F483996

General Info

Members Datasets Scaffolds Average Seq Length
865 460 751 160

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10685783|Ga0207683_106857832
Length 176
Sequence MRVHIGSDHAGLELKDHLLNWLADHGHEVVDHGPFVYDAADDYPVFCLRAAEGVAADWQDGQESLGVVVGGSGNGEQISANKVKGVRAVLAWSEETARLGREHNNANVISVGGRMHALEDMVSFVAEFLSTPFSGDPRHARRIEMLGDYEKTGNLPPLPDSAIGRQPGGPGHPGDA

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2517572101 Frankia sp. DC12 Isolate Nodule
3 2527291627 Frankia casuarinae Thr Isolate Nodule
4 2527291629 Frankia sp. BMG5.23 Isolate Nodule
5 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
6 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
7 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
8 2576861822 Frankia sp. CeD Isolate Nodule
9 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
10 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
11 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
12 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
13 2619618881 Frankia sp. ACN1ag Isolate Unclassified
14 2619619003 Frankia sp. CpI1-P Isolate Nodule
15 2626541554 Frankia sp. AvcI.1 Isolate Nodule
16 2643221548 Streptomyces sp. Root55 Isolate Unclassified
17 2643221578 Streptomyces sp. Root63 Isolate Unclassified
18 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
19 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
20 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
21 2643221647 Streptomyces sp. Root369 Isolate Unclassified
22 2643221670 Streptomyces sp. Root431 Isolate Unclassified
23 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
24 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
25 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
26 2643221714 Streptomyces sp. Root264 Isolate Unclassified
27 2671180195 Frankia sp. CcI49 Isolate Nodule
28 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
29 2684623036 Frankia sp. CgIM4 Isolate Nodule
30 2687453737 Frankia sp. BMG5.36 Isolate Nodule
31 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
32 2710264753 Frankia sp. KB5 Isolate Nodule
33 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
34 2773857922 Frankia sp. CcI49 Isolate Nodule
35 2773857924 Frankia sp. CgIS1 Isolate Nodule
36 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
37 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
38 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
39 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
40 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
41 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
42 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
43 2808606448 Streptomyces sp. 193411 Isolate Unclassified
44 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
45 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
46 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
47 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
48 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
49 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
50 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
51 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
52 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
53 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
54 2862574272 Streptomyces sp. AcE210 Isolate Nodule
55 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
56 2867428634 Streptomyces sp. RP5T Isolate Unclassified
57 2867475112 Streptomyces sp. TM32 Isolate Unclassified
58 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
59 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
60 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
61 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
62 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
63 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
64 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
65 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
66 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
67 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
68 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
69 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
70 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
71 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
72 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
73 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
74 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
75 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
76 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
77 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
78 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
79 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
80 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
81 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
82 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
83 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
84 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
85 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
86 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
87 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
88 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
89 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
90 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
91 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
92 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
93 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
94 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
95 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
96 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
97 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
98 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
99 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
100 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
101 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
102 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
103 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
104 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
105 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
106 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
107 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
108 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
109 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
110 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
111 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
112 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
113 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
114 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
115 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
116 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
117 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
118 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
119 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
120 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
121 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
122 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
123 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
124 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
125 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
126 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
127 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
128 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
129 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
130 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
131 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
132 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
133 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
134 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
135 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
136 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
137 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
138 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
139 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
140 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
141 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
142 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
143 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
144 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
145 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
147 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
148 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
149 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
150 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
151 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
152 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
153 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
154 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
157 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
158 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
159 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
160 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
161 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
162 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
163 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
164 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
165 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
167 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
205 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
206 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
207 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
208 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
209 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
210 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
211 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
212 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
213 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
214 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
215 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
216 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
217 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
218 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
219 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
223 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
226 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
227 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
228 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
235 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
236 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
237 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
238 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
239 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
240 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
241 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
242 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
243 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
244 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
245 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
246 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
247 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
248 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
249 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
250 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
251 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
252 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
253 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
254 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
255 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
256 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
257 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
258 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
259 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
260 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
263 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
264 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
265 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
266 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
267 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
268 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
269 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
270 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
271 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
272 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
275 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
276 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
277 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
278 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
279 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
280 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
281 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
282 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
283 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
284 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
285 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
286 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
287 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
288 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
291 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
292 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
293 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
297 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
298 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
299 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
300 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
