga0466964_0134692 | Ga0466964_0134692_281_769 | 155 |
| 441 | 3300044706 | Ga0466964_0367195 | Ga0466964_0367195_119_610 | 155 |
| 442 | 3300044719 | Ga0466971_0000710 | Ga0466971_0000710_5329_5814 | 155 |
| 443 | 3300044719 | Ga0466971_0019236 | Ga0466971_0019236_1065_1550 | 155 |
| 444 | 3300044719 | Ga0466971_0053943 | Ga0466971_0053943_1310_1783 | 155 |
| 445 | 3300044719 | Ga0466971_0071863 | Ga0466971_0071863_712_1194 | 155 |
| 446 | 3300044735 | Ga0466968_0282624 | Ga0466968_0282624_261_746 | 155 |
| 447 | 3300044765 | Ga0466970_0001444 | Ga0466970_0001444_236_721 | 155 |
| 448 | 3300044765 | Ga0466970_0002527 | Ga0466970_0002527_4279_4764 | 155 |
| 449 | 3300044765 | Ga0466970_0039654 | Ga0466970_0039654_1698_2183 | 155 |
| 450 | 3300044765 | Ga0466970_0120152 | Ga0466970_0120152_234_731 | 155 |
| 451 | 3300044842 | Ga0466957_0000835 | Ga0466957_0000835_10848_11333 | 155 |
| 452 | 3300044901 | Ga0466960_0001092 | Ga0466960_0001092_6118_6603 | 155 |
| 453 | 3300045049 | Ga0466959_0002801 | Ga0466959_0002801_6821_7306 | 155 |
| 454 | 3300045049 | Ga0466959_0023538 | Ga0466959_0023538_1021_1503 | 155 |
| 455 | 3300045049 | Ga0466959_0038264 | Ga0466959_0038264_2460_2945 | 155 |
| 456 | 3300045049 | Ga0466959_0068438 | Ga0466959_0068438_1268_1741 | 155 |
| 457 | 3300045836 | Ga0466958_0000131 | Ga0466958_0000131_10844_11329 | 155 |
| 458 | 3300045836 | Ga0466958_0040078 | Ga0466958_0040078_818_1291 | 155 |
| 459 | 3300045836 | Ga0466958_0094738 | Ga0466958_0094738_1176_1661 | 155 |
| 460 | 3300045836 | Ga0466958_0195262 | Ga0466958_0195262_400_873 | 155 |
| 461 | 3300045836 | Ga0466958_0591695 | Ga0466958_0591695_181_660 | 155 |
| 462 | 3300045976 | Ga0466967_0004265 | Ga0466967_0004265_239_724 | 155 |
| 463 | 3300045976 | Ga0466967_0037002 | Ga0466967_0037002_3352_3837 | 155 |
| 464 | 3300045976 | Ga0466967_0182323 | Ga0466967_0182323_988_1476 | 155 |
| 465 | 3300045976 | Ga0466967_0587664 | Ga0466967_0587664_50_535 | 155 |
| 466 | 3300045976 | Ga0466967_0600736 | Ga0466967_0600736_518_1057 | 155 |
| 467 | 3300045976 | Ga0466967_0745825 | Ga0466967_0745825_430_918 | 155 |
| 468 | 3300046454 | Ga0495592_0016180 | Ga0495592_0016180_1474_1959 | 155 |
| 469 | 3300046454 | Ga0495592_0025554 | Ga0495592_0025554_1891_2376 | 155 |
| 470 | 3300046454 | Ga0495592_0060863 | Ga0495592_0060863_1992_2474 | 155 |
| 471 | 3300046454 | Ga0495592_0066916 | Ga0495592_0066916_1829_2317 | 155 |
| 472 | 3300046455 | Ga0495603_0000262 | Ga0495603_0000262_24537_25025 | 155 |
| 473 | 3300046455 | Ga0495603_0005677 | Ga0495603_0005677_378_866 | 155 |
| 474 | 3300046455 | Ga0495603_0011907 | Ga0495603_0011907_3208_3690 | 155 |
| 475 | 3300046455 | Ga0495603_0013959 | Ga0495603_0013959_158_646 | 155 |
| 476 | 3300046455 | Ga0495603_0208648 | Ga0495603_0208648_543_1031 | 155 |
| 477 | 3300046455 | Ga0495603_0659725 | Ga0495603_0659725_74_568 | 155 |
| 478 | 3300046459 | Ga0495629_0000568 | Ga0495629_0000568_11243_11731 | 155 |
| 479 | 3300046459 | Ga0495629_0020591 | Ga0495629_0020591_2348_2836 | 155 |
| 480 | 3300046459 | Ga0495629_0030504 | Ga0495629_0030504_1675_2160 | 155 |
| 481 | 3300046459 | Ga0495629_0044422 | Ga0495629_0044422_302_787 | 155 |
| 482 | 3300046459 | Ga0495629_0064829 | Ga0495629_0064829_1753_2247 | 155 |
| 483 | 3300046459 | Ga0495629_0077264 | Ga0495629_0077264_1697_2179 | 155 |
| 484 | 3300046459 | Ga0495629_0125074 | Ga0495629_0125074_1147_1635 | 155 |
| 485 | 3300046459 | Ga0495629_0530563 | Ga0495629_0530563_288_776 | 155 |
| 486 | 3300046460 | Ga0495638_0103740 | Ga0495638_0103740_357_845 | 155 |
| 487 | 3300046460 | Ga0495638_0169866 | Ga0495638_0169866_48_533 | 155 |
| 488 | 3300046460 | Ga0495638_0373842 | Ga0495638_0373842_179_670 | 155 |
| 489 | 3300046462 | Ga0495651_0002804 | Ga0495651_0002804_6409_6891 | 155 |
| 490 | 3300046462 | Ga0495651_0005834 | Ga0495651_0005834_6804_7289 | 155 |
| 491 | 3300046462 | Ga0495651_0014386 | Ga0495651_0014386_770_1258 | 155 |
| 492 | 3300046462 | Ga0495651_0073443 | Ga0495651_0073443_158_643 | 155 |
| 493 | 3300046462 | Ga0495651_0077267 | Ga0495651_0077267_1773_2261 | 155 |
| 494 | 3300046462 | Ga0495651_0259486 | Ga0495651_0259486_24_503 | 155 |
| 495 | 3300046462 | Ga0495651_0761966 | Ga0495651_0761966_47_520 | 155 |
| 496 | 3300046463 | Ga0495653_0006299 | Ga0495653_0006299_4892_5377 | 155 |
