F483993

General Info

Members Datasets Scaffolds Average Seq Length
865 439 1724 66

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10007952|Ga0070717_100079528
Length 75
Sequence MTKDEKKMAIGTVKWFNDAKGFGFITQDNGGPDVFCHHTAIQADGFRTLAEGQKVEFETVKGPKGLQAQNVRPVA

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
109 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
125 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
126 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
127 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
128 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
144 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
145 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300019162 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
151 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
155 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
156 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
157 3300023547 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
160 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
161 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
235 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
236 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
237 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300030886 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
250 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
251 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
252 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
253 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
254 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
255 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
256 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
257 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
258 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
259 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
260 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
261 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
262 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
263 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
264 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
265 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
266 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
267 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
268 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
269 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
270 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
271 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
272 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
274 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
275 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
276 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
277 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
278 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
279 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
280 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
281 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
282 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
283 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
284 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
285 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
286 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
287 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
288 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
290 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
291 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
292 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
293 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
294 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
295 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
296 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
297 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
298 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
299 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
300 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
301 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
302 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
303 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
304 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
305 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
306 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
307 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
308 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
309 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
310 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
311 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
312 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
313 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
314 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
315 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
316 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
317 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
318 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
319 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
320 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
321 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
322 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
323 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
324 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
325 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
326 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
327 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
328 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
329 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
330 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
331 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
332 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
333 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
334 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
335 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
336 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
337 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
338 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
339 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
340 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
341 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
342 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
343 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
344 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
345 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
346 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
347 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
348 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
349 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
350 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
351 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
352 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
353 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
354 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
355 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
356 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
357 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
358 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
359 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
360 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
361 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
362 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
363 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
364 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
365 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
366 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
367 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
368 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
369 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
370 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
371 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
372 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
373 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
374 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
375 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
376 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
377 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
378 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
379 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
380 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
381 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
382 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
383 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
384 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
385 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
386 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
387 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