301 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
302 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
303 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
304 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
305 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
306 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
307 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
308 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
309 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
310 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
311 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
312 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
313 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
314 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
315 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
316 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
317 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
318 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
319 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
320 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
321 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
322 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
323 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
324 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
325 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
326 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
327 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
328 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
329 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
330 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
331 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
332 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
333 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
334 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
335 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
336 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
337 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
338 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
339 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
340 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
341 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
342 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
343 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
344 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
345 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
346 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
347 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
348 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
349 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
350 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
351 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
352 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
353 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
354 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
355 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
356 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
357 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
358 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
359 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
360 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
361 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
362 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
363 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
364 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
365 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
366 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
382 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
383 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
384 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
385 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
386 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
387 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
388 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
389 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
390 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
391 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
392 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
393 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
394 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
395 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
398 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
399 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
400 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
401 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
402 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
403 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
404 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
405 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
406 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
407 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
408 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
409 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
410 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
411 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
412 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
413 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
414 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
415 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
416 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
417 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
418 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
419 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
420 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
421 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
422 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
423 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
424 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
425 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
426 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
427 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
428 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
429 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
430 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
431 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
432 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
433 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
434 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
435 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
436 637000116 Frankia casuarinae CcI3 Isolate Nodule
437 8002775197 Frankia nepalensis CN7 Isolate Nodule
438 8002784119 Frankia sp. AgB1.9 Isolate Nodule
439 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
440 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
441 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
442 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
443 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
444 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
445 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
446 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
447 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
448 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
449 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
450 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
451 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
452 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
453 8054920844 Frankia tisae Agncl-8 Isolate Nodule
454 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
455 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
456 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
457 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
458 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
459 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
460 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.36
Metatranscriptomes 0.46
Isolates 13.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.97
Nodule 2.43
Rhizoplane 2.43
Rhizosphere 80.69
Stem 0
Stem Tuber 0
Unclassified 9.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10068568 3300001979 Bacteria 956
2 JGI24739J22299_10022301 3300001989 Bacteria 2246
3 JGI24739J22299_10182026 3300001989 Bacteria 618
4 JGI24737J22298_10008180 3300001990 Bacteria 3512
5 JGI24735J21928_10188688 3300002067 Bacteria 597
6 rootH2_10171867 3300003320 Bacteria 1388
7 rootH1_10027836 3300003323 Bacteria 1598
8 JGI25160J50197_1020109 3300003354 Bacteria 2026
9 Ga0006562J51391_1094426 3300003578 Bacteria 2695
10 Ga0006562J51391_1109822 3300003578 Bacteria 754
11 Ga0058692_1048845 3300003856 Bacteria 708
12 Ga0070683_100262476 3300005329 Bacteria 1643
13 Ga0070683_100366079 3300005329 Bacteria 1373
14 Ga0068869_101124483 3300005334 Bacteria 688
15 Ga0070666_10003675 3300005335 Bacteria 9296
16 Ga0070661_100766311 3300005344 Bacteria 790
17 Ga0070668_100405861 3300005347 Bacteria 1164
18 Ga0070668_100829628 3300005347 Bacteria 823
19 Ga0070675_101085642 3300005354 Bacteria 736
20 Ga0070671_100241920 3300005355 Bacteria 1532
21 Ga0070659_100859924 3300005366 Bacteria 791
22 Ga0070667_100018295 3300005367 Bacteria 5809
23 Ga0070713_100895120 3300005436 Bacteria 853
24 Ga0070710_10214923 3300005437 Bacteria 1220
25 Ga0070711_100884605 3300005439 Bacteria 761
26 Ga0070708_100059206 3300005445 Bacteria 3414
27 Ga0070663_100024525 3300005455 Bacteria 4062
28 Ga0070663_100141730 3300005455 Bacteria 1836
29 Ga0070706_101168259 3300005467 Bacteria 708
30 Ga0070707_101067006 3300005468 Bacteria 773
31 Ga0070698_100143021 3300005471 Bacteria 2342
32 Ga0068853_100111278 3300005539 Bacteria 2433
33 Ga0068853_100588571 3300005539 Bacteria 1056
34 Ga0070686_100465872 3300005544 Bacteria 974
35 Ga0070665_100025085 3300005548 Bacteria 6009
36 Ga0070665_100030936 3300005548 Bacteria 5387
37 Ga0070665_100103226 3300005548 Bacteria 2854
38 Ga0070665_100993081 3300005548 Bacteria 852
39 Ga0068855_100002515 3300005563 Bacteria 22580
40 Ga0070664_100739406 3300005564 Bacteria 918
41 Ga0068857_100018695 3300005577 Bacteria 6083
42 Ga0068854_100004644 3300005578 Bacteria 8668
43 Ga0068856_100037419 3300005614 Bacteria 4762
44 Ga0068856_100076400 3300005614 Bacteria 3319
45 Ga0068856_100342594 3300005614 Bacteria 1513
46 Ga0068856_100442064 3300005614 Bacteria 1321
47 Ga0068856_100832558 3300005614 Bacteria 942
48 Ga0068856_101565129 3300005614 Bacteria 673
49 Ga0068852_100040818 3300005616 Bacteria 3918
50 Ga0068859_100000091 3300005617 Bacteria 82527
51 Ga0068859_101838933 3300005617 Bacteria 669
52 Ga0068851_10152574 3300005834 Bacteria 1264
53 Ga0068851_10186590 3300005834 Bacteria 1151
54 Ga0068870_10556417 3300005840 Bacteria 773
55 Ga0068863_100000271 3300005841 Bacteria 53894
56 Ga0068863_101103109 3300005841 Bacteria 798
57 Ga0068858_100000074 3300005842 Bacteria 104483
58 Ga0068858_100002463 3300005842 Bacteria 18687
59 Ga0068860_100000017 3300005843 Bacteria 307083
60 Ga0068862_100000145 3300005844 Bacteria 80544
61 Ga0081455_10000038 3300005937 Bacteria 135510
62 Ga0081455_10064031 3300005937 Bacteria 3081
63 Ga0075368_10003220 3300006042 Bacteria 5429
64 Ga0075363_100096824 3300006048 Bacteria 1630
65 Ga0075363_100374840 3300006048 Bacteria 834
66 Ga0070715_10420532 3300006163 Bacteria 747
67 Ga0070716_100108207 3300006173 Bacteria 1717
68 Ga0070716_100740614 3300006173 Bacteria 755
69 Ga0070712_100138932 3300006175 Bacteria 1851
70 Ga0075367_10004802 3300006178 Bacteria 6652
71 Ga0097620_100000091 3300006931 Bacteria 82527
72 Ga0097620_101838457 3300006931 Bacteria 669
73 Ga0099795_10067347 3300007788 Bacteria 1343
74 Ga0105244_10382601 3300009036 Bacteria 648
75 Ga0105240_10076806 3300009093 Bacteria 4117
76 Ga0105245_10503484 3300009098 Bacteria 1227
77 Ga0105245_10928749 3300009098 Bacteria 912
78 Ga0105245_11574576 3300009098 Bacteria 709
79 Ga0105247_10000102 3300009101 Bacteria 90969
80 Ga0114129_10127582 3300009147 Bacteria 3497
81 Ga0105241_10001550 3300009174 Bacteria 17612
82 Ga0105241_10915110 3300009174 Bacteria 815
83 Ga0105248_10000329 3300009177 Bacteria 55993
84 Ga0105248_10000892 3300009177 Bacteria 33382
85 Ga0105248_10042603 3300009177 Bacteria 5092
86 Ga0105248_10657488 3300009177 Bacteria 1182
87 Ga0105237_10041436 3300009545 Bacteria 4643
88 Ga0105238_10063772 3300009551 Bacteria 3686
89 Ga0105238_10699710 3300009551 Bacteria 1025
90 Ga0105238_10791931 3300009551 Bacteria 963
91 Ga0105249_10008763 3300009553 Bacteria 8828
92 Ga0105249_10992092 3300009553 Bacteria 908
93 Ga0105249_11484714 3300009553 Bacteria 750
94 Ga0105249_11666359 3300009553 Bacteria 710
95 Ga0105239_10233827 3300010375 Bacteria 2062
96 Ga0105239_10381729 3300010375 Bacteria 1593
97 Ga0105239_11405164 3300010375 Bacteria 806
98 Ga0105239_11542198 3300010375 Bacteria 768
99 Ga0105246_10021803 3300011119 Bacteria 4126
100 Ga0105246_10118602 3300011119 Bacteria 1957
101 Ga0105246_11089237 3300011119 Bacteria 729
102 Ga0157369_10089205 3300013105 Bacteria 3292
103 Ga0157369_10291546 3300013105 Bacteria 1699
104 Ga0157369_10586593 3300013105 Bacteria 1151
105 Ga0157369_10819480 3300013105 Bacteria 956
106 Ga0157374_10417021 3300013296 Bacteria 1341
107 Ga0157374_11363244 3300013296 Bacteria 732
108 Ga0163162_11282725 3300013306 Bacteria 832
109 Ga0157372_10105482 3300013307 Bacteria 3223
110 Ga0157372_10517806 3300013307 Bacteria 1391
111 Ga0157372_11625625 3300013307 Bacteria 744
112 Ga0163163_10011655 3300014325 Bacteria 7986
113 Ga0163163_10063765 3300014325 Bacteria 3655
114 Ga0182008_10004862 3300014497 Bacteria 7764
115 Ga0157379_10000011 3300014968 Bacteria 111920
116 Ga0157379_10005095 3300014968 Bacteria 11269