| 497 | 3300046463 | Ga0495653_0208905 | Ga0495653_0208905_183_671 | 155 |
| 498 | 3300046472 | Ga0495580_0078450 | Ga0495580_0078450_164_652 | 155 |
| 499 | 3300046473 | Ga0495582_0208112 | Ga0495582_0208112_88_576 | 155 |
| 500 | 3300046474 | Ga0495605_0156828 | Ga0495605_0156828_487_972 | 155 |
| 501 | 3300046475 | Ga0495639_0128546 | Ga0495639_0128546_379_873 | 155 |
| 502 | 3300046476 | Ga0495662_0003168 | Ga0495662_0003168_3828_4313 | 155 |
| 503 | 3300046476 | Ga0495662_0023317 | Ga0495662_0023317_1043_1531 | 155 |
| 504 | 3300046476 | Ga0495662_0028494 | Ga0495662_0028494_559_1053 | 155 |
| 505 | 3300046476 | Ga0495662_0069514 | Ga0495662_0069514_1052_1540 | 155 |
| 506 | 3300046476 | Ga0495662_0086708 | Ga0495662_0086708_211_696 | 155 |
| 507 | 3300046477 | Ga0495664_0016373 | Ga0495664_0016373_2365_2850 | 155 |
| 508 | 3300046477 | Ga0495664_0038406 | Ga0495664_0038406_892_1377 | 155 |
| 509 | 3300046477 | Ga0495664_0258661 | Ga0495664_0258661_397_885 | 155 |
| 510 | 3300046492 | Ga0495585_0007532 | Ga0495585_0007532_317_805 | 155 |
| 511 | 3300046492 | Ga0495585_0121389 | Ga0495585_0121389_787_1278 | 155 |
| 512 | 3300046492 | Ga0495585_0257069 | Ga0495585_0257069_233_721 | 155 |
| 513 | 3300046499 | Ga0495594_0010108 | Ga0495594_0010108_3342_3836 | 155 |
| 514 | 3300046499 | Ga0495594_0040807 | Ga0495594_0040807_250_735 | 155 |
| 515 | 3300046499 | Ga0495594_0060770 | Ga0495594_0060770_1305_1796 | 155 |
| 516 | 3300046501 | Ga0495607_0085096 | Ga0495607_0085096_1170_1655 | 155 |
| 517 | 3300046506 | Ga0495583_0050899 | Ga0495583_0050899_414_902 | 155 |
| 518 | 3300046507 | Ga0495606_0012769 | Ga0495606_0012769_20_508 | 155 |
| 519 | 3300046511 | Ga0495608_0004021 | Ga0495608_0004021_3524_4009 | 155 |
| 520 | 3300046511 | Ga0495608_0452370 | Ga0495608_0452370_210_695 | 155 |
| 521 | 3300046512 | Ga0495610_0047656 | Ga0495610_0047656_1491_1979 | 155 |
| 522 | 3300046512 | Ga0495610_0110806 | Ga0495610_0110806_148_636 | 155 |
| 523 | 3300046513 | Ga0495616_0024623 | Ga0495616_0024623_1710_2198 | 155 |
| 524 | 3300046514 | Ga0495618_0088917 | Ga0495618_0088917_935_1423 | 155 |
| 525 | 3300046514 | Ga0495618_0103514 | Ga0495618_0103514_416_904 | 155 |
| 526 | 3300046515 | Ga0495620_0004889 | Ga0495620_0004889_5745_6233 | 155 |
| 527 | 3300046515 | Ga0495620_0048083 | Ga0495620_0048083_804_1292 | 155 |
| 528 | 3300046516 | Ga0495628_0000688 | Ga0495628_0000688_2706_3191 | 155 |
| 529 | 3300046516 | Ga0495628_0171284 | Ga0495628_0171284_828_1316 | 155 |
| 530 | 3300046516 | Ga0495628_0974992 | Ga0495628_0974992_41_523 | 155 |
| 531 | 3300046517 | Ga0495630_0021554 | Ga0495630_0021554_2039_2524 | 155 |
| 532 | 3300046517 | Ga0495630_0074723 | Ga0495630_0074723_1656_2141 | 155 |
| 533 | 3300046517 | Ga0495630_0832233 | Ga0495630_0832233_41_529 | 155 |
| 534 | 3300046518 | Ga0495631_0010353 | Ga0495631_0010353_1503_1991 | 155 |
| 535 | 3300046519 | Ga0495632_0006703 | Ga0495632_0006703_6450_6941 | 155 |
| 536 | 3300046520 | Ga0495637_0074465 | Ga0495637_0074465_843_1331 | 155 |
| 537 | 3300046522 | Ga0495643_0005069 | Ga0495643_0005069_7322_7813 | 155 |
| 538 | 3300046522 | Ga0495643_0008442 | Ga0495643_0008442_2608_3096 | 155 |
| 539 | 3300046524 | Ga0495648_0086870 | Ga0495648_0086870_811_1299 | 155 |
| 540 | 3300046524 | Ga0495648_0250205 | Ga0495648_0250205_142_633 | 155 |
| 541 | 3300046526 | Ga0495666_0010110 | Ga0495666_0010110_451_936 | 155 |
| 542 | 3300046526 | Ga0495666_0079575 | Ga0495666_0079575_519_1007 | 155 |
| 543 | 3300046526 | Ga0495666_0344170 | Ga0495666_0344170_132_617 | 155 |
| 544 | 3300046528 | Ga0495642_0257685 | Ga0495642_0257685_232_720 | 155 |
| 545 | 3300046529 | Ga0495652_0004375 | Ga0495652_0004375_5960_6442 | 155 |
| 546 | 3300046529 | Ga0495652_0092433 | Ga0495652_0092433_21_506 | 155 |
| 547 | 3300046529 | Ga0495652_0141907 | Ga0495652_0141907_980_1468 | 155 |
| 548 | 3300046529 | Ga0495652_0346537 | Ga0495652_0346537_168_656 | 155 |
| 549 | 3300046530 | Ga0495654_0059565 | Ga0495654_0059565_1202_1690 | 155 |
| 550 | 3300046531 | Ga0495665_0000429 | Ga0495665_0000429_20540_21025 | 155 |
| 551 | 3300046533 | Ga0495640_0002937 | Ga0495640_0002937_12126_12611 | 155 |
| 552 | 3300046533 | Ga0495640_0003552 | Ga0495640_0003552_11231_11719 | 155 |
| 553 | 3300046533 | Ga0495640_0014341 | Ga0495640_0014341_2162_2650 | 155 |