388 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
389 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
390 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
391 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
392 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
393 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
399 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
400 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
401 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
402 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
404 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
405 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
406 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
407 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
408 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
409 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
410 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
411 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
412 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
413 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
414 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
415 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
416 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
433 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
434 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
435 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
436 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
437 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
438 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
439 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.22
Metatranscriptomes 5.09
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 2.31
Rhizosphere 93.87
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10007952 3300006028 Bacteria 7898
2 JGI24752J21851_1054339 3300001976 Bacteria 547
3 JGI24746J21847_1028042 3300001977 Bacteria 777
4 JGI24747J21853_1033199 3300001978 Bacteria 595
5 JGI24739J22299_10216052 3300001989 Bacteria 562
6 JGI24737J22298_10208307 3300001990 Bacteria 577
7 JGI24743J22301_10005654 3300001991 Bacteria 2095
8 JGI24743J22301_10059717 3300001991 Bacteria 784
9 JGI24743J22301_10128823 3300001991 Bacteria 558
10 JGI24735J21928_10204216 3300002067 Bacteria 573
11 JGI24735J21928_10239147 3300002067 Bacteria 529
12 JGI24750J21931_1056156 3300002070 Bacteria 623
13 JGI24745J21846_1011979 3300002073 Bacteria 994
14 JGI24034J26672_10013996 3300002239 Bacteria 1220
15 JGI24034J26672_10091346 3300002239 Bacteria 565
16 JGI24751J29686_10046431 3300002459 Bacteria 897
17 JGI25404J52841_10004398 3300003659 Bacteria 2852
18 JGI25404J52841_10089306 3300003659 Bacteria 644
19 Ga0065712_10372393 3300005290 Bacteria 744
20 Ga0065715_10742737 3300005293 Bacteria 634
21 Ga0070658_10001524 3300005327 Bacteria 19636
22 Ga0070658_11775407 3300005327 Bacteria 534
23 Ga0070676_10003794 3300005328 Bacteria 7927
24 Ga0070676_10050319 3300005328 Bacteria 2442
25 Ga0070683_100001273 3300005329 Bacteria 19202
26 Ga0070683_100426605 3300005329 Bacteria 1265
27 Ga0070690_100000319 3300005330 Bacteria 24741
28 Ga0070670_100005386 3300005331 Bacteria 10799
29 Ga0070670_100605866 3300005331 Bacteria 980
30 Ga0070677_10000440 3300005333 Bacteria 14230
31 Ga0068869_100000369 3300005334 Bacteria 24221
32 Ga0070666_10000685 3300005335 Bacteria 20549
33 Ga0070666_10026908 3300005335 Bacteria 3763
34 Ga0070666_10086376 3300005335 Bacteria 2149
35 Ga0070680_100068570 3300005336 Bacteria 2911
36 Ga0070680_100701288 3300005336 Bacteria 871
37 Ga0070682_100216689 3300005337 Bacteria 1360
38 Ga0070682_101721125 3300005337 Bacteria 545
39 Ga0068868_100001554 3300005338 Bacteria 15679
40 Ga0070660_100000840 3300005339 Bacteria 20421
41 Ga0070689_100001008 3300005340 Bacteria 17649
42 Ga0070691_10085474 3300005341 Bacteria 1550
43 Ga0070687_100000001 3300005343 Bacteria 110332
44 Ga0070687_100079032 3300005343 Bacteria 1789
45 Ga0070661_100000069 3300005344 Bacteria 83366
46 Ga0070661_100032368 3300005344 Bacteria 3786
47 Ga0070661_100373925 3300005344 Bacteria 1122
48 Ga0070692_10024913 3300005345 Bacteria 2945
49 Ga0070668_100000341 3300005347 Bacteria 30806
50 Ga0070669_100000700 3300005353 Bacteria 24568
51 Ga0070675_100003072 3300005354 Bacteria 12611
52 Ga0070671_100007285 3300005355 Bacteria 8839
53 Ga0070671_100897219 3300005355 Bacteria 774
54 Ga0070674_100000876 3300005356 Bacteria 15679
55 Ga0070673_100001053 3300005364 Bacteria 15679
56 Ga0070673_100074295 3300005364 Bacteria 2739
57 Ga0070688_100000023 3300005365 Bacteria 69795
58 Ga0070659_100000172 3300005366 Bacteria 49995
59 Ga0070659_100203871 3300005366 Bacteria 1629
60 Ga0070667_100002969 3300005367 Bacteria 14578
61 Ga0070703_10061937 3300005406 Bacteria 1226
62 Ga0070703_10284771 3300005406 Bacteria 683
63 Ga0070709_10001297 3300005434 Bacteria 13637
64 Ga0070709_10886113 3300005434 Bacteria 705
65 Ga0070714_100001870 3300005435 Bacteria 15345
66 Ga0070713_100001100 3300005436 Bacteria 17248
67 Ga0070713_100157598 3300005436 Bacteria 2024
68 Ga0070713_100359705 3300005436 Bacteria 1352
69 Ga0070710_10000496 3300005437 Bacteria 18492
70 Ga0070710_10031337 3300005437 Bacteria 2869
71 Ga0070710_10795762 3300005437 Bacteria 675
72 Ga0070701_10024462 3300005438 Bacteria 2922
73 Ga0070711_100000670 3300005439 Bacteria 17922
74 Ga0070711_100023318 3300005439 Bacteria 4022
75 Ga0070705_100000877 3300005440 Bacteria 16821
76 Ga0070705_100307926 3300005440 Bacteria 1138
77 Ga0070700_100002114 3300005441 Bacteria 10088
78 Ga0070700_100059244 3300005441 Bacteria 2409
79 Ga0070694_100162047 3300005444 Bacteria 1642
80 Ga0070708_100000973 3300005445 Bacteria 21817
81 Ga0070708_100001176 3300005445 Bacteria 20167
82 Ga0070708_100001685 3300005445 Bacteria 16980
83 Ga0070708_100035170 3300005445 Bacteria 4363
84 Ga0070708_100323538 3300005445 Bacteria 1453
85 Ga0070708_100869896 3300005445 Bacteria 846
86 Ga0070663_100000134 3300005455 Bacteria 35392
87 Ga0070678_100000316 3300005456 Bacteria 22558
88 Ga0070662_100000267 3300005457 Bacteria 30582
89 Ga0070681_10420267 3300005458 Bacteria 1249
90 Ga0070681_10560249 3300005458 Unclassified 1057
91 Ga0068867_100000499 3300005459 Bacteria 26194
92 Ga0070685_10000305 3300005466 Bacteria 30855
93 Ga0070706_100002146 3300005467 Bacteria 20085
94 Ga0070706_100140264 3300005467 Bacteria 2257
95 Ga0070706_100200639 3300005467 Bacteria 1863
96 Ga0070707_100005494 3300005468 Bacteria 11851
97 Ga0070707_100081379 3300005468 Bacteria 3127
98 Ga0070698_100003076 3300005471 Bacteria 18391
99 Ga0070699_100006061 3300005518 Bacteria 10568
100 Ga0070699_100040050 3300005518 Bacteria 4058
101 Ga0070679_100005268 3300005530 Bacteria 11970
102 Ga0070679_100378236 3300005530 Bacteria 1363
103 Ga0070679_100477015 3300005530 Bacteria 1192
104 Ga0070684_100073384 3300005535 Bacteria 3015
105 Ga0070684_101426888 3300005535 Bacteria 652
106 Ga0070697_100000778 3300005536 Bacteria 23910
107 Ga0070697_100027233 3300005536 Bacteria 4572
108 Ga0070697_100287144 3300005536 Bacteria 1412
109 Ga0068853_100000688 3300005539 Bacteria 23325
110 Ga0068853_100031982 3300005539 Bacteria 4454
111 Ga0070672_100000525 3300005543 Bacteria 22411
112 Ga0070686_100005990 3300005544 Bacteria 6746
113 Ga0070686_100059298 3300005544 Bacteria 2465
114 Ga0070695_100016518 3300005545 Bacteria 4469
115 Ga0070695_101799532 3300005545 Bacteria 514
116 Ga0070696_100003151 3300005546 Bacteria 10979
117 Ga0070696_100178735 3300005546 Bacteria 1573
118 Ga0070693_100006183 3300005547 Bacteria 5802
119 Ga0070693_100201088 3300005547 Bacteria 1294
120 Ga0070665_100014433 3300005548 Bacteria 7927
121 Ga0070665_100030721 3300005548 Bacteria 5405
122 Ga0070665_102447832 3300005548 Bacteria 524
123 Ga0070704_100203463 3300005549 Bacteria 1600
124 Ga0068855_100005229 3300005563 Bacteria 15829
125 Ga0070664_100000852 3300005564 Bacteria 23573
126 Ga0070664_100001306 3300005564 Bacteria 19902
127 Ga0070664_100028872 3300005564 Bacteria 4620
128 Ga0068857_100000758 3300005577 Bacteria 23986
129 Ga0068857_101023676 3300005577 Bacteria 795
130 Ga0068854_100000089 3300005578 Bacteria 64543
131 Ga0068856_100003957 3300005614 Bacteria 14837
132 Ga0068856_100454513 3300005614 Bacteria 1302
133 Ga0068856_102001707 3300005614 Bacteria 590
134 Ga0070702_100056431 3300005615 Bacteria 2268
135 Ga0068852_100000072 3300005616 Bacteria 70022
136 Ga0068859_100002215 3300005617 Bacteria 19718
137 Ga0068864_100002336 3300005618 Bacteria 15679
138 Ga0068864_100051031 3300005618 Bacteria 3562
139 Ga0068866_10000160 3300005718 Bacteria 31120
140 Ga0068866_10071864 3300005718 Bacteria 1831
141 Ga0068861_100000015 3300005719 Bacteria 79924
142 Ga0068861_100520717 3300005719 Bacteria 1078
143 Ga0068851_10001524 3300005834 Bacteria 10169
144 Ga0068870_10000838 3300005840 Bacteria 11976
145 Ga0068870_10031871 3300005840 Bacteria 2673
146 Ga0068863_100000428 3300005841 Bacteria 42559
147 Ga0068863_100008115 3300005841 Bacteria 10249
148 Ga0068858_100016013 3300005842 Bacteria 7042
149 Ga0068860_100008025 3300005843 Bacteria 10528
150 Ga0068862_100001279 3300005844 Bacteria 23572
151 Ga0081540_1000023 3300005983 Bacteria 159665