117 Ga0157376_10613314 3300014969 Bacteria 1084
118 Ga0157376_11377170 3300014969 Bacteria 737
119 Ga0182006_1042073 3300015261 Bacteria 1791
120 Ga0182007_10017762 3300015262 Bacteria 2590
121 Ga0182005_1048093 3300015265 Bacteria 1159
122 Ga0183367_1006 3300015688 Bacteria 648044
123 Ga0206356_11015788 3300020070 Bacteria 1343
124 Ga0207426_1003154 3300025302 Bacteria 9351
125 Ga0207426_1010499 3300025302 Bacteria 3590
126 Ga0207426_1011444 3300025302 Bacteria 3379
127 Ga0207426_1011888 3300025302 Bacteria 3294
128 Ga0207656_10550560 3300025321 Bacteria 588
129 Ga0207713_1115213 3300025735 Bacteria 908
130 Ga0207710_10000029 3300025900 Bacteria 289155
131 Ga0207688_10283449 3300025901 Bacteria 1010
132 Ga0207680_10009015 3300025903 Bacteria 4927
133 Ga0207680_10816304 3300025903 Bacteria 669
134 Ga0207647_10001305 3300025904 Bacteria 19192
135 Ga0207647_10015896 3300025904 Bacteria 5148
136 Ga0207699_10228239 3300025906 Bacteria 1274
137 Ga0207695_10002038 3300025913 Bacteria 30975
138 Ga0207671_10000773 3300025914 Bacteria 40536
139 Ga0207693_10154321 3300025915 Bacteria 1806
140 Ga0207693_10197015 3300025915 Bacteria 1584
141 Ga0207694_10001277 3300025924 Bacteria 21698
142 Ga0207694_10386338 3300025924 Bacteria 1162
143 Ga0207687_10313309 3300025927 Bacteria 1268
144 Ga0207700_10896748 3300025928 Bacteria 793
145 Ga0207700_11151744 3300025928 Bacteria 693
146 Ga0207664_10035146 3300025929 Bacteria 3865
147 Ga0207690_10011468 3300025932 Bacteria 5299
148 Ga0207665_10058996 3300025939 Bacteria 2596
149 Ga0207691_10889878 3300025940 Bacteria 746
150 Ga0207711_10000270 3300025941 Bacteria 56050
151 Ga0207711_10020076 3300025941 Bacteria 5568
152 Ga0207711_10025120 3300025941 Bacteria 4999
153 Ga0207661_10246711 3300025944 Bacteria 1586
154 Ga0207679_10930653 3300025945 Bacteria 796
155 Ga0207667_10184168 3300025949 Bacteria 2144
156 Ga0207712_10010620 3300025961 Bacteria 5845
157 Ga0207668_10030636 3300025972 Bacteria 3537
158 Ga0207640_10487002 3300025981 Bacteria 1024
159 Ga0207658_11084071 3300025986 Bacteria 731
160 Ga0207703_10000066 3300026035 Bacteria 125891
161 Ga0207703_10010385 3300026035 Bacteria 7283
162 Ga0207639_10067698 3300026041 Bacteria 2779
163 Ga0207639_10147455 3300026041 Bacteria 1967
164 Ga0207678_10035871 3300026067 Bacteria 4318
165 Ga0207678_11117127 3300026067 Bacteria 698
166 Ga0207702_10068391 3300026078 Bacteria 3051
167 Ga0207702_10187468 3300026078 Bacteria 1909
168 Ga0207702_10318700 3300026078 Bacteria 1480
169 Ga0207641_10006406 3300026088 Bacteria 9922
170 Ga0207674_10015589 3300026116 Bacteria 8345
171 Ga0207683_10685783 3300026121 Bacteria 950
172 Ga0207698_10025948 3300026142 Bacteria 4138
173 Ga0207698_10111307 3300026142 Bacteria 2295
174 Ga0209371_1010292 3300027312 Bacteria 2891
175 Ga0268266_10003027 3300028379 Bacteria 17268
176 Ga0268266_10028709 3300028379 Bacteria 4729
177 Ga0268266_10465160 3300028379 Bacteria 1204
178 Ga0268265_10000057 3300028380 Bacteria 155346
179 Ga0268264_10000033 3300028381 Bacteria 404123
180 Ga0307517_10003800 3300028786 Bacteria 23438
181 Ga0307517_10018307 3300028786 Bacteria 9067
182 Ga0307515_10002026 3300028794 Bacteria 44830
183 Ga0307511_10001267 3300030521 Bacteria 26758
184 Ga0307511_10067233 3300030521 Bacteria 2661
185 Ga0307511_10131991 3300030521 Bacteria 1501
186 Ga0307512_10004012 3300030522 Bacteria 16446
187 Ga0307512_10120662 3300030522 Bacteria 1686
188 Ga0316178_1131002 3300030735 Bacteria 670
189 Ga0316183_1211421 3300030742 Bacteria 1143
190 Ga0316181_1147835 3300030744 Bacteria 2343
191 Ga0316182_1358891 3300030745 Bacteria 1259
192 Ga0265327_10000836 3300031251 Bacteria 45980
193 Ga0307513_10000001 3300031456 Bacteria 1660464
194 Ga0307513_10069728 3300031456 Bacteria 3678
195 Ga0307509_10008457 3300031507 Bacteria 13110
196 Ga0307509_10015152 3300031507 Bacteria 9019
197 Ga0307509_10155262 3300031507 Bacteria 2196
198 Ga0307508_10005831 3300031616 Bacteria 11637
199 Ga0307508_10056008 3300031616 Bacteria 3492
200 Ga0307514_10014502 3300031649 Bacteria 6521
201 Ga0307514_10092567 3300031649 Bacteria 2198
202 Ga0307514_10132056 3300031649 Bacteria 1717
203 Ga0316576_10016048 3300031727 Bacteria 5048
204 Ga0316578_10636815 3300031728 Bacteria 623
205 Ga0307516_10052872 3300031730 Bacteria 3975
206 Ga0307516_10069322 3300031730 Bacteria 3392
207 Ga0307516_10120977 3300031730 Bacteria 2408
208 Ga0307405_11573266 3300031731 Bacteria 579
209 Ga0307413_10554152 3300031824 Bacteria 933
210 Ga0307518_10119709 3300031838 Bacteria 1865
211 Ga0307410_10606659 3300031852 Bacteria 913
212 Ga0307416_100073304 3300032002 Bacteria 2854
213 Ga0307416_100547280 3300032002 Bacteria 1230
214 Ga0307507_10061631 3300033179 Bacteria 3491
215 Ga0307510_10010159 3300033180 Bacteria 11194
216 Ga0307510_10036555 3300033180 Bacteria 5464
217 Ga0307510_10093465 3300033180 Bacteria 2838
218 Ga0307510_10271494 3300033180 Bacteria 1172
219 Ga0316574_0001605 3300035398 Bacteria 10837
220 Ga0373924_0465525 3300035410 Bacteria 567
221 Ga0373947_0128621 3300035725 Bacteria 1615
222 Ga0373947_0212576 3300035725 Bacteria 1269
223 Ga0373937_0407256 3300036401 Bacteria 1290
224 Ga0395898_0002956 3300037466 Bacteria 19318
225 Ga0395898_0007126 3300037466 Bacteria 11871
226 Ga0436364_0039243 3300037853 Bacteria 739
227 Ga0436364_0260305 3300037853 Bacteria 7779
228 Ga0395901_0017720 3300038443 Bacteria 7271
229 Ga0395901_0662331 3300038443 Bacteria 1046
230 Ga0439436_0001661 3300041404 Bacteria 6494
231 Ga0439436_0003853 3300041404 Bacteria 4594
232 Ga0439439_0004962 3300041406 Bacteria 3020
233 Ga0439466_0015240 3300041411 Bacteria 2793
234 Ga0451791_0799676 3300041451 Bacteria 1861
235 Ga0451797_0186243 3300041453 Bacteria 576
236 Ga0451795_1505047 3300041456 Bacteria 1008
237 Ga0451800_0748042 3300041459 Bacteria 830
238 Ga0451807_1733353 3300041486 Bacteria 1508
239 Ga0451841_0755329 3300041498 Bacteria 2221
240 Ga0451845_0686953 3300041501 Bacteria 727
241 Ga0451843_0142188 3300041509 Bacteria 1307
242 Ga0451843_1009812 3300041509 Bacteria 1463
243 Ga0451853_0881640 3300041512 Bacteria 2212
244 Ga0451853_2835984 3300041512 Bacteria 1577
245 Ga0439433_0013258 3300041999 Bacteria 1809
246 Ga0439442_029566 3300042002 Bacteria 1143
247 Ga0439442_038173 3300042002 Bacteria 1007
248 Ga0439442_042325 3300042002 Bacteria 958
249 Ga0439442_098709 3300042002 Bacteria 631
250 Ga0439448_0011297 3300042005 Bacteria 2660
251 Ga0439449_0001026 3300042007 Bacteria 10997
252 Ga0439449_0006120 3300042007 Bacteria 4598
253 Ga0439449_0014464 3300042007 Bacteria 2967
254 Ga0439449_0014736 3300042007 Bacteria 2937
255 Ga0439455_0010021 3300042012 Bacteria 2072
256 Ga0439455_0035974 3300042012 Bacteria 1251
257 Ga0439457_004751 3300042014 Bacteria 3503
258 Ga0439457_022509 3300042014 Bacteria 1395
259 Ga0439462_0005725 3300042015 Bacteria 3073
260 Ga0450903_000082 3300042138 Bacteria 19506
261 Ga0450903_008844 3300042138 Bacteria 1645
262 Ga0450906_062960 3300042145 Bacteria 660
263 Ga0439458_0002493 3300042157 Bacteria 4471
264 Ga0466969_0003067 3300044656 Bacteria 8901
265 Ga0466969_0016217 3300044656 Bacteria 3902
266 Ga0466969_0128213 3300044656 Bacteria 1177
267 Ga0466969_0215357 3300044656 Bacteria 874
268 Ga0466972_0001201 3300044658 Bacteria 12458
269 Ga0466972_0003162 3300044658 Bacteria 8177
270 Ga0466972_0518533 3300044658 Bacteria 561
271 Ga0466965_0000676 3300044683 Bacteria 12553
272 Ga0466965_0247607 3300044683 Bacteria 955
273 Ga0466965_0351491 3300044683 Bacteria 807
274 Ga0466966_0002187 3300044684 Bacteria 12691
275 Ga0466966_0006304 3300044684 Bacteria 7848
276 Ga0466966_0010729 3300044684 Bacteria 6091
277 Ga0466966_0320383 3300044684 Bacteria 931
278 Ga0466961_0002111 3300044693 Bacteria 12377
279 Ga0466961_0009728 3300044693 Bacteria 6120
280 Ga0466961_0052837 3300044693 Bacteria 2593
281 Ga0466961_0066048 3300044693 Bacteria 2298
282 Ga0466961_0154866 3300044693 Bacteria 1430
283 Ga0466961_0189307 3300044693 Bacteria 1276
284 Ga0466963_0000826 3300044694 Bacteria 15507
285 Ga0466963_0059468 3300044694 Bacteria 2550
286 Ga0466963_0231550 3300044694 Bacteria 1295
287 Ga0466964_0003907 3300044706 Bacteria 5476
288 Ga0466964_0134692 3300044706 Bacteria 1129
289 Ga0466964_0367195 3300044706 Bacteria 744
290 Ga0466971_0000710 3300044719 Bacteria 13318
291 Ga0466971_0019236 3300044719 Bacteria 3031
292 Ga0466971_0053943 3300044719 Bacteria 1812
293 Ga0466971_0071863 3300044719 Bacteria 1571
294 Ga0466968_0160230 3300044735 Bacteria 1038
295 Ga0466968_0282624 3300044735 Bacteria 794
296 Ga0466970_0001444 3300044765 Bacteria 11496
297 Ga0466970_0002527 3300044765 Bacteria 8826
298 Ga0466970_0039654 3300044765 Bacteria 2500
299 Ga0466970_0120152 3300044765 Bacteria 1439
300 Ga0466970_0437382 3300044765 Bacteria 749
301 Ga0466957_0000835 3300044842 Bacteria 15739
302 Ga0466960_0001092 3300044901 Bacteria 9749
303 Ga0466960_0830493 3300044901 Bacteria 561
304 Ga0466959_0002801 3300045049 Bacteria 11227
305 Ga0466959_0023538 3300045049 Bacteria 4557
306 Ga0466959_0038264 3300045049 Bacteria 3545
307 Ga0466959_0068438 3300045049 Bacteria 2573
308 Ga0466958_0000131 3300045836 Bacteria 24937
309 Ga0466958_0040078 3300045836 Bacteria 2815
310 Ga0466958_0094738 3300045836 Bacteria 1850
311 Ga0466958_0195262 3300045836 Bacteria 1287
312 Ga0466958_0591695 3300045836 Bacteria 721
313 Ga0466967_0004265 3300045976 Bacteria 9607
314 Ga0466967_0037002 3300045976 Bacteria 4172
315 Ga0466967_0182323 3300045976 Bacteria 1981
316 Ga0466967_0587664 3300045976 Bacteria 1098
317 Ga0466967_0600736 3300045976 Bacteria 1086
318 Ga0466967_0745825 3300045976 Bacteria 971
319 Ga0466967_0759544 3300045976 Bacteria 962
320 Ga0495592_0016180 3300046454 Bacteria 5658
321 Ga0495592_0025554 3300046454 Bacteria 4482
322 Ga0495592_0060863 3300046454 Bacteria 2776
323 Ga0495592_0066916 3300046454 Bacteria 2627
324 Ga0495603_0000262 3300046455 Bacteria 27718
325 Ga0495603_0005677 3300046455 Bacteria 7455
326 Ga0495603_0011907 3300046455 Bacteria 5263
327 Ga0495603_0013959 3300046455 Bacteria 4857
328 Ga0495603_0208648 3300046455 Bacteria 1128
329 Ga0495603_0659725 3300046455 Bacteria 598
330 Ga0495629_0000568 3300046459 Bacteria 29992
331 Ga0495629_0020591 3300046459 Bacteria 4710
332 Ga0495629_0030504 3300046459 Bacteria 3821
333 Ga0495629_0044422 3300046459 Bacteria 3118
334 Ga0495629_0064829 3300046459 Bacteria 2550
335 Ga0495629_0077264 3300046459 Bacteria 2324
336 Ga0495629_0125074 3300046459 Bacteria 1791
337 Ga0495629_0530563 3300046459 Bacteria 791
338 Ga0495629_0568082 3300046459 Bacteria 760
339 Ga0495638_0103740 3300046460 Bacteria 1697
340 Ga0495638_0169866 3300046460 Bacteria 1252
341 Ga0495638_0373842 3300046460 Bacteria 746
342 Ga0495651_0002804 3300046462 Bacteria 13516
343 Ga0495651_0005834 3300046462 Bacteria 9394
344 Ga0495651_0014386 3300046462 Bacteria 6118
345 Ga0495651_0073443 3300046462 Bacteria 2596
346 Ga0495651_0077267 3300046462 Bacteria 2520
347 Ga0495651_0259486 3300046462 Bacteria 1183
348 Ga0495651_0761966 3300046462 Bacteria 600
349 Ga0495653_0006299 3300046463 Bacteria 9733
350 Ga0495653_0208905 3300046463 Bacteria 1320
351 Ga0495580_0078450 3300046472 Bacteria 2303
352 Ga0495582_0208112 3300046473 Bacteria 1118
353 Ga0495605_0156828 3300046474 Bacteria 1012
354 Ga0495639_0128546 3300046475 Bacteria 1212
355 Ga0495662_0003168 3300046476 Bacteria 8305
356 Ga0495662_0023317 3300046476 Bacteria 2988
357 Ga0495662_0028494 3300046476 Bacteria 2695
358 Ga0495662_0069514 3300046476 Bacteria 1705
359 Ga0495662_0086708 3300046476 Bacteria 1524
360 Ga0495664_0016373 3300046477 Bacteria 4221
361 Ga0495664_0038406 3300046477 Bacteria 2826
362 Ga0495664_0258661 3300046477 Bacteria 1052
363 Ga0495584_0222531 3300046491 Bacteria 959
364 Ga0495585_0007532 3300046492 Bacteria 6658
365 Ga0495585_0121389 3300046492 Bacteria 1382
366 Ga0495585_0257069 3300046492 Bacteria 870
367 Ga0495594_0010108 3300046499 Bacteria 4890
368 Ga0495594_0040807 3300046499 Bacteria 2541
369 Ga0495594_0060770 3300046499 Bacteria 2090
370 Ga0495607_0085096 3300046501 Bacteria 1728
371 Ga0495583_0050899 3300046506 Bacteria 1890
372 Ga0495606_0012769 3300046507 Bacteria 6696
373 Ga0495608_0004021 3300046511 Bacteria 10553
374 Ga0495608_0452370 3300046511 Bacteria 781
375 Ga0495610_0047656 3300046512 Bacteria 2107
376 Ga0495610_0110806 3300046512 Bacteria 1216
377 Ga0495616_0024623 3300046513 Bacteria 3226
378 Ga0495618_0088917 3300046514 Bacteria 1975
379 Ga0495618_0103514 3300046514 Bacteria 1822
380 Ga0495620_0004889 3300046515 Bacteria 7524
381 Ga0495620_0048083 3300046515 Bacteria 1833
382 Ga0495628_0000688 3300046516 Bacteria 31177
383 Ga0495628_0171284 3300046516 Bacteria 1646
384 Ga0495628_0974992 3300046516 Bacteria 584
385 Ga0495630_0021554 3300046517 Bacteria 4757
386 Ga0495630_0074723 3300046517 Bacteria 2553
387 Ga0495630_0832233 3300046517 Bacteria 704
388 Ga0495631_0010353 3300046518 Bacteria 4615
389 Ga0495632_0006703 3300046519 Bacteria 7362
390 Ga0495637_0074465 3300046520 Bacteria 1363
391 Ga0495643_0005069 3300046522 Bacteria 9014
392 Ga0495643_0008442 3300046522 Bacteria 6517
393 Ga0495648_0086870 3300046524 Bacteria 1763
394 Ga0495648_0250205 3300046524 Bacteria 856
395 Ga0495666_0010110 3300046526 Bacteria 4706
396 Ga0495666_0079575 3300046526 Bacteria 1552
397 Ga0495666_0344170 3300046526 Bacteria 672
398 Ga0495642_0257685 3300046528 Bacteria 762
399 Ga0495652_0004375 3300046529 Bacteria 13514
400 Ga0495652_0092433 3300046529 Bacteria 2471
401 Ga0495652_0141907 3300046529 Bacteria 1888
402 Ga0495652_0346537 3300046529 Bacteria 1065
403 Ga0495654_0059565 3300046530 Bacteria 1838
404 Ga0495665_0000429 3300046531 Bacteria 21413
405 Ga0495640_0002937 3300046533 Bacteria 13724
406 Ga0495640_0003552 3300046533 Bacteria 12522
407 Ga0495640_0014341 3300046533 Bacteria 6000
408 Ga0495640_0082137 3300046533 Bacteria 2141
409 Ga0495640_0119518 3300046533 Bacteria 1714
410 Ga0495587_0009674 3300046536 Bacteria 6165
411 Ga0495609_0029135 3300046538 Bacteria 2515
412 Ga0495645_0008311 3300046543 Bacteria 7245