| 554 | 3300046533 | Ga0495640_0082137 | Ga0495640_0082137_107_592 | 155 |
| 555 | 3300046533 | Ga0495640_0119518 | Ga0495640_0119518_99_587 | 155 |
| 556 | 3300046536 | Ga0495587_0009674 | Ga0495587_0009674_4679_5164 | 155 |
| 557 | 3300046538 | Ga0495609_0029135 | Ga0495609_0029135_1734_2222 | 155 |
| 558 | 3300046543 | Ga0495645_0008311 | Ga0495645_0008311_2608_3090 | 155 |
| 559 | 3300046543 | Ga0495645_0043616 | Ga0495645_0043616_2532_3020 | 155 |
| 560 | 3300046543 | Ga0495645_0165037 | Ga0495645_0165037_24_509 | 155 |
| 561 | 3300046557 | Ga0495622_0090717 | Ga0495622_0090717_452_943 | 155 |
| 562 | 3300046557 | Ga0495622_0097238 | Ga0495622_0097238_236_724 | 155 |
| 563 | 3300046557 | Ga0495622_0445511 | Ga0495622_0445511_30_518 | 155 |
| 564 | 3300046558 | Ga0495633_0182608 | Ga0495633_0182608_364_852 | 155 |
| 565 | 3300046559 | Ga0495667_0007764 | Ga0495667_0007764_6762_7247 | 155 |
| 566 | 3300046559 | Ga0495667_0219352 | Ga0495667_0219352_124_612 | 155 |
| 567 | 3300046559 | Ga0495667_0244270 | Ga0495667_0244270_47_532 | 155 |
| 568 | 3300046616 | Ga0495668_0079133 | Ga0495668_0079133_988_1476 | 155 |
| 569 | 3300046616 | Ga0495668_0390754 | Ga0495668_0390754_152_643 | 155 |
| 570 | 3300046642 | Ga0495634_0002265 | Ga0495634_0002265_412_897 | 155 |
| 571 | 3300046642 | Ga0495634_0167490 | Ga0495634_0167490_859_1347 | 155 |
| 572 | 3300046642 | Ga0495634_0177293 | Ga0495634_0177293_454_939 | 155 |
| 573 | 3300046660 | Ga0495625_0046473 | Ga0495625_0046473_67_552 | 155 |
| 574 | 3300046660 | Ga0495625_0084323 | Ga0495625_0084323_1704_2186 | 155 |
| 575 | 3300046660 | Ga0495625_0286788 | Ga0495625_0286788_115_603 | 155 |
| 576 | 3300046660 | Ga0495625_0344996 | Ga0495625_0344996_278_763 | 155 |
| 577 | 3300046660 | Ga0495625_0345081 | Ga0495625_0345081_153_638 | 155 |
| 578 | 3300046663 | Ga0495635_0047065 | Ga0495635_0047065_1041_1526 | 155 |
| 579 | 3300046663 | Ga0495635_0468489 | Ga0495635_0468489_326_811 | 155 |
| 580 | 3300046663 | Ga0495635_0533518 | Ga0495635_0533518_245_733 | 155 |
| 581 | 3300046665 | Ga0495661_0085658 | Ga0495661_0085658_190_678 | 155 |
| 582 | 3300046674 | Ga0495588_0009916 | Ga0495588_0009916_561_1049 | 155 |
| 583 | 3300046674 | Ga0495588_0011624 | Ga0495588_0011624_2594_3088 | 155 |
| 584 | 3300046674 | Ga0495588_0049565 | Ga0495588_0049565_1495_1980 | 155 |
| 585 | 3300046674 | Ga0495588_0169828 | Ga0495588_0169828_49_534 | 155 |
| 586 | 3300046675 | Ga0495657_0020033 | Ga0495657_0020033_856_1344 | 155 |
| 587 | 3300046675 | Ga0495657_0022714 | Ga0495657_0022714_809_1294 | 155 |
| 588 | 3300046675 | Ga0495657_0111715 | Ga0495657_0111715_806_1291 | 155 |
| 589 | 3300046675 | Ga0495657_0125896 | Ga0495657_0125896_642_1130 | 155 |
| 590 | 3300046678 | Ga0495599_0029257 | Ga0495599_0029257_1002_1487 | 155 |
| 591 | 3300046678 | Ga0495599_0108560 | Ga0495599_0108560_688_1176 | 155 |
| 592 | 3300046679 | Ga0495623_0148191 | Ga0495623_0148191_454_939 | 155 |
| 593 | 3300046679 | Ga0495623_0179819 | Ga0495623_0179819_33_515 | 155 |
| 594 | 3300046680 | Ga0495646_0060550 | Ga0495646_0060550_778_1263 | 155 |
| 595 | 3300046680 | Ga0495646_0104401 | Ga0495646_0104401_255_743 | 155 |
| 596 | 3300046680 | Ga0495646_0113806 | Ga0495646_0113806_986_1468 | 155 |
| 597 | 3300046683 | Ga0495658_0057104 | Ga0495658_0057104_752_1243 | 155 |
| 598 | 3300046683 | Ga0495658_0207499 | Ga0495658_0207499_428_913 | 155 |
| 599 | 3300046689 | Ga0495613_0001287 | Ga0495613_0001287_17748_18236 | 155 |
| 600 | 3300046689 | Ga0495613_0007095 | Ga0495613_0007095_2703_3191 | 155 |
| 601 | 3300046689 | Ga0495613_0051170 | Ga0495613_0051170_690_1175 | 155 |
| 602 | 3300046689 | Ga0495613_0137924 | Ga0495613_0137924_747_1232 | 155 |
| 603 | 3300046689 | Ga0495613_0165642 | Ga0495613_0165642_149_634 | 155 |
| 604 | 3300046689 | Ga0495613_0548080 | Ga0495613_0548080_192_683 | 155 |
| 605 | 3300046689 | Ga0495613_0725837 | Ga0495613_0725837_93_581 | 155 |
| 606 | 3300046690 | Ga0495624_0046459 | Ga0495624_0046459_1843_2331 | 155 |
| 607 | 3300046690 | Ga0495624_0109284 | Ga0495624_0109284_1154_1645 | 155 |
| 608 | 3300046690 | Ga0495624_0124359 | Ga0495624_0124359_370_858 | 155 |
| 609 | 3300046691 | Ga0495670_0026460 | Ga0495670_0026460_1081_1572 | 155 |