152 Ga0081540_1000118 3300005983 Bacteria 84097
153 Ga0081540_1001080 3300005983 Bacteria 24226
154 Ga0070717_10003707 3300006028 Bacteria 10979
155 Ga0070717_10037608 3300006028 Bacteria 3931
156 Ga0070717_10049986 3300006028 Bacteria 3434
157 Ga0070717_10145270 3300006028 Bacteria 2048
158 Ga0070717_10195762 3300006028 Bacteria 1768
159 Ga0070717_11659308 3300006028 Bacteria 579
160 Ga0070716_100000437 3300006173 Bacteria 17250
161 Ga0070716_100157787 3300006173 Bacteria 1467
162 Ga0070716_100570700 3300006173 Bacteria 847
163 Ga0070716_100929280 3300006173 Bacteria 683
164 Ga0070712_100001524 3300006175 Bacteria 14142
165 Ga0070712_100049958 3300006175 Bacteria 2907
166 Ga0070712_101406516 3300006175 Bacteria 609
167 Ga0070712_101448923 3300006175 Bacteria 600
168 Ga0097621_100000221 3300006237 Bacteria 37981
169 Ga0068871_100001589 3300006358 Bacteria 15270
170 Ga0068871_100994132 3300006358 Bacteria 781
171 Ga0075428_100104034 3300006844 Bacteria 3096
172 Ga0075428_100312302 3300006844 Unclassified 1690
173 Ga0075430_100377461 3300006846 Bacteria 1170
174 Ga0075430_100470982 3300006846 Bacteria 1037
175 Ga0075431_100185909 3300006847 Bacteria 2131
176 Ga0075431_100328195 3300006847 Bacteria 1542
177 Ga0075431_101363762 3300006847 Bacteria 669
178 Ga0075431_101426236 3300006847 Bacteria 652
179 Ga0075433_10431470 3300006852 Bacteria 1162
180 Ga0075433_11342859 3300006852 Bacteria 619
181 Ga0075433_11922065 3300006852 Bacteria 507
182 Ga0075434_100307182 3300006871 Bacteria 1606
183 Ga0075434_100397655 3300006871 Bacteria 1399
184 Ga0075434_101352014 3300006871 Bacteria 723
185 Ga0075434_102549444 3300006871 Bacteria 512
186 Ga0075429_100051906 3300006880 Bacteria 3567
187 Ga0075429_100053811 3300006880 Bacteria 3502
188 Ga0068865_100000118 3300006881 Bacteria 39940
189 Ga0068865_100568876 3300006881 Bacteria 954
190 Ga0075436_100776205 3300006914 Bacteria 713
191 Ga0097620_100002215 3300006931 Bacteria 19718
192 Ga0075435_101482048 3300007076 Bacteria 595
193 Ga0099794_10000003 3300007265 Bacteria 139452
194 Ga0099794_10201367 3300007265 Bacteria 1019
195 Ga0099794_10306682 3300007265 Bacteria 822
196 Ga0099795_10117901 3300007788 Bacteria 1059
197 Ga0105251_10277623 3300009011 Bacteria 757
198 Ga0105244_10448087 3300009036 Bacteria 594
199 Ga0105240_10003604 3300009093 Bacteria 23980
200 Ga0105245_10000145 3300009098 Bacteria 66795
201 Ga0105245_12717157 3300009098 Bacteria 548
202 Ga0105247_10000193 3300009101 Bacteria 60141
203 Ga0114129_10631328 3300009147 Bacteria 1384
204 Ga0105243_10003134 3300009148 Bacteria 13580
205 Ga0105243_10782063 3300009148 Bacteria 939
206 Ga0105243_12893430 3300009148 Bacteria 520
207 Ga0105241_10001101 3300009174 Bacteria 20563
208 Ga0105241_10294697 3300009174 Bacteria 1390
209 Ga0105242_10010326 3300009176 Bacteria 7159
210 Ga0105242_11332148 3300009176 Bacteria 743
211 Ga0105248_10004426 3300009177 Bacteria 15552
212 Ga0105248_10007516 3300009177 Bacteria 11957
213 Ga0105237_10000812 3300009545 Bacteria 42732
214 Ga0105237_10684613 3300009545 Bacteria 1032
215 Ga0105238_10001065 3300009551 Bacteria 27691
216 Ga0105238_10867521 3300009551 Bacteria 920
217 Ga0105249_10000171 3300009553 Bacteria 75805
218 Ga0105249_10009702 3300009553 Bacteria 8437
219 Ga0105249_10271762 3300009553 Bacteria 1689
220 Ga0099796_10110110 3300010159 Bacteria 1047
221 Ga0099796_10292528 3300010159 Bacteria 688
222 Ga0105239_10001634 3300010375 Bacteria 29562
223 Ga0105239_10122289 3300010375 Bacteria 2892
224 Ga0105239_10852557 3300010375 Bacteria 1045
225 Ga0105246_10000943 3300011119 Bacteria 16633
226 Ga0157325_1007844 3300012485 Bacteria 727
227 Ga0157329_1012418 3300012491 Bacteria 697
228 Ga0157323_1040058 3300012495 Bacteria 534
229 Ga0157345_1028198 3300012498 Bacteria 614
230 Ga0157338_1042256 3300012515 Bacteria 625
231 Ga0157373_10006249 3300013100 Bacteria 8901
232 Ga0157371_10001230 3300013102 Bacteria 27209
233 Ga0157370_10755944 3300013104 Bacteria 886
234 Ga0157370_11004292 3300013104 Bacteria 755
235 Ga0157369_10001086 3300013105 Bacteria 33975
236 Ga0157369_10096549 3300013105 Bacteria 3153
237 Ga0157369_10252196 3300013105 Bacteria 1841
238 Ga0157374_10001393 3300013296 Bacteria 20509
239 Ga0157374_10003766 3300013296 Bacteria 12752
240 Ga0157374_10325332 3300013296 Bacteria 1524
241 Ga0157374_12130512 3300013296 Bacteria 588
242 Ga0157378_10000755 3300013297 Bacteria 30249
243 Ga0157378_10563387 3300013297 Bacteria 1146
244 Ga0163162_10001134 3300013306 Bacteria 24797
245 Ga0163162_10192646 3300013306 Bacteria 2166
246 Ga0163162_12600309 3300013306 Bacteria 582
247 Ga0157372_10146598 3300013307 Bacteria 2722
248 Ga0157375_10001074 3300013308 Bacteria 23685
249 Ga0157375_12753878 3300013308 Bacteria 588
250 Ga0163163_10011847 3300014325 Bacteria 7927
251 Ga0157380_10003188 3300014326 Bacteria 11194
252 Ga0182008_10380262 3300014497 Bacteria 754
253 Ga0157377_10000913 3300014745 Bacteria 12313
254 Ga0157379_10000590 3300014968 Bacteria 29376
255 Ga0157379_10303969 3300014968 Bacteria 1454
256 Ga0157379_10917134 3300014968 Bacteria 832
257 Ga0157379_11389513 3300014968 Bacteria 680
258 Ga0157376_10000455 3300014969 Bacteria 26408
259 Ga0157376_10114657 3300014969 Bacteria 2378
260 Ga0157376_10308048 3300014969 Bacteria 1501
261 Ga0182006_1000039 3300015261 Bacteria 211568
262 Ga0182007_10166343 3300015262 Bacteria 756
263 Ga0163161_10062237 3300017792 Bacteria 2718
264 Ga0184597_111251 3300019162 Bacteria 558
265 Ga0184603_112217 3300019192 Bacteria 560
266 Ga0197907_10364955 3300020069 Bacteria 964
267 Ga0206355_1004666 3300020076 Bacteria 1207
268 Ga0206355_1048623 3300020076 Bacteria 747
269 Ga0206352_10706461 3300020078 Bacteria 1100
270 Ga0206350_10516989 3300020080 Bacteria 945
271 Ga0206353_10589080 3300020082 Bacteria 608
272 Ga0206353_10907574 3300020082 Bacteria 528
273 Ga0213872_10307841 3300021361 Bacteria 656
274 Ga0213874_10073208 3300021377 Bacteria 1097
275 Ga0213876_10560810 3300021384 Bacteria 608
276 Ga0247554_104415 3300023547 Bacteria 576
277 Ga0247551_105519 3300023552 Bacteria 527
278 Ga0224572_1066446 3300024225 Bacteria 667
279 Ga0207673_1013391 3300025290 Bacteria 1075
280 Ga0207697_10003056 3300025315 Bacteria 8393
281 Ga0207656_10047310 3300025321 Bacteria 1849
282 Ga0207655_1198136 3300025728 Bacteria 601
283 Ga0207653_10022530 3300025885 Bacteria 2001
284 Ga0207653_10306157 3300025885 Bacteria 617
285 Ga0207682_10000711 3300025893 Bacteria 15454
286 Ga0207692_10040697 3300025898 Bacteria 2295
287 Ga0207692_10301400 3300025898 Bacteria 975
288 Ga0207642_10000129 3300025899 Bacteria 20861
289 Ga0207710_10003310 3300025900 Bacteria 7199
290 Ga0207710_10012945 3300025900 Bacteria 3514
291 Ga0207688_10000050 3300025901 Bacteria 42166
292 Ga0207688_10041151 3300025901 Bacteria 2569
293 Ga0207680_10000450 3300025903 Bacteria 19408
294 Ga0207680_10081111 3300025903 Bacteria 2038
295 Ga0207647_10003230 3300025904 Bacteria 12229
296 Ga0207647_10755951 3300025904 Bacteria 526
297 Ga0207685_10112646 3300025905 Bacteria 1182
298 Ga0207685_10530968 3300025905 Bacteria 623
299 Ga0207699_10000728 3300025906 Bacteria 15716
300 Ga0207699_11080347 3300025906 Bacteria 594
301 Ga0207645_10000022 3300025907 Bacteria 103273
302 Ga0207645_10073792 3300025907 Bacteria 2184
303 Ga0207643_10000011 3300025908 Bacteria 150819
304 Ga0207705_10001292 3300025909 Bacteria 20098
305 Ga0207705_10700449 3300025909 Bacteria 787
306 Ga0207684_10000068 3300025910 Bacteria 191048
307 Ga0207684_10107594 3300025910 Bacteria 2386
308 Ga0207684_10639918 3300025910 Bacteria 906
309 Ga0207654_10001102 3300025911 Bacteria 14612
310 Ga0207654_11129160 3300025911 Bacteria 571
311 Ga0207707_10089230 3300025912 Bacteria 2694
312 Ga0207707_10734083 3300025912 Bacteria 827
313 Ga0207695_10010142 3300025913 Bacteria 11557
314 Ga0207695_10292327 3300025913 Bacteria 1521
315 Ga0207695_10744237 3300025913 Bacteria 861
316 Ga0207671_10001264 3300025914 Bacteria 29790
317 Ga0207671_10048984 3300025914 Bacteria 3127
318 Ga0207693_10007067 3300025915 Bacteria 9265
319 Ga0207693_10038996 3300025915 Bacteria 3740
320 Ga0207663_10018812 3300025916 Bacteria 3880
321 Ga0207663_10067392 3300025916 Bacteria 2295
322 Ga0207660_10023351 3300025917 Bacteria 4176
323 Ga0207660_11284995 3300025917 Bacteria 594
324 Ga0207662_10000004 3300025918 Bacteria 128333
325 Ga0207657_10000055 3300025919 Bacteria 105424
326 Ga0207649_10000272 3300025920 Bacteria 40849
327 Ga0207649_10030844 3300025920 Bacteria 3180
328 Ga0207649_10303509 3300025920 Bacteria 1168
329 Ga0207652_10023431 3300025921 Bacteria 5115
330 Ga0207652_10047178 3300025921 Bacteria 3679
331 Ga0207646_10019011 3300025922 Bacteria 6397
332 Ga0207646_10518642 3300025922 Bacteria 1073
333 Ga0207681_10000399 3300025923 Bacteria 30223
334 Ga0207694_10003286 3300025924 Bacteria 12876
335 Ga0207650_10000833 3300025925 Bacteria 23570
336 Ga0207659_10000048 3300025926 Bacteria 83743
337 Ga0207659_11335782 3300025926 Bacteria 615
338 Ga0207687_10001570 3300025927 Bacteria 15705
339 Ga0207687_10425939 3300025927 Bacteria 1096
340 Ga0207700_10000378 3300025928 Bacteria 25808
341 Ga0207700_10613774 3300025928 Bacteria 968
342 Ga0207700_11682579 3300025928 Bacteria 560
343 Ga0207664_10171087 3300025929 Bacteria 1859
344 Ga0207664_10428186 3300025929 Bacteria 1179