413 Ga0495645_0043616 3300046543 Bacteria 3272
414 Ga0495645_0165037 3300046543 Bacteria 1528
415 Ga0495622_0090717 3300046557 Bacteria 1404
416 Ga0495622_0097238 3300046557 Bacteria 1350
417 Ga0495622_0445511 3300046557 Bacteria 555
418 Ga0495633_0182608 3300046558 Bacteria 965
419 Ga0495667_0007764 3300046559 Bacteria 7267
420 Ga0495667_0219352 3300046559 Bacteria 1214
421 Ga0495667_0244270 3300046559 Bacteria 1143
422 Ga0495668_0079133 3300046616 Bacteria 1804
423 Ga0495668_0390754 3300046616 Bacteria 764
424 Ga0495634_0002265 3300046642 Bacteria 16131
425 Ga0495634_0167490 3300046642 Bacteria 1382
426 Ga0495634_0177293 3300046642 Bacteria 1336
427 Ga0495625_0046473 3300046660 Bacteria 3133
428 Ga0495625_0084323 3300046660 Bacteria 2207
429 Ga0495625_0286788 3300046660 Bacteria 1057
430 Ga0495625_0344996 3300046660 Bacteria 942
431 Ga0495625_0345081 3300046660 Bacteria 942
432 Ga0495635_0047065 3300046663 Bacteria 2975
433 Ga0495635_0369918 3300046663 Bacteria 955
434 Ga0495635_0468489 3300046663 Bacteria 831
435 Ga0495635_0533518 3300046663 Bacteria 770
436 Ga0495661_0085658 3300046665 Bacteria 1805
437 Ga0495588_0009916 3300046674 Bacteria 4414
438 Ga0495588_0011624 3300046674 Bacteria 4137
439 Ga0495588_0049565 3300046674 Bacteria 2159
440 Ga0495588_0169828 3300046674 Bacteria 1153
441 Ga0495657_0020033 3300046675 Bacteria 4815
442 Ga0495657_0022714 3300046675 Bacteria 4488
443 Ga0495657_0111715 3300046675 Bacteria 1730
444 Ga0495657_0125896 3300046675 Bacteria 1609
445 Ga0495599_0029257 3300046678 Bacteria 3452
446 Ga0495599_0108560 3300046678 Bacteria 1729
447 Ga0495623_0148191 3300046679 Bacteria 1389
448 Ga0495623_0179819 3300046679 Bacteria 1230
449 Ga0495646_0060550 3300046680 Bacteria 2257
450 Ga0495646_0104401 3300046680 Bacteria 1620
451 Ga0495646_0113806 3300046680 Bacteria 1538
452 Ga0495658_0057104 3300046683 Bacteria 2228
453 Ga0495658_0207499 3300046683 Bacteria 1223
454 Ga0495613_0001287 3300046689 Bacteria 19142
455 Ga0495613_0007095 3300046689 Bacteria 8340
456 Ga0495613_0051170 3300046689 Bacteria 3045
457 Ga0495613_0137924 3300046689 Bacteria 1744
458 Ga0495613_0165642 3300046689 Bacteria 1570
459 Ga0495613_0548080 3300046689 Bacteria 774
460 Ga0495613_0725837 3300046689 Bacteria 653
461 Ga0495624_0046459 3300046690 Bacteria 2760
462 Ga0495624_0109284 3300046690 Bacteria 1701
463 Ga0495624_0124359 3300046690 Bacteria 1583
464 Ga0495670_0026460 3300046691 Bacteria 2871
465 Ga0495670_0505265 3300046691 Bacteria 657
466 Ga0495671_0008724 3300046692 Bacteria 5693
467 Ga0495671_0095564 3300046692 Bacteria 1454
468 Ga0495671_0104635 3300046692 Bacteria 1382
469 Ga0495671_0173720 3300046692 Bacteria 1047
470 Ga0495649_0022229 3300046694 Bacteria 3549
471 Ga0495649_0378465 3300046694 Bacteria 712
472 Ga0495589_0001579 3300046794 Bacteria 13077
473 Ga0495589_0035849 3300046794 Bacteria 2486
474 Ga0495589_0091701 3300046794 Bacteria 1475
475 Ga0495589_0109077 3300046794 Bacteria 1337
476 Ga0495600_0003072 3300046809 Bacteria 9756
477 Ga0495600_0143717 3300046809 Bacteria 1547
478 Ga0495600_0162653 3300046809 Bacteria 1442
479 Ga0495600_0302208 3300046809 Bacteria 1009
480 Ga0495600_0628982 3300046809 Bacteria 650
481 Ga0495660_0198131 3300046810 Bacteria 960
482 Ga0495581_0017936 3300047315 Bacteria 4113
483 Ga0495581_0037365 3300047315 Bacteria 2810
484 Ga0495581_0041107 3300047315 Bacteria 2675
485 Ga0495581_0109941 3300047315 Bacteria 1603
486 Ga0495581_0174347 3300047315 Bacteria 1258
487 Ga0495581_0190859 3300047315 Bacteria 1198
488 Ga0495581_0192963 3300047315 Bacteria 1191
489 Ga0495604_0001544 3300047317 Bacteria 18967
490 Ga0495604_0002658 3300047317 Bacteria 14345
491 Ga0495604_0006701 3300047317 Bacteria 9131
492 Ga0495604_0008240 3300047317 Bacteria 8246
493 Ga0495604_0095678 3300047317 Bacteria 2193
494 Ga0495604_0103562 3300047317 Bacteria 2087
495 Ga0495604_0130910 3300047317 Bacteria 1803
496 Ga0495604_0483254 3300047317 Bacteria 805
497 Ga0495636_0015287 3300047318 Bacteria 3059
498 Ga0495636_0065064 3300047318 Bacteria 1548
499 Ga0495636_0097440 3300047318 Bacteria 1282
500 Ga0495636_0425013 3300047318 Bacteria 635
501 Ga0495674_0073300 3300047319 Bacteria 2951
502 Ga0495672_0418907 3300047320 Bacteria 609
503 Ga0495676_0004653 3300047321 Bacteria 12570
504 Ga0495676_0005038 3300047321 Bacteria 12118
505 Ga0495676_0010943 3300047321 Bacteria 8201
506 Ga0495676_0016651 3300047321 Bacteria 6513
507 Ga0495676_0129550 3300047321 Bacteria 1823
508 Ga0495676_0510078 3300047321 Bacteria 788
509 Ga0495680_0169626 3300047322 Bacteria 1580
510 Ga0495683_0063116 3300047323 Bacteria 1831
511 Ga0495683_0149261 3300047323 Bacteria 1089
512 Ga0495687_003543 3300047443 Bacteria 11232
513 Ga0495687_006208 3300047443 Bacteria 7379
514 Ga0495687_055720 3300047443 Bacteria 1651
515 Ga0495675_0020228 3300047444 Bacteria 4231
516 Ga0495675_0022281 3300047444 Bacteria 4037
517 Ga0495675_0029780 3300047444 Bacteria 3482
518 Ga0495675_0052064 3300047444 Bacteria 2599
519 Ga0495675_0076561 3300047444 Bacteria 2109
520 Ga0495675_0156950 3300047444 Bacteria 1403
521 Ga0495675_0249975 3300047444 Bacteria 1065
522 Ga0495675_0565220 3300047444 Bacteria 647
523 Ga0495685_005480 3300047447 Bacteria 4145
524 Ga0495685_017229 3300047447 Bacteria 2473
525 Ga0495685_020765 3300047447 Bacteria 2258
526 Ga0495685_038200 3300047447 Bacteria 1645
527 Ga0495685_043185 3300047447 Bacteria 1538
528 Ga0495681_0004834 3300047470 Bacteria 9118
529 Ga0495681_0020908 3300047470 Bacteria 3538
530 Ga0495684_0140251 3300047471 Bacteria 1812
531 Ga0495686_0036838 3300047472 Bacteria 3138
532 Ga0495593_0020472 3300047673 Bacteria 3705
533 Ga0495593_0057431 3300047673 Bacteria 2043
534 Ga0495593_0175221 3300047673 Bacteria 1080
535 Ga0495593_0188085 3300047673 Bacteria 1039
536 Ga0495602_0004329 3300048088 Bacteria 14797
537 Ga0495602_0157623 3300048088 Bacteria 1776
538 Ga0495602_0204795 3300048088 Bacteria 1502
539 Ga0495614_0022740 3300048089 Bacteria 2703
540 Ga0495614_0033987 3300048089 Bacteria 2192
541 Ga0495614_0056536 3300048089 Bacteria 1684
542 Ga0495626_0025073 3300048091 Bacteria 2919
543 Ga0495626_0310079 3300048091 Bacteria 622
544 Ga0496100_0324726 3300048903 Bacteria 1157
545 Ga0496101_0132276 3300048904 Bacteria 1895
546 Ga0496102_0591295 3300048905 Bacteria 1033
547 Ga0496104_0260008 3300048907 Bacteria 1649
548 Ga0496104_0472179 3300048907 Bacteria 1166
549 Ga0496105_1235970 3300048908 Bacteria 548
550 Ga0496108_0053272 3300048911 Bacteria 3393
551 Ga0496109_0441593 3300048912 Bacteria 1229
552 Ga0496110_0835610 3300048913 Bacteria 826
553 Ga0496111_0718134 3300048914 Bacteria 726
554 Ga0496111_1085344 3300048914 Bacteria 571
555 Ga0496113_0462902 3300048916 Bacteria 1019
556 Ga0496113_1139383 3300048916 Bacteria 611
557 Ga0496114_0054832 3300048917 Bacteria 3324
558 Ga0496118_0023433 3300048921 Bacteria 5361
559 Ga0496119_0000784 3300048922 Bacteria 42478
560 Ga0496119_0009833 3300048922 Bacteria 8131
561 Ga0496120_0006188 3300048923 Bacteria 9257
562 Ga0496126_0000048 3300048929 Bacteria 317977
563 Ga0495678_107839 3300049459 Bacteria 954
564 Ga0501323_043062 3300049539 Bacteria 667
565 Ga0501031_0011192 3300049568 Bacteria 5846
566 Ga0501031_0029774 3300049568 Bacteria 3562
567 Ga0501031_0063701 3300049568 Bacteria 2401
568 Ga0501031_0700510 3300049568 Bacteria 650
569 Ga0501032_0003050 3300049569 Bacteria 12975
570 Ga0501032_0017046 3300049569 Bacteria 5103
571 Ga0501032_0023051 3300049569 Bacteria 4309
572 Ga0501032_0141625 3300049569 Bacteria 1583
573 Ga0501032_0211887 3300049569 Bacteria 1263
574 Ga0501032_0312514 3300049569 Bacteria 1015
575 Ga0501033_0009749 3300049570 Bacteria 7377
576 Ga0501033_0022267 3300049570 Bacteria 4781
577 Ga0501033_0041517 3300049570 Bacteria 3432
578 Ga0501033_0044508 3300049570 Bacteria 3304
579 Ga0501033_0067663 3300049570 Bacteria 2626
580 Ga0501033_0069497 3300049570 Bacteria 2588
581 Ga0501033_0302497 3300049570 Bacteria 1126
582 Ga0501034_0002857 3300049571 Bacteria 20131
583 Ga0501034_0003189 3300049571 Bacteria 18861
584 Ga0501034_0011990 3300049571 Bacteria 8957
585 Ga0501034_0021523 3300049571 Bacteria 6570
586 Ga0501034_0028508 3300049571 Bacteria 5682
587 Ga0501034_0029497 3300049571 Bacteria 5576
588 Ga0501034_0082761 3300049571 Bacteria 3211
589 Ga0501034_0126182 3300049571 Bacteria 2544
590 Ga0501034_0147569 3300049571 Bacteria 2329
591 Ga0501034_0166411 3300049571 Bacteria 2173
592 Ga0501034_0591604 3300049571 Bacteria 1016
593 Ga0501036_0000627 3300049572 Bacteria 25739
594 Ga0501036_0004155 3300049572 Bacteria 11652
595 Ga0501036_0005036 3300049572 Bacteria 10692
596 Ga0501036_0010604 3300049572 Bacteria 7615
597 Ga0501036_0025455 3300049572 Bacteria 4991
598 Ga0501036_0035885 3300049572 Bacteria 4195
599 Ga0501036_0177362 3300049572 Bacteria 1794
600 Ga0501036_0267770 3300049572 Bacteria 1431
601 Ga0501037_0000644 3300049573 Bacteria 26982
602 Ga0501037_0006911 3300049573 Bacteria 8285
603 Ga0501037_0042196 3300049573 Bacteria 3353
604 Ga0501037_0056596 3300049573 Bacteria 2863
605 Ga0501037_0078706 3300049573 Bacteria 2392
606 Ga0501037_0664753 3300049573 Bacteria 695
607 Ga0501038_0001482 3300049574 Bacteria 21611
608 Ga0501038_0013836 3300049574 Bacteria 7353
609 Ga0501038_0017684 3300049574 Bacteria 6444
610 Ga0501038_0078854 3300049574 Bacteria 2778
611 Ga0501038_0326465 3300049574 Bacteria 1199
612 Ga0501038_0707311 3300049574 Bacteria 754
613 Ga0501038_0938209 3300049574 Bacteria 637
614 Ga0501039_0026796 3300049575 Bacteria 4429
615 Ga0501039_0034037 3300049575 Bacteria 3931
616 Ga0501039_0036312 3300049575 Bacteria 3802
617 Ga0501039_0054450 3300049575 Bacteria 3097
618 Ga0501039_0150948 3300049575 Bacteria 1825
619 Ga0501039_1012596 3300049575 Bacteria 645
620 Ga0501041_0003388 3300049577 Bacteria 9172
621 Ga0501042_0003012 3300049578 Bacteria 10481
622 Ga0501042_0033787 3300049578 Bacteria 3626
623 Ga0501042_0036871 3300049578 Bacteria 3469
624 Ga0501043_0002045 3300049579 Bacteria 17217
625 Ga0501043_0012717 3300049579 Bacteria 6580
626 Ga0501043_0017130 3300049579 Bacteria 5682
627 Ga0501043_0018811 3300049579 Bacteria 5422
628 Ga0501043_0044121 3300049579 Bacteria 3505
629 Ga0501043_0052803 3300049579 Bacteria 3192
630 Ga0501043_0095141 3300049579 Bacteria 2341
631 Ga0501043_0108234 3300049579 Bacteria 2183
632 Ga0501043_0153098 3300049579 Bacteria 1804
633 Ga0501046_0037593 3300049580 Bacteria 3890
634 Ga0501046_0174741 3300049580 Bacteria 1609
635 Ga0501047_0000025 3300049581 Bacteria 225560
636 Ga0501047_0000084 3300049581 Bacteria 121007
637 Ga0501047_0001101 3300049581 Bacteria 26872
638 Ga0501047_0009755 3300049581 Bacteria 9071
639 Ga0501047_0019088 3300049581 Bacteria 6578
640 Ga0501047_0044875 3300049581 Bacteria 4272
641 Ga0501047_0075142 3300049581 Bacteria 3252
642 Ga0501047_0114311 3300049581 Bacteria 2581
643 Ga0501047_0140125 3300049581 Bacteria 2297
644 Ga0501047_0484364 3300049581 Bacteria 1064
645 Ga0501047_0518446 3300049581 Bacteria 1018
646 Ga0501047_0899853 3300049581 Bacteria 698
647 Ga0501048_0003714 3300049582 Bacteria 11633
648 Ga0501048_0019385 3300049582 Bacteria 4991
649 Ga0501048_0023824 3300049582 Bacteria 4470
650 Ga0501067_0006058 3300049583 Bacteria 6704
651 Ga0501067_0304829 3300049583 Bacteria 887
652 Ga0501068_0009848 3300049584 Bacteria 5353
653 Ga0501068_0042882 3300049584 Bacteria 2721
654 Ga0501069_0008664 3300049585 Bacteria 5356
655 Ga0501069_0202091 3300049585 Bacteria 1152
656 Ga0501070_0003688 3300049586 Bacteria 13237
657 Ga0501070_0058067 3300049586 Bacteria 3207
658 Ga0501070_0137328 3300049586 Bacteria 2019
659 Ga0501070_0209834 3300049586 Bacteria 1599
660 Ga0501070_0442447 3300049586 Bacteria 1048
661 Ga0501070_1049262 3300049586 Bacteria 630
662 Ga0501071_0000759 3300049587 Bacteria 17111
663 Ga0501072_0004361 3300049588 Bacteria 10737
664 Ga0501072_1011734 3300049588 Bacteria 648
665 Ga0501073_0044192 3300049589 Bacteria 3139
666 Ga0501073_0173247 3300049589 Bacteria 1494
667 Ga0501073_0799803 3300049589 Bacteria 650
668 Ga0501074_0000296 3300049590 Bacteria 28700
669 Ga0501074_0002291 3300049590 Bacteria 13309
670 Ga0501074_0066303 3300049590 Bacteria 2596
671 Ga0501076_0009593 3300049592 Bacteria 7148
672 Ga0501076_0585960 3300049592 Bacteria 920
673 Ga0501077_0013524 3300049593 Bacteria 5119
674 Ga0501223_058837 3300049663 Bacteria 750
675 Ga0501235_028837 3300049669 Bacteria 1248
676 Ga0501080_0030534 3300049742 Bacteria 5021
677 Ga0501080_1084503 3300049742 Bacteria 692
678 Ga0501083_0014645 3300049744 Bacteria 5482
679 Ga0501035_0007013 3300049822 Bacteria 10527
680 Ga0501035_0022321 3300049822 Bacteria 5811
681 Ga0501035_0040956 3300049822 Bacteria 4183
682 Ga0501035_0080509 3300049822 Bacteria 2876
683 Ga0501035_0173536 3300049822 Bacteria 1861
684 Ga0501035_0224064 3300049822 Bacteria 1604
685 Ga0501035_0802890 3300049822 Bacteria 751
686 Ga0501044_0019610 3300049823 Bacteria 7229
687 Ga0501044_0025758 3300049823 Bacteria 6235
688 Ga0501044_0046168 3300049823 Bacteria 4511
689 Ga0501044_0046661 3300049823 Bacteria 4484
690 Ga0501044_0052883 3300049823 Bacteria 4181
691 Ga0501044_0062712 3300049823 Bacteria 3799
692 Ga0501044_0086845 3300049823 Bacteria 3160
693 Ga0501044_0245699 3300049823 Bacteria 1732
694 Ga0501044_0265864 3300049823 Bacteria 1652
695 Ga0501044_0779036 3300049823 Bacteria 837
696 Ga0501044_0912929 3300049823 Bacteria 753
697 Ga0501044_1080562 3300049823 Bacteria 672
698 Ga0501045_0070710 3300049824 Bacteria 2568
699 Ga0501045_0077517 3300049824 Bacteria 2449
700 Ga0501045_0209060 3300049824 Bacteria 1454
701 Ga0501045_0269191 3300049824 Bacteria 1268
702 Ga0501045_0371228 3300049824 Bacteria 1065
703 nmdc:mga03n38_20804_c1 3300050490 Bacteria 2631
704 nmdc:mga06z11_208166_c1 3300050494 Bacteria 1139
705 nmdc:mga04h51_32266_c1 3300050495 Bacteria 1660
706 nmdc:mga07m45_186073_c1 3300050496 Bacteria 1207
707 nmdc:mga05p37_1096738_c1 3300050507 Bacteria 834
708 Ga0495601_0033677 3300053077 Bacteria 3193
709 Ga0495612_0416590 3300053078 Bacteria 612
710 Ga0500610_0031224 3300053079 Bacteria 2705