| 610 | 3300046691 | Ga0495670_0505265 | Ga0495670_0505265_109_597 | 155 |
| 611 | 3300046692 | Ga0495671_0008724 | Ga0495671_0008724_1304_1789 | 155 |
| 612 | 3300046692 | Ga0495671_0095564 | Ga0495671_0095564_529_1014 | 155 |
| 613 | 3300046692 | Ga0495671_0104635 | Ga0495671_0104635_627_1118 | 155 |
| 614 | 3300046692 | Ga0495671_0173720 | Ga0495671_0173720_19_507 | 155 |
| 615 | 3300046694 | Ga0495649_0022229 | Ga0495649_0022229_618_1103 | 155 |
| 616 | 3300046694 | Ga0495649_0378465 | Ga0495649_0378465_20_508 | 155 |
| 617 | 3300046794 | Ga0495589_0001579 | Ga0495589_0001579_59_547 | 155 |
| 618 | 3300046794 | Ga0495589_0035849 | Ga0495589_0035849_1895_2377 | 155 |
| 619 | 3300046794 | Ga0495589_0091701 | Ga0495589_0091701_123_608 | 155 |
| 620 | 3300046794 | Ga0495589_0109077 | Ga0495589_0109077_808_1302 | 155 |
| 621 | 3300046809 | Ga0495600_0003072 | Ga0495600_0003072_2802_3284 | 155 |
| 622 | 3300046809 | Ga0495600_0143717 | Ga0495600_0143717_885_1373 | 155 |
| 623 | 3300046809 | Ga0495600_0162653 | Ga0495600_0162653_21_506 | 155 |
| 624 | 3300046809 | Ga0495600_0302208 | Ga0495600_0302208_70_558 | 155 |
| 625 | 3300046809 | Ga0495600_0628982 | Ga0495600_0628982_30_614 | 155 |
| 626 | 3300046810 | Ga0495660_0198131 | Ga0495660_0198131_107_595 | 155 |
| 627 | 3300047315 | Ga0495581_0017936 | Ga0495581_0017936_1473_1958 | 155 |
| 628 | 3300047315 | Ga0495581_0037365 | Ga0495581_0037365_2253_2741 | 155 |
| 629 | 3300047315 | Ga0495581_0041107 | Ga0495581_0041107_1521_2006 | 155 |
| 630 | 3300047315 | Ga0495581_0109941 | Ga0495581_0109941_308_796 | 155 |
| 631 | 3300047315 | Ga0495581_0174347 | Ga0495581_0174347_695_1186 | 155 |
| 632 | 3300047315 | Ga0495581_0190859 | Ga0495581_0190859_687_1181 | 155 |
| 633 | 3300047315 | Ga0495581_0192963 | Ga0495581_0192963_392_886 | 155 |
| 634 | 3300047317 | Ga0495604_0001544 | Ga0495604_0001544_6546_7031 | 155 |
| 635 | 3300047317 | Ga0495604_0002658 | Ga0495604_0002658_9045_9530 | 155 |
| 636 | 3300047317 | Ga0495604_0006701 | Ga0495604_0006701_6093_6581 | 155 |
| 637 | 3300047317 | Ga0495604_0008240 | Ga0495604_0008240_2405_2890 | 155 |
| 638 | 3300047317 | Ga0495604_0095678 | Ga0495604_0095678_1682_2170 | 155 |
| 639 | 3300047317 | Ga0495604_0103562 | Ga0495604_0103562_757_1245 | 155 |
| 640 | 3300047317 | Ga0495604_0130910 | Ga0495604_0130910_1230_1718 | 155 |
| 641 | 3300047317 | Ga0495604_0483254 | Ga0495604_0483254_151_633 | 155 |
| 642 | 3300047318 | Ga0495636_0015287 | Ga0495636_0015287_97_582 | 155 |
| 643 | 3300047318 | Ga0495636_0065064 | Ga0495636_0065064_233_718 | 155 |
| 644 | 3300047318 | Ga0495636_0097440 | Ga0495636_0097440_73_561 | 155 |
| 645 | 3300047318 | Ga0495636_0425013 | Ga0495636_0425013_80_568 | 155 |
| 646 | 3300047319 | Ga0495674_0073300 | Ga0495674_0073300_1602_2087 | 155 |
| 647 | 3300047320 | Ga0495672_0418907 | Ga0495672_0418907_61_549 | 155 |
| 648 | 3300047321 | Ga0495676_0004653 | Ga0495676_0004653_2031_2519 | 155 |
| 649 | 3300047321 | Ga0495676_0005038 | Ga0495676_0005038_707_1195 | 155 |
| 650 | 3300047321 | Ga0495676_0010943 | Ga0495676_0010943_2327_2812 | 155 |
| 651 | 3300047321 | Ga0495676_0016651 | Ga0495676_0016651_1815_2303 | 155 |
| 652 | 3300047321 | Ga0495676_0129550 | Ga0495676_0129550_504_992 | 155 |
| 653 | 3300047321 | Ga0495676_0510078 | Ga0495676_0510078_210_692 | 155 |
| 654 | 3300047322 | Ga0495680_0169626 | Ga0495680_0169626_541_1029 | 155 |
| 655 | 3300047323 | Ga0495683_0063116 | Ga0495683_0063116_76_561 | 155 |
| 656 | 3300047323 | Ga0495683_0149261 | Ga0495683_0149261_260_748 | 155 |
| 657 | 3300047443 | Ga0495687_003543 | Ga0495687_003543_2005_2490 | 155 |
| 658 | 3300047443 | Ga0495687_006208 | Ga0495687_006208_6841_7326 | 155 |
| 659 | 3300047443 | Ga0495687_055720 | Ga0495687_055720_276_767 | 155 |
| 660 | 3300047444 | Ga0495675_0020228 | Ga0495675_0020228_2235_2720 | 155 |
| 661 | 3300047444 | Ga0495675_0022281 | Ga0495675_0022281_285_773 | 155 |
| 662 | 3300047444 | Ga0495675_0029780 | Ga0495675_0029780_2444_2929 | 155 |
| 663 | 3300047444 | Ga0495675_0052064 | Ga0495675_0052064_1966_2451 | 155 |
| 664 | 3300047444 | Ga0495675_0076561 | Ga0495675_0076561_936_1424 | 155 |
| 665 | 3300047444 | Ga0495675_0156950 | Ga0495675_0156950_891_1379 | 155 |
| 666 | 3300047444 | Ga0495675_0249975 | Ga0495675_0249975_105_593 | 155 |