345 Ga0207644_10000215 3300025931 Bacteria 39971
346 Ga0207644_10046649 3300025931 Bacteria 3088
347 Ga0207644_10291951 3300025931 Bacteria 1311
348 Ga0207644_10464211 3300025931 Bacteria 1041
349 Ga0207690_10000221 3300025932 Bacteria 43110
350 Ga0207690_10062501 3300025932 Bacteria 2535
351 Ga0207706_10000534 3300025933 Bacteria 40347
352 Ga0207686_10005043 3300025934 Bacteria 7104
353 Ga0207709_10004291 3300025935 Bacteria 8259
354 Ga0207670_10000315 3300025936 Bacteria 29073
355 Ga0207669_10000480 3300025937 Bacteria 17442
356 Ga0207704_10000102 3300025938 Bacteria 47829
357 Ga0207704_10304498 3300025938 Bacteria 1222
358 Ga0207665_10001239 3300025939 Bacteria 17206
359 Ga0207665_10126555 3300025939 Bacteria 1810
360 Ga0207665_10298110 3300025939 Bacteria 1204
361 Ga0207665_11192621 3300025939 Bacteria 607
362 Ga0207691_10000177 3300025940 Bacteria 60130
363 Ga0207691_10036738 3300025940 Bacteria 4538
364 Ga0207711_10000159 3300025941 Bacteria 72647
365 Ga0207711_10319164 3300025941 Bacteria 1435
366 Ga0207711_10590443 3300025941 Bacteria 1036
367 Ga0207689_10000027 3300025942 Bacteria 100932
368 Ga0207661_10046709 3300025944 Bacteria 3433
369 Ga0207661_10905370 3300025944 Bacteria 812
370 Ga0207661_11529697 3300025944 Bacteria 611
371 Ga0207679_10000432 3300025945 Bacteria 29564
372 Ga0207679_10001520 3300025945 Bacteria 14508
373 Ga0207679_10106025 3300025945 Bacteria 2208
374 Ga0207667_10002170 3300025949 Bacteria 24593
375 Ga0207667_10173170 3300025949 Bacteria 2218
376 Ga0207667_11732561 3300025949 Bacteria 591
377 Ga0207667_12135390 3300025949 Bacteria 518
378 Ga0207651_10000025 3300025960 Bacteria 72585
379 Ga0207712_10000368 3300025961 Bacteria 39958
380 Ga0207712_10052806 3300025961 Bacteria 2848
381 Ga0207668_10000877 3300025972 Bacteria 18137
382 Ga0207668_12027933 3300025972 Bacteria 518
383 Ga0207640_10000646 3300025981 Bacteria 20373
384 Ga0207640_10613858 3300025981 Bacteria 922
385 Ga0207658_10000694 3300025986 Bacteria 29293
386 Ga0207677_10000120 3300026023 Bacteria 64258
387 Ga0207677_10139474 3300026023 Bacteria 1854
388 Ga0207677_10258053 3300026023 Bacteria 1419
389 Ga0207703_10000125 3300026035 Bacteria 92115
390 Ga0207703_10154775 3300026035 Bacteria 2002
391 Ga0207639_10001661 3300026041 Bacteria 14998
392 Ga0207639_11424943 3300026041 Bacteria 650
393 Ga0207639_12284735 3300026041 Bacteria 502
394 Ga0207678_10000364 3300026067 Bacteria 41175
395 Ga0207708_10006142 3300026075 Bacteria 8906
396 Ga0207702_10003587 3300026078 Bacteria 14105
397 Ga0207702_10044277 3300026078 Bacteria 3741
398 Ga0207702_11861112 3300026078 Bacteria 593
399 Ga0207702_12474431 3300026078 Bacteria 506
400 Ga0207641_10000776 3300026088 Bacteria 34097
401 Ga0207641_10220806 3300026088 Bacteria 1757
402 Ga0207648_10001131 3300026089 Bacteria 29967
403 Ga0207648_10089211 3300026089 Bacteria 2693
404 Ga0207676_10000448 3300026095 Bacteria 34882
405 Ga0207676_10146374 3300026095 Bacteria 2029
406 Ga0207674_10002010 3300026116 Bacteria 25827
407 Ga0207674_10004055 3300026116 Bacteria 17756
408 Ga0207674_10081497 3300026116 Bacteria 3238
409 Ga0207675_100000004 3300026118 Bacteria 210328
410 Ga0207683_10000007 3300026121 Bacteria 175543
411 Ga0207698_10000460 3300026142 Bacteria 23661
412 Ga0207698_10108854 3300026142 Bacteria 2317
413 Ga0209588_1000001 3300027671 Bacteria 705877
414 Ga0209588_1143877 3300027671 Bacteria 757
415 Ga0209588_1221069 3300027671 Bacteria 585
416 Ga0268266_10000207 3300028379 Bacteria 102761
417 Ga0268266_10075220 3300028379 Bacteria 2933
418 Ga0268266_10207602 3300028379 Bacteria 1795
419 Ga0268266_12175297 3300028379 Bacteria 527
420 Ga0268265_10001016 3300028380 Bacteria 25303
421 Ga0268264_10000301 3300028381 Bacteria 80467
422 Ga0268264_10067204 3300028381 Bacteria 3025
423 Ga0265334_10251031 3300028573 Bacteria 609
424 Ga0307515_10172394 3300028794 Bacteria 2150
425 Ga0265338_10006058 3300028800 Bacteria 15528
426 Ga0265338_10020126 3300028800 Bacteria 7036
427 Ga0265338_10274744 3300028800 Bacteria 1233
428 Ga0265762_1049239 3300030760 Bacteria 842
429 Ga0265775_110697 3300030762 Bacteria 580
430 Ga0265763_1045098 3300030763 Bacteria 542
431 Ga0265767_117906 3300030836 Bacteria 522
432 Ga0265777_112710 3300030877 Bacteria 637
433 Ga0265776_102341 3300030880 Bacteria 866
434 Ga0265764_107783 3300030882 Bacteria 639
435 Ga0265772_103086 3300030886 Bacteria 678
436 Ga0265772_106371 3300030886 Bacteria 543
437 Ga0265769_111517 3300030888 Bacteria 616
438 Ga0265769_121168 3300030888 Bacteria 517
439 Ga0265761_103014 3300030889 Bacteria 810
440 Ga0265768_115355 3300030963 Bacteria 531
441 Ga0265760_10285414 3300031090 Bacteria 581
442 Ga0265339_10043863 3300031249 Bacteria 2470
443 Ga0310103_109293 3300031614 Bacteria 1328
444 Ga0316575_10199642 3300031665 Bacteria 833
445 Ga0265314_10015910 3300031711 Bacteria 5957
446 Ga0307410_11145669 3300031852 Bacteria 676
447 Ga0307406_10853970 3300031901 Bacteria 772
448 Ga0307406_11721115 3300031901 Bacteria 556
449 Ga0307407_10527845 3300031903 Bacteria 869
450 Ga0307412_10000034 3300031911 Bacteria 206033
451 Ga0307409_101327322 3300031995 Bacteria 745
452 Ga0307416_100000030 3300032002 Bacteria 162430
453 Ga0307416_100916250 3300032002 Bacteria 977
454 Ga0307414_10050128 3300032004 Bacteria 2890
455 Ga0307411_10250702 3300032005 Bacteria 1392
456 Ga0307411_11211955 3300032005 Bacteria 685
457 Ga0316583_10080066 3300032133 Bacteria 1142
458 Ga0307510_10019182 3300033180 Bacteria 8024
459 Ga0307510_10086645 3300033180 Bacteria 3003
460 Ga0307510_10403465 3300033180 Bacteria 810
461 Ga0316215_1020665 3300033544 Bacteria 670
462 Ga0316214_1006892 3300033545 Bacteria 1509
463 Ga0316212_1003326 3300033547 Bacteria 2317
464 Ga0373926_0062383 3300035083 Bacteria 1360
465 Ga0373928_0034472 3300035084 Bacteria 1136
466 Ga0373934_0272585 3300035086 Bacteria 700
467 Ga0373940_0005034 3300035088 Bacteria 2839
468 Ga0373944_0002752 3300035089 Bacteria 4491
469 Ga0373951_0152486 3300035091 Bacteria 649
470 Ga0373923_0103749 3300035111 Bacteria 1256
471 Ga0373923_0272820 3300035111 Bacteria 796
472 Ga0373941_0030431 3300035115 Bacteria 1600
473 Ga0373945_0030788 3300035116 Bacteria 1892
474 Ga0373953_0168110 3300035117 Bacteria 944
475 Ga0373956_0494588 3300035119 Bacteria 584
476 Ga0373956_0628678 3300035119 Bacteria 512
477 Ga0373957_0117936 3300035120 Bacteria 1073
478 Ga0373943_0149455 3300035170 Bacteria 1264
479 Ga0373943_0729706 3300035170 Bacteria 588
480 Ga0373946_0008383 3300035171 Bacteria 3790
481 Ga0373946_0370968 3300035171 Bacteria 718
482 Ga0373955_0476584 3300035172 Bacteria 761
483 Ga0373955_0557467 3300035172 Bacteria 701
484 Ga0373942_0007929 3300035207 Bacteria 2469
485 Ga0373924_0046625 3300035410 Bacteria 1786
486 Ga0373931_0056293 3300035691 Bacteria 2106
487 Ga0373935_0038874 3300035692 Bacteria 2980
488 Ga0373935_0227523 3300035692 Bacteria 1297
489 Ga0373935_0267815 3300035692 Bacteria 1200
490 Ga0373935_0814224 3300035692 Bacteria 690
491 Ga0373935_1141904 3300035692 Bacteria 580
492 Ga0373933_0067119 3300035724 Bacteria 2175
493 Ga0373947_0862817 3300035725 Bacteria 618
494 Ga0373947_1199064 3300035725 Bacteria 517
495 Ga0373937_0493283 3300036401 Bacteria 1163
496 Ga0265778_041358 3300036457 Bacteria 615
497 Ga0373925_0046089 3300037068 Bacteria 3240
498 Ga0373925_0362081 3300037068 Bacteria 1179
499 Ga0395900_0702398 3300037418 Bacteria 945
500 Ga0395900_1755474 3300037418 Bacteria 531
501 Ga0436364_0696697 3300037853 Bacteria 829
502 Ga0436364_1282020 3300037853 Bacteria 2172
503 Ga0242420_104242 3300038996 Bacteria 606
504 Ga0436365_1011888 3300039437 Bacteria 565
505 Ga0436360_0412722 3300039438 Bacteria 651
506 Ga0436360_0519576 3300039438 Bacteria 692
507 Ga0436360_1101507 3300039438 Bacteria 777
508 Ga0436361_0105626 3300039447 Bacteria 76260
509 Ga0436361_0783445 3300039447 Bacteria 514
510 Ga0436363_0993477 3300039450 Bacteria 697
511 Ga0436363_1388306 3300039450 Bacteria 960
512 Ga0436362_1271413 3300039453 Bacteria 637
513 Ga0451791_1741236 3300041451 Bacteria 550
514 Ga0451793_1517122 3300041452 Bacteria 579
515 Ga0451798_1070021 3300041458 Bacteria 629
516 Ga0451804_0521722 3300041463 Bacteria 1504
517 Ga0451839_1281877 3300041496 Bacteria 749
518 Ga0451851_0515133 3300041507 Bacteria 880
519 Ga0451851_1083970 3300041507 Bacteria 572
520 Ga0451853_0939589 3300041512 Bacteria 1118
521 Ga0451853_1109228 3300041512 Bacteria 685
522 Ga0439458_0079350 3300042157 Bacteria 836
523 Ga0451577_0000057 3300042876 Bacteria 273077
524 Ga0451577_0000119 3300042876 Bacteria 172779
525 Ga0451577_0006036 3300042876 Bacteria 12191
526 Ga0451577_0012695 3300042876 Bacteria 7904
527 Ga0451577_0019717 3300042876 Bacteria 6198
528 Ga0451577_0023332 3300042876 Bacteria 5643
529 Ga0451577_0043649 3300042876 Bacteria 4016
530 Ga0451577_0059236 3300042876 Bacteria 3415
531 Ga0451577_0080039 3300042876 Bacteria 2913
532 Ga0451577_0139920 3300042876 Bacteria 2174
533 Ga0451577_0197460 3300042876 Bacteria 1816
534 Ga0451577_0204496 3300042876 Bacteria 1782
535 Ga0451577_0246542 3300042876 Bacteria 1617
536 Ga0451577_0294888 3300042876 Bacteria 1469
537 Ga0451577_0712693 3300042876 Bacteria 908
538 Ga0451577_0834693 3300042876 Bacteria 831
539 Ga0451577_1107330 3300042876 Bacteria 708
540 Ga0451577_1361028 3300042876 Bacteria 630