711 Ga0495655_0004158 3300053083 Bacteria 2454
712 Ga0495619_0128099 3300053085 Bacteria 1743
713 Ga0495619_0214026 3300053085 Bacteria 1335
714 Ga0495619_0243872 3300053085 Bacteria 1245
715 Ga0495619_0520271 3300053085 Bacteria 817
716 Ga0500578_0009710 3300053086 Bacteria 6250
717 Ga0500578_0072990 3300053086 Bacteria 2186
718 Ga0500644_0070789 3300053088 Bacteria 1256
719 Ga0500646_0021663 3300053090 Bacteria 1714
720 Ga0500566_0155992 3300053094 Bacteria 1195
721 Ga0500640_033131 3300053095 Bacteria 2269
722 Ga0500641_0023300 3300053096 Bacteria 2380
723 Ga0500654_108906 3300053099 Bacteria 1144
724 Ga0500660_069730 3300053100 Bacteria 1654
725 Ga0500553_142862 3300053101 Bacteria 939
726 Ga0500560_006362 3300053107 Bacteria 2697
727 Ga0500569_013156 3300053109 Bacteria 2019
728 Ga0500652_073838 3300053131 Bacteria 1415
729 Ga0500658_0028250 3300053134 Bacteria 2175
730 Ga0500559_0218339 3300053136 Bacteria 899
731 Ga0500561_0009085 3300053137 Bacteria 2005
732 Ga0500573_0058933 3300053140 Bacteria 2201
733 Ga0500573_0073692 3300053140 Bacteria 1945
734 Ga0500573_0098584 3300053140 Bacteria 1646
735 Ga0500573_0393437 3300053140 Bacteria 658
736 Ga0500579_017070 3300053143 Bacteria 4693
737 Ga0500588_0310319 3300053146 Bacteria 597
738 Ga0500600_0009525 3300053149 Bacteria 5863
739 Ga0500600_0196664 3300053149 Bacteria 954
740 Ga0500616_0052585 3300053153 Bacteria 2141
741 Ga0500633_0005923 3300053160 Bacteria 2953
742 Ga0500634_0000949 3300053161 Bacteria 10434
743 Ga0500656_001651 3300053732 Bacteria 1944
744 Ga0500587_004984 3300053739 Bacteria 1806
745 Ga0501084_0012357 3300054114 Bacteria 7073
746 Ga0501082_0005799 3300060353 Bacteria 10720
747 Ga0466962_0004456 3300061719 Bacteria 6710
748 Ga0466962_0030053 3300061719 Bacteria 2601
749 Ga0466962_0048655 3300061719 Bacteria 2026
750 Ga0466962_0075601 3300061719 Bacteria 1609
751 Ga0530510_0033810 3300061734 Bacteria 3681

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0000048 Ga0496126_0000048_52931_53407 139
2 3300005617 Ga0068859_100000091 Ga0068859_10000009113 140
3 3300005844 Ga0068862_100000145 Ga0068862_10000014522 140
4 3300006931 Ga0097620_100000091 Ga0097620_10000009154 140
5 3300009553 Ga0105249_10008763 Ga0105249_100087636 140
6 3300014325 Ga0163163_10011655 Ga0163163_100116556 140
7 3300025961 Ga0207712_10010620 Ga0207712_100106204 140
8 3300028380 Ga0268265_10000057 Ga0268265_1000005741 140
9 3300005614 Ga0068856_100442064 Ga0068856_1004420643 141
10 3300048922 Ga0496119_0009833 Ga0496119_0009833_5454_5960 141
11 3300010375 Ga0105239_11542198 Ga0105239_115421981 142
12 3300013307 Ga0157372_11625625 Ga0157372_116256252 142
13 3300014969 Ga0157376_11377170 Ga0157376_113771701 142
14 3300005841 Ga0068863_101103109 Ga0068863_1011031091 145
15 3300009101 Ga0105247_10000102 Ga0105247_1000010235 145
16 3300009177 Ga0105248_10000892 Ga0105248_1000089215 145
17 3300014968 Ga0157379_10005095 Ga0157379_100050952 145
18 3300025735 Ga0207713_1115213 Ga0207713_11152131 145
19 3300025900 Ga0207710_10000029 Ga0207710_1000002977 145
20 3300025941 Ga0207711_10020076 Ga0207711_100200762 145
21 3300048922 Ga0496119_0000784 Ga0496119_0000784_5124_5612 145
22 3300048923 Ga0496120_0006188 Ga0496120_0006188_3480_3968 145
23 3300046491 Ga0495584_0222531 Ga0495584_0222531_37_477 146
24 3300020070 Ga0206356_11015788 Ga0206356_110157883 148
25 3300026041 Ga0207639_10147455 Ga0207639_101474553 148
26 3300026142 Ga0207698_10111307 Ga0207698_101113073 148
27 3300038443 Ga0395901_0662331 Ga0395901_0662331_294_743 148
28 3300042012 Ga0439455_0010021 Ga0439455_0010021_1345_1794 148
29 3300005354 Ga0070675_101085642 Ga0070675_1010856422 149
30 3300009036 Ga0105244_10382601 Ga0105244_103826011 149
31 3300041451 Ga0451791_0799676 Ga0451791_0799676_615_1064 149
32 3300041453 Ga0451797_0186243 Ga0451797_0186243_75_524 149
33 3300041459 Ga0451800_0748042 Ga0451800_0748042_175_624 149
34 3300041486 Ga0451807_1733353 Ga0451807_1733353_309_758 149
35 3300041509 Ga0451843_0142188 Ga0451843_0142188_419_868 149
36 3300041509 Ga0451843_1009812 Ga0451843_1009812_968_1417 149
37 3300041512 Ga0451853_2835984 Ga0451853_2835984_31_480 149
38 3300046663 Ga0495635_0369918 Ga0495635_0369918_154_603 149
39 3300048917 Ga0496114_0054832 Ga0496114_0054832_2371_2820 149
40 3300049571 Ga0501034_0002857 Ga0501034_0002857_1352_1801 149
41 3300049571 Ga0501034_0147569 Ga0501034_0147569_1155_1604 149
42 iso_pu_bacteria 2554235005 2554258559 149
43 iso_pu_bacteria 2808606982 2811848300 149
44 3300005842 Ga0068858_100000074 Ga0068858_10000007446 150
45 3300009177 Ga0105248_10000329 Ga0105248_1000032961 150
46 3300014325 Ga0163163_10063765 Ga0163163_100637653 150
47 3300014968 Ga0157379_10000011 Ga0157379_1000001157 150
48 3300025941 Ga0207711_10000270 Ga0207711_100002704 150
49 3300026035 Ga0207703_10000066 Ga0207703_1000006670 150
50 3300026067 Ga0207678_11117127 Ga0207678_111171271 150
51 3300033180 Ga0307510_10271494 Ga0307510_102714942 150
52 iso_pu_bacteria 2508501039 2508676229 151
53 iso_pu_bacteria 2517572101 2517763441 151
54 iso_pu_bacteria 2527291627 2528204410 151
55 iso_pu_bacteria 2527291629 2528214137 151
56 iso_pu_bacteria 2546825537 2546948247 151
57 iso_pu_bacteria 2547132111 2547406862 151
58 iso_pu_bacteria 2576861822 2579749137 151
59 iso_pu_bacteria 2579778521 2579852140 151
60 iso_pu_bacteria 2582581313 2585304796 151
61 iso_pu_bacteria 2582581314 2585319476 151
62 iso_pu_bacteria 2616644814 2616700762 151
63 iso_pu_bacteria 2619618881 2619854737 151
64 iso_pu_bacteria 2619619003 2620351174 151
65 iso_pu_bacteria 2626541554 2626637774 151
66 iso_pu_bacteria 2643221548 2643759780 151
67 iso_pu_bacteria 2643221578 2643897905 151
68 iso_pu_bacteria 2643221587 2643944658 151
69 iso_pu_bacteria 2643221601 2644018666 151
70 iso_pu_bacteria 2643221631 2644179801 151
71 iso_pu_bacteria 2643221647 2644269282 151
72 iso_pu_bacteria 2643221670 2644385419 151
73 iso_pu_bacteria 2643221673 2644409050 151
74 iso_pu_bacteria 2643221677 2644431556 151
75 iso_pu_bacteria 2643221678 2644436414 151
76 iso_pu_bacteria 2643221714 2644625740 151
77 iso_pu_bacteria 2671180195 2671834005 151
78 iso_pu_bacteria 2684623035 2686535859 151
79 iso_pu_bacteria 2684623036 2686542538 151
80 iso_pu_bacteria 2687453737 2689961512 151
81 iso_pu_bacteria 2687453743 2689992878 151
82 iso_pu_bacteria 2710264753 2710603151 151
83 iso_pu_bacteria 2767802112 2768646020 151
84 iso_pu_bacteria 2773857922 2774852161 151
85 iso_pu_bacteria 2773857924 2774865275 151
86 iso_pu_bacteria 2784132148 2784587889 151
87 iso_pu_bacteria 2784746768 2785368612 151
88 iso_pu_bacteria 2786546132 2786669718 151
89 iso_pu_bacteria 2791355406 2793976122 151
90 iso_pu_bacteria 2802429296 2804844904 151
91 iso_pu_bacteria 2808606359 2808841298 151
92 iso_pu_bacteria 2808606375 2808919819 151
93 iso_pu_bacteria 2808606448 2809231476 151
94 iso_pu_bacteria 2811994879 2812358958 151
95 iso_pu_bacteria 2811994917 2812481208 151
96 iso_pu_bacteria 2816332119 2816424473 151
97 iso_pu_bacteria 2818991463 2819693648 151
98 iso_pu_bacteria 2818991472 2819742828 151
99 iso_pu_bacteria 2852635781 2852642197 151
100 iso_pu_bacteria 2862178590 2862184870 151
101 iso_pu_bacteria 2862281513 2862288117 151
102 iso_pu_bacteria 2862290372 2862291916 151
103 iso_pu_bacteria 2862574272 2862579973 151
104 iso_pu_bacteria 2862705112 2862711041 151
105 iso_pu_bacteria 2867428634 2867437316 151
106 iso_pu_bacteria 2867475112 2867479693 151
107 iso_pu_bacteria 2873151551 2873156531 151
108 iso_pu_bacteria 2875391855 2875393816 151
109 iso_pu_bacteria 2877676314 2877681899 151
110 iso_pu_bacteria 2895880812 2895888554 151
111 iso_pu_bacteria 2912715099 2912720872 151
112 iso_pu_bacteria 2912723979 2912724988 151
113 iso_pu_bacteria 2918501144 2918503846 151
114 iso_pu_bacteria 2919468124 2919468697 151
115 iso_pu_bacteria 2946045630 2946050836 151
116 iso_pu_bacteria 2946064051 2946066919 151
117 iso_pu_bacteria 2946072368 2946075243 151
118 iso_pu_bacteria 2947224130 2947230316 151
119 iso_pu_bacteria 2954002825 2954003631 151
120 iso_pu_bacteria 2954380949 2954387037 151
121 iso_pu_bacteria 2954673503 2954676143 151
122 iso_pu_bacteria 2954682443 2954688024 151
123 iso_pu_bacteria 2954691527 2954697874 151
124 iso_pu_bacteria 2954701450 2954704342 151
125 iso_pu_bacteria 2954711539 2954716986 151
126 iso_pu_bacteria 2954721474 2954726937 151
127 iso_pu_bacteria 2954731030 2954734860 151
128 iso_pu_bacteria 2954740390 2954745858 151
129 iso_pu_bacteria 2954749733 2954753732 151
130 iso_pu_bacteria 2954759201 2954764831 151
131 iso_pu_bacteria 2966598605 2966603260 151
132 iso_pu_bacteria 2990044586 2990046530 151
133 iso_pu_bacteria 2990059506 2990061856 151
134 iso_pu_bacteria 2997451912 2997456572 151
135 iso_pu_bacteria 2997600082 2997608142 151
136 iso_pu_bacteria 3006321560 3006321807 151
137 iso_pu_bacteria 3006393351 3006399662 151
138 iso_pu_bacteria 3006493962 3006501796 151
139 iso_pu_bacteria 637000116 637878494 151
140 iso_pu_bacteria 8002775197 8002776629 151
141 iso_pu_bacteria 8008485437 8008488812 151
142 iso_pu_bacteria 8008574985 8008579589 151
143 iso_pu_bacteria 8023623736 8023629294 151
144 iso_pu_bacteria 8025413630 8025419342 151
145 iso_pu_bacteria 8025478263 8025485389 151
146 iso_pu_bacteria 8025524527 8025528295 151
147 iso_pu_bacteria 8033684223 8033686342 151
148 iso_pu_bacteria 8047893842 8047898923 151
149 iso_pu_bacteria 8048127548 8048127715 151
150 iso_pu_bacteria 8048356638 8048359996 151
151 iso_pu_bacteria 8048369669 8048375881 151
152 iso_pu_bacteria 8048379754 8048382326 151
153 iso_pu_bacteria 8054913762 8054914030 151
154 iso_pu_bacteria 8054920844 8054925481 151
155 iso_pu_bacteria 8055066027 8055074328 151
156 iso_pu_bacteria 8055157932 8055163185 151
157 iso_pu_bacteria 8056054917 8056054946 151
158 iso_pu_bacteria 8056447290 8056452366 151
159 iso_pu_bacteria 8056667051 8056667508 151
160 iso_pu_bacteria 8056829672 8056833929 151
161 3300035410 Ga0373924_0465525 Ga0373924_0465525_27_485 152
162 3300035725 Ga0373947_0212576 Ga0373947_0212576_546_1004 152
163 3300036401 Ga0373937_0407256 Ga0373937_0407256_118_576 152
164 3300046459 Ga0495629_0568082 Ga0495629_0568082_112_570 152
165 3300005335 Ga0070666_10003675 Ga0070666_100036757 153
166 3300005347 Ga0070668_100405861 Ga0070668_1004058612 153
167 3300005355 Ga0070671_100241920 Ga0070671_1002419201 153
168 3300005367 Ga0070667_100018295 Ga0070667_1000182954 153
169 3300005445 Ga0070708_100059206 Ga0070708_1000592063 153
170 3300005544 Ga0070686_100465872 Ga0070686_1004658721 153
171 3300005548 Ga0070665_100103226 Ga0070665_1001032262 153
172 3300005841 Ga0068863_100000271 Ga0068863_1000002714 153
173 3300005842 Ga0068858_100002463 Ga0068858_1000024634 153
174 3300005843 Ga0068860_100000017 Ga0068860_10000001777 153
175 3300009177 Ga0105248_10657488 Ga0105248_106574883 153
176 3300025903 Ga0207680_10009015 Ga0207680_100090155 153
177 3300025972 Ga0207668_10030636 Ga0207668_100306364 153
178 3300025986 Ga0207658_11084071 Ga0207658_110840711 153
179 3300026035 Ga0207703_10010385 Ga0207703_100103855 153
180 3300026088 Ga0207641_10006406 Ga0207641_1000640610 153
181 3300028379 Ga0268266_10003027 Ga0268266_100030275 153
182 3300028381 Ga0268264_10000033 Ga0268264_10000033165 153
183 3300044656 Ga0466969_0215357 Ga0466969_0215357_365_859 153
184 3300044901 Ga0466960_0830493 Ga0466960_0830493_28_489 153
185 3300048903 Ga0496100_0324726 Ga0496100_0324726_615_1106 153
186 3300048904 Ga0496101_0132276 Ga0496101_0132276_1353_1844 153
187 3300048905 Ga0496102_0591295 Ga0496102_0591295_464_925 153
188 3300048907 Ga0496104_0472179 Ga0496104_0472179_61_552 153
189 3300048912 Ga0496109_0441593 Ga0496109_0441593_609_1100 153
190 3300048913 Ga0496110_0835610 Ga0496110_0835610_137_628 153
191 3300048914 Ga0496111_0718134 Ga0496111_0718134_54_545 153
192 3300048916 Ga0496113_1139383 Ga0496113_1139383_49_531 153
193 iso_pu_bacteria 8054160619 8054165027 153
194 3300005937 Ga0081455_10000038 Ga0081455_10000038134 154
195 3300009177 Ga0105248_10042603 Ga0105248_100426033 154
196 3300025941 Ga0207711_10025120 Ga0207711_100251204 154
197 3300031852 Ga0307410_10606659 Ga0307410_106066592 154
198 3300044694 Ga0466963_0231550 Ga0466963_0231550_303_767 154
199 3300044735 Ga0466968_0160230 Ga0466968_0160230_88_552 154
200 3300044765 Ga0466970_0437382 Ga0466970_0437382_50_514 154
201 3300045976 Ga0466967_0759544 Ga0466967_0759544_63_527 154
202 3300048921 Ga0496118_0023433 Ga0496118_0023433_2921_3415 154
203 3300049569 Ga0501032_0211887 Ga0501032_0211887_645_1109 154
204 3300049571 Ga0501034_0021523 Ga0501034_0021523_4900_5364 154
205 3300049572 Ga0501036_0000627 Ga0501036_0000627_22770_23234 154
206 3300049573 Ga0501037_0006911 Ga0501037_0006911_5876_6340 154
207 3300049574 Ga0501038_0017684 Ga0501038_0017684_4732_5196 154
208 3300049575 Ga0501039_0034037 Ga0501039_0034037_3401_3865 154
209 3300049578 Ga0501042_0003012 Ga0501042_0003012_2953_3417 154
210 3300049579 Ga0501043_0002045 Ga0501043_0002045_3651_4115 154
211 3300049581 Ga0501047_0009755 Ga0501047_0009755_1790_2254 154
212 3300049582 Ga0501048_0003714 Ga0501048_0003714_6665_7129 154
213 3300049589 Ga0501073_0799803 Ga0501073_0799803_72_536 154
214 3300049590 Ga0501074_0000296 Ga0501074_0000296_25225_25689 154
215 3300049592 Ga0501076_0585960 Ga0501076_0585960_84_548 154
216 3300049742 Ga0501080_1084503 Ga0501080_1084503_123_587 154
217 3300049823 Ga0501044_0086845 Ga0501044_0086845_952_1416 154
218 3300049824 Ga0501045_0070710 Ga0501045_0070710_1132_1596 154
219 iso_pu_bacteria 8055172936 8055179552 154
220 3300001979 JGI24740J21852_10068568 JGI24740J21852_100685682 155
221 3300001989 JGI24739J22299_10022301 JGI24739J22299_100223012 155
222 3300001989 JGI24739J22299_10182026 JGI24739J22299_101820262 155
223 3300001990 JGI24737J22298_10008180 JGI24737J22298_100081803 155
224 3300002067 JGI24735J21928_10188688 JGI24735J21928_101886881 155
225 3300003320 rootH2_10171867 rootH2_101718672 155
226 3300003323 rootH1_10027836 rootH1_100278362 155
227 3300003354 JGI25160J50197_1020109 JGI25160J50197_10201092 155