| 667 | 3300047444 | Ga0495675_0565220 | Ga0495675_0565220_139_624 | 155 |
| 668 | 3300047447 | Ga0495685_005480 | Ga0495685_005480_1153_1644 | 155 |
| 669 | 3300047447 | Ga0495685_017229 | Ga0495685_017229_1683_2168 | 155 |
| 670 | 3300047447 | Ga0495685_020765 | Ga0495685_020765_188_682 | 155 |
| 671 | 3300047447 | Ga0495685_038200 | Ga0495685_038200_1136_1624 | 155 |
| 672 | 3300047447 | Ga0495685_043185 | Ga0495685_043185_18_506 | 155 |
| 673 | 3300047470 | Ga0495681_0004834 | Ga0495681_0004834_5874_6359 | 155 |
| 674 | 3300047470 | Ga0495681_0020908 | Ga0495681_0020908_2810_3301 | 155 |
| 675 | 3300047471 | Ga0495684_0140251 | Ga0495684_0140251_326_811 | 155 |
| 676 | 3300047472 | Ga0495686_0036838 | Ga0495686_0036838_602_1093 | 155 |
| 677 | 3300047673 | Ga0495593_0020472 | Ga0495593_0020472_2574_3059 | 155 |
| 678 | 3300047673 | Ga0495593_0057431 | Ga0495593_0057431_425_910 | 155 |
| 679 | 3300047673 | Ga0495593_0175221 | Ga0495593_0175221_279_767 | 155 |
| 680 | 3300047673 | Ga0495593_0188085 | Ga0495593_0188085_522_1010 | 155 |
| 681 | 3300048088 | Ga0495602_0004329 | Ga0495602_0004329_11112_11597 | 155 |
| 682 | 3300048088 | Ga0495602_0157623 | Ga0495602_0157623_1067_1555 | 155 |
| 683 | 3300048088 | Ga0495602_0204795 | Ga0495602_0204795_225_710 | 155 |
| 684 | 3300048089 | Ga0495614_0022740 | Ga0495614_0022740_1359_1844 | 155 |
| 685 | 3300048089 | Ga0495614_0033987 | Ga0495614_0033987_479_967 | 155 |
| 686 | 3300048089 | Ga0495614_0056536 | Ga0495614_0056536_450_932 | 155 |
| 687 | 3300048091 | Ga0495626_0025073 | Ga0495626_0025073_1482_1970 | 155 |
| 688 | 3300048091 | Ga0495626_0310079 | Ga0495626_0310079_100_591 | 155 |
| 689 | 3300048907 | Ga0496104_0260008 | Ga0496104_0260008_1010_1498 | 155 |
| 690 | 3300048908 | Ga0496105_1235970 | Ga0496105_1235970_16_510 | 155 |
| 691 | 3300048911 | Ga0496108_0053272 | Ga0496108_0053272_119_607 | 155 |
| 692 | 3300048914 | Ga0496111_1085344 | Ga0496111_1085344_76_543 | 155 |
| 693 | 3300048916 | Ga0496113_0462902 | Ga0496113_0462902_524_991 | 155 |
| 694 | 3300049459 | Ga0495678_107839 | Ga0495678_107839_448_936 | 155 |
| 695 | 3300049539 | Ga0501323_043062 | Ga0501323_043062_97_582 | 155 |
| 696 | 3300049568 | Ga0501031_0011192 | Ga0501031_0011192_5298_5786 | 155 |
| 697 | 3300049568 | Ga0501031_0029774 | Ga0501031_0029774_1151_1639 | 155 |
| 698 | 3300049568 | Ga0501031_0063701 | Ga0501031_0063701_1784_2269 | 155 |
| 699 | 3300049568 | Ga0501031_0700510 | Ga0501031_0700510_83_571 | 155 |
| 700 | 3300049569 | Ga0501032_0003050 | Ga0501032_0003050_165_653 | 155 |
| 701 | 3300049569 | Ga0501032_0017046 | Ga0501032_0017046_3970_4458 | 155 |
| 702 | 3300049569 | Ga0501032_0023051 | Ga0501032_0023051_75_563 | 155 |
| 703 | 3300049569 | Ga0501032_0141625 | Ga0501032_0141625_1003_1494 | 155 |
| 704 | 3300049569 | Ga0501032_0312514 | Ga0501032_0312514_405_893 | 155 |
| 705 | 3300049570 | Ga0501033_0009749 | Ga0501033_0009749_3160_3645 | 155 |
| 706 | 3300049570 | Ga0501033_0022267 | Ga0501033_0022267_1115_1603 | 155 |
| 707 | 3300049570 | Ga0501033_0041517 | Ga0501033_0041517_1991_2479 | 155 |
| 708 | 3300049570 | Ga0501033_0044508 | Ga0501033_0044508_90_575 | 155 |
| 709 | 3300049570 | Ga0501033_0067663 | Ga0501033_0067663_773_1261 | 155 |
| 710 | 3300049570 | Ga0501033_0069497 | Ga0501033_0069497_975_1466 | 155 |
| 711 | 3300049570 | Ga0501033_0302497 | Ga0501033_0302497_47_535 | 155 |
| 712 | 3300049571 | Ga0501034_0003189 | Ga0501034_0003189_175_660 | 155 |
| 713 | 3300049571 | Ga0501034_0011990 | Ga0501034_0011990_8179_8664 | 155 |
| 714 | 3300049571 | Ga0501034_0028508 | Ga0501034_0028508_5134_5622 | 155 |
| 715 | 3300049571 | Ga0501034_0029497 | Ga0501034_0029497_3981_4469 | 155 |
| 716 | 3300049571 | Ga0501034_0082761 | Ga0501034_0082761_2570_3055 | 155 |
| 717 | 3300049571 | Ga0501034_0126182 | Ga0501034_0126182_796_1287 | 155 |
| 718 | 3300049571 | Ga0501034_0166411 | Ga0501034_0166411_960_1448 | 155 |
| 719 | 3300049571 | Ga0501034_0591604 | Ga0501034_0591604_361_849 | 155 |
| 720 | 3300049572 | Ga0501036_0004155 | Ga0501036_0004155_3824_4309 | 155 |
| 721 | 3300049572 | Ga0501036_0005036 | Ga0501036_0005036_9689_10174 | 155 |
| 722 | 3300049572 | Ga0501036_0010604 | Ga0501036_0010604_3456_3944 | 155 |
| 723 | 3300049572 | Ga0501036_0025455 | Ga0501036_0025455_4443_4931 | 155 |