541 Ga0451577_1693320 3300042876 Bacteria 556
542 Ga0466972_0313304 3300044658 Bacteria 733
543 Ga0453683_0000248 3300044673 Bacteria 71208
544 Ga0453683_0000691 3300044673 Bacteria 35481
545 Ga0453683_0002661 3300044673 Bacteria 13669
546 Ga0453683_0003585 3300044673 Bacteria 11412
547 Ga0453683_0003938 3300044673 Bacteria 10753
548 Ga0453683_0042300 3300044673 Bacteria 2860
549 Ga0453683_0066358 3300044673 Bacteria 2256
550 Ga0453683_0067214 3300044673 Bacteria 2240
551 Ga0453683_0079967 3300044673 Bacteria 2047
552 Ga0453683_0158255 3300044673 Bacteria 1432
553 Ga0453683_0159408 3300044673 Bacteria 1427
554 Ga0453683_0164394 3300044673 Bacteria 1404
555 Ga0453683_0166736 3300044673 Bacteria 1394
556 Ga0453683_0286787 3300044673 Bacteria 1052
557 Ga0453683_0306763 3300044673 Bacteria 1016
558 Ga0453683_0403370 3300044673 Bacteria 881
559 Ga0453683_0418364 3300044673 Bacteria 865
560 Ga0453683_0593407 3300044673 Bacteria 722
561 Ga0453684_0000196 3300044712 Bacteria 265218
562 Ga0453684_0000258 3300044712 Bacteria 228312
563 Ga0453684_0000729 3300044712 Bacteria 115611
564 Ga0453684_0001130 3300044712 Bacteria 83545
565 Ga0453684_0001663 3300044712 Bacteria 60227
566 Ga0453684_0003569 3300044712 Bacteria 34750
567 Ga0453684_0007995 3300044712 Bacteria 19156
568 Ga0453684_0009291 3300044712 Bacteria 17256
569 Ga0453684_0024781 3300044712 Bacteria 8745
570 Ga0453684_0041174 3300044712 Bacteria 6254
571 Ga0453684_0046369 3300044712 Bacteria 5781
572 Ga0453684_0054332 3300044712 Bacteria 5217
573 Ga0453684_0059478 3300044712 Bacteria 4925
574 Ga0453684_0116930 3300044712 Bacteria 3227
575 Ga0453684_0123296 3300044712 Bacteria 3124
576 Ga0453684_0127762 3300044712 Bacteria 3056
577 Ga0453684_0141725 3300044712 Bacteria 2869
578 Ga0453684_0194552 3300044712 Bacteria 2369
579 Ga0453684_0303482 3300044712 Bacteria 1814
580 Ga0453684_0373875 3300044712 Bacteria 1601
581 Ga0453684_0389905 3300044712 Bacteria 1562
582 Ga0453684_0401770 3300044712 Bacteria 1534
583 Ga0453684_0436143 3300044712 Bacteria 1460
584 Ga0453684_0463345 3300044712 Bacteria 1409
585 Ga0453684_0500635 3300044712 Bacteria 1345
586 Ga0453684_0594215 3300044712 Bacteria 1214
587 Ga0453684_0619670 3300044712 Bacteria 1184
588 Ga0453684_0653332 3300044712 Bacteria 1147
589 Ga0453684_0671567 3300044712 Bacteria 1128
590 Ga0453684_0807469 3300044712 Bacteria 1011
591 Ga0453684_0850020 3300044712 Bacteria 981
592 Ga0453684_0871877 3300044712 Bacteria 966
593 Ga0453684_0921965 3300044712 Bacteria 934
594 Ga0453684_1102307 3300044712 Bacteria 838
595 Ga0453684_1150080 3300044712 Bacteria 817
596 Ga0453684_1909765 3300044712 Bacteria 600
597 Ga0453684_2125505 3300044712 Bacteria 562
598 Ga0466970_0355519 3300044765 Bacteria 832
599 Ga0451576_0002384 3300045051 Bacteria 28282
600 Ga0451576_0003731 3300045051 Bacteria 20600
601 Ga0451576_0008630 3300045051 Bacteria 11938
602 Ga0451576_0015322 3300045051 Bacteria 8496
603 Ga0451576_0034751 3300045051 Bacteria 5352
604 Ga0451576_0048314 3300045051 Bacteria 4470
605 Ga0451576_0070431 3300045051 Bacteria 3640
606 Ga0451576_0085466 3300045051 Bacteria 3282
607 Ga0451576_0094229 3300045051 Bacteria 3114
608 Ga0451576_0098137 3300045051 Bacteria 3047
609 Ga0451576_0119203 3300045051 Bacteria 2747
610 Ga0451576_0130775 3300045051 Bacteria 2616
611 Ga0451576_0146078 3300045051 Bacteria 2466
612 Ga0451576_0292198 3300045051 Bacteria 1704
613 Ga0451576_0367052 3300045051 Bacteria 1508
614 Ga0451576_0391225 3300045051 Bacteria 1457
615 Ga0451576_0727924 3300045051 Bacteria 1042
616 Ga0451576_1008367 3300045051 Bacteria 872
617 Ga0451576_1138496 3300045051 Bacteria 816
618 Ga0451576_1798630 3300045051 Bacteria 633
619 Ga0451576_2175247 3300045051 Bacteria 570
620 Ga0451576_2348168 3300045051 Bacteria 546
621 Ga0495592_0276162 3300046454 Bacteria 1100
622 Ga0495592_0687365 3300046454 Bacteria 617
623 Ga0495603_0250527 3300046455 Bacteria 1019
624 Ga0495603_0410469 3300046455 Bacteria 776
625 Ga0495629_0051341 3300046459 Bacteria 2886
626 Ga0495629_0055435 3300046459 Bacteria 2771
627 Ga0495629_0269623 3300046459 Bacteria 1169
628 Ga0495641_0250073 3300046461 Bacteria 797
629 Ga0495651_0040843 3300046462 Bacteria 3604
630 Ga0495651_0057363 3300046462 Bacteria 2989
631 Ga0495651_0094695 3300046462 Bacteria 2234
632 Ga0495653_0025713 3300046463 Bacteria 4724
633 Ga0495653_0032485 3300046463 Bacteria 4142
634 Ga0495653_0077739 3300046463 Bacteria 2463
635 Ga0495653_0109091 3300046463 Bacteria 1992
636 Ga0495580_0170362 3300046472 Bacteria 1505
637 Ga0495582_0052180 3300046473 Bacteria 2255
638 Ga0495582_0232402 3300046473 Bacteria 1056
639 Ga0495639_0006807 3300046475 Bacteria 4914
640 Ga0495662_0007189 3300046476 Bacteria 5514
641 Ga0495662_0032643 3300046476 Bacteria 2515
642 Ga0495664_0002380 3300046477 Bacteria 10080
643 Ga0495664_0089624 3300046477 Bacteria 1849
644 Ga0495664_0474027 3300046477 Bacteria 748
645 Ga0495584_0499249 3300046491 Bacteria 620
646 Ga0495584_0666608 3300046491 Bacteria 530
647 Ga0495594_0000638 3300046499 Bacteria 18047
648 Ga0495594_0023040 3300046499 Bacteria 3335
649 Ga0495594_0049295 3300046499 Bacteria 2314
650 Ga0495594_0236288 3300046499 Bacteria 1042
651 Ga0495583_0005394 3300046506 Bacteria 8700
652 Ga0495606_0079354 3300046507 Bacteria 2044
653 Ga0495606_0165499 3300046507 Bacteria 1287
654 Ga0495608_0024225 3300046511 Bacteria 4152
655 Ga0495608_0026901 3300046511 Bacteria 3918
656 Ga0495608_0047676 3300046511 Bacteria 2847
657 Ga0495608_0057431 3300046511 Bacteria 2568
658 Ga0495608_0418427 3300046511 Bacteria 818
659 Ga0495610_0000001 3300046512 Bacteria 1620061
660 Ga0495618_0176744 3300046514 Bacteria 1357
661 Ga0495618_0251886 3300046514 Bacteria 1107
662 Ga0495618_0260214 3300046514 Bacteria 1086
663 Ga0495618_0289634 3300046514 Bacteria 1019
664 Ga0495628_0017109 3300046516 Bacteria 6040
665 Ga0495628_0289443 3300046516 Bacteria 1214
666 Ga0495628_0776746 3300046516 Bacteria 672
667 Ga0495630_0464520 3300046517 Bacteria 970
668 Ga0495630_1018227 3300046517 Bacteria 629
669 Ga0495631_0290190 3300046518 Bacteria 696
670 Ga0495632_0266895 3300046519 Bacteria 764
671 Ga0495648_0299677 3300046524 Bacteria 754
672 Ga0495666_0020471 3300046526 Bacteria 3277
673 Ga0495666_0038361 3300046526 Bacteria 2329
674 Ga0495652_0019179 3300046529 Bacteria 6093
675 Ga0495652_0043441 3300046529 Bacteria 3870
676 Ga0495652_0108053 3300046529 Bacteria 2243
677 Ga0495652_0473646 3300046529 Bacteria 873
678 Ga0495665_0005464 3300046531 Bacteria 6844
679 Ga0495665_0045240 3300046531 Bacteria 2338
680 Ga0495640_0044390 3300046533 Bacteria 3090
681 Ga0495640_0071973 3300046533 Bacteria 2317
682 Ga0495640_0093537 3300046533 Bacteria 1981
683 Ga0495640_0615380 3300046533 Bacteria 655
684 Ga0495586_0038923 3300046535 Bacteria 2555
685 Ga0495586_0044991 3300046535 Bacteria 2378
686 Ga0495587_0017871 3300046536 Bacteria 4399
687 Ga0495587_0038861 3300046536 Bacteria 2851
688 Ga0495587_0283349 3300046536 Bacteria 928
689 Ga0495609_0264553 3300046538 Bacteria 706
690 Ga0495645_0032192 3300046543 Bacteria 3824
691 Ga0495645_0152638 3300046543 Bacteria 1603
692 Ga0495622_0067403 3300046557 Bacteria 1654
693 Ga0495667_0006302 3300046559 Bacteria 8049
694 Ga0495667_0028059 3300046559 Bacteria 3790
695 Ga0495667_0214226 3300046559 Bacteria 1230
696 Ga0495667_0509492 3300046559 Bacteria 753
697 Ga0495656_0641749 3300046615 Bacteria 570
698 Ga0495634_0007238 3300046642 Bacteria 8366
699 Ga0495634_0076691 3300046642 Bacteria 2193
700 Ga0495634_0567935 3300046642 Bacteria 660
701 Ga0495625_0054921 3300046660 Bacteria 2843
702 Ga0495625_0425976 3300046660 Bacteria 824
703 Ga0495625_0541434 3300046660 Bacteria 706
704 Ga0495625_0561495 3300046660 Bacteria 690
705 Ga0495635_0044805 3300046663 Bacteria 3051
706 Ga0495635_0066955 3300046663 Bacteria 2463
707 Ga0495635_0545053 3300046663 Bacteria 761
708 Ga0495659_0096942 3300046664 Bacteria 1138
709 Ga0495588_0031387 3300046674 Bacteria 2674
710 Ga0495657_0016429 3300046675 Bacteria 5394
711 Ga0495657_0133826 3300046675 Bacteria 1550
712 Ga0495599_0033153 3300046678 Bacteria 3244
713 Ga0495599_0064468 3300046678 Bacteria 2288
714 Ga0495599_0243652 3300046678 Bacteria 1095
715 Ga0495599_0244099 3300046678 Bacteria 1094
716 Ga0495623_0048800 3300046679 Bacteria 2684
717 Ga0495623_0071584 3300046679 Bacteria 2157
718 Ga0495623_0240913 3300046679 Bacteria 1021
719 Ga0495646_0001478 3300046680 Bacteria 13962
720 Ga0495646_0031296 3300046680 Bacteria 3317
721 Ga0495646_0046819 3300046680 Bacteria 2634
722 Ga0495647_0003169 3300046681 Bacteria 5262
723 Ga0495658_0231354 3300046683 Bacteria 1159
724 Ga0495669_0108549 3300046684 Bacteria 1294
725 Ga0495613_0004053 3300046689 Bacteria 10962
726 Ga0495613_0020517 3300046689 Bacteria 4926
727 Ga0495613_0663789 3300046689 Bacteria 689
728 Ga0495613_0719230 3300046689 Bacteria 656
729 Ga0495624_0025491 3300046690 Bacteria 3881
730 Ga0495624_0131960 3300046690 Bacteria 1531
731 Ga0495624_0227626 3300046690 Bacteria 1130
732 Ga0495671_0049153 3300046692 Bacteria 2103
733 Ga0495600_0022924 3300046809 Bacteria 4013
734 Ga0495600_0348877 3300046809 Bacteria 927
735 Ga0495581_0015161 3300047315 Bacteria 4473
736 Ga0495581_0285657 3300047315 Bacteria 964
737 Ga0495581_0372212 3300047315 Bacteria 834