228 3300003578 Ga0006562J51391_1094426 Ga0006562J51391_10944262 155
229 3300003578 Ga0006562J51391_1109822 Ga0006562J51391_11098221 155
230 3300003856 Ga0058692_1048845 Ga0058692_10488451 155
231 3300005329 Ga0070683_100262476 Ga0070683_1002624762 155
232 3300005329 Ga0070683_100366079 Ga0070683_1003660792 155
233 3300005334 Ga0068869_101124483 Ga0068869_1011244831 155
234 3300005344 Ga0070661_100766311 Ga0070661_1007663111 155
235 3300005347 Ga0070668_100829628 Ga0070668_1008296281 155
236 3300005366 Ga0070659_100859924 Ga0070659_1008599241 155
237 3300005436 Ga0070713_100895120 Ga0070713_1008951202 155
238 3300005437 Ga0070710_10214923 Ga0070710_102149233 155
239 3300005439 Ga0070711_100884605 Ga0070711_1008846052 155
240 3300005455 Ga0070663_100024525 Ga0070663_1000245252 155
241 3300005455 Ga0070663_100141730 Ga0070663_1001417302 155
242 3300005467 Ga0070706_101168259 Ga0070706_1011682591 155
243 3300005468 Ga0070707_101067006 Ga0070707_1010670062 155
244 3300005471 Ga0070698_100143021 Ga0070698_1001430212 155
245 3300005539 Ga0068853_100111278 Ga0068853_1001112782 155
246 3300005539 Ga0068853_100588571 Ga0068853_1005885711 155
247 3300005548 Ga0070665_100025085 Ga0070665_1000250854 155
248 3300005548 Ga0070665_100030936 Ga0070665_1000309364 155
249 3300005548 Ga0070665_100993081 Ga0070665_1009930812 155
250 3300005563 Ga0068855_100002515 Ga0068855_10000251517 155
251 3300005564 Ga0070664_100739406 Ga0070664_1007394062 155
252 3300005577 Ga0068857_100018695 Ga0068857_1000186951 155
253 3300005578 Ga0068854_100004644 Ga0068854_1000046443 155
254 3300005614 Ga0068856_100037419 Ga0068856_1000374194 155
255 3300005614 Ga0068856_100076400 Ga0068856_1000764005 155
256 3300005614 Ga0068856_100342594 Ga0068856_1003425942 155
257 3300005614 Ga0068856_100832558 Ga0068856_1008325581 155
258 3300005614 Ga0068856_101565129 Ga0068856_1015651292 155
259 3300005616 Ga0068852_100040818 Ga0068852_1000408183 155
260 3300005617 Ga0068859_101838933 Ga0068859_1018389332 155
261 3300005834 Ga0068851_10152574 Ga0068851_101525743 155
262 3300005834 Ga0068851_10186590 Ga0068851_101865902 155
263 3300005840 Ga0068870_10556417 Ga0068870_105564172 155
264 3300005937 Ga0081455_10064031 Ga0081455_100640313 155
265 3300006042 Ga0075368_10003220 Ga0075368_100032202 155
266 3300006048 Ga0075363_100096824 Ga0075363_1000968242 155
267 3300006048 Ga0075363_100374840 Ga0075363_1003748401 155
268 3300006163 Ga0070715_10420532 Ga0070715_104205321 155
269 3300006173 Ga0070716_100108207 Ga0070716_1001082072 155
270 3300006173 Ga0070716_100740614 Ga0070716_1007406142 155
271 3300006175 Ga0070712_100138932 Ga0070712_1001389323 155
272 3300006178 Ga0075367_10004802 Ga0075367_100048022 155
273 3300006931 Ga0097620_101838457 Ga0097620_1018384572 155
274 3300007788 Ga0099795_10067347 Ga0099795_100673472 155
275 3300009093 Ga0105240_10076806 Ga0105240_100768061 155
276 3300009098 Ga0105245_10503484 Ga0105245_105034842 155
277 3300009098 Ga0105245_10928749 Ga0105245_109287492 155
278 3300009098 Ga0105245_11574576 Ga0105245_115745762 155
279 3300009147 Ga0114129_10127582 Ga0114129_101275823 155
280 3300009174 Ga0105241_10001550 Ga0105241_100015502 155
281 3300009174 Ga0105241_10915110 Ga0105241_109151102 155
282 3300009545 Ga0105237_10041436 Ga0105237_100414361 155
283 3300009551 Ga0105238_10063772 Ga0105238_100637723 155
284 3300009551 Ga0105238_10699710 Ga0105238_106997102 155
285 3300009551 Ga0105238_10791931 Ga0105238_107919312 155
286 3300009553 Ga0105249_10992092 Ga0105249_109920922 155
287 3300009553 Ga0105249_11484714 Ga0105249_114847141 155
288 3300009553 Ga0105249_11666359 Ga0105249_116663591 155
289 3300010375 Ga0105239_10233827 Ga0105239_102338272 155
290 3300010375 Ga0105239_10381729 Ga0105239_103817291 155
291 3300010375 Ga0105239_11405164 Ga0105239_114051641 155
292 3300011119 Ga0105246_10021803 Ga0105246_100218034 155
293 3300011119 Ga0105246_10118602 Ga0105246_101186022 155
294 3300011119 Ga0105246_11089237 Ga0105246_110892372 155
295 3300013105 Ga0157369_10089205 Ga0157369_100892052 155
296 3300013105 Ga0157369_10291546 Ga0157369_102915462 155
297 3300013105 Ga0157369_10586593 Ga0157369_105865932 155
298 3300013105 Ga0157369_10819480 Ga0157369_108194802 155
299 3300013296 Ga0157374_10417021 Ga0157374_104170212 155
300 3300013296 Ga0157374_11363244 Ga0157374_113632441 155
301 3300013306 Ga0163162_11282725 Ga0163162_112827251 155
302 3300013307 Ga0157372_10105482 Ga0157372_101054822 155
303 3300013307 Ga0157372_10517806 Ga0157372_105178062 155
304 3300014497 Ga0182008_10004862 Ga0182008_100048629 155
305 3300014969 Ga0157376_10613314 Ga0157376_106133141 155
306 3300015261 Ga0182006_1042073 Ga0182006_10420732 155
307 3300015262 Ga0182007_10017762 Ga0182007_100177622 155
308 3300015265 Ga0182005_1048093 Ga0182005_10480932 155
309 3300015688 Ga0183367_1006 Ga0183367_1006456 155
310 3300025302 Ga0207426_1003154 Ga0207426_10031543 155
311 3300025302 Ga0207426_1010499 Ga0207426_10104993 155
312 3300025302 Ga0207426_1011444 Ga0207426_10114442 155
313 3300025302 Ga0207426_1011888 Ga0207426_10118882 155
314 3300025321 Ga0207656_10550560 Ga0207656_105505602 155
315 3300025901 Ga0207688_10283449 Ga0207688_102834492 155
316 3300025903 Ga0207680_10816304 Ga0207680_108163041 155
317 3300025904 Ga0207647_10001305 Ga0207647_1000130513 155
318 3300025904 Ga0207647_10015896 Ga0207647_100158963 155
319 3300025906 Ga0207699_10228239 Ga0207699_102282392 155
320 3300025913 Ga0207695_10002038 Ga0207695_100020381 155
321 3300025914 Ga0207671_10000773 Ga0207671_1000077311 155
322 3300025915 Ga0207693_10154321 Ga0207693_101543212 155
323 3300025915 Ga0207693_10197015 Ga0207693_101970153 155
324 3300025924 Ga0207694_10001277 Ga0207694_1000127713 155
325 3300025924 Ga0207694_10386338 Ga0207694_103863382 155
326 3300025927 Ga0207687_10313309 Ga0207687_103133092 155
327 3300025928 Ga0207700_10896748 Ga0207700_108967482 155
328 3300025928 Ga0207700_11151744 Ga0207700_111517442 155
329 3300025929 Ga0207664_10035146 Ga0207664_100351462 155
330 3300025932 Ga0207690_10011468 Ga0207690_100114684 155
331 3300025939 Ga0207665_10058996 Ga0207665_100589962 155
332 3300025940 Ga0207691_10889878 Ga0207691_108898781 155
333 3300025944 Ga0207661_10246711 Ga0207661_102467112 155
334 3300025945 Ga0207679_10930653 Ga0207679_109306531 155
335 3300025949 Ga0207667_10184168 Ga0207667_101841682 155
336 3300025981 Ga0207640_10487002 Ga0207640_104870021 155
337 3300026041 Ga0207639_10067698 Ga0207639_100676983 155
338 3300026067 Ga0207678_10035871 Ga0207678_100358712 155
339 3300026078 Ga0207702_10068391 Ga0207702_100683912 155
340 3300026078 Ga0207702_10187468 Ga0207702_101874682 155
341 3300026078 Ga0207702_10318700 Ga0207702_103187001 155
342 3300026116 Ga0207674_10015589 Ga0207674_100155896 155
343 3300026121 Ga0207683_10685783 Ga0207683_106857832 155
344 3300026142 Ga0207698_10025948 Ga0207698_100259482 155
345 3300027312 Ga0209371_1010292 Ga0209371_10102923 155
346 3300028379 Ga0268266_10028709 Ga0268266_100287094 155
347 3300028379 Ga0268266_10465160 Ga0268266_104651602 155
348 3300028786 Ga0307517_10003800 Ga0307517_1000380011 155
349 3300028786 Ga0307517_10018307 Ga0307517_100183073 155
350 3300028794 Ga0307515_10002026 Ga0307515_1000202621 155
351 3300030521 Ga0307511_10001267 Ga0307511_1000126716 155
352 3300030521 Ga0307511_10067233 Ga0307511_100672333 155
353 3300030521 Ga0307511_10131991 Ga0307511_101319913 155
354 3300030522 Ga0307512_10004012 Ga0307512_100040123 155
355 3300030522 Ga0307512_10120662 Ga0307512_101206622 155
356 3300030735 Ga0316178_1131002 Ga0316178_11310022 155
357 3300030742 Ga0316183_1211421 Ga0316183_12114212 155
358 3300030744 Ga0316181_1147835 Ga0316181_11478353 155
359 3300030745 Ga0316182_1358891 Ga0316182_13588912 155
360 3300031251 Ga0265327_10000836 Ga0265327_1000083625 155
361 3300031456 Ga0307513_10000001 Ga0307513_100000011203 155
362 3300031456 Ga0307513_10069728 Ga0307513_100697283 155
363 3300031507 Ga0307509_10008457 Ga0307509_100084574 155
364 3300031507 Ga0307509_10015152 Ga0307509_100151523 155
365 3300031507 Ga0307509_10155262 Ga0307509_101552622 155
366 3300031616 Ga0307508_10005831 Ga0307508_100058318 155
367 3300031616 Ga0307508_10056008 Ga0307508_100560082 155
368 3300031649 Ga0307514_10014502 Ga0307514_100145021 155
369 3300031649 Ga0307514_10092567 Ga0307514_100925672 155
370 3300031649 Ga0307514_10132056 Ga0307514_101320562 155
371 3300031727 Ga0316576_10016048 Ga0316576_100160482 155
372 3300031728 Ga0316578_10636815 Ga0316578_106368151 155
373 3300031730 Ga0307516_10052872 Ga0307516_100528722 155
374 3300031730 Ga0307516_10069322 Ga0307516_100693222 155
375 3300031730 Ga0307516_10120977 Ga0307516_101209772 155
376 3300031731 Ga0307405_11573266 Ga0307405_115732661 155
377 3300031824 Ga0307413_10554152 Ga0307413_105541521 155
378 3300031838 Ga0307518_10119709 Ga0307518_101197091 155
379 3300032002 Ga0307416_100073304 Ga0307416_1000733042 155
380 3300032002 Ga0307416_100547280 Ga0307416_1005472802 155
381 3300033179 Ga0307507_10061631 Ga0307507_100616313 155
382 3300033180 Ga0307510_10010159 Ga0307510_100101599 155
383 3300033180 Ga0307510_10036555 Ga0307510_100365554 155
384 3300033180 Ga0307510_10093465 Ga0307510_100934652 155
385 3300035398 Ga0316574_0001605 Ga0316574_0001605_4605_5081 155
386 3300035725 Ga0373947_0128621 Ga0373947_0128621_510_983 155
387 3300037466 Ga0395898_0002956 Ga0395898_0002956_11101_11595 155
388 3300037466 Ga0395898_0007126 Ga0395898_0007126_8622_9107 155
389 3300037853 Ga0436364_0039243 Ga0436364_0039243_85_588 155
390 3300037853 Ga0436364_0260305 Ga0436364_0260305_6992_7480 155
391 3300038443 Ga0395901_0017720 Ga0395901_0017720_6279_6773 155
392 3300041404 Ga0439436_0001661 Ga0439436_0001661_3789_4256 155
393 3300041404 Ga0439436_0003853 Ga0439436_0003853_2655_3140 155
394 3300041406 Ga0439439_0004962 Ga0439439_0004962_2294_2761 155
395 3300041411 Ga0439466_0015240 Ga0439466_0015240_287_754 155
396 3300041456 Ga0451795_1505047 Ga0451795_1505047_15_500 155
397 3300041498 Ga0451841_0755329 Ga0451841_0755329_1557_2042 155
398 3300041501 Ga0451845_0686953 Ga0451845_0686953_125_613 155
399 3300041512 Ga0451853_0881640 Ga0451853_0881640_619_1107 155
400 3300041999 Ga0439433_0013258 Ga0439433_0013258_377_844 155
401 3300042002 Ga0439442_029566 Ga0439442_029566_166_633 155
402 3300042002 Ga0439442_038173 Ga0439442_038173_211_678 155
403 3300042002 Ga0439442_042325 Ga0439442_042325_434_919 155
404 3300042002 Ga0439442_098709 Ga0439442_098709_117_602 155
405 3300042005 Ga0439448_0011297 Ga0439448_0011297_1867_2352 155
406 3300042007 Ga0439449_0001026 Ga0439449_0001026_8591_9076 155
407 3300042007 Ga0439449_0006120 Ga0439449_0006120_3171_3638 155
408 3300042007 Ga0439449_0014464 Ga0439449_0014464_2144_2629 155
409 3300042007 Ga0439449_0014736 Ga0439449_0014736_1042_1509 155
410 3300042012 Ga0439455_0035974 Ga0439455_0035974_35_520 155
411 3300042014 Ga0439457_004751 Ga0439457_004751_2763_3248 155
412 3300042014 Ga0439457_022509 Ga0439457_022509_902_1369 155
413 3300042015 Ga0439462_0005725 Ga0439462_0005725_1250_1735 155
414 3300042138 Ga0450903_000082 Ga0450903_000082_11270_11755 155
415 3300042138 Ga0450903_008844 Ga0450903_008844_671_1162 155
416 3300042145 Ga0450906_062960 Ga0450906_062960_87_554 155
417 3300042157 Ga0439458_0002493 Ga0439458_0002493_418_903 155
418 3300044656 Ga0466969_0003067 Ga0466969_0003067_6518_7000 155
419 3300044656 Ga0466969_0016217 Ga0466969_0016217_3102_3587 155
420 3300044656 Ga0466969_0128213 Ga0466969_0128213_328_816 155
421 3300044658 Ga0466972_0001201 Ga0466972_0001201_3864_4349 155
422 3300044658 Ga0466972_0003162 Ga0466972_0003162_3291_3779 155
423 3300044658 Ga0466972_0518533 Ga0466972_0518533_26_517 155
424 3300044683 Ga0466965_0000676 Ga0466965_0000676_1218_1703 155
425 3300044683 Ga0466965_0247607 Ga0466965_0247607_62_550 155
426 3300044683 Ga0466965_0351491 Ga0466965_0351491_85_570 155
427 3300044684 Ga0466966_0002187 Ga0466966_0002187_10847_11332 155
428 3300044684 Ga0466966_0006304 Ga0466966_0006304_2805_3290 155
429 3300044684 Ga0466966_0010729 Ga0466966_0010729_71_559 155
430 3300044684 Ga0466966_0320383 Ga0466966_0320383_79_561 155
431 3300044693 Ga0466961_0002111 Ga0466961_0002111_10797_11282 155
432 3300044693 Ga0466961_0009728 Ga0466961_0009728_5315_5800 155
433 3300044693 Ga0466961_0052837 Ga0466961_0052837_92_574 155
434 3300044693 Ga0466961_0066048 Ga0466961_0066048_798_1271 155
435 3300044693 Ga0466961_0154866 Ga0466961_0154866_282_758 155
436 3300044693 Ga0466961_0189307 Ga0466961_0189307_276_755 155
437 3300044694 Ga0466963_0000826 Ga0466963_0000826_4179_4664 155
438 3300044694 Ga0466963_0059468 Ga0466963_0059468_232_717 155
439 3300044706 Ga0466964_0003907 Ga0466964_0003907_4795_5280 155
440 3300044706 Ga0466964_0134692 Ga0466964_0134692_281_769 155
441 3300044706 Ga0466964_0367195 Ga0466964_0367195_119_610 155
442 3300044719 Ga0466971_0000710 Ga0466971_0000710_5329_5814 155
443 3300044719 Ga0466971_0019236 Ga0466971_0019236_1065_1550 155
444 3300044719 Ga0466971_0053943 Ga0466971_0053943_1310_1783 155
445 3300044719 Ga0466971_0071863 Ga0466971_0071863_712_1194 155
446 3300044735 Ga0466968_0282624 Ga0466968_0282624_261_746 155
447 3300044765 Ga0466970_0001444 Ga0466970_0001444_236_721 155
448 3300044765 Ga0466970_0002527 Ga0466970_0002527_4279_4764 155
449 3300044765 Ga0466970_0039654 Ga0466970_0039654_1698_2183 155
450 3300044765 Ga0466970_0120152 Ga0466970_0120152_234_731 155
451 3300044842 Ga0466957_0000835 Ga0466957_0000835_10848_11333 155
452 3300044901 Ga0466960_0001092 Ga0466960_0001092_6118_6603 155
453 3300045049 Ga0466959_0002801 Ga0466959_0002801_6821_7306 155
454 3300045049 Ga0466959_0023538 Ga0466959_0023538_1021_1503 155
455 3300045049 Ga0466959_0038264 Ga0466959_0038264_2460_2945 155
456 3300045049 Ga0466959_0068438 Ga0466959_0068438_1268_1741 155
457 3300045836 Ga0466958_0000131 Ga0466958_0000131_10844_11329 155
458 3300045836 Ga0466958_0040078 Ga0466958_0040078_818_1291 155
459 3300045836 Ga0466958_0094738 Ga0466958_0094738_1176_1661 155