| 724 | 3300049572 | Ga0501036_0035885 | Ga0501036_0035885_3579_4067 | 155 |
| 725 | 3300049572 | Ga0501036_0177362 | Ga0501036_0177362_136_624 | 155 |
| 726 | 3300049572 | Ga0501036_0267770 | Ga0501036_0267770_755_1243 | 155 |
| 727 | 3300049573 | Ga0501037_0000644 | Ga0501037_0000644_26330_26818 | 155 |
| 728 | 3300049573 | Ga0501037_0042196 | Ga0501037_0042196_2710_3195 | 155 |
| 729 | 3300049573 | Ga0501037_0056596 | Ga0501037_0056596_838_1326 | 155 |
| 730 | 3300049573 | Ga0501037_0078706 | Ga0501037_0078706_851_1339 | 155 |
| 731 | 3300049573 | Ga0501037_0664753 | Ga0501037_0664753_81_572 | 155 |
| 732 | 3300049574 | Ga0501038_0001482 | Ga0501038_0001482_13232_13720 | 155 |
| 733 | 3300049574 | Ga0501038_0013836 | Ga0501038_0013836_108_593 | 155 |
| 734 | 3300049574 | Ga0501038_0078854 | Ga0501038_0078854_1223_1711 | 155 |
| 735 | 3300049574 | Ga0501038_0326465 | Ga0501038_0326465_697_1182 | 155 |
| 736 | 3300049574 | Ga0501038_0707311 | Ga0501038_0707311_247_735 | 155 |
| 737 | 3300049574 | Ga0501038_0938209 | Ga0501038_0938209_89_577 | 155 |
| 738 | 3300049575 | Ga0501039_0026796 | Ga0501039_0026796_3777_4265 | 155 |
| 739 | 3300049575 | Ga0501039_0036312 | Ga0501039_0036312_3287_3775 | 155 |
| 740 | 3300049575 | Ga0501039_0054450 | Ga0501039_0054450_270_758 | 155 |
| 741 | 3300049575 | Ga0501039_0150948 | Ga0501039_0150948_1236_1721 | 155 |
| 742 | 3300049575 | Ga0501039_1012596 | Ga0501039_1012596_62_547 | 155 |
| 743 | 3300049577 | Ga0501041_0003388 | Ga0501041_0003388_403_891 | 155 |
| 744 | 3300049578 | Ga0501042_0033787 | Ga0501042_0033787_3020_3508 | 155 |
| 745 | 3300049578 | Ga0501042_0036871 | Ga0501042_0036871_1442_1930 | 155 |
| 746 | 3300049579 | Ga0501043_0012717 | Ga0501043_0012717_5226_5714 | 155 |
| 747 | 3300049579 | Ga0501043_0017130 | Ga0501043_0017130_5134_5622 | 155 |
| 748 | 3300049579 | Ga0501043_0018811 | Ga0501043_0018811_1885_2370 | 155 |
| 749 | 3300049579 | Ga0501043_0044121 | Ga0501043_0044121_2142_2633 | 155 |
| 750 | 3300049579 | Ga0501043_0052803 | Ga0501043_0052803_510_998 | 155 |
| 751 | 3300049579 | Ga0501043_0095141 | Ga0501043_0095141_854_1342 | 155 |
| 752 | 3300049579 | Ga0501043_0108234 | Ga0501043_0108234_139_624 | 155 |
| 753 | 3300049579 | Ga0501043_0153098 | Ga0501043_0153098_1021_1506 | 155 |
| 754 | 3300049580 | Ga0501046_0037593 | Ga0501046_0037593_61_549 | 155 |
| 755 | 3300049580 | Ga0501046_0174741 | Ga0501046_0174741_93_578 | 155 |
| 756 | 3300049581 | Ga0501047_0000025 | Ga0501047_0000025_66820_67308 | 155 |
| 757 | 3300049581 | Ga0501047_0000084 | Ga0501047_0000084_105412_105927 | 155 |
| 758 | 3300049581 | Ga0501047_0001101 | Ga0501047_0001101_26324_26812 | 155 |
| 759 | 3300049581 | Ga0501047_0019088 | Ga0501047_0019088_3814_4302 | 155 |
| 760 | 3300049581 | Ga0501047_0044875 | Ga0501047_0044875_2434_2922 | 155 |
| 761 | 3300049581 | Ga0501047_0075142 | Ga0501047_0075142_175_663 | 155 |
| 762 | 3300049581 | Ga0501047_0114311 | Ga0501047_0114311_354_839 | 155 |
| 763 | 3300049581 | Ga0501047_0140125 | Ga0501047_0140125_1207_1698 | 155 |
| 764 | 3300049581 | Ga0501047_0484364 | Ga0501047_0484364_276_761 | 155 |
| 765 | 3300049581 | Ga0501047_0518446 | Ga0501047_0518446_291_776 | 155 |
| 766 | 3300049581 | Ga0501047_0899853 | Ga0501047_0899853_152_640 | 155 |
| 767 | 3300049582 | Ga0501048_0019385 | Ga0501048_0019385_4443_4931 | 155 |
| 768 | 3300049582 | Ga0501048_0023824 | Ga0501048_0023824_107_592 | 155 |
| 769 | 3300049583 | Ga0501067_0006058 | Ga0501067_0006058_3210_3698 | 155 |
| 770 | 3300049583 | Ga0501067_0304829 | Ga0501067_0304829_269_757 | 155 |
| 771 | 3300049584 | Ga0501068_0009848 | Ga0501068_0009848_4682_5170 | 155 |
| 772 | 3300049584 | Ga0501068_0042882 | Ga0501068_0042882_1778_2263 | 155 |
| 773 | 3300049585 | Ga0501069_0008664 | Ga0501069_0008664_1070_1558 | 155 |
| 774 | 3300049585 | Ga0501069_0202091 | Ga0501069_0202091_84_572 | 155 |
| 775 | 3300049586 | Ga0501070_0003688 | Ga0501070_0003688_4018_4503 | 155 |
| 776 | 3300049586 | Ga0501070_0058067 | Ga0501070_0058067_987_1475 | 155 |
| 777 | 3300049586 | Ga0501070_0137328 | Ga0501070_0137328_82_570 | 155 |
| 778 | 3300049586 | Ga0501070_0209834 | Ga0501070_0209834_753_1244 | 155 |
| 779 | 3300049586 | Ga0501070_0442447 | Ga0501070_0442447_441_929 | 155 |
| 780 | 3300049586 | Ga0501070_1049262 | Ga0501070_1049262_19_507 | 155 |