738 Ga0495604_0036386 3300047317 Bacteria 3881
739 Ga0495604_0567765 3300047317 Bacteria 730
740 Ga0495674_0065460 3300047319 Bacteria 3156
741 Ga0495674_0075092 3300047319 Bacteria 2909
742 Ga0495674_0169859 3300047319 Bacteria 1820
743 Ga0495674_0245970 3300047319 Bacteria 1473
744 Ga0495672_0110907 3300047320 Bacteria 1472
745 Ga0495672_0445868 3300047320 Bacteria 584
746 Ga0495676_0006925 3300047321 Bacteria 10413
747 Ga0495676_0075553 3300047321 Bacteria 2576
748 Ga0495680_0005789 3300047322 Bacteria 11567
749 Ga0495680_0017828 3300047322 Bacteria 6044
750 Ga0495680_0068981 3300047322 Bacteria 2699
751 Ga0495680_0150451 3300047322 Bacteria 1697
752 Ga0495683_0258095 3300047323 Bacteria 762
753 Ga0495675_0018824 3300047444 Bacteria 4387
754 Ga0495675_0235482 3300047444 Bacteria 1104
755 Ga0495673_0195057 3300047469 Bacteria 760
756 Ga0495684_0017798 3300047471 Bacteria 5473
757 Ga0495684_0022113 3300047471 Bacteria 4896
758 Ga0495684_0052489 3300047471 Bacteria 3111
759 Ga0495684_0138352 3300047471 Bacteria 1827
760 Ga0495684_0200511 3300047471 Bacteria 1471
761 Ga0495684_0535098 3300047471 Bacteria 800
762 Ga0495686_0035397 3300047472 Bacteria 3210
763 Ga0495593_0117452 3300047673 Bacteria 1355
764 Ga0495593_0142580 3300047673 Bacteria 1213
765 Ga0495602_0046941 3300048088 Bacteria 3896
766 Ga0495614_0014156 3300048089 Bacteria 3495
767 Ga0495614_0021203 3300048089 Bacteria 2807
768 Ga0495615_0079360 3300048090 Bacteria 897
769 Ga0496100_0036356 3300048903 Bacteria 3106
770 Ga0496100_0138237 3300048903 Bacteria 1723
771 Ga0496101_0077965 3300048904 Bacteria 2443
772 Ga0496102_0017081 3300048905 Bacteria 6351
773 Ga0496102_0736733 3300048905 Bacteria 908
774 Ga0496105_1209319 3300048908 Bacteria 556
775 Ga0496106_0002409 3300048909 Bacteria 13933
776 Ga0496106_1328011 3300048909 Bacteria 558
777 Ga0496106_1351056 3300048909 Bacteria 552
778 Ga0496107_0005478 3300048910 Bacteria 8684
779 Ga0496108_0044653 3300048911 Bacteria 3699
780 Ga0496109_0008916 3300048912 Bacteria 8546
781 Ga0496109_1000745 3300048912 Bacteria 773
782 Ga0496110_0339147 3300048913 Bacteria 1369
783 Ga0496110_1336348 3300048913 Bacteria 626
784 Ga0496114_0185776 3300048917 Bacteria 1816
785 Ga0496119_0413184 3300048922 Bacteria 642
786 Ga0496120_0212401 3300048923 Bacteria 930
787 Ga0496120_0272920 3300048923 Bacteria 785
788 Ga0496122_0011091 3300048925 Bacteria 9188
789 Ga0496123_0045704 3300048926 Bacteria 2980
790 Ga0496124_0249556 3300048927 Bacteria 1314
791 Ga0496126_0000853 3300048929 Bacteria 53738
792 Ga0496126_0002002 3300048929 Bacteria 28825
793 Ga0496126_0133436 3300048929 Bacteria 2144
794 Ga0501036_0405985 3300049572 Bacteria 1136
795 Ga0501036_1247817 3300049572 Bacteria 605
796 Ga0501036_1530837 3300049572 Bacteria 539
797 Ga0501039_0311642 3300049575 Bacteria 1237
798 Ga0501039_1382766 3300049575 Bacteria 542
799 Ga0501040_0460754 3300049576 Bacteria 915
800 Ga0501041_0066597 3300049577 Bacteria 2207
801 Ga0501042_0629996 3300049578 Bacteria 780
802 Ga0501071_0121681 3300049587 Bacteria 1935
803 Ga0501075_0122305 3300049591 Bacteria 1981
804 Ga0501076_0317321 3300049592 Bacteria 1278
805 Ga0501079_0127446 3300049741 Bacteria 1980
806 Ga0501035_0000091 3300049822 Bacteria 111687
807 Ga0501045_0190325 3300049824 Bacteria 1529
808 Ga0501045_0643593 3300049824 Bacteria 784
809 nmdc:mga09592_10213_c1 3300050508 Bacteria 7640
810 nmdc:mga09592_242623_c1 3300050508 Bacteria 1561
811 nmdc:mga09592_381719_c1 3300050508 Bacteria 1218
812 nmdc:mga0qj67_175636_c1 3300050509 Bacteria 1739
813 nmdc:mga0qj67_340594_c1 3300050509 Bacteria 1213
814 nmdc:mga06r32_1139703_c1 3300050510 Bacteria 728
815 nmdc:mga06r32_194678_c1 3300050510 Unclassified 2014
816 nmdc:mga06r32_78485_c1 3300050510 Bacteria 3209
817 nmdc:mga06r32_82569_c1 3300050510 Bacteria 2624
818 nmdc:mga0n895_1248304_c1 3300050512 Bacteria 716
819 nmdc:mga0n895_1391647_c1 3300050512 Bacteria 670
820 nmdc:mga0n895_1890340_c1 3300050512 Bacteria 556
821 nmdc:mga0n895_369344_c1 3300050512 Bacteria 1452
822 nmdc:mga0rr50_215335_c1 3300050513 Bacteria 1584
823 nmdc:mga0rr50_504977_c1 3300050513 Bacteria 1028
824 nmdc:mga08x19_100071_c1 3300050514 Bacteria 1922
825 nmdc:mga08x19_1108685_c1 3300050514 Bacteria 562
826 nmdc:mga08x19_777081_c1 3300050514 Bacteria 680
827 nmdc:mga0a205_153065_c1 3300050515 Bacteria 2205
828 Ga0495612_0029309 3300053078 Bacteria 2217
829 Ga0495612_0303208 3300053078 Bacteria 716
830 Ga0495595_0037565 3300053084 Bacteria 2202
831 Ga0495595_0043733 3300053084 Bacteria 2056
832 Ga0495619_0405293 3300053085 Bacteria 941
833 Ga0500556_0104877 3300053104 Bacteria 1092
834 Ga0500595_000040 3300053119 Bacteria 97854
835 Ga0500595_003285 3300053119 Bacteria 7623
836 Ga0587093_070727 3300059478 Unclassified 586
837 Ga0587070_042623 3300059491 Bacteria 875
838 Ga0587082_132714 3300059504 Bacteria 574
839 Ga0587085_046288 3300059506 Unclassified 777
840 Ga0587085_082840 3300059506 Bacteria 649
841 Ga0587091_074516 3300059511 Bacteria 749
842 Ga0587129_023848 3300059608 Bacteria 558
843 Ga0587131_020964 3300059609 Bacteria 538
844 Ga0587101_154376 3300059623 Unclassified 500
845 Ga0587109_129990 3300059624 Bacteria 606
846 Ga0587117_062884 3300059627 Unclassified 642
847 Ga0587122_029344 3300059628 Bacteria 640
848 Ga0587128_125696 3300059630 Bacteria 563
849 Ga0587067_072899 3300059640 Bacteria 745
850 Ga0587107_104557 3300059652 Bacteria 565
851 Ga0587119_057495 3300059658 Bacteria 593
852 Ga0587111_0148256 3300060346 Bacteria 628
853 Ga0501082_0055780 3300060353 Bacteria 3403
854 Ga0530510_0032985 3300061734 Bacteria 3727
855 Ga0530510_0055783 3300061734 Bacteria 2854
856 Ga0530510_0344012 3300061734 Bacteria 1120
857 2590611410 2588254257 Bacteria 5436094
858 2597865111 2597489888 Bacteria 6179543
859 2729201947 2728369107 Bacteria 5082720
860 2842086561 2842083920 Bacteria 4857652
861 2906000560 2905999023 Bacteria 4591259
862 2946020709 2946019816 Bacteria 4621265
863 Ga0070717_10007952
864 JGI24752J21851_1054339
865 JGI24746J21847_1028042
866 JGI24747J21853_1033199
867 JGI24739J22299_10216052
868 JGI24737J22298_10208307
869 JGI24743J22301_10005654
870 JGI24743J22301_10059717
871 JGI24743J22301_10128823
872 JGI24735J21928_10204216
873 JGI24735J21928_10239147
874 JGI24750J21931_1056156
875 JGI24745J21846_1011979
876 JGI24034J26672_10013996
877 JGI24034J26672_10091346
878 JGI24751J29686_10046431
879 JGI25404J52841_10004398
880 JGI25404J52841_10089306
881 Ga0065712_10372393
882 Ga0065715_10742737
883 Ga0070658_10001524
884 Ga0070658_11775407
885 Ga0070676_10003794
886 Ga0070676_10050319
887 Ga0070683_100001273
888 Ga0070683_100426605
889 Ga0070690_100000319
890 Ga0070670_100005386
891 Ga0070670_100605866
892 Ga0070677_10000440
893 Ga0068869_100000369
894 Ga0070666_10000685
895 Ga0070666_10026908
896 Ga0070666_10086376
897 Ga0070680_100068570
898 Ga0070680_100701288
899 Ga0070682_100216689
900 Ga0070682_101721125
901 Ga0068868_100001554
902 Ga0070660_100000840
903 Ga0070689_100001008
904 Ga0070691_10085474
905 Ga0070687_100000001
906 Ga0070687_100079032
907 Ga0070661_100000069
908 Ga0070661_100032368
909 Ga0070661_100373925
910 Ga0070692_10024913
911 Ga0070668_100000341
912 Ga0070669_100000700
913 Ga0070675_100003072
914 Ga0070671_100007285
915 Ga0070671_100897219
916 Ga0070674_100000876
917 Ga0070673_100001053
918 Ga0070673_100074295
919 Ga0070688_100000023
920 Ga0070659_100000172
921 Ga0070659_100203871
922 Ga0070667_100002969
923 Ga0070703_10061937
924 Ga0070703_10284771
925 Ga0070709_10001297
926 Ga0070709_10886113
927 Ga0070714_100001870
928 Ga0070713_100001100
929 Ga0070713_100157598
930 Ga0070713_100359705
931 Ga0070710_10000496
932 Ga0070710_10031337
933 Ga0070710_10795762
934 Ga0070701_10024462
935 Ga0070711_100000670
936 Ga0070711_100023318
937 Ga0070705_100000877
938 Ga0070705_100307926
939 Ga0070700_100002114
940 Ga0070700_100059244
941 Ga0070694_100162047
942 Ga0070708_100000973
943 Ga0070708_100001176
944 Ga0070708_100001685
945 Ga0070708_100035170
946 Ga0070708_100323538
947 Ga0070708_100869896
948 Ga0070663_100000134
949 Ga0070678_100000316
950 Ga0070662_100000267
951 Ga0070681_10420267
952 Ga0070681_10560249
953 Ga0068867_100000499
954 Ga0070685_10000305
955 Ga0070706_100002146
956 Ga0070706_100140264
957 Ga0070706_100200639
958 Ga0070707_100005494
959 Ga0070707_100081379
960 Ga0070698_100003076
961 Ga0070699_100006061
962 Ga0070699_100040050
963 Ga0070679_100005268
964 Ga0070679_100378236
965 Ga0070679_100477015
966 Ga0070684_100073384
967 Ga0070684_101426888
968 Ga0070697_100000778
969 Ga0070697_100027233
970 Ga0070697_100287144
971 Ga0068853_100000688
972 Ga0068853_100031982
973 Ga0070672_100000525
974 Ga0070686_100005990
975 Ga0070686_100059298
976 Ga0070695_100016518
977 Ga0070695_101799532
978 Ga0070696_100003151
979 Ga0070696_100178735
980 Ga0070693_100006183
981 Ga0070693_100201088
982 Ga0070665_100014433
983 Ga0070665_100030721
984 Ga0070665_102447832
985 Ga0070704_100203463
986 Ga0068855_100005229
987 Ga0070664_100000852
988 Ga0070664_100001306
989 Ga0070664_100028872
990 Ga0068857_100000758
991 Ga0068857_101023676
992 Ga0068854_100000089
993 Ga0068856_100003957
994 Ga0068856_100454513
995 Ga0068856_102001707
996 Ga0070702_100056431
997 Ga0068852_100000072
998 Ga0068859_100002215
999 Ga0068864_100002336
1000 Ga0068864_100051031