460 3300045836 Ga0466958_0195262 Ga0466958_0195262_400_873 155
461 3300045836 Ga0466958_0591695 Ga0466958_0591695_181_660 155
462 3300045976 Ga0466967_0004265 Ga0466967_0004265_239_724 155
463 3300045976 Ga0466967_0037002 Ga0466967_0037002_3352_3837 155
464 3300045976 Ga0466967_0182323 Ga0466967_0182323_988_1476 155
465 3300045976 Ga0466967_0587664 Ga0466967_0587664_50_535 155
466 3300045976 Ga0466967_0600736 Ga0466967_0600736_518_1057 155
467 3300045976 Ga0466967_0745825 Ga0466967_0745825_430_918 155
468 3300046454 Ga0495592_0016180 Ga0495592_0016180_1474_1959 155
469 3300046454 Ga0495592_0025554 Ga0495592_0025554_1891_2376 155
470 3300046454 Ga0495592_0060863 Ga0495592_0060863_1992_2474 155
471 3300046454 Ga0495592_0066916 Ga0495592_0066916_1829_2317 155
472 3300046455 Ga0495603_0000262 Ga0495603_0000262_24537_25025 155
473 3300046455 Ga0495603_0005677 Ga0495603_0005677_378_866 155
474 3300046455 Ga0495603_0011907 Ga0495603_0011907_3208_3690 155
475 3300046455 Ga0495603_0013959 Ga0495603_0013959_158_646 155
476 3300046455 Ga0495603_0208648 Ga0495603_0208648_543_1031 155
477 3300046455 Ga0495603_0659725 Ga0495603_0659725_74_568 155
478 3300046459 Ga0495629_0000568 Ga0495629_0000568_11243_11731 155
479 3300046459 Ga0495629_0020591 Ga0495629_0020591_2348_2836 155
480 3300046459 Ga0495629_0030504 Ga0495629_0030504_1675_2160 155
481 3300046459 Ga0495629_0044422 Ga0495629_0044422_302_787 155
482 3300046459 Ga0495629_0064829 Ga0495629_0064829_1753_2247 155
483 3300046459 Ga0495629_0077264 Ga0495629_0077264_1697_2179 155
484 3300046459 Ga0495629_0125074 Ga0495629_0125074_1147_1635 155
485 3300046459 Ga0495629_0530563 Ga0495629_0530563_288_776 155
486 3300046460 Ga0495638_0103740 Ga0495638_0103740_357_845 155
487 3300046460 Ga0495638_0169866 Ga0495638_0169866_48_533 155
488 3300046460 Ga0495638_0373842 Ga0495638_0373842_179_670 155
489 3300046462 Ga0495651_0002804 Ga0495651_0002804_6409_6891 155
490 3300046462 Ga0495651_0005834 Ga0495651_0005834_6804_7289 155
491 3300046462 Ga0495651_0014386 Ga0495651_0014386_770_1258 155
492 3300046462 Ga0495651_0073443 Ga0495651_0073443_158_643 155
493 3300046462 Ga0495651_0077267 Ga0495651_0077267_1773_2261 155
494 3300046462 Ga0495651_0259486 Ga0495651_0259486_24_503 155
495 3300046462 Ga0495651_0761966 Ga0495651_0761966_47_520 155
496 3300046463 Ga0495653_0006299 Ga0495653_0006299_4892_5377 155
497 3300046463 Ga0495653_0208905 Ga0495653_0208905_183_671 155
498 3300046472 Ga0495580_0078450 Ga0495580_0078450_164_652 155
499 3300046473 Ga0495582_0208112 Ga0495582_0208112_88_576 155
500 3300046474 Ga0495605_0156828 Ga0495605_0156828_487_972 155
501 3300046475 Ga0495639_0128546 Ga0495639_0128546_379_873 155
502 3300046476 Ga0495662_0003168 Ga0495662_0003168_3828_4313 155
503 3300046476 Ga0495662_0023317 Ga0495662_0023317_1043_1531 155
504 3300046476 Ga0495662_0028494 Ga0495662_0028494_559_1053 155
505 3300046476 Ga0495662_0069514 Ga0495662_0069514_1052_1540 155
506 3300046476 Ga0495662_0086708 Ga0495662_0086708_211_696 155
507 3300046477 Ga0495664_0016373 Ga0495664_0016373_2365_2850 155
508 3300046477 Ga0495664_0038406 Ga0495664_0038406_892_1377 155
509 3300046477 Ga0495664_0258661 Ga0495664_0258661_397_885 155
510 3300046492 Ga0495585_0007532 Ga0495585_0007532_317_805 155
511 3300046492 Ga0495585_0121389 Ga0495585_0121389_787_1278 155
512 3300046492 Ga0495585_0257069 Ga0495585_0257069_233_721 155
513 3300046499 Ga0495594_0010108 Ga0495594_0010108_3342_3836 155
514 3300046499 Ga0495594_0040807 Ga0495594_0040807_250_735 155
515 3300046499 Ga0495594_0060770 Ga0495594_0060770_1305_1796 155
516 3300046501 Ga0495607_0085096 Ga0495607_0085096_1170_1655 155
517 3300046506 Ga0495583_0050899 Ga0495583_0050899_414_902 155
518 3300046507 Ga0495606_0012769 Ga0495606_0012769_20_508 155
519 3300046511 Ga0495608_0004021 Ga0495608_0004021_3524_4009 155
520 3300046511 Ga0495608_0452370 Ga0495608_0452370_210_695 155
521 3300046512 Ga0495610_0047656 Ga0495610_0047656_1491_1979 155
522 3300046512 Ga0495610_0110806 Ga0495610_0110806_148_636 155
523 3300046513 Ga0495616_0024623 Ga0495616_0024623_1710_2198 155
524 3300046514 Ga0495618_0088917 Ga0495618_0088917_935_1423 155
525 3300046514 Ga0495618_0103514 Ga0495618_0103514_416_904 155
526 3300046515 Ga0495620_0004889 Ga0495620_0004889_5745_6233 155
527 3300046515 Ga0495620_0048083 Ga0495620_0048083_804_1292 155
528 3300046516 Ga0495628_0000688 Ga0495628_0000688_2706_3191 155
529 3300046516 Ga0495628_0171284 Ga0495628_0171284_828_1316 155
530 3300046516 Ga0495628_0974992 Ga0495628_0974992_41_523 155
531 3300046517 Ga0495630_0021554 Ga0495630_0021554_2039_2524 155
532 3300046517 Ga0495630_0074723 Ga0495630_0074723_1656_2141 155
533 3300046517 Ga0495630_0832233 Ga0495630_0832233_41_529 155
534 3300046518 Ga0495631_0010353 Ga0495631_0010353_1503_1991 155
535 3300046519 Ga0495632_0006703 Ga0495632_0006703_6450_6941 155
536 3300046520 Ga0495637_0074465 Ga0495637_0074465_843_1331 155
537 3300046522 Ga0495643_0005069 Ga0495643_0005069_7322_7813 155
538 3300046522 Ga0495643_0008442 Ga0495643_0008442_2608_3096 155
539 3300046524 Ga0495648_0086870 Ga0495648_0086870_811_1299 155
540 3300046524 Ga0495648_0250205 Ga0495648_0250205_142_633 155
541 3300046526 Ga0495666_0010110 Ga0495666_0010110_451_936 155
542 3300046526 Ga0495666_0079575 Ga0495666_0079575_519_1007 155
543 3300046526 Ga0495666_0344170 Ga0495666_0344170_132_617 155
544 3300046528 Ga0495642_0257685 Ga0495642_0257685_232_720 155
545 3300046529 Ga0495652_0004375 Ga0495652_0004375_5960_6442 155
546 3300046529 Ga0495652_0092433 Ga0495652_0092433_21_506 155
547 3300046529 Ga0495652_0141907 Ga0495652_0141907_980_1468 155
548 3300046529 Ga0495652_0346537 Ga0495652_0346537_168_656 155
549 3300046530 Ga0495654_0059565 Ga0495654_0059565_1202_1690 155
550 3300046531 Ga0495665_0000429 Ga0495665_0000429_20540_21025 155
551 3300046533 Ga0495640_0002937 Ga0495640_0002937_12126_12611 155
552 3300046533 Ga0495640_0003552 Ga0495640_0003552_11231_11719 155
553 3300046533 Ga0495640_0014341 Ga0495640_0014341_2162_2650 155
554 3300046533 Ga0495640_0082137 Ga0495640_0082137_107_592 155
555 3300046533 Ga0495640_0119518 Ga0495640_0119518_99_587 155
556 3300046536 Ga0495587_0009674 Ga0495587_0009674_4679_5164 155
557 3300046538 Ga0495609_0029135 Ga0495609_0029135_1734_2222 155
558 3300046543 Ga0495645_0008311 Ga0495645_0008311_2608_3090 155
559 3300046543 Ga0495645_0043616 Ga0495645_0043616_2532_3020 155
560 3300046543 Ga0495645_0165037 Ga0495645_0165037_24_509 155
561 3300046557 Ga0495622_0090717 Ga0495622_0090717_452_943 155
562 3300046557 Ga0495622_0097238 Ga0495622_0097238_236_724 155
563 3300046557 Ga0495622_0445511 Ga0495622_0445511_30_518 155
564 3300046558 Ga0495633_0182608 Ga0495633_0182608_364_852 155
565 3300046559 Ga0495667_0007764 Ga0495667_0007764_6762_7247 155
566 3300046559 Ga0495667_0219352 Ga0495667_0219352_124_612 155
567 3300046559 Ga0495667_0244270 Ga0495667_0244270_47_532 155
568 3300046616 Ga0495668_0079133 Ga0495668_0079133_988_1476 155
569 3300046616 Ga0495668_0390754 Ga0495668_0390754_152_643 155
570 3300046642 Ga0495634_0002265 Ga0495634_0002265_412_897 155
571 3300046642 Ga0495634_0167490 Ga0495634_0167490_859_1347 155
572 3300046642 Ga0495634_0177293 Ga0495634_0177293_454_939 155
573 3300046660 Ga0495625_0046473 Ga0495625_0046473_67_552 155
574 3300046660 Ga0495625_0084323 Ga0495625_0084323_1704_2186 155
575 3300046660 Ga0495625_0286788 Ga0495625_0286788_115_603 155
576 3300046660 Ga0495625_0344996 Ga0495625_0344996_278_763 155
577 3300046660 Ga0495625_0345081 Ga0495625_0345081_153_638 155
578 3300046663 Ga0495635_0047065 Ga0495635_0047065_1041_1526 155
579 3300046663 Ga0495635_0468489 Ga0495635_0468489_326_811 155
580 3300046663 Ga0495635_0533518 Ga0495635_0533518_245_733 155
581 3300046665 Ga0495661_0085658 Ga0495661_0085658_190_678 155
582 3300046674 Ga0495588_0009916 Ga0495588_0009916_561_1049 155
583 3300046674 Ga0495588_0011624 Ga0495588_0011624_2594_3088 155
584 3300046674 Ga0495588_0049565 Ga0495588_0049565_1495_1980 155
585 3300046674 Ga0495588_0169828 Ga0495588_0169828_49_534 155
586 3300046675 Ga0495657_0020033 Ga0495657_0020033_856_1344 155
587 3300046675 Ga0495657_0022714 Ga0495657_0022714_809_1294 155
588 3300046675 Ga0495657_0111715 Ga0495657_0111715_806_1291 155
589 3300046675 Ga0495657_0125896 Ga0495657_0125896_642_1130 155
590 3300046678 Ga0495599_0029257 Ga0495599_0029257_1002_1487 155
591 3300046678 Ga0495599_0108560 Ga0495599_0108560_688_1176 155
592 3300046679 Ga0495623_0148191 Ga0495623_0148191_454_939 155
593 3300046679 Ga0495623_0179819 Ga0495623_0179819_33_515 155
594 3300046680 Ga0495646_0060550 Ga0495646_0060550_778_1263 155
595 3300046680 Ga0495646_0104401 Ga0495646_0104401_255_743 155
596 3300046680 Ga0495646_0113806 Ga0495646_0113806_986_1468 155
597 3300046683 Ga0495658_0057104 Ga0495658_0057104_752_1243 155
598 3300046683 Ga0495658_0207499 Ga0495658_0207499_428_913 155
599 3300046689 Ga0495613_0001287 Ga0495613_0001287_17748_18236 155
600 3300046689 Ga0495613_0007095 Ga0495613_0007095_2703_3191 155
601 3300046689 Ga0495613_0051170 Ga0495613_0051170_690_1175 155
602 3300046689 Ga0495613_0137924 Ga0495613_0137924_747_1232 155
603 3300046689 Ga0495613_0165642 Ga0495613_0165642_149_634 155
604 3300046689 Ga0495613_0548080 Ga0495613_0548080_192_683 155
605 3300046689 Ga0495613_0725837 Ga0495613_0725837_93_581 155
606 3300046690 Ga0495624_0046459 Ga0495624_0046459_1843_2331 155
607 3300046690 Ga0495624_0109284 Ga0495624_0109284_1154_1645 155
608 3300046690 Ga0495624_0124359 Ga0495624_0124359_370_858 155
609 3300046691 Ga0495670_0026460 Ga0495670_0026460_1081_1572 155
610 3300046691 Ga0495670_0505265 Ga0495670_0505265_109_597 155
611 3300046692 Ga0495671_0008724 Ga0495671_0008724_1304_1789 155
612 3300046692 Ga0495671_0095564 Ga0495671_0095564_529_1014 155
613 3300046692 Ga0495671_0104635 Ga0495671_0104635_627_1118 155
614 3300046692 Ga0495671_0173720 Ga0495671_0173720_19_507 155
615 3300046694 Ga0495649_0022229 Ga0495649_0022229_618_1103 155
616 3300046694 Ga0495649_0378465 Ga0495649_0378465_20_508 155
617 3300046794 Ga0495589_0001579 Ga0495589_0001579_59_547 155
618 3300046794 Ga0495589_0035849 Ga0495589_0035849_1895_2377 155
619 3300046794 Ga0495589_0091701 Ga0495589_0091701_123_608 155
620 3300046794 Ga0495589_0109077 Ga0495589_0109077_808_1302 155
621 3300046809 Ga0495600_0003072 Ga0495600_0003072_2802_3284 155
622 3300046809 Ga0495600_0143717 Ga0495600_0143717_885_1373 155
623 3300046809 Ga0495600_0162653 Ga0495600_0162653_21_506 155
624 3300046809 Ga0495600_0302208 Ga0495600_0302208_70_558 155
625 3300046809 Ga0495600_0628982 Ga0495600_0628982_30_614 155
626 3300046810 Ga0495660_0198131 Ga0495660_0198131_107_595 155
627 3300047315 Ga0495581_0017936 Ga0495581_0017936_1473_1958 155
628 3300047315 Ga0495581_0037365 Ga0495581_0037365_2253_2741 155
629 3300047315 Ga0495581_0041107 Ga0495581_0041107_1521_2006 155
630 3300047315 Ga0495581_0109941 Ga0495581_0109941_308_796 155
631 3300047315 Ga0495581_0174347 Ga0495581_0174347_695_1186 155
632 3300047315 Ga0495581_0190859 Ga0495581_0190859_687_1181 155
633 3300047315 Ga0495581_0192963 Ga0495581_0192963_392_886 155
634 3300047317 Ga0495604_0001544 Ga0495604_0001544_6546_7031 155
635 3300047317 Ga0495604_0002658 Ga0495604_0002658_9045_9530 155
636 3300047317 Ga0495604_0006701 Ga0495604_0006701_6093_6581 155
637 3300047317 Ga0495604_0008240 Ga0495604_0008240_2405_2890 155
638 3300047317 Ga0495604_0095678 Ga0495604_0095678_1682_2170 155
639 3300047317 Ga0495604_0103562 Ga0495604_0103562_757_1245 155
640 3300047317 Ga0495604_0130910 Ga0495604_0130910_1230_1718 155
641 3300047317 Ga0495604_0483254 Ga0495604_0483254_151_633 155
642 3300047318 Ga0495636_0015287 Ga0495636_0015287_97_582 155
643 3300047318 Ga0495636_0065064 Ga0495636_0065064_233_718 155
644 3300047318 Ga0495636_0097440 Ga0495636_0097440_73_561 155
645 3300047318 Ga0495636_0425013 Ga0495636_0425013_80_568 155
646 3300047319 Ga0495674_0073300 Ga0495674_0073300_1602_2087 155
647 3300047320 Ga0495672_0418907 Ga0495672_0418907_61_549 155
648 3300047321 Ga0495676_0004653 Ga0495676_0004653_2031_2519 155
649 3300047321 Ga0495676_0005038 Ga0495676_0005038_707_1195 155
650 3300047321 Ga0495676_0010943 Ga0495676_0010943_2327_2812 155
651 3300047321 Ga0495676_0016651 Ga0495676_0016651_1815_2303 155
652 3300047321 Ga0495676_0129550 Ga0495676_0129550_504_992 155
653 3300047321 Ga0495676_0510078 Ga0495676_0510078_210_692 155
654 3300047322 Ga0495680_0169626 Ga0495680_0169626_541_1029 155
655 3300047323 Ga0495683_0063116 Ga0495683_0063116_76_561 155
656 3300047323 Ga0495683_0149261 Ga0495683_0149261_260_748 155
657 3300047443 Ga0495687_003543 Ga0495687_003543_2005_2490 155
658 3300047443 Ga0495687_006208 Ga0495687_006208_6841_7326 155
659 3300047443 Ga0495687_055720 Ga0495687_055720_276_767 155
660 3300047444 Ga0495675_0020228 Ga0495675_0020228_2235_2720 155
661 3300047444 Ga0495675_0022281 Ga0495675_0022281_285_773 155
662 3300047444 Ga0495675_0029780 Ga0495675_0029780_2444_2929 155
663 3300047444 Ga0495675_0052064 Ga0495675_0052064_1966_2451 155
664 3300047444 Ga0495675_0076561 Ga0495675_0076561_936_1424 155
665 3300047444 Ga0495675_0156950 Ga0495675_0156950_891_1379 155
666 3300047444 Ga0495675_0249975 Ga0495675_0249975_105_593 155
667 3300047444 Ga0495675_0565220 Ga0495675_0565220_139_624 155
668 3300047447 Ga0495685_005480 Ga0495685_005480_1153_1644 155
669 3300047447 Ga0495685_017229 Ga0495685_017229_1683_2168 155
670 3300047447 Ga0495685_020765 Ga0495685_020765_188_682 155
671 3300047447 Ga0495685_038200 Ga0495685_038200_1136_1624 155
672 3300047447 Ga0495685_043185 Ga0495685_043185_18_506 155
673 3300047470 Ga0495681_0004834 Ga0495681_0004834_5874_6359 155
674 3300047470 Ga0495681_0020908 Ga0495681_0020908_2810_3301 155
675 3300047471 Ga0495684_0140251 Ga0495684_0140251_326_811 155
676 3300047472 Ga0495686_0036838 Ga0495686_0036838_602_1093 155
677 3300047673 Ga0495593_0020472 Ga0495593_0020472_2574_3059 155
678 3300047673 Ga0495593_0057431 Ga0495593_0057431_425_910 155
679 3300047673 Ga0495593_0175221 Ga0495593_0175221_279_767 155