| 781 | 3300049587 | Ga0501071_0000759 | Ga0501071_0000759_9893_10381 | 155 |
| 782 | 3300049588 | Ga0501072_0004361 | Ga0501072_0004361_9760_10248 | 155 |
| 783 | 3300049588 | Ga0501072_1011734 | Ga0501072_1011734_137_625 | 155 |
| 784 | 3300049589 | Ga0501073_0044192 | Ga0501073_0044192_2121_2609 | 155 |
| 785 | 3300049589 | Ga0501073_0173247 | Ga0501073_0173247_624_1112 | 155 |
| 786 | 3300049590 | Ga0501074_0002291 | Ga0501074_0002291_9772_10257 | 155 |
| 787 | 3300049590 | Ga0501074_0066303 | Ga0501074_0066303_1925_2413 | 155 |
| 788 | 3300049592 | Ga0501076_0009593 | Ga0501076_0009593_1229_1717 | 155 |
| 789 | 3300049593 | Ga0501077_0013524 | Ga0501077_0013524_3686_4174 | 155 |
| 790 | 3300049663 | Ga0501223_058837 | Ga0501223_058837_61_546 | 155 |
| 791 | 3300049669 | Ga0501235_028837 | Ga0501235_028837_76_561 | 155 |
| 792 | 3300049742 | Ga0501080_0030534 | Ga0501080_0030534_780_1268 | 155 |
| 793 | 3300049744 | Ga0501083_0014645 | Ga0501083_0014645_3536_4024 | 155 |
| 794 | 3300049822 | Ga0501035_0007013 | Ga0501035_0007013_6704_7189 | 155 |
| 795 | 3300049822 | Ga0501035_0022321 | Ga0501035_0022321_3274_3762 | 155 |
| 796 | 3300049822 | Ga0501035_0040956 | Ga0501035_0040956_2680_3165 | 155 |
| 797 | 3300049822 | Ga0501035_0080509 | Ga0501035_0080509_2328_2816 | 155 |
| 798 | 3300049822 | Ga0501035_0173536 | Ga0501035_0173536_809_1297 | 155 |
| 799 | 3300049822 | Ga0501035_0224064 | Ga0501035_0224064_997_1485 | 155 |
| 800 | 3300049822 | Ga0501035_0802890 | Ga0501035_0802890_217_705 | 155 |
| 801 | 3300049823 | Ga0501044_0019610 | Ga0501044_0019610_799_1287 | 155 |
| 802 | 3300049823 | Ga0501044_0025758 | Ga0501044_0025758_286_771 | 155 |
| 803 | 3300049823 | Ga0501044_0046168 | Ga0501044_0046168_2400_2885 | 155 |
| 804 | 3300049823 | Ga0501044_0046661 | Ga0501044_0046661_876_1367 | 155 |
| 805 | 3300049823 | Ga0501044_0052883 | Ga0501044_0052883_2505_2993 | 155 |
| 806 | 3300049823 | Ga0501044_0062712 | Ga0501044_0062712_3251_3739 | 155 |
| 807 | 3300049823 | Ga0501044_0245699 | Ga0501044_0245699_994_1482 | 155 |
| 808 | 3300049823 | Ga0501044_0265864 | Ga0501044_0265864_1032_1517 | 155 |
| 809 | 3300049823 | Ga0501044_0779036 | Ga0501044_0779036_334_810 | 155 |
| 810 | 3300049823 | Ga0501044_0912929 | Ga0501044_0912929_86_574 | 155 |
| 811 | 3300049823 | Ga0501044_1080562 | Ga0501044_1080562_168_656 | 155 |
| 812 | 3300049824 | Ga0501045_0077517 | Ga0501045_0077517_1840_2328 | 155 |
| 813 | 3300049824 | Ga0501045_0209060 | Ga0501045_0209060_430_918 | 155 |
| 814 | 3300049824 | Ga0501045_0269191 | Ga0501045_0269191_692_1180 | 155 |
| 815 | 3300049824 | Ga0501045_0371228 | Ga0501045_0371228_93_584 | 155 |
| 816 | 3300050490 | nmdc:mga03n38_20804_c1 | nmdc:mga03n38_20804_c1_1800_2288 | 155 |
| 817 | 3300050494 | nmdc:mga06z11_208166_c1 | nmdc:mga06z11_208166_c1_138_626 | 155 |
| 818 | 3300050495 | nmdc:mga04h51_32266_c1 | nmdc:mga04h51_32266_c1_1127_1615 | 155 |
| 819 | 3300050496 | nmdc:mga07m45_186073_c1 | nmdc:mga07m45_186073_c1_677_1165 | 155 |
| 820 | 3300050507 | nmdc:mga05p37_1096738_c1 | nmdc:mga05p37_1096738_c1_28_495 | 155 |
| 821 | 3300053077 | Ga0495601_0033677 | Ga0495601_0033677_1109_1582 | 155 |
| 822 | 3300053078 | Ga0495612_0416590 | Ga0495612_0416590_57_530 | 155 |
| 823 | 3300053079 | Ga0500610_0031224 | Ga0500610_0031224_1616_2101 | 155 |
| 824 | 3300053083 | Ga0495655_0004158 | Ga0495655_0004158_1626_2117 | 155 |
| 825 | 3300053085 | Ga0495619_0128099 | Ga0495619_0128099_717_1202 | 155 |
| 826 | 3300053085 | Ga0495619_0214026 | Ga0495619_0214026_273_740 | 155 |
| 827 | 3300053085 | Ga0495619_0243872 | Ga0495619_0243872_328_819 | 155 |
| 828 | 3300053085 | Ga0495619_0520271 | Ga0495619_0520271_201_686 | 155 |
| 829 | 3300053086 | Ga0500578_0009710 | Ga0500578_0009710_4093_4584 | 155 |
| 830 | 3300053086 | Ga0500578_0072990 | Ga0500578_0072990_296_784 | 155 |
| 831 | 3300053088 | Ga0500644_0070789 | Ga0500644_0070789_104_589 | 155 |
| 832 | 3300053090 | Ga0500646_0021663 | Ga0500646_0021663_734_1225 | 155 |
| 833 | 3300053094 | Ga0500566_0155992 | Ga0500566_0155992_431_922 | 155 |
| 834 | 3300053095 | Ga0500640_033131 | Ga0500640_033131_1303_1788 | 155 |
| 835 | 3300053096 | Ga0500641_0023300 | Ga0500641_0023300_1809_2297 | 155 |
| 836 | 3300053099 | Ga0500654_108906 | Ga0500654_108906_184_675 | 155 |