1001 Ga0068866_10000160
1002 Ga0068866_10071864
1003 Ga0068861_100000015
1004 Ga0068861_100520717
1005 Ga0068851_10001524
1006 Ga0068870_10000838
1007 Ga0068870_10031871
1008 Ga0068863_100000428
1009 Ga0068863_100008115
1010 Ga0068858_100016013
1011 Ga0068860_100008025
1012 Ga0068862_100001279
1013 Ga0081540_1000023
1014 Ga0081540_1000118
1015 Ga0081540_1001080
1016 Ga0070717_10003707
1017 Ga0070717_10037608
1018 Ga0070717_10049986
1019 Ga0070717_10145270
1020 Ga0070717_10195762
1021 Ga0070717_11659308
1022 Ga0070716_100000437
1023 Ga0070716_100157787
1024 Ga0070716_100570700
1025 Ga0070716_100929280
1026 Ga0070712_100001524
1027 Ga0070712_100049958
1028 Ga0070712_101406516
1029 Ga0070712_101448923
1030 Ga0097621_100000221
1031 Ga0068871_100001589
1032 Ga0068871_100994132
1033 Ga0075428_100104034
1034 Ga0075428_100312302
1035 Ga0075430_100377461
1036 Ga0075430_100470982
1037 Ga0075431_100185909
1038 Ga0075431_100328195
1039 Ga0075431_101363762
1040 Ga0075431_101426236
1041 Ga0075433_10431470
1042 Ga0075433_11342859
1043 Ga0075433_11922065
1044 Ga0075434_100307182
1045 Ga0075434_100397655
1046 Ga0075434_101352014
1047 Ga0075434_102549444
1048 Ga0075429_100051906
1049 Ga0075429_100053811
1050 Ga0068865_100000118
1051 Ga0068865_100568876
1052 Ga0075436_100776205
1053 Ga0097620_100002215
1054 Ga0075435_101482048
1055 Ga0099794_10000003
1056 Ga0099794_10201367
1057 Ga0099794_10306682
1058 Ga0099795_10117901
1059 Ga0105251_10277623
1060 Ga0105244_10448087
1061 Ga0105240_10003604
1062 Ga0105245_10000145
1063 Ga0105245_12717157
1064 Ga0105247_10000193
1065 Ga0114129_10631328
1066 Ga0105243_10003134
1067 Ga0105243_10782063
1068 Ga0105243_12893430
1069 Ga0105241_10001101
1070 Ga0105241_10294697
1071 Ga0105242_10010326
1072 Ga0105242_11332148
1073 Ga0105248_10004426
1074 Ga0105248_10007516
1075 Ga0105237_10000812
1076 Ga0105237_10684613
1077 Ga0105238_10001065
1078 Ga0105238_10867521
1079 Ga0105249_10000171
1080 Ga0105249_10009702
1081 Ga0105249_10271762
1082 Ga0099796_10110110
1083 Ga0099796_10292528
1084 Ga0105239_10001634
1085 Ga0105239_10122289
1086 Ga0105239_10852557
1087 Ga0105246_10000943
1088 Ga0157325_1007844
1089 Ga0157329_1012418
1090 Ga0157323_1040058
1091 Ga0157345_1028198
1092 Ga0157338_1042256
1093 Ga0157373_10006249
1094 Ga0157371_10001230
1095 Ga0157370_10755944
1096 Ga0157370_11004292
1097 Ga0157369_10001086
1098 Ga0157369_10096549
1099 Ga0157369_10252196
1100 Ga0157374_10001393
1101 Ga0157374_10003766
1102 Ga0157374_10325332
1103 Ga0157374_12130512
1104 Ga0157378_10000755
1105 Ga0157378_10563387
1106 Ga0163162_10001134
1107 Ga0163162_10192646
1108 Ga0163162_12600309
1109 Ga0157372_10146598
1110 Ga0157375_10001074
1111 Ga0157375_12753878
1112 Ga0163163_10011847
1113 Ga0157380_10003188
1114 Ga0182008_10380262
1115 Ga0157377_10000913
1116 Ga0157379_10000590
1117 Ga0157379_10303969
1118 Ga0157379_10917134
1119 Ga0157379_11389513
1120 Ga0157376_10000455
1121 Ga0157376_10114657
1122 Ga0157376_10308048
1123 Ga0182006_1000039
1124 Ga0182007_10166343
1125 Ga0163161_10062237
1126 Ga0184597_111251
1127 Ga0184603_112217
1128 Ga0197907_10364955
1129 Ga0206355_1004666
1130 Ga0206355_1048623
1131 Ga0206352_10706461
1132 Ga0206350_10516989
1133 Ga0206353_10589080
1134 Ga0206353_10907574
1135 Ga0213872_10307841
1136 Ga0213874_10073208
1137 Ga0213876_10560810
1138 Ga0247554_104415
1139 Ga0247551_105519
1140 Ga0224572_1066446
1141 Ga0207673_1013391
1142 Ga0207697_10003056
1143 Ga0207656_10047310
1144 Ga0207655_1198136
1145 Ga0207653_10022530
1146 Ga0207653_10306157
1147 Ga0207682_10000711
1148 Ga0207692_10040697
1149 Ga0207692_10301400
1150 Ga0207642_10000129
1151 Ga0207710_10003310
1152 Ga0207710_10012945
1153 Ga0207688_10000050
1154 Ga0207688_10041151
1155 Ga0207680_10000450
1156 Ga0207680_10081111
1157 Ga0207647_10003230
1158 Ga0207647_10755951
1159 Ga0207685_10112646
1160 Ga0207685_10530968
1161 Ga0207699_10000728
1162 Ga0207699_11080347
1163 Ga0207645_10000022
1164 Ga0207645_10073792
1165 Ga0207643_10000011
1166 Ga0207705_10001292
1167 Ga0207705_10700449
1168 Ga0207684_10000068
1169 Ga0207684_10107594
1170 Ga0207684_10639918
1171 Ga0207654_10001102
1172 Ga0207654_11129160
1173 Ga0207707_10089230
1174 Ga0207707_10734083
1175 Ga0207695_10010142
1176 Ga0207695_10292327
1177 Ga0207695_10744237
1178 Ga0207671_10001264
1179 Ga0207671_10048984
1180 Ga0207693_10007067
1181 Ga0207693_10038996
1182 Ga0207663_10018812
1183 Ga0207663_10067392
1184 Ga0207660_10023351
1185 Ga0207660_11284995
1186 Ga0207662_10000004
1187 Ga0207657_10000055
1188 Ga0207649_10000272
1189 Ga0207649_10030844
1190 Ga0207649_10303509
1191 Ga0207652_10023431
1192 Ga0207652_10047178
1193 Ga0207646_10019011
1194 Ga0207646_10518642
1195 Ga0207681_10000399
1196 Ga0207694_10003286
1197 Ga0207650_10000833
1198 Ga0207659_10000048
1199 Ga0207659_11335782
1200 Ga0207687_10001570
1201 Ga0207687_10425939
1202 Ga0207700_10000378
1203 Ga0207700_10613774
1204 Ga0207700_11682579
1205 Ga0207664_10171087
1206 Ga0207664_10428186
1207 Ga0207644_10000215
1208 Ga0207644_10046649
1209 Ga0207644_10291951
1210 Ga0207644_10464211
1211 Ga0207690_10000221
1212 Ga0207690_10062501
1213 Ga0207706_10000534
1214 Ga0207686_10005043
1215 Ga0207709_10004291
1216 Ga0207670_10000315
1217 Ga0207669_10000480
1218 Ga0207704_10000102
1219 Ga0207704_10304498
1220 Ga0207665_10001239
1221 Ga0207665_10126555
1222 Ga0207665_10298110
1223 Ga0207665_11192621
1224 Ga0207691_10000177
1225 Ga0207691_10036738
1226 Ga0207711_10000159
1227 Ga0207711_10319164
1228 Ga0207711_10590443
1229 Ga0207689_10000027
1230 Ga0207661_10046709
1231 Ga0207661_10905370
1232 Ga0207661_11529697
1233 Ga0207679_10000432
1234 Ga0207679_10001520
1235 Ga0207679_10106025
1236 Ga0207667_10002170
1237 Ga0207667_10173170
1238 Ga0207667_11732561
1239 Ga0207667_12135390
1240 Ga0207651_10000025
1241 Ga0207712_10000368
1242 Ga0207712_10052806
1243 Ga0207668_10000877
1244 Ga0207668_12027933
1245 Ga0207640_10000646
1246 Ga0207640_10613858
1247 Ga0207658_10000694
1248 Ga0207677_10000120
1249 Ga0207677_10139474
1250 Ga0207677_10258053
1251 Ga0207703_10000125
1252 Ga0207703_10154775
1253 Ga0207639_10001661
1254 Ga0207639_11424943
1255 Ga0207639_12284735
1256 Ga0207678_10000364
1257 Ga0207708_10006142
1258 Ga0207702_10003587
1259 Ga0207702_10044277
1260 Ga0207702_11861112
1261 Ga0207702_12474431
1262 Ga0207641_10000776
1263 Ga0207641_10220806
1264 Ga0207648_10001131
1265 Ga0207648_10089211
1266 Ga0207676_10000448
1267 Ga0207676_10146374
1268 Ga0207674_10002010
1269 Ga0207674_10004055
1270 Ga0207674_10081497
1271 Ga0207675_100000004
1272 Ga0207683_10000007
1273 Ga0207698_10000460
1274 Ga0207698_10108854
1275 Ga0209588_1000001
1276 Ga0209588_1143877
1277 Ga0209588_1221069
1278 Ga0268266_10000207
1279 Ga0268266_10075220
1280 Ga0268266_10207602
1281 Ga0268266_12175297
1282 Ga0268265_10001016
1283 Ga0268264_10000301
1284 Ga0268264_10067204
1285 Ga0265334_10251031
1286 Ga0307515_10172394
1287 Ga0265338_10006058
1288 Ga0265338_10020126
1289 Ga0265338_10274744
1290 Ga0265762_1049239
1291 Ga0265775_110697
1292 Ga0265763_1045098
1293 Ga0265767_117906
1294 Ga0265777_112710
1295 Ga0265776_102341
1296 Ga0265764_107783
1297 Ga0265772_103086
1298 Ga0265772_106371
1299 Ga0265769_111517
1300 Ga0265769_121168
1301 Ga0265761_103014
1302 Ga0265768_115355
1303 Ga0265760_10285414
1304 Ga0265339_10043863
1305 Ga0310103_109293
1306 Ga0316575_10199642
1307 Ga0265314_10015910
1308 Ga0307410_11145669
1309 Ga0307406_10853970
1310 Ga0307406_11721115
1311 Ga0307407_10527845
1312 Ga0307412_10000034
1313 Ga0307409_101327322
1314 Ga0307416_100000030
1315 Ga0307416_100916250
1316 Ga0307414_10050128
1317 Ga0307411_10250702
1318 Ga0307411_11211955
1319 Ga0316583_10080066
1320 Ga0307510_10019182
1321 Ga0307510_10086645
1322 Ga0307510_10403465
1323 Ga0316215_1020665
1324 Ga0316214_1006892
1325 Ga0316212_1003326
1326 Ga0373926_0062383
1327 Ga0373928_0034472
1328 Ga0373934_0272585
1329 Ga0373940_0005034
1330 Ga0373944_0002752
1331 Ga0373951_0152486
1332 Ga0373923_0103749
1333 Ga0373923_0272820
1334 Ga0373941_0030431
1335 Ga0373945_0030788
1336 Ga0373953_0168110
1337 Ga0373956_0494588
1338 Ga0373956_0628678
1339 Ga0373957_0117936
1340 Ga0373943_0149455
1341 Ga0373943_0729706
1342 Ga0373946_0008383
1343 Ga0373946_0370968
1344 Ga0373955_0476584
1345 Ga0373955_0557467
1346 Ga0373942_0007929
1347 Ga0373924_0046625
1348 Ga0373931_0056293
1349 Ga0373935_0038874
1350 Ga0373935_0227523
1351 Ga0373935_0267815
1352 Ga0373935_0814224
1353 Ga0373935_1141904
1354 Ga0373933_0067119
1355 Ga0373947_0862817
1356 Ga0373947_1199064
1357 Ga0373937_0493283
1358 Ga0265778_041358
1359 Ga0373925_0046089
1360 Ga0373925_0362081
1361 Ga0395900_0702398
1362 Ga0395900_1755474
1363 Ga0436364_0696697
1364 Ga0436364_1282020
1365 Ga0242420_104242
1366 Ga0436365_1011888
1367 Ga0436360_0412722
1368 Ga0436360_0519576
1369 Ga0436360_1101507
1370 Ga0436361_0105626
1371 Ga0436361_0783445
1372 Ga0436363_0993477
1373 Ga0436363_1388306
1374 Ga0436362_1271413
1375 Ga0451791_1741236
1376 Ga0451793_1517122
1377 Ga0451798_1070021
1378 Ga0451804_0521722
1379 Ga0451839_1281877
1380 Ga0451851_0515133
1381 Ga0451851_1083970
1382 Ga0451853_0939589
1383 Ga0451853_1109228
1384 Ga0439458_0079350
1385 Ga0451577_0000057
1386 Ga0451577_0000119
1387 Ga0451577_0006036
1388 Ga0451577_0012695
1389 Ga0451577_0019717
1390 Ga0451577_0023332
1391 Ga0451577_0043649
1392 Ga0451577_0059236
1393 Ga0451577_0080039
1394 Ga0451577_0139920
1395 Ga0451577_0197460
1396 Ga0451577_0204496
1397 Ga0451577_0246542
1398 Ga0451577_0294888
1399 Ga0451577_0712693
1400 Ga0451577_0834693
1401 Ga0451577_1107330
1402 Ga0451577_1361028
1403 Ga0451577_1693320
1404 Ga0466972_0313304
1405 Ga0453683_0000248
1406 Ga0453683_0000691
1407 Ga0453683_0002661
1408 Ga0453683_0003585
1409 Ga0453683_0003938
1410 Ga0453683_0042300
1411 Ga0453683_0066358
1412 Ga0453683_0067214
1413 Ga0453683_0079967
1414 Ga0453683_0158255
1415 Ga0453683_0159408
1416 Ga0453683_0164394
1417 Ga0453683_0166736
1418 Ga0453683_0286787
1419 Ga0453683_0306763
1420 Ga0453683_0403370
1421 Ga0453683_0418364
1422 Ga0453683_0593407
1423 Ga0453684_0000196
1424 Ga0453684_0000258
1425 Ga0453684_0000729
1426 Ga0453684_0001130
1427 Ga0453684_0001663
1428 Ga0453684_0003569
1429 Ga0453684_0007995
1430 Ga0453684_0009291
1431 Ga0453684_0024781
1432 Ga0453684_0041174
1433 Ga0453684_0046369
1434 Ga0453684_0054332
1435 Ga0453684_0059478
1436 Ga0453684_0116930
1437 Ga0453684_0123296
1438 Ga0453684_0127762
1439 Ga0453684_0141725
1440 Ga0453684_0194552
1441 Ga0453684_0303482
1442 Ga0453684_0373875
1443 Ga0453684_0389905
1444 Ga0453684_0401770
1445 Ga0453684_0436143
1446 Ga0453684_0463345
1447 Ga0453684_0500635
1448 Ga0453684_0594215
1449 Ga0453684_0619670
1450 Ga0453684_0653332
1451 Ga0453684_0671567
1452 Ga0453684_0807469
1453 Ga0453684_0850020
1454 Ga0453684_0871877
1455 Ga0453684_0921965
1456 Ga0453684_1102307
1457 Ga0453684_1150080
1458 Ga0453684_1909765
1459 Ga0453684_2125505
1460 Ga0466970_0355519
1461 Ga0451576_0002384
1462 Ga0451576_0003731
1463 Ga0451576_0008630
1464 Ga0451576_0015322
1465 Ga0451576_0034751
1466 Ga0451576_0048314
1467 Ga0451576_0070431
1468 Ga0451576_0085466
1469 Ga0451576_0094229
1470 Ga0451576_0098137
1471 Ga0451576_0119203
1472 Ga0451576_0130775
1473 Ga0451576_0146078
1474 Ga0451576_0292198
1475 Ga0451576_0367052
1476 Ga0451576_0391225
1477 Ga0451576_0727924
1478 Ga0451576_1008367
1479 Ga0451576_1138496
1480 Ga0451576_1798630
1481 Ga0451576_2175247
1482 Ga0451576_2348168
1483 Ga0495592_0276162
1484 Ga0495592_0687365
1485 Ga0495603_0250527
1486 Ga0495603_0410469
1487 Ga0495629_0051341
1488 Ga0495629_0055435
1489 Ga0495629_0269623
1490 Ga0495641_0250073
1491 Ga0495651_0040843
1492 Ga0495651_0057363
1493 Ga0495651_0094695
1494 Ga0495653_0025713
1495 Ga0495653_0032485
1496 Ga0495653_0077739
1497 Ga0495653_0109091
1498 Ga0495580_0170362
1499 Ga0495582_0052180
1500 Ga0495582_0232402
1501 Ga0495639_0006807
1502 Ga0495662_0007189
1503 Ga0495662_0032643
1504 Ga0495664_0002380
1505 Ga0495664_0089624
1506 Ga0495664_0474027
1507 Ga0495584_0499249
1508 Ga0495584_0666608
1509 Ga0495594_0000638
1510 Ga0495594_0023040
1511 Ga0495594_0049295
1512 Ga0495594_0236288
1513 Ga0495583_0005394
1514 Ga0495606_0079354
1515 Ga0495606_0165499
1516 Ga0495608_0024225
1517 Ga0495608_0026901
1518 Ga0495608_0047676
1519 Ga0495608_0057431
1520 Ga0495608_0418427
1521 Ga0495610_0000001
1522 Ga0495618_0176744
1523 Ga0495618_0251886
1524 Ga0495618_0260214
1525 Ga0495618_0289634
1526 Ga0495628_0017109
1527 Ga0495628_0289443
1528 Ga0495628_0776746
1529 Ga0495630_0464520
1530 Ga0495630_1018227
1531 Ga0495631_0290190
1532 Ga0495632_0266895
1533 Ga0495648_0299677
1534 Ga0495666_0020471
1535 Ga0495666_0038361
1536 Ga0495652_0019179
1537 Ga0495652_0043441
1538 Ga0495652_0108053
1539 Ga0495652_0473646
1540 Ga0495665_0005464
1541 Ga0495665_0045240
1542 Ga0495640_0044390
1543 Ga0495640_0071973
1544 Ga0495640_0093537
1545 Ga0495640_0615380
1546 Ga0495586_0038923
1547 Ga0495586_0044991
1548 Ga0495587_0017871
1549 Ga0495587_0038861
1550 Ga0495587_0283349
1551 Ga0495609_0264553
1552 Ga0495645_0032192
1553 Ga0495645_0152638
1554 Ga0495622_0067403
1555 Ga0495667_0006302
1556 Ga0495667_0028059
1557 Ga0495667_0214226
1558 Ga0495667_0509492
1559 Ga0495656_0641749
1560 Ga0495634_0007238
1561 Ga0495634_0076691
1562 Ga0495634_0567935
1563 Ga0495625_0054921
1564 Ga0495625_0425976
1565 Ga0495625_0541434
1566 Ga0495625_0561495
1567 Ga0495635_0044805
1568 Ga0495635_0066955
1569 Ga0495635_0545053
1570 Ga0495659_0096942
1571 Ga0495588_0031387
1572 Ga0495657_0016429
1573 Ga0495657_0133826
1574 Ga0495599_0033153
1575 Ga0495599_0064468
1576 Ga0495599_0243652
1577 Ga0495599_0244099
1578 Ga0495623_0048800
1579 Ga0495623_0071584
1580 Ga0495623_0240913
1581 Ga0495646_0001478
1582 Ga0495646_0031296
1583 Ga0495646_0046819
1584 Ga0495647_0003169
1585 Ga0495658_0231354
1586 Ga0495669_0108549
1587 Ga0495613_0004053
1588 Ga0495613_0020517
1589 Ga0495613_0663789
1590 Ga0495613_0719230
1591 Ga0495624_0025491
1592 Ga0495624_0131960
1593 Ga0495624_0227626
1594 Ga0495671_0049153
1595 Ga0495600_0022924
1596 Ga0495600_0348877
1597 Ga0495581_0015161
1598 Ga0495581_0285657
1599 Ga0495581_0372212
1600 Ga0495604_0036386
1601 Ga0495604_0567765
1602 Ga0495674_0065460
1603 Ga0495674_0075092
1604 Ga0495674_0169859
1605 Ga0495674_0245970
1606 Ga0495672_0110907
1607 Ga0495672_0445868
1608 Ga0495676_0006925
1609 Ga0495676_0075553
1610 Ga0495680_0005789
1611 Ga0495680_0017828
1612 Ga0495680_0068981
1613 Ga0495680_0150451
1614 Ga0495683_0258095
1615 Ga0495675_0018824
1616 Ga0495675_0235482
1617 Ga0495673_0195057
1618 Ga0495684_0017798
1619 Ga0495684_0022113
1620 Ga0495684_0052489
1621 Ga0495684_0138352
1622 Ga0495684_0200511
1623 Ga0495684_0535098
1624 Ga0495686_0035397
1625 Ga0495593_0117452
1626 Ga0495593_0142580
1627 Ga0495602_0046941
1628 Ga0495614_0014156
1629 Ga0495614_0021203
1630 Ga0495615_0079360
1631 Ga0496100_0036356
1632 Ga0496100_0138237
1633 Ga0496101_0077965
1634 Ga0496102_0017081
1635 Ga0496102_0736733
1636 Ga0496105_1209319
1637 Ga0496106_0002409
1638 Ga0496106_1328011
1639 Ga0496106_1351056
1640 Ga0496107_0005478
1641 Ga0496108_0044653
1642 Ga0496109_0008916
1643 Ga0496109_1000745
1644 Ga0496110_0339147
1645 Ga0496110_1336348
1646 Ga0496114_0185776
1647 Ga0496119_0413184
1648 Ga0496120_0212401
1649 Ga0496120_0272920
1650 Ga0496122_0011091
1651 Ga0496123_0045704
1652 Ga0496124_0249556
1653 Ga0496126_0000853
1654 Ga0496126_0002002
1655 Ga0496126_0133436
1656 Ga0501036_0405985
1657 Ga0501036_1247817
1658 Ga0501036_1530837
1659 Ga0501039_0311642
1660 Ga0501039_1382766
1661 Ga0501040_0460754
1662 Ga0501041_0066597
1663 Ga0501042_0629996
1664 Ga0501071_0121681
1665 Ga0501075_0122305
1666 Ga0501076_0317321
1667 Ga0501079_0127446
1668 Ga0501035_0000091
1669 Ga0501045_0190325
1670 Ga0501045_0643593
1671 nmdc:mga09592_10213_c1
1672 nmdc:mga09592_242623_c1
1673 nmdc:mga09592_381719_c1
1674 nmdc:mga0qj67_175636_c1
1675 nmdc:mga0qj67_340594_c1
1676 nmdc:mga06r32_1139703_c1
1677 nmdc:mga06r32_194678_c1
1678 nmdc:mga06r32_78485_c1
1679 nmdc:mga06r32_82569_c1
1680 nmdc:mga0n895_1248304_c1
1681 nmdc:mga0n895_1391647_c1
1682 nmdc:mga0n895_1890340_c1
1683 nmdc:mga0n895_369344_c1
1684 nmdc:mga0rr50_215335_c1
1685 nmdc:mga0rr50_504977_c1
1686 nmdc:mga08x19_100071_c1
1687 nmdc:mga08x19_1108685_c1
1688 nmdc:mga08x19_777081_c1
1689 nmdc:mga0a205_153065_c1
1690 Ga0495612_0029309
1691 Ga0495612_0303208
1692 Ga0495595_0037565
1693 Ga0495595_0043733
1694 Ga0495619_0405293
1695 Ga0500556_0104877
1696 Ga0500595_000040
1697 Ga0500595_003285
1698 Ga0587093_070727
1699 Ga0587070_042623
1700 Ga0587082_132714
1701 Ga0587085_046288
1702 Ga0587085_082840
1703 Ga0587091_074516
1704 Ga0587129_023848
1705 Ga0587131_020964
1706 Ga0587101_154376
1707 Ga0587109_129990
1708 Ga0587117_062884
1709 Ga0587122_029344
1710 Ga0587128_125696
1711 Ga0587067_072899
1712 Ga0587107_104557
1713 Ga0587119_057495
1714 Ga0587111_0148256
1715 Ga0501082_0055780
1716 Ga0530510_0032985
1717 Ga0530510_0055783
1718 Ga0530510_0344012
1719 2590611410
1720 2597865111
1721 2729201947
1722 2842086561
1723 2906000560
1724 2946020709

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

9

74

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mjc-assembly1.cif.gz_A crystal structure of cspa, the major cold shock protein of escherichia coli 0.9828 2 67
3i2z-assembly2.cif.gz_B structure of cold shock protein e from salmonella typhimurium 0.9785 1 67
8h1i-assembly1.cif.gz_B crystal structure of plygrcs, a bacteriophage endolysin in complex with cold shock protein c 0.9711 2 67
1hza-assembly1.cif.gz_B bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability 0.9705 1 67
1c9o-assembly1.cif.gz_B crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp 0.9616 1 67
ID Description Score Start End Superfamily
af_Q9VRN5_36_116_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9722 2 64 2.40.50.140
af_P92186_48_133_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.97 2 64 2.40.50.140
af_Q94C69_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9662 2 64 2.40.50.140
af_P91306_55_138_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9569 2 64 2.40.50.140
af_I1LPN7_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9555 2 64 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A511TFR2-F1-model_v4 Cold-shock protein 1.012 1 67 GO:0003676
GO:0005737
AF-A0A4Q5ZHQ1-F1-model_v4 deleted 1.01 1 67
AF-A0A534XW84-F1-model_v4 Cold-shock protein 1.009 1 67 GO:0003676
GO:0005737
AF-A0A542TNR2-F1-model_v4 deleted 1.009 1 67
AF-A0A502CNC9-F1-model_v4 Cold-shock protein 1.009 1 67 GO:0003676
GO:0005737

Map