680 3300047673 Ga0495593_0188085 Ga0495593_0188085_522_1010 155
681 3300048088 Ga0495602_0004329 Ga0495602_0004329_11112_11597 155
682 3300048088 Ga0495602_0157623 Ga0495602_0157623_1067_1555 155
683 3300048088 Ga0495602_0204795 Ga0495602_0204795_225_710 155
684 3300048089 Ga0495614_0022740 Ga0495614_0022740_1359_1844 155
685 3300048089 Ga0495614_0033987 Ga0495614_0033987_479_967 155
686 3300048089 Ga0495614_0056536 Ga0495614_0056536_450_932 155
687 3300048091 Ga0495626_0025073 Ga0495626_0025073_1482_1970 155
688 3300048091 Ga0495626_0310079 Ga0495626_0310079_100_591 155
689 3300048907 Ga0496104_0260008 Ga0496104_0260008_1010_1498 155
690 3300048908 Ga0496105_1235970 Ga0496105_1235970_16_510 155
691 3300048911 Ga0496108_0053272 Ga0496108_0053272_119_607 155
692 3300048914 Ga0496111_1085344 Ga0496111_1085344_76_543 155
693 3300048916 Ga0496113_0462902 Ga0496113_0462902_524_991 155
694 3300049459 Ga0495678_107839 Ga0495678_107839_448_936 155
695 3300049539 Ga0501323_043062 Ga0501323_043062_97_582 155
696 3300049568 Ga0501031_0011192 Ga0501031_0011192_5298_5786 155
697 3300049568 Ga0501031_0029774 Ga0501031_0029774_1151_1639 155
698 3300049568 Ga0501031_0063701 Ga0501031_0063701_1784_2269 155
699 3300049568 Ga0501031_0700510 Ga0501031_0700510_83_571 155
700 3300049569 Ga0501032_0003050 Ga0501032_0003050_165_653 155
701 3300049569 Ga0501032_0017046 Ga0501032_0017046_3970_4458 155
702 3300049569 Ga0501032_0023051 Ga0501032_0023051_75_563 155
703 3300049569 Ga0501032_0141625 Ga0501032_0141625_1003_1494 155
704 3300049569 Ga0501032_0312514 Ga0501032_0312514_405_893 155
705 3300049570 Ga0501033_0009749 Ga0501033_0009749_3160_3645 155
706 3300049570 Ga0501033_0022267 Ga0501033_0022267_1115_1603 155
707 3300049570 Ga0501033_0041517 Ga0501033_0041517_1991_2479 155
708 3300049570 Ga0501033_0044508 Ga0501033_0044508_90_575 155
709 3300049570 Ga0501033_0067663 Ga0501033_0067663_773_1261 155
710 3300049570 Ga0501033_0069497 Ga0501033_0069497_975_1466 155
711 3300049570 Ga0501033_0302497 Ga0501033_0302497_47_535 155
712 3300049571 Ga0501034_0003189 Ga0501034_0003189_175_660 155
713 3300049571 Ga0501034_0011990 Ga0501034_0011990_8179_8664 155
714 3300049571 Ga0501034_0028508 Ga0501034_0028508_5134_5622 155
715 3300049571 Ga0501034_0029497 Ga0501034_0029497_3981_4469 155
716 3300049571 Ga0501034_0082761 Ga0501034_0082761_2570_3055 155
717 3300049571 Ga0501034_0126182 Ga0501034_0126182_796_1287 155
718 3300049571 Ga0501034_0166411 Ga0501034_0166411_960_1448 155
719 3300049571 Ga0501034_0591604 Ga0501034_0591604_361_849 155
720 3300049572 Ga0501036_0004155 Ga0501036_0004155_3824_4309 155
721 3300049572 Ga0501036_0005036 Ga0501036_0005036_9689_10174 155
722 3300049572 Ga0501036_0010604 Ga0501036_0010604_3456_3944 155
723 3300049572 Ga0501036_0025455 Ga0501036_0025455_4443_4931 155
724 3300049572 Ga0501036_0035885 Ga0501036_0035885_3579_4067 155
725 3300049572 Ga0501036_0177362 Ga0501036_0177362_136_624 155
726 3300049572 Ga0501036_0267770 Ga0501036_0267770_755_1243 155
727 3300049573 Ga0501037_0000644 Ga0501037_0000644_26330_26818 155
728 3300049573 Ga0501037_0042196 Ga0501037_0042196_2710_3195 155
729 3300049573 Ga0501037_0056596 Ga0501037_0056596_838_1326 155
730 3300049573 Ga0501037_0078706 Ga0501037_0078706_851_1339 155
731 3300049573 Ga0501037_0664753 Ga0501037_0664753_81_572 155
732 3300049574 Ga0501038_0001482 Ga0501038_0001482_13232_13720 155
733 3300049574 Ga0501038_0013836 Ga0501038_0013836_108_593 155
734 3300049574 Ga0501038_0078854 Ga0501038_0078854_1223_1711 155
735 3300049574 Ga0501038_0326465 Ga0501038_0326465_697_1182 155
736 3300049574 Ga0501038_0707311 Ga0501038_0707311_247_735 155
737 3300049574 Ga0501038_0938209 Ga0501038_0938209_89_577 155
738 3300049575 Ga0501039_0026796 Ga0501039_0026796_3777_4265 155
739 3300049575 Ga0501039_0036312 Ga0501039_0036312_3287_3775 155
740 3300049575 Ga0501039_0054450 Ga0501039_0054450_270_758 155
741 3300049575 Ga0501039_0150948 Ga0501039_0150948_1236_1721 155
742 3300049575 Ga0501039_1012596 Ga0501039_1012596_62_547 155
743 3300049577 Ga0501041_0003388 Ga0501041_0003388_403_891 155
744 3300049578 Ga0501042_0033787 Ga0501042_0033787_3020_3508 155
745 3300049578 Ga0501042_0036871 Ga0501042_0036871_1442_1930 155
746 3300049579 Ga0501043_0012717 Ga0501043_0012717_5226_5714 155
747 3300049579 Ga0501043_0017130 Ga0501043_0017130_5134_5622 155
748 3300049579 Ga0501043_0018811 Ga0501043_0018811_1885_2370 155
749 3300049579 Ga0501043_0044121 Ga0501043_0044121_2142_2633 155
750 3300049579 Ga0501043_0052803 Ga0501043_0052803_510_998 155
751 3300049579 Ga0501043_0095141 Ga0501043_0095141_854_1342 155
752 3300049579 Ga0501043_0108234 Ga0501043_0108234_139_624 155
753 3300049579 Ga0501043_0153098 Ga0501043_0153098_1021_1506 155
754 3300049580 Ga0501046_0037593 Ga0501046_0037593_61_549 155
755 3300049580 Ga0501046_0174741 Ga0501046_0174741_93_578 155
756 3300049581 Ga0501047_0000025 Ga0501047_0000025_66820_67308 155
757 3300049581 Ga0501047_0000084 Ga0501047_0000084_105412_105927 155
758 3300049581 Ga0501047_0001101 Ga0501047_0001101_26324_26812 155
759 3300049581 Ga0501047_0019088 Ga0501047_0019088_3814_4302 155
760 3300049581 Ga0501047_0044875 Ga0501047_0044875_2434_2922 155
761 3300049581 Ga0501047_0075142 Ga0501047_0075142_175_663 155
762 3300049581 Ga0501047_0114311 Ga0501047_0114311_354_839 155
763 3300049581 Ga0501047_0140125 Ga0501047_0140125_1207_1698 155
764 3300049581 Ga0501047_0484364 Ga0501047_0484364_276_761 155
765 3300049581 Ga0501047_0518446 Ga0501047_0518446_291_776 155
766 3300049581 Ga0501047_0899853 Ga0501047_0899853_152_640 155
767 3300049582 Ga0501048_0019385 Ga0501048_0019385_4443_4931 155
768 3300049582 Ga0501048_0023824 Ga0501048_0023824_107_592 155
769 3300049583 Ga0501067_0006058 Ga0501067_0006058_3210_3698 155
770 3300049583 Ga0501067_0304829 Ga0501067_0304829_269_757 155
771 3300049584 Ga0501068_0009848 Ga0501068_0009848_4682_5170 155
772 3300049584 Ga0501068_0042882 Ga0501068_0042882_1778_2263 155
773 3300049585 Ga0501069_0008664 Ga0501069_0008664_1070_1558 155
774 3300049585 Ga0501069_0202091 Ga0501069_0202091_84_572 155
775 3300049586 Ga0501070_0003688 Ga0501070_0003688_4018_4503 155
776 3300049586 Ga0501070_0058067 Ga0501070_0058067_987_1475 155
777 3300049586 Ga0501070_0137328 Ga0501070_0137328_82_570 155
778 3300049586 Ga0501070_0209834 Ga0501070_0209834_753_1244 155
779 3300049586 Ga0501070_0442447 Ga0501070_0442447_441_929 155
780 3300049586 Ga0501070_1049262 Ga0501070_1049262_19_507 155
781 3300049587 Ga0501071_0000759 Ga0501071_0000759_9893_10381 155
782 3300049588 Ga0501072_0004361 Ga0501072_0004361_9760_10248 155
783 3300049588 Ga0501072_1011734 Ga0501072_1011734_137_625 155
784 3300049589 Ga0501073_0044192 Ga0501073_0044192_2121_2609 155
785 3300049589 Ga0501073_0173247 Ga0501073_0173247_624_1112 155
786 3300049590 Ga0501074_0002291 Ga0501074_0002291_9772_10257 155
787 3300049590 Ga0501074_0066303 Ga0501074_0066303_1925_2413 155
788 3300049592 Ga0501076_0009593 Ga0501076_0009593_1229_1717 155
789 3300049593 Ga0501077_0013524 Ga0501077_0013524_3686_4174 155
790 3300049663 Ga0501223_058837 Ga0501223_058837_61_546 155
791 3300049669 Ga0501235_028837 Ga0501235_028837_76_561 155
792 3300049742 Ga0501080_0030534 Ga0501080_0030534_780_1268 155
793 3300049744 Ga0501083_0014645 Ga0501083_0014645_3536_4024 155
794 3300049822 Ga0501035_0007013 Ga0501035_0007013_6704_7189 155
795 3300049822 Ga0501035_0022321 Ga0501035_0022321_3274_3762 155
796 3300049822 Ga0501035_0040956 Ga0501035_0040956_2680_3165 155
797 3300049822 Ga0501035_0080509 Ga0501035_0080509_2328_2816 155
798 3300049822 Ga0501035_0173536 Ga0501035_0173536_809_1297 155
799 3300049822 Ga0501035_0224064 Ga0501035_0224064_997_1485 155
800 3300049822 Ga0501035_0802890 Ga0501035_0802890_217_705 155
801 3300049823 Ga0501044_0019610 Ga0501044_0019610_799_1287 155
802 3300049823 Ga0501044_0025758 Ga0501044_0025758_286_771 155
803 3300049823 Ga0501044_0046168 Ga0501044_0046168_2400_2885 155
804 3300049823 Ga0501044_0046661 Ga0501044_0046661_876_1367 155
805 3300049823 Ga0501044_0052883 Ga0501044_0052883_2505_2993 155
806 3300049823 Ga0501044_0062712 Ga0501044_0062712_3251_3739 155
807 3300049823 Ga0501044_0245699 Ga0501044_0245699_994_1482 155
808 3300049823 Ga0501044_0265864 Ga0501044_0265864_1032_1517 155
809 3300049823 Ga0501044_0779036 Ga0501044_0779036_334_810 155
810 3300049823 Ga0501044_0912929 Ga0501044_0912929_86_574 155
811 3300049823 Ga0501044_1080562 Ga0501044_1080562_168_656 155
812 3300049824 Ga0501045_0077517 Ga0501045_0077517_1840_2328 155
813 3300049824 Ga0501045_0209060 Ga0501045_0209060_430_918 155
814 3300049824 Ga0501045_0269191 Ga0501045_0269191_692_1180 155
815 3300049824 Ga0501045_0371228 Ga0501045_0371228_93_584 155
816 3300050490 nmdc:mga03n38_20804_c1 nmdc:mga03n38_20804_c1_1800_2288 155
817 3300050494 nmdc:mga06z11_208166_c1 nmdc:mga06z11_208166_c1_138_626 155
818 3300050495 nmdc:mga04h51_32266_c1 nmdc:mga04h51_32266_c1_1127_1615 155
819 3300050496 nmdc:mga07m45_186073_c1 nmdc:mga07m45_186073_c1_677_1165 155
820 3300050507 nmdc:mga05p37_1096738_c1 nmdc:mga05p37_1096738_c1_28_495 155
821 3300053077 Ga0495601_0033677 Ga0495601_0033677_1109_1582 155
822 3300053078 Ga0495612_0416590 Ga0495612_0416590_57_530 155
823 3300053079 Ga0500610_0031224 Ga0500610_0031224_1616_2101 155
824 3300053083 Ga0495655_0004158 Ga0495655_0004158_1626_2117 155
825 3300053085 Ga0495619_0128099 Ga0495619_0128099_717_1202 155
826 3300053085 Ga0495619_0214026 Ga0495619_0214026_273_740 155
827 3300053085 Ga0495619_0243872 Ga0495619_0243872_328_819 155
828 3300053085 Ga0495619_0520271 Ga0495619_0520271_201_686 155
829 3300053086 Ga0500578_0009710 Ga0500578_0009710_4093_4584 155
830 3300053086 Ga0500578_0072990 Ga0500578_0072990_296_784 155
831 3300053088 Ga0500644_0070789 Ga0500644_0070789_104_589 155
832 3300053090 Ga0500646_0021663 Ga0500646_0021663_734_1225 155
833 3300053094 Ga0500566_0155992 Ga0500566_0155992_431_922 155
834 3300053095 Ga0500640_033131 Ga0500640_033131_1303_1788 155
835 3300053096 Ga0500641_0023300 Ga0500641_0023300_1809_2297 155
836 3300053099 Ga0500654_108906 Ga0500654_108906_184_675 155
837 3300053100 Ga0500660_069730 Ga0500660_069730_718_1209 155
838 3300053101 Ga0500553_142862 Ga0500553_142862_13_498 155
839 3300053107 Ga0500560_006362 Ga0500560_006362_1301_1786 155
840 3300053109 Ga0500569_013156 Ga0500569_013156_1289_1780 155
841 3300053131 Ga0500652_073838 Ga0500652_073838_238_729 155
842 3300053134 Ga0500658_0028250 Ga0500658_0028250_1073_1564 155
843 3300053136 Ga0500559_0218339 Ga0500559_0218339_350_823 155
844 3300053137 Ga0500561_0009085 Ga0500561_0009085_755_1246 155
845 3300053140 Ga0500573_0058933 Ga0500573_0058933_1498_1983 155
846 3300053140 Ga0500573_0073692 Ga0500573_0073692_321_806 155
847 3300053140 Ga0500573_0098584 Ga0500573_0098584_383_868 155
848 3300053140 Ga0500573_0393437 Ga0500573_0393437_73_561 155
849 3300053143 Ga0500579_017070 Ga0500579_017070_687_1178 155
850 3300053146 Ga0500588_0310319 Ga0500588_0310319_63_554 155
851 3300053149 Ga0500600_0009525 Ga0500600_0009525_2743_3234 155
852 3300053149 Ga0500600_0196664 Ga0500600_0196664_374_859 155
853 3300053153 Ga0500616_0052585 Ga0500616_0052585_111_602 155
854 3300053160 Ga0500633_0005923 Ga0500633_0005923_749_1240 155
855 3300053161 Ga0500634_0000949 Ga0500634_0000949_1407_1898 155
856 3300053732 Ga0500656_001651 Ga0500656_001651_831_1322 155
857 3300053739 Ga0500587_004984 Ga0500587_004984_956_1447 155
858 3300054114 Ga0501084_0012357 Ga0501084_0012357_5296_5784 155
859 3300060353 Ga0501082_0005799 Ga0501082_0005799_4674_5162 155
860 3300061719 Ga0466962_0004456 Ga0466962_0004456_4448_4933 155
861 3300061719 Ga0466962_0030053 Ga0466962_0030053_340_825 155
862 3300061719 Ga0466962_0048655 Ga0466962_0048655_466_954 155
863 3300061719 Ga0466962_0075601 Ga0466962_0075601_762_1244 155
864 3300061734 Ga0530510_0033810 Ga0530510_0033810_2476_2964 155
865 iso_pu_bacteria 8002784119 8002786289 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

3

146

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bes-assembly2.cif.gz_C structure of mycobacterium tuberculosis ribose-5-phosphate isomerase, rpib, rv2465c, in complex with 4-phospho-d-erythronohydroxamic acid. 0.9848 1 155
2bes-assembly2.cif.gz_C structure of mycobacterium tuberculosis ribose-5-phosphate isomerase, rpib, rv2465c, in complex with 4-phospho-d-erythronohydroxamic acid. 0.9786 1 155
6mu0-assembly1.cif.gz_A crystal structure of ribose-5-phosphate isomerase b from mycoplasma genitalium with bound ribulose-5-phosphate 0.9686 2 148
4em8-assembly1.cif.gz_B the structure of ribose 5-phosphate isomerase b from anaplasma phagocytophilum 0.9645 2 142
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.9639 2 146
ID Description Score Start End Superfamily
af_P9WKD7_1_162_3.40.1400.10 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.986 1 155 3.40.1400.10
af_P9WKD7_1_162_3.40.1400.10 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9797 1 155 3.40.1400.10
6mu0A00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9682 2 148 3.40.1400.10
4em8B00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9645 2 142 3.40.1400.10
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9605 2 147 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A0N0AP15-F1-model_v4 Ribose-5-phosphate isomerase B (EC 5.3.1.6) (Phosphoriboisomerase B) 1.001 1 155 GO:0004751
GO:0009052
GO:0019316
AF-A0A6G2QD59-F1-model_v4 Ribose-5-phosphate isomerase B (EC 5.3.1.6) (Phosphoriboisomerase B) 0.9998 1 120 GO:0004751
GO:0009052
GO:0019316
AF-A0A1C4Q6M6-F1-model_v4 DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18) 0.9996 1 155 GO:0000703
GO:0003684
GO:0005975
GO:0006284
GO:0008270
GO:0016861
GO:0140078
AF-A0A1H6DPR8-F1-model_v4 Ribose-5-phosphate isomerase B (EC 5.3.1.6) (Phosphoriboisomerase B) 0.9992 1 155 GO:0004751
GO:0009052
GO:0019316
AF-A0A4R9E0A7-F1-model_v4 deleted 0.9988 1 155

Feature Viewer

pLDDT pTM Quality
98.1 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map