| 837 | 3300053100 | Ga0500660_069730 | Ga0500660_069730_718_1209 | 155 |
| 838 | 3300053101 | Ga0500553_142862 | Ga0500553_142862_13_498 | 155 |
| 839 | 3300053107 | Ga0500560_006362 | Ga0500560_006362_1301_1786 | 155 |
| 840 | 3300053109 | Ga0500569_013156 | Ga0500569_013156_1289_1780 | 155 |
| 841 | 3300053131 | Ga0500652_073838 | Ga0500652_073838_238_729 | 155 |
| 842 | 3300053134 | Ga0500658_0028250 | Ga0500658_0028250_1073_1564 | 155 |
| 843 | 3300053136 | Ga0500559_0218339 | Ga0500559_0218339_350_823 | 155 |
| 844 | 3300053137 | Ga0500561_0009085 | Ga0500561_0009085_755_1246 | 155 |
| 845 | 3300053140 | Ga0500573_0058933 | Ga0500573_0058933_1498_1983 | 155 |
| 846 | 3300053140 | Ga0500573_0073692 | Ga0500573_0073692_321_806 | 155 |
| 847 | 3300053140 | Ga0500573_0098584 | Ga0500573_0098584_383_868 | 155 |
| 848 | 3300053140 | Ga0500573_0393437 | Ga0500573_0393437_73_561 | 155 |
| 849 | 3300053143 | Ga0500579_017070 | Ga0500579_017070_687_1178 | 155 |
| 850 | 3300053146 | Ga0500588_0310319 | Ga0500588_0310319_63_554 | 155 |
| 851 | 3300053149 | Ga0500600_0009525 | Ga0500600_0009525_2743_3234 | 155 |
| 852 | 3300053149 | Ga0500600_0196664 | Ga0500600_0196664_374_859 | 155 |
| 853 | 3300053153 | Ga0500616_0052585 | Ga0500616_0052585_111_602 | 155 |
| 854 | 3300053160 | Ga0500633_0005923 | Ga0500633_0005923_749_1240 | 155 |
| 855 | 3300053161 | Ga0500634_0000949 | Ga0500634_0000949_1407_1898 | 155 |
| 856 | 3300053732 | Ga0500656_001651 | Ga0500656_001651_831_1322 | 155 |
| 857 | 3300053739 | Ga0500587_004984 | Ga0500587_004984_956_1447 | 155 |
| 858 | 3300054114 | Ga0501084_0012357 | Ga0501084_0012357_5296_5784 | 155 |
| 859 | 3300060353 | Ga0501082_0005799 | Ga0501082_0005799_4674_5162 | 155 |
| 860 | 3300061719 | Ga0466962_0004456 | Ga0466962_0004456_4448_4933 | 155 |
| 861 | 3300061719 | Ga0466962_0030053 | Ga0466962_0030053_340_825 | 155 |
| 862 | 3300061719 | Ga0466962_0048655 | Ga0466962_0048655_466_954 | 155 |
| 863 | 3300061719 | Ga0466962_0075601 | Ga0466962_0075601_762_1244 | 155 |
| 864 | 3300061734 | Ga0530510_0033810 | Ga0530510_0033810_2476_2964 | 155 |
| 865 | iso_pu_bacteria | 8002784119 | 8002786289 | 155 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2bes-assembly2.cif.gz_C | structure of mycobacterium tuberculosis ribose-5-phosphate isomerase, rpib, rv2465c, in complex with 4-phospho-d-erythronohydroxamic acid. | 0.9848 | 1 | 155 |
| 2bes-assembly2.cif.gz_C | structure of mycobacterium tuberculosis ribose-5-phosphate isomerase, rpib, rv2465c, in complex with 4-phospho-d-erythronohydroxamic acid. | 0.9786 | 1 | 155 |
| 6mu0-assembly1.cif.gz_A | crystal structure of ribose-5-phosphate isomerase b from mycoplasma genitalium with bound ribulose-5-phosphate | 0.9686 | 2 | 148 |
| 4em8-assembly1.cif.gz_B | the structure of ribose 5-phosphate isomerase b from anaplasma phagocytophilum | 0.9645 | 2 | 142 |
| 1nn4-assembly1.cif.gz_A | structural genomics, rpib/alsb | 0.9639 | 2 | 146 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKD7_1_162_3.40.1400.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.986 | 1 | 155 | 3.40.1400.10 |
| af_P9WKD7_1_162_3.40.1400.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9797 | 1 | 155 | 3.40.1400.10 |
| 6mu0A00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9682 | 2 | 148 | 3.40.1400.10 |
| 4em8B00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9645 | 2 | 142 | 3.40.1400.10 |
| 1nn4D00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9605 | 2 | 147 | 3.40.1400.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0N0AP15-F1-model_v4 | Ribose-5-phosphate isomerase B (EC 5.3.1.6) (Phosphoriboisomerase B) | 1.001 | 1 | 155 |
GO:0004751
GO:0009052 GO:0019316 |
| AF-A0A6G2QD59-F1-model_v4 | Ribose-5-phosphate isomerase B (EC 5.3.1.6) (Phosphoriboisomerase B) | 0.9998 | 1 | 120 |
GO:0004751
GO:0009052 GO:0019316 |
| AF-A0A1C4Q6M6-F1-model_v4 | DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18) | 0.9996 | 1 | 155 |
GO:0000703
GO:0003684 GO:0005975 GO:0006284 GO:0008270 GO:0016861 GO:0140078 |
| AF-A0A1H6DPR8-F1-model_v4 | Ribose-5-phosphate isomerase B (EC 5.3.1.6) (Phosphoriboisomerase B) | 0.9992 | 1 | 155 |
GO:0004751
GO:0009052 GO:0019316 |
| AF-A0A4R9E0A7-F1-model_v4 | deleted | 0.9988 | 1 | 155 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar