F483981

General Info

Members Datasets Scaffolds Average Seq Length
865 508 734 179

Family's Representative Sequence

Representative Sequence 3300003751|Ga0055538_1000008|Ga0055538_1000008136
Length 182
Sequence MSRFLGEIKQLGYVVADIEAAMQHWTEVLGVGPFYYMERVPLKNYRYRGQPYEIHNSVALANAGGVQVELIQARCDTPSMYRDFIQRGQERQSGLQHVAYWTEDFERDLAALQARGWKVGMSGEVGERGRFVYFETEYHPGTVIELSEVAGPKGKVFKLIRSASENWDGRDPVRSFPDLGSL

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
4 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
5 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
6 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
7 2547132374 Acidovorax radicis N35 Isolate Unclassified
8 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
9 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
10 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
11 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
12 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
13 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
14 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
15 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
16 2643221569 Achromobacter sp. Root565 Isolate Unclassified
17 2643221596 Acidovorax sp. Root70 Isolate Unclassified
18 2643221621 Achromobacter sp. Root83 Isolate Unclassified
19 2643221658 Variovorax sp. Root411 Isolate Unclassified
20 2643221672 Variovorax sp. Root434 Isolate Unclassified
21 2643221683 Variovorax sp. Root473 Isolate Unclassified
22 2643221717 Acidovorax sp. Root267 Isolate Unclassified
23 2643221733 Bosea sp. Root381 Isolate Unclassified
24 2643221734 Bosea sp. Root670 Isolate Unclassified
25 2643221736 Bosea sp. Root483D1 Isolate Unclassified
26 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
27 2738541277 Variovorax sp. GV051 Isolate Unclassified
28 2738541307 Variovorax sp. GV008 Isolate Unclassified
29 2738543019 Variovorax sp. GV040 Isolate Unclassified
30 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
31 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
32 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
33 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
34 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
35 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
36 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
37 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
38 2818991446 Variovorax sp. 1180 Isolate Unclassified
39 2818991467 Bosea vestrisii 3192 Isolate Unclassified
40 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
41 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
42 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
43 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
44 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
45 2841760612 Bosea sp. Tri-49 Isolate Nodule
46 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
47 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
48 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
49 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
50 2844104063 Bosea sp. Tri-39 Isolate Nodule
51 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
52 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
53 2851182111 Bosea sp. Tri-44 Isolate Nodule
54 2851246043 Bosea sp. Tri-54 Isolate Nodule
55 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
56 2855730933 Achromobacter sp. HZ28 Isolate Nodule
57 2855767633 Achromobacter sp. HZ34 Isolate Nodule
58 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
59 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
60 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
61 2858950400 Achromobacter sp. K91 Isolate Unclassified
62 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
63 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
64 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
65 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
66 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
67 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
68 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
69 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
70 2899924645 Variovorax sp. 369 Isolate Unclassified
71 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
72 2904456579 Variovorax sp. 2002 Isolate Unclassified
73 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
74 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
75 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
76 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
77 2922368715
78 2928037797 Variovorax sp. 1126 Isolate Unclassified
79 2928044640 Variovorax sp. 1128 Isolate Unclassified
80 2928051484 Variovorax sp. 1133 Isolate Unclassified
81 2928070936 Variovorax gossypii 1167 Isolate Unclassified
82 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
83 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
84 2929520902 Variovorax beijingensis 502 Isolate Unclassified
85 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
86 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
87 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
88 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
89 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
90 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
91 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
92 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
93 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
94 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
95 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
96 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
97 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
98 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
99 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
100 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
101 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
102 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
103 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
104 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
105 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
106 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
107 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
108 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
109 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
110 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
111 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
112 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
113 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
114 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
115 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
116 2941479691
117 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
118 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
119 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
120 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
121 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
122 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
123 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
124 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
125 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
126 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
127 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
128 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
129 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
130 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
131 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
132 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
133 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
134 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
135 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
136 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
137 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
138 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
139 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
140 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
141 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
142 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
143 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
144 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
145 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
146 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
147 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
148 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
149 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
150 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
151 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
152 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
153 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
154 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
155 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
156 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
157 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
158 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
159 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
160 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
161 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
162 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
163 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
164 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
165 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
166 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
167 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
168 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
169 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
170 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
171 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
172 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
173 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
174 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
175 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
176 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
177 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
178 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
179 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
180 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
181 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
182 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
183 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
184 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
185 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
186 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
187 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
188 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
189 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
190 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
191 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
192 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
193 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
194 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
195 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
196 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
197 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
198 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
199 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
200 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
201 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
202 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
203 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
204 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
205 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
206 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
207 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
208 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
209 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
210 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
211 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
212 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
213 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
214 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
215 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
216 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
217 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
218 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
219 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
220 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
221 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
222 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
223 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
224 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
225 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
226 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
227 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
228 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
229 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
230 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
231 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
232 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
233 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
234 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
235 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
236 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
237 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
238 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
239 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
240 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
241 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
242 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
243 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
244 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
245 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
246 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
247 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
248 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
249 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
250 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
251 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
252 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
253 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
254 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
255 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
256 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
257 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
258 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
259 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
260 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
261 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
262 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
263 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
270 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
272 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
273 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
274 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
277 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
278 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
279 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
280 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
282 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
283 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
284 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
286 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
287 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
288 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
290 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
291 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
339 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
340 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
341 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
345 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
346 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
347 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
348 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
349 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
350 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
351 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
352 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
353 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
354 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
355 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
356 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
357 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
358 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
359 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
360 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
361 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
362 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
363 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
364 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
365 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
366 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
367 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
368 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
369 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
370 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
371 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
372 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
373 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
374 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
375 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
376 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
377 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
378 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
379 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
380 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
381 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
382 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
383 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
384 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
385 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
386 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
387 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
388 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
389 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
390 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
391 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
392 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
393 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
394 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
395 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
396 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
397 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
398 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
399 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
400 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
401 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
402 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
403 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
404 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
405 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
406 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
407 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
408 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
409 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
410 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
411 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
412 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
413 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
414 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
415 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
416 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
417 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
418 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
419 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
420 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
421 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
422 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
423 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
424 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
425 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
426 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
427 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
428 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
429 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
430 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
431 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
432 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
433 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
434 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
435 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
436 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
447 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
448 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
449 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
450 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
451 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
452 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
453 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
454 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
455 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
456 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
457 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
458 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
460 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
461 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
462 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
463 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
464 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
465 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
466 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
467 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
468 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
469 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
470 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
471 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
472 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
473 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
474 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
475 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
476 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
477 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
478 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
479 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
480 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
481 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
482 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
483 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
484 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
485 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
486 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
487 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
488 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
489 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
490 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
491 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
492 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
493 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
494 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
495 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
496 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
497 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
498 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
499 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
500 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
501 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
502 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
503 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
504 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
505 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
506 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
507 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
508 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.61
Metatranscriptomes 0.35
Isolates 15.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.47
Nodule 6.94
Rhizoplane 1.85
Rhizosphere 48.21
Stem 0
Stem Tuber 0
Unclassified 16.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000179 3300002704 Bacteria 27405
2 JGI25155J39150_1001060 3300002704 Bacteria 2843
3 JGI25156J39149_1000387 3300002705 Bacteria 27718
4 JGI25156J39149_1004087 3300002705 Bacteria 4542
5 JGI25162J39368_1003728 3300002737 Bacteria 4105
6 JGI25154J39366_1000254 3300002738 Bacteria 34119
7 JGI25154J39366_1000325 3300002738 Bacteria 27718
8 JGI25157J39369_1001567 3300002741 Bacteria 8116
9 JGI25159J45721_1001968 3300002987 Bacteria 8181
10 JGI25159J45721_1006051 3300002987 Bacteria 3681
11 JGI25151J46595_10000015 3300003187 Bacteria 250420
12 JGI25151J46595_10002602 3300003187 Bacteria 10656
13 JGI25151J46595_10009706 3300003187 Bacteria 4535
14 JGI25406J46586_10007868 3300003203 Bacteria 4849
15 JGI25153J46596_10009431 3300003215 Bacteria 4535
16 rootH1_10076755 3300003316 Bacteria 1251
17 rootH2_10024720 3300003320 Bacteria 3201
18 rootH2_10035441 3300003320 Bacteria 1478
19 rootH1_10074964 3300003323 Bacteria 1426
20 JGI25160J50197_1001959 3300003354 Bacteria 9817
21 Ga0006562J51391_1021334 3300003578 Bacteria 7590
22 Ga0006562J51391_1066283 3300003578 Bacteria 1870
23 Ga0006562J51391_1066285 3300003578 Bacteria 570
24 Ga0055538_1000008 3300003751 Bacteria 398547
25 Ga0055539_1000012 3300003752 Bacteria 398547
26 Ga0055533_1000015 3300003756 Bacteria 398547
27 Ga0055532_1000296 3300003758 Bacteria 30822
28 Ga0055525_1000017 3300003759 Bacteria 398547
29 Ga0055535_1000343 3300003761 Bacteria 46486
30 Ga0055542_1000126 3300003762 Bacteria 100388
31 Ga0055529_1021079 3300003763 Bacteria 810
32 Ga0055526_1000609 3300003771 Bacteria 27783
33 Ga0055526_1002143 3300003771 Bacteria 13531
34 Ga0055526_1002522 3300003771 Bacteria 12311
35 Ga0055537_1000448 3300003773 Bacteria 26137
36 Ga0055537_1004389 3300003773 Bacteria 4039
37 Ga0055537_1013245 3300003773 Bacteria 1560
38 Ga0055524_1000051 3300003775 Bacteria 146215
39 Ga0055524_1001475 3300003775 Bacteria 13416
40 Ga0055536_1000789 3300003781 Bacteria 21094
41 Ga0055536_1012291 3300003781 Bacteria 3189
42 Ga0055534_1000473 3300003784 Bacteria 22622
43 Ga0055534_1001389 3300003784 Bacteria 9669
44 Ga0055534_1019691 3300003784 Bacteria 1153
45 Ga0055528_1001744 3300003790 Bacteria 12554
46 Ga0055528_1009552 3300003790 Bacteria 4039
47 Ga0055528_1045886 3300003790 Bacteria 927
48 Ga0055530_10000311 3300003791 Bacteria 44214
49 Ga0055530_10008806 3300003791 Bacteria 3978
50 Ga0055530_10059819 3300003791 Bacteria 853
51 Ga0055540_1001220 3300003792 Bacteria 15793
52 Ga0055540_1001502 3300003792 Bacteria 13862
53 Ga0055540_1006880 3300003792 Bacteria 4415
54 Ga0055531_10001247 3300003794 Bacteria 19316
55 Ga0055531_10001433 3300003794 Bacteria 17614
56 Ga0055541_1000009 3300003841 Bacteria 398547
57 Ga0055543_1001701 3300004625 Bacteria 8306
58 Ga0065165_1000132 3300005262 Bacteria 128732
59 Ga0065165_1012862 3300005262 Bacteria 3373
60 Ga0065714_10005309 3300005288 Bacteria 5001
61 Ga0065704_10226558 3300005289 Bacteria 1056
62 Ga0065715_10615207 3300005293 Bacteria 691
63 Ga0070658_10571372 3300005327 Bacteria 979
64 Ga0070676_10000836 3300005328 Bacteria 15209
65 Ga0070676_10044337 3300005328 Bacteria 2588
66 Ga0070676_10288143 3300005328 Bacteria 1109
67 Ga0070670_100040721 3300005331 Bacteria 3993
68 Ga0070670_100162239 3300005331 Bacteria 1937
69 Ga0070677_10007554 3300005333 Bacteria 3633
70 Ga0070677_10009782 3300005333 Bacteria 3261
71 Ga0068869_100002364 3300005334 Bacteria 11353
72 Ga0068869_100592122 3300005334 Bacteria 936
73 Ga0070666_10002536 3300005335 Bacteria 11047
74 Ga0070682_100321995 3300005337 Bacteria 1142
75 Ga0068868_100004050 3300005338 Bacteria 10215
76 Ga0068868_100241641 3300005338 Bacteria 1517
77 Ga0068868_100366844 3300005338 Bacteria 1237
78 Ga0068868_100493468 3300005338 Bacteria 1071
79 Ga0070689_100110819 3300005340 Bacteria 2182
80 Ga0070661_100184500 3300005344 Bacteria 1589
81 Ga0070668_100005115 3300005347 Bacteria 9718
82 Ga0070668_100026991 3300005347 Bacteria 4359
83 Ga0070668_100247359 3300005347 Bacteria 1479
84 Ga0070675_100008930 3300005354 Bacteria 7786
85 Ga0070671_100000599 3300005355 Bacteria 25802
86 Ga0070671_100319014 3300005355 Bacteria 1324
87 Ga0070674_100008482 3300005356 Bacteria 6120
88 Ga0070674_100013048 3300005356 Bacteria 5123
89 Ga0070674_100281207 3300005356 Bacteria 1319
90 Ga0070674_100422375 3300005356 Bacteria 1094
91 Ga0070673_100000267 3300005364 Bacteria 26687
92 Ga0070673_100248835 3300005364 Bacteria 1548
93 Ga0070659_100044528 3300005366 Bacteria 3475
94 Ga0070667_100028450 3300005367 Bacteria 4653
95 Ga0070667_100147097 3300005367 Bacteria 2067
96 Ga0070709_10019614 3300005434 Bacteria 3912
97 Ga0070713_100011483 3300005436 Bacteria 6453
98 Ga0070710_10000449 3300005437 Bacteria 19305
99 Ga0070711_100005210 3300005439 Bacteria 7753
100 Ga0070663_100007358 3300005455 Bacteria 6698
101 Ga0070663_100207736 3300005455 Bacteria 1532
102 Ga0070663_100994419 3300005455 Bacteria 729
103 Ga0070678_100000237 3300005456 Bacteria 25212
104 Ga0070678_100029771 3300005456 Bacteria 3744
105 Ga0070678_100226805 3300005456 Bacteria 1555
106 Ga0070678_100603641 3300005456 Bacteria 980
107 Ga0070662_100118584 3300005457 Bacteria 2026
108 Ga0070662_100213019 3300005457 Bacteria 1538
109 Ga0068867_100007594 3300005459 Bacteria 7671
110 Ga0068867_100016101 3300005459 Bacteria 5309
111 Ga0068867_100580109 3300005459 Bacteria 975
112 Ga0068867_100595909 3300005459 Bacteria 963
113 Ga0070685_10052232 3300005466 Bacteria 2365
114 Ga0070707_101047930 3300005468 Bacteria 781
115 Ga0070698_101247596 3300005471 Bacteria 693
116 Ga0068853_100019877 3300005539 Bacteria 5578
117 Ga0068853_100213156 3300005539 Bacteria 1761
118 Ga0068853_100777451 3300005539 Bacteria 916
119 Ga0070672_100004191 3300005543 Bacteria 9416
120 Ga0070672_100086670 3300005543 Bacteria 2519
121 Ga0070686_100102553 3300005544 Bacteria 1935
122 Ga0070693_100806614 3300005547 Bacteria 696
123 Ga0070665_100009082 3300005548 Bacteria 10070
124 Ga0070665_100018899 3300005548 Bacteria 6911
125 Ga0070665_100337753 3300005548 Bacteria 1511
126 Ga0070665_100526374 3300005548 Bacteria 1194
127 Ga0070704_100404801 3300005549 Bacteria 1165
128 Ga0068855_100171564 3300005563 Bacteria 2456
129 Ga0068855_101490263 3300005563 Bacteria 695
130 Ga0068857_100119715 3300005577 Bacteria 2370
131 Ga0068854_100031253 3300005578 Bacteria 3699
132 Ga0068852_100001911 3300005616 Bacteria 14185
133 Ga0068852_100026765 3300005616 Bacteria 4693
134 Ga0068852_100707387 3300005616 Bacteria 1018
135 Ga0068859_100027377 3300005617 Bacteria 5718
136 Ga0068859_100347510 3300005617 Bacteria 1578
137 Ga0068864_100040816 3300005618 Bacteria 3968
138 Ga0068866_10031652 3300005718 Bacteria 2550
139 Ga0068861_100143902 3300005719 Bacteria 1949
140 Ga0068861_100184249 3300005719 Bacteria 1740
141 Ga0068851_10000220 3300005834 Bacteria 27525
142 Ga0068851_10011189 3300005834 Bacteria 4203
143 Ga0068870_10002587 3300005840 Bacteria 7570
144 Ga0068863_100033620 3300005841 Bacteria 4885
145 Ga0068863_100581000 3300005841 Bacteria 1108
146 Ga0068858_100044399 3300005842 Bacteria 4120
147 Ga0068858_100194212 3300005842 Bacteria 1918
148 Ga0068860_100000222 3300005843 Bacteria 88724
149 Ga0068860_100038152 3300005843 Bacteria 4596
150 Ga0068860_101659581 3300005843 Bacteria 661
151 Ga0068862_100024728 3300005844 Bacteria 5040
152 Ga0068862_100430011 3300005844 Bacteria 1241
153 Ga0081540_1001161 3300005983 Bacteria 23188
154 Ga0081540_1127240 3300005983 Bacteria 1046
155 Ga0081539_10002771 3300005985 Bacteria 23569
156 Ga0081539_10151524 3300005985 Bacteria 1115
157 Ga0070717_10170016 3300006028 Bacteria 1895
158 Ga0075365_10025414 3300006038 Bacteria 3749
159 Ga0075365_10052635 3300006038 Bacteria 2694
160 Ga0075365_10264862 3300006038 Bacteria 1209
161 Ga0075368_10016748 3300006042 Bacteria 2734
162 Ga0075368_10133928 3300006042 Bacteria 1031
163 Ga0075363_100005976 3300006048 Bacteria 5487
164 Ga0075363_100024223 3300006048 Bacteria 3083
165 Ga0075363_100033640 3300006048 Bacteria 2671
166 Ga0075363_100043367 3300006048 Bacteria 2379
167 Ga0075363_100193326 3300006048 Bacteria 1161
168 Ga0075363_100198736 3300006048 Bacteria 1145
169 Ga0075364_10003868 3300006051 Bacteria 8582
170 Ga0075364_10017219 3300006051 Bacteria 4511
171 Ga0075364_10028130 3300006051 Bacteria 3597
172 Ga0075364_10438279 3300006051 Bacteria 892
173 Ga0075364_10464447 3300006051 Bacteria 865
174 Ga0070716_100008383 3300006173 Bacteria 5128
175 Ga0070712_100012417 3300006175 Bacteria 5415
176 Ga0075362_10008824 3300006177 Bacteria 3874
177 Ga0075362_10010440 3300006177 Bacteria 3626
178 Ga0075362_10036224 3300006177 Bacteria 2157
179 Ga0075362_10157238 3300006177 Bacteria 1093
180 Ga0075362_10575610 3300006177 Bacteria 580
181 Ga0075362_10605460 3300006177 Bacteria 566
182 Ga0075367_10098742 3300006178 Bacteria 1783
183 Ga0075367_10099593 3300006178 Bacteria 1775
184 Ga0075367_10163896 3300006178 Bacteria 1383
185 Ga0075367_10575648 3300006178 Bacteria 715
186 Ga0075369_10372519 3300006186 Bacteria 671
187 Ga0075366_10001052 3300006195 Bacteria 13529
188 Ga0075366_10052923 3300006195 Bacteria 2411
189 Ga0075366_10064539 3300006195 Bacteria 2177
190 Ga0075366_10297351 3300006195 Bacteria 987
191 Ga0097621_100733870 3300006237 Bacteria 911
192 Ga0097621_101079448 3300006237 Bacteria 753
193 Ga0075370_10190706 3300006353 Bacteria 1208
194 Ga0075370_10255296 3300006353 Bacteria 1039
195 Ga0075370_10297946 3300006353 Bacteria 959
196 Ga0075370_10326142 3300006353 Bacteria 915
197 Ga0075370_10349313 3300006353 Bacteria 883
198 Ga0075370_10500432 3300006353 Bacteria 733
199 Ga0068871_100036092 3300006358 Bacteria 3934
200 Ga0075430_100235229 3300006846 Bacteria 1519
201 Ga0068865_100500122 3300006881 Bacteria 1013
202 Ga0068865_100734927 3300006881 Bacteria 846
203 Ga0097620_100027377 3300006931 Bacteria 5718
204 Ga0097620_100347512 3300006931 Bacteria 1578
205 Ga0079104_1000014 3300006946 Bacteria 337362
206 Ga0079104_1043240 3300006946 Bacteria 1039
207 Ga0099826_10000671 3300006948 Bacteria 17716
208 Ga0105250_10167444 3300009092 Bacteria 919
209 Ga0105240_10020115 3300009093 Bacteria 8911
210 Ga0105240_10031768 3300009093 Bacteria 6841
211 Ga0105240_10258346 3300009093 Bacteria 2011
212 Ga0111539_10141238 3300009094 Bacteria 2819
213 Ga0105245_10279072 3300009098 Bacteria 1632
214 Ga0105245_11412575 3300009098 Bacteria 746
215 Ga0105247_10080682 3300009101 Bacteria 2050
216 Ga0105247_10086543 3300009101 Bacteria 1983
217 Ga0105243_10182188 3300009148 Bacteria 1828
218 Ga0105243_10959417 3300009148 Bacteria 855
219 Ga0105241_10949265 3300009174 Bacteria 801
220 Ga0105248_10191070 3300009177 Bacteria 2307
221 Ga0105237_10017067 3300009545 Bacteria 7533
222 Ga0105237_10225506 3300009545 Bacteria 1874
223 Ga0105237_10750806 3300009545 Bacteria 982
224 Ga0105238_10126253 3300009551 Bacteria 2537
225 Ga0105238_10223585 3300009551 Bacteria 1859
226 Ga0105238_10884773 3300009551 Bacteria 911
227 Ga0105238_11117932 3300009551 Bacteria 811
228 Ga0105249_10671704 3300009553 Bacteria 1095
229 Ga0105239_10011838 3300010375 Bacteria 9732
230 Ga0105239_10192154 3300010375 Bacteria 2285
231 Ga0105239_11401067 3300010375 Bacteria 807
232 Ga0105246_10398275 3300011119 Bacteria 1142
233 Ga0105246_11208375 3300011119 Bacteria 696
234 Ga0157373_10016931 3300013100 Bacteria 5311
235 Ga0157373_10187461 3300013100 Bacteria 1457
236 Ga0157371_10245755 3300013102 Bacteria 1288
237 Ga0157370_10199218 3300013104 Bacteria 1858
238 Ga0157370_11296196 3300013104 Bacteria 656
239 Ga0157369_10003086 3300013105 Bacteria 19911
240 Ga0171462_1007 3300013250 Bacteria 417698
241 Ga0157374_10141705 3300013296 Bacteria 2334
242 Ga0157374_10550310 3300013296 Bacteria 1162
243 Ga0157378_10352602 3300013297 Bacteria 1438
244 Ga0157378_10848352 3300013297 Bacteria 942
245 Ga0163162_10087647 3300013306 Bacteria 3191
246 Ga0163162_10242657 3300013306 Bacteria 1933
247 Ga0163162_11425735 3300013306 Bacteria 788
248 Ga0163162_11528040 3300013306 Bacteria 761
249 Ga0163162_11818368 3300013306 Bacteria 697
250 Ga0157372_10869210 3300013307 Bacteria 1047
251 Ga0157375_10003695 3300013308 Bacteria 13282
252 Ga0157375_10213388 3300013308 Bacteria 2088
253 Ga0163163_10081276 3300014325 Bacteria 3242
254 Ga0157380_10319304 3300014326 Bacteria 1439
255 Ga0157380_10328010 3300014326 Bacteria 1422
256 Ga0157380_11258998 3300014326 Bacteria 785
257 Ga0182008_10053014 3300014497 Bacteria 2009
258 Ga0157379_10486614 3300014968 Bacteria 1142
259 Ga0157376_10017569 3300014969 Bacteria 5461
260 Ga0157376_10127372 3300014969 Bacteria 2267
261 Ga0157376_10457434 3300014969 Bacteria 1246
262 Ga0182006_1062347 3300015261 Bacteria 1403
263 Ga0163161_10000162 3300017792 Bacteria 61742
264 Ga0163161_10010689 3300017792 Bacteria 6355
265 Ga0163161_10089671 3300017792 Bacteria 2274
266 Ga0163161_10500784 3300017792 Bacteria 989
267 Ga0163161_10949738 3300017792 Bacteria 731
268 Ga0213872_10013357 3300021361 Bacteria 3849
269 Ga0209435_100018 3300025206 Bacteria 274625
270 Ga0209435_100240 3300025206 Bacteria 14674
271 Ga0209436_101550 3300025208 Bacteria 7811
272 Ga0209784_100005 3300025224 Bacteria 1040422
273 Ga0209566_100005 3300025225 Bacteria 1040422
274 Ga0209674_100009 3300025226 Bacteria 1040422
275 Ga0209672_100223 3300025228 Bacteria 43877
276 Ga0209672_112083 3300025228 Bacteria 1086
277 Ga0209147_100051 3300025229 Bacteria 274605
278 Ga0209147_102363 3300025229 Bacteria 4779
279 Ga0209563_100012 3300025230 Bacteria 1040422
280 Ga0209437_100117 3300025233 Bacteria 209271
281 Ga0209258_100018 3300025242 Bacteria 567561
282 Ga0209258_100540 3300025242 Bacteria 35122
283 Ga0209258_113561 3300025242 Bacteria 967
284 Ga0207425_1001643 3300025245 Bacteria 9000
285 Ga0207425_1006207 3300025245 Bacteria 3296
286 Ga0209646_1000090 3300025246 Bacteria 189912
287 Ga0209646_1000105 3300025246 Bacteria 163453
288 Ga0209026_1000042 3300025250 Bacteria 273111
289 Ga0209026_1023782 3300025250 Bacteria 932
290 Ga0209677_100006 3300025253 Bacteria 1040422
291 Ga0209148_1000030 3300025254 Bacteria 567582
292 Ga0209148_1012446 3300025254 Bacteria 1555
293 Ga0209759_1000538 3300025256 Bacteria 39836
294 Ga0209759_1000625 3300025256 Bacteria 33672
295 Ga0209129_1002222 3300025258 Bacteria 9733
296 Ga0209233_1002155 3300025261 Bacteria 7390
297 Ga0209565_1000175 3300025263 Bacteria 81833
298 Ga0209565_1001044 3300025263 Bacteria 14011
299 Ga0209565_1002838 3300025263 Bacteria 5962
300 Ga0209455_1001445 3300025272 Bacteria 10721
301 Ga0209455_1003989 3300025272 Bacteria 5003
302 Ga0209673_1000099 3300025273 Bacteria 193248
303 Ga0209673_1000559 3300025273 Bacteria 59593
304 Ga0209673_1011026 3300025273 Bacteria 3760
305 Ga0209673_1076371 3300025273 Bacteria 781
306 Ga0209130_1000215 3300025284 Bacteria 75723
307 Ga0209130_1000327 3300025284 Bacteria 54775
308 Ga0209675_1000054 3300025291 Bacteria 193248
309 Ga0209675_1000523 3300025291 Bacteria 28159
310 Ga0209675_1000603 3300025291 Bacteria 25795
311 Ga0209675_1000703 3300025291 Bacteria 23088
312 Ga0209675_1005881 3300025291 Bacteria 5034
313 Ga0209676_1000004 3300025292 Bacteria 1138360
314 Ga0209676_1000172 3300025292 Bacteria 153664
315 Ga0209676_1000214 3300025292 Bacteria 127818
316 Ga0209676_1010705 3300025292 Bacteria 3781
317 Ga0209025_1000010 3300025294 Bacteria 986612
318 Ga0209025_1000039 3300025294 Bacteria 377396
319 Ga0209025_1000343 3300025294 Bacteria 101870
320 Ga0209025_1004962 3300025294 Bacteria 11136
321 Ga0209025_1006817 3300025294 Bacteria 8719
322 Ga0209025_1017362 3300025294 Bacteria 4160
323 Ga0209025_1020360 3300025294 Bacteria 3634
324 Ga0209025_1037168 3300025294 Bacteria 2165
325 Ga0209564_1000048 3300025295 Bacteria 364806
326 Ga0209564_1000065 3300025295 Bacteria 315205
327 Ga0209564_1000413 3300025295 Bacteria 75268
328 Ga0209758_1005464 3300025297 Bacteria 9767
329 Ga0209758_1020982 3300025297 Bacteria 3064
330 Ga0209758_1023214 3300025297 Bacteria 2813
331 Ga0209758_1053854 3300025297 Bacteria 1379
332 Ga0209050_1000002 3300025298 Bacteria 1792849
333 Ga0209050_1000509 3300025298 Bacteria 65792
334 Ga0209050_1006610 3300025298 Bacteria 6808
335 Ga0209050_1012301 3300025298 Bacteria 3940
336 Ga0209050_1027702 3300025298 Bacteria 1860
337 Ga0209050_1079540 3300025298 Bacteria 702
338 Ga0209256_1000041 3300025299 Bacteria 364827
339 Ga0209256_1000067 3300025299 Bacteria 246812
340 Ga0209256_1001487 3300025299 Bacteria 23902
341 Ga0209256_1020709 3300025299 Bacteria 2043
342 Ga0209256_1074473 3300025299 Bacteria 755
343 Ga0207426_1000178 3300025302 Bacteria 159291
344 Ga0207426_1000264 3300025302 Bacteria 110747
345 Ga0209051_1000002 3300025303 Bacteria 1631846
346 Ga0209051_1000074 3300025303 Bacteria 208667
347 Ga0209051_1000096 3300025303 Bacteria 167399
348 Ga0209051_1000211 3300025303 Bacteria 101426
349 Ga0209051_1088683 3300025303 Bacteria 867
350 Ga0209257_1000002 3300025304 Bacteria 1767052
351 Ga0209257_1000072 3300025304 Bacteria 332791
352 Ga0207697_10019012 3300025315 Bacteria 2814
353 Ga0207656_10006995 3300025321 Bacteria 4094
354 Ga0207656_10117062 3300025321 Bacteria 1237
355 Ga0207682_10000345 3300025893 Bacteria 21217
356 Ga0207682_10010037 3300025893 Bacteria 3717
357 Ga0207692_10013490 3300025898 Bacteria 3547
358 Ga0207642_10069208 3300025899 Bacteria 1673
359 Ga0207710_10036871 3300025900 Bacteria 2157
360 Ga0207710_10357535 3300025900 Bacteria 745
361 Ga0207688_10038004 3300025901 Bacteria 2671
362 Ga0207680_10012948 3300025903 Bacteria 4264
363 Ga0207647_10129705 3300025904 Bacteria 1482
364 Ga0207699_10001182 3300025906 Bacteria 12360
365 Ga0207645_10000607 3300025907 Bacteria 29680
366 Ga0207645_10042823 3300025907 Bacteria 2896
367 Ga0207643_10004161 3300025908 Bacteria 7801
368 Ga0207695_10003709 3300025913 Bacteria 21285
369 Ga0207695_10044520 3300025913 Bacteria 4720
370 Ga0207695_10415003 3300025913 Bacteria 1230
371 Ga0207671_10147505 3300025914 Bacteria 1816
372 Ga0207663_10037001 3300025916 Bacteria 2940
373 Ga0207681_10069040 3300025923 Bacteria 2457
374 Ga0207694_10146640 3300025924 Bacteria 1900
375 Ga0207694_10240227 3300025924 Bacteria 1480
376 Ga0207694_10642015 3300025924 Bacteria 894
377 Ga0207694_10810966 3300025924 Bacteria 791
378 Ga0207650_10049287 3300025925 Bacteria 3109
379 Ga0207650_10093371 3300025925 Bacteria 2303
380 Ga0207659_10011128 3300025926 Bacteria 5676
381 Ga0207659_10023076 3300025926 Bacteria 4149
382 Ga0207700_10102240 3300025928 Bacteria 2288
383 Ga0207664_10023118 3300025929 Bacteria 4653
384 Ga0207644_10104292 3300025931 Bacteria 2134
385 Ga0207690_10028024 3300025932 Bacteria 3566
386 Ga0207690_10190597 3300025932 Bacteria 1550
387 Ga0207706_10007642 3300025933 Bacteria 9993
388 Ga0207706_10177212 3300025933 Bacteria 1873
389 Ga0207669_10008887 3300025937 Bacteria 4745
390 Ga0207669_10168864 3300025937 Bacteria 1555
391 Ga0207669_10247761 3300025937 Bacteria 1325
392 Ga0207669_10584568 3300025937 Bacteria 905
393 Ga0207704_10125393 3300025938 Bacteria 1767
394 Ga0207704_10567189 3300025938 Bacteria 925
395 Ga0207665_10009013 3300025939 Bacteria 6547
396 Ga0207691_10003533 3300025940 Bacteria 15201
397 Ga0207689_10001874 3300025942 Bacteria 19902
398 Ga0207689_10246599 3300025942 Bacteria 1477
399 Ga0207689_10553273 3300025942 Bacteria 966
400 Ga0207667_10035907 3300025949 Bacteria 5316
401 Ga0207667_11230472 3300025949 Bacteria 727
402 Ga0207651_10031082 3300025960 Bacteria 3408
403 Ga0207651_10264198 3300025960 Bacteria 1414
404 Ga0207668_10033473 3300025972 Bacteria 3404
405 Ga0207668_10050917 3300025972 Bacteria 2857
406 Ga0207668_10166921 3300025972 Bacteria 1722
407 Ga0207668_10447490 3300025972 Bacteria 1102
408 Ga0207668_10596139 3300025972 Bacteria 962
409 Ga0207640_10140266 3300025981 Bacteria 1761
410 Ga0207658_10003030 3300025986 Bacteria 12008
411 Ga0207658_10506745 3300025986 Bacteria 1076
412 Ga0207658_10604850 3300025986 Bacteria 985
413 Ga0207677_10015110 3300026023 Bacteria 4530
414 Ga0207677_10371424 3300026023 Bacteria 1204
415 Ga0207703_10291745 3300026035 Bacteria 1485
416 Ga0207639_10149371 3300026041 Bacteria 1956
417 Ga0207678_10002641 3300026067 Bacteria 16310
418 Ga0207678_10016002 3300026067 Bacteria 6589
419 Ga0207678_10540218 3300026067 Bacteria 1019
420 Ga0207641_10009515 3300026088 Bacteria 8011
421 Ga0207641_10605691 3300026088 Bacteria 1073
422 Ga0207648_10001598 3300026089 Bacteria 24810
423 Ga0207648_10019748 3300026089 Bacteria 6080
424 Ga0207648_10154059 3300026089 Bacteria 2028
425 Ga0207676_10122896 3300026095 Bacteria 2192
426 Ga0207676_10166314 3300026095 Bacteria 1917
427 Ga0207674_10260179 3300026116 Bacteria 1682
428 Ga0207674_11577307 3300026116 Bacteria 625
429 Ga0207675_100077185 3300026118 Bacteria 3120
430 Ga0207675_100163209 3300026118 Bacteria 2126
431 Ga0207683_10000003 3300026121 Bacteria 191866
432 Ga0207683_10006708 3300026121 Bacteria 9849
433 Ga0207683_10328392 3300026121 Bacteria 1402
434 Ga0207683_11195766 3300026121 Bacteria 705
435 Ga0207698_10009172 3300026142 Bacteria 6291
436 Ga0207698_10239404 3300026142 Bacteria 1653
437 Ga0207698_10295587 3300026142 Bacteria 1505
438 Ga0209281_1000032 3300027111 Bacteria 401727
439 Ga0209282_1000560 3300027666 Bacteria 18047
440 Ga0209282_1001565 3300027666 Bacteria 12632
441 Ga0207428_10084084 3300027907 Bacteria 2481
442 Ga0268266_10001663 3300028379 Bacteria 25674
443 Ga0268266_10026221 3300028379 Bacteria 4959
444 Ga0268266_10291416 3300028379 Bacteria 1520
445 Ga0268266_10431082 3300028379 Bacteria 1251
446 Ga0268266_10500413 3300028379 Bacteria 1160
447 Ga0268266_10862270 3300028379 Bacteria 875
448 Ga0268265_10032680 3300028380 Bacteria 3773
449 Ga0268265_10084880 3300028380 Bacteria 2511
450 Ga0268264_10000042 3300028381 Bacteria 372069
451 Ga0268264_10080012 3300028381 Bacteria 2789
452 Ga0307515_10133611 3300028794 Bacteria 2714
453 Ga0307515_10214821 3300028794 Bacteria 1757
454 Ga0268256_1016829 3300030500 Bacteria 2080
455 Ga0307511_10000269 3300030521 Bacteria 54080
456 Ga0316183_1151865 3300030742 Bacteria 958
457 Ga0307513_10000363 3300031456 Bacteria 66311
458 Ga0307513_10660273 3300031456 Bacteria 752
459 Ga0307509_10528024 3300031507 Bacteria 861
460 Ga0307408_100232502 3300031548 Bacteria 1511
461 Ga0307408_100267201 3300031548 Bacteria 1418
462 Ga0307408_101006136 3300031548 Bacteria 768
463 Ga0307408_101683314 3300031548 Bacteria 604
464 Ga0307508_10340181 3300031616 Bacteria 1092
465 Ga0307514_10145777 3300031649 Bacteria 1600
466 Ga0307405_10225398 3300031731 Bacteria 1378
467 Ga0307406_10005714 3300031901 Bacteria 6811
468 Ga0307407_10290201 3300031903 Bacteria 1137
469 Ga0307407_10309329 3300031903 Bacteria 1105
470 Ga0307412_10015136 3300031911 Bacteria 4565
471 Ga0307412_10062574 3300031911 Bacteria 2506
472 Ga0307414_10563807 3300032004 Bacteria 1017
473 Ga0307414_10679017 3300032004 Bacteria 931
474 Ga0307414_11392463 3300032004 Bacteria 652
475 Ga0307411_10136427 3300032005 Bacteria 1802
476 Ga0307507_10010960 3300033179 Bacteria 11546
477 Ga0307510_10278123 3300033180 Bacteria 1146
478 Ga0395900_0008958 3300037418 Bacteria 10262
479 Ga0395901_0401651 3300038443 Bacteria 1408
480 Ga0436361_0721781 3300039447 Bacteria 7176
481 Ga0439436_0053994 3300041404 Bacteria 1131
482 Ga0439466_0168027 3300041411 Bacteria 670
483 Ga0451798_0745458 3300041458 Bacteria 805
484 Ga0451841_0361748 3300041498 Bacteria 802
485 Ga0451853_3403264 3300041512 Bacteria 589
486 Ga0439449_0012030 3300042007 Bacteria 3252
487 Ga0439435_0026993 3300042436 Bacteria 1533
488 Ga0466966_0703205 3300044684 Bacteria 609
489 Ga0453684_0316588 3300044712 Bacteria 1769
490 Ga0466970_0135437 3300044765 Bacteria 1355
491 Ga0466960_0162483 3300044901 Bacteria 1200
492 Ga0495627_005063 3300046453 Bacteria 5386
493 Ga0495638_0005314 3300046460 Bacteria 9606
494 Ga0495638_0018313 3300046460 Bacteria 4654
495 Ga0495638_0226317 3300046460 Bacteria 1043
496 Ga0495650_0022697 3300046471 Bacteria 3006
497 Ga0495664_0053665 3300046477 Bacteria 2397
498 Ga0495584_0037163 3300046491 Bacteria 2460
499 Ga0495585_0028235 3300046492 Bacteria 3201
500 Ga0495594_0536460 3300046499 Bacteria 664
501 Ga0495607_0110863 3300046501 Bacteria 1455
502 Ga0495608_0498007 3300046511 Bacteria 738
503 Ga0495616_0005308 3300046513 Bacteria 7942
504 Ga0495620_0014162 3300046515 Bacteria 4062
505 Ga0495631_0000426 3300046518 Bacteria 29159
506 Ga0495632_0185450 3300046519 Bacteria 952
507 Ga0495637_0009500 3300046520 Bacteria 4739
508 Ga0495644_0067625 3300046523 Bacteria 1342
509 Ga0495663_0012053 3300046525 Bacteria 2410
510 Ga0495654_0004161 3300046530 Bacteria 8670
511 Ga0495654_0008510 3300046530 Bacteria 5659
512 Ga0495654_0066111 3300046530 Bacteria 1725
513 Ga0495598_0017539 3300046537 Bacteria 1847
514 Ga0495609_0053194 3300046538 Bacteria 1801
515 Ga0495621_0011984 3300046539 Bacteria 2696
516 Ga0495621_0031051 3300046539 Bacteria 1830
517 Ga0495633_0005187 3300046558 Bacteria 8049
518 Ga0495633_0041997 3300046558 Bacteria 2173
519 Ga0495656_0009763 3300046615 Bacteria 3463
520 Ga0495656_0021536 3300046615 Bacteria 2511
521 Ga0495668_0316661 3300046616 Bacteria 856
522 Ga0495668_0370607 3300046616 Bacteria 786
523 Ga0495611_0049460 3300046648 Bacteria 1892
524 Ga0495611_0155522 3300046648 Bacteria 1068
525 Ga0495625_0000012 3300046660 Bacteria 363006
526 Ga0495625_0001388 3300046660 Bacteria 29712
527 Ga0495625_0068658 3300046660 Bacteria 2491
528 Ga0495625_0761493 3300046660 Bacteria 566
529 Ga0495659_0038268 3300046664 Bacteria 1703
530 Ga0495661_0269118 3300046665 Bacteria 863
531 Ga0495588_0007705 3300046674 Bacteria 4917
532 Ga0495588_0023899 3300046674 Bacteria 3031
533 Ga0495588_0081007 3300046674 Bacteria 1694
534 Ga0495588_0087892 3300046674 Bacteria 1626
535 Ga0495669_0018324 3300046684 Bacteria 3009
536 Ga0495669_0042218 3300046684 Bacteria 2027
537 Ga0495670_0017971 3300046691 Bacteria 3483
538 Ga0495670_0079404 3300046691 Bacteria 1670
539 Ga0495670_0227721 3300046691 Bacteria 991
540 Ga0495671_0002982 3300046692 Bacteria 10517
541 Ga0495589_0188986 3300046794 Bacteria 975
542 Ga0495600_0097520 3300046809 Bacteria 1916
543 Ga0495660_0388902 3300046810 Bacteria 613
544 Ga0495636_0052048 3300047318 Bacteria 1717
545 Ga0495676_0332960 3300047321 Bacteria 1018
546 Ga0495680_0418807 3300047322 Bacteria 922
547 Ga0495683_0096630 3300047323 Bacteria 1425
548 Ga0495673_0218911 3300047469 Bacteria 705
549 Ga0495686_0255704 3300047472 Bacteria 983
550 Ga0495593_0381513 3300047673 Bacteria 705
551 Ga0495614_0102385 3300048089 Bacteria 1253
552 Ga0496101_0043191 3300048904 Bacteria 3221
553 Ga0496101_0109043 3300048904 Bacteria 2082
554 Ga0496105_0440522 3300048908 Bacteria 1029
555 Ga0496106_0049526 3300048909 Bacteria 3165
556 Ga0496107_0043728 3300048910 Bacteria 3218
557 Ga0496112_0072397 3300048915 Bacteria 3407
558 Ga0496113_0300495 3300048916 Bacteria 1285
559 Ga0496114_0141505 3300048917 Bacteria 2083
560 Ga0496115_0085401 3300048918 Bacteria 2574
561 Ga0496115_0703080 3300048918 Bacteria 794
562 Ga0496116_0005026 3300048919 Bacteria 12454
563 Ga0496116_0009110 3300048919 Bacteria 8508
564 Ga0496116_0011042 3300048919 Bacteria 7512
565 Ga0496116_0157799 3300048919 Bacteria 1249
566 Ga0496116_0399264 3300048919 Bacteria 609
567 Ga0496117_0027239 3300048920 Bacteria 4457
568 Ga0496117_0166326 3300048920 Bacteria 1286
569 Ga0496118_0025220 3300048921 Bacteria 5105
570 Ga0496118_0047194 3300048921 Bacteria 3342
571 Ga0496118_0071103 3300048921 Bacteria 2507
572 Ga0496118_0092192 3300048921 Bacteria 2080
573 Ga0496119_0010553 3300048922 Bacteria 7756
574 Ga0496119_0038228 3300048922 Bacteria 3105
575 Ga0496119_0131515 3300048922 Bacteria 1363
576 Ga0496120_0010542 3300048923 Bacteria 6438
577 Ga0496121_0003228 3300048924 Bacteria 23448
578 Ga0496121_0004174 3300048924 Bacteria 19753
579 Ga0496121_0007031 3300048924 Bacteria 13666
580 Ga0496121_0035713 3300048924 Bacteria 4447
581 Ga0496121_0043094 3300048924 Bacteria 3913
582 Ga0496121_0087466 3300048924 Bacteria 2446
583 Ga0496121_0095864 3300048924 Bacteria 2304
584 Ga0496121_0134977 3300048924 Bacteria 1840
585 Ga0496121_0140589 3300048924 Bacteria 1792
586 Ga0496121_0148902 3300048924 Bacteria 1725
587 Ga0496121_0253681 3300048924 Bacteria 1218
588 Ga0496121_0496697 3300048924 Bacteria 775
589 Ga0496122_0000077 3300048925 Bacteria 218099
590 Ga0496122_0003370 3300048925 Bacteria 21035
591 Ga0496122_0024195 3300048925 Bacteria 5320
592 Ga0496122_0107506 3300048925 Bacteria 1843
593 Ga0496123_0000526 3300048926 Bacteria 65966
594 Ga0496123_0000532 3300048926 Bacteria 65557
595 Ga0496123_0014659 3300048926 Bacteria 6479
596 Ga0496123_0101819 3300048926 Bacteria 1669
597 Ga0496123_0171543 3300048926 Bacteria 1143
598 Ga0496124_0000038 3300048927 Bacteria 312485
599 Ga0496124_0013537 3300048927 Bacteria 7955
600 Ga0496124_0040457 3300048927 Bacteria 4031
601 Ga0496124_0085351 3300048927 Bacteria 2587
602 Ga0496124_0385393 3300048927 Bacteria 978
603 Ga0496124_0581560 3300048927 Bacteria 732
604 Ga0496124_0669292 3300048927 Bacteria 663
605 Ga0496125_0000146 3300048928 Bacteria 154919
606 Ga0496125_0014183 3300048928 Bacteria 7772
607 Ga0496125_0020425 3300048928 Bacteria 6216
608 Ga0496125_0031633 3300048928 Bacteria 4713
609 Ga0496125_0129021 3300048928 Bacteria 1784
610 Ga0496125_0135356 3300048928 Bacteria 1725
611 Ga0496125_0149719 3300048928 Bacteria 1605
612 Ga0496126_0034370 3300048929 Bacteria 4761
613 Ga0496126_0083303 3300048929 Bacteria 2823
614 Ga0496126_0102158 3300048929 Bacteria 2507
615 Ga0496126_0123711 3300048929 Bacteria 2240
616 Ga0496126_0156364 3300048929 Bacteria 1951
617 Ga0496126_0777875 3300048929 Bacteria 736
618 Ga0501031_0039093 3300049568 Bacteria 3095
619 Ga0501031_0132321 3300049568 Bacteria 1629
620 Ga0501032_0025218 3300049569 Bacteria 4100
621 Ga0501032_0127623 3300049569 Bacteria 1679
622 Ga0501033_0005437 3300049570 Bacteria 10095
623 Ga0501033_0089147 3300049570 Bacteria 2256
624 Ga0501033_0265988 3300049570 Bacteria 1213
625 Ga0501034_0197076 3300049571 Bacteria 1973
626 Ga0501034_1562900 3300049571 Bacteria 533
627 Ga0501036_0273615 3300049572 Bacteria 1413
628 Ga0501037_0002062 3300049573 Bacteria 14575
629 Ga0501038_0097217 3300049574 Bacteria 2457
630 Ga0501038_0103052 3300049574 Bacteria 2374
631 Ga0501038_0964620 3300049574 Bacteria 627
632 Ga0501039_0284805 3300049575 Bacteria 1299
633 Ga0501043_0000045 3300049579 Bacteria 114003
634 Ga0501043_0081497 3300049579 Bacteria 2543
635 Ga0501043_0802061 3300049579 Bacteria 681
636 Ga0501047_0009582 3300049581 Bacteria 9154
637 Ga0501047_0101205 3300049581 Bacteria 2761
638 Ga0501068_0064102 3300049584 Bacteria 2236
639 Ga0501069_0000007 3300049585 Bacteria 182820
640 Ga0501071_0018353 3300049587 Bacteria 4842
641 Ga0501073_0063290 3300049589 Bacteria 2580
642 Ga0501074_0000248 3300049590 Bacteria 30421
643 Ga0501076_1015289 3300049592 Bacteria 683
644 Ga0501257_044790 3300049686 Bacteria 1093
645 Ga0501221_054557 3300049704 Bacteria 909
646 Ga0501079_0933273 3300049741 Bacteria 683
647 Ga0501080_0003117 3300049742 Bacteria 14621
648 Ga0501083_0000029 3300049744 Bacteria 107507
649 Ga0501262_000279 3300049759 Bacteria 6165
650 Ga0501035_0000274 3300049822 Bacteria 61155
651 Ga0501035_0006148 3300049822 Bacteria 11302
652 Ga0501035_0023999 3300049822 Bacteria 5596
653 Ga0501035_0042149 3300049822 Bacteria 4118
654 Ga0501035_0358454 3300049822 Bacteria 1219
655 Ga0501044_0000009 3300049823 Bacteria 270072
656 Ga0501044_0000589 3300049823 Bacteria 44077
657 Ga0501044_0009703 3300049823 Bacteria 10472
658 Ga0501044_0013376 3300049823 Bacteria 8874
659 nmdc:mga03683_1317_c2 3300050489 Bacteria 3698
660 nmdc:mga03683_160396_c1 3300050489 Bacteria 1018
661 nmdc:mga03683_2511_c1 3300050489 Bacteria 5713
662 nmdc:mga03683_49227_c1 3300050489 Bacteria 1753
663 nmdc:mga03n38_412382_c1 3300050490 Bacteria 745
664 nmdc:mga00v17_39821_c1 3300050491 Bacteria 2816
665 nmdc:mga00v17_6892_c1 3300050491 Bacteria 6040
666 nmdc:mga00v17_689386_c1 3300050491 Bacteria 655
667 nmdc:mga00v17_8064_c1 3300050491 Bacteria 5654
668 nmdc:mga0yw44_251103_c1 3300050492 Bacteria 1177
669 nmdc:mga0yw44_28608_c1 3300050492 Bacteria 3208
670 nmdc:mga0yw44_769_c1 3300050492 Bacteria 5344
671 nmdc:mga0yw44_899063_c1 3300050492 Bacteria 601
672 nmdc:mga0k408_174581_c1 3300050493 Bacteria 1281
673 nmdc:mga0k408_174613_c1 3300050493 Bacteria 1281
674 nmdc:mga0k408_197265_c1 3300050493 Bacteria 1201
675 nmdc:mga0k408_2092_c1 3300050493 Bacteria 10683
676 nmdc:mga0k408_45743_c1 3300050493 Bacteria 2526
677 nmdc:mga06z11_179918_c1 3300050494 Bacteria 1219
678 nmdc:mga06z11_692780_c1 3300050494 Bacteria 621
679 nmdc:mga04h51_13215_c1 3300050495 Bacteria 2333
680 nmdc:mga04h51_81353_c1 3300050495 Bacteria 1150
681 nmdc:mga07m45_13404_c1 3300050496 Bacteria 4350
682 nmdc:mga07m45_28732_c1 3300050496 Bacteria 3070
683 nmdc:mga07m45_353692_c1 3300050496 Bacteria 853
684 nmdc:mga07m45_3854_c1 3300050496 Bacteria 7270
685 nmdc:mga07m45_397137_c1 3300050496 Bacteria 800
686 nmdc:mga08y16_127745_c1 3300050511 Bacteria 2644
687 nmdc:mga0sz30_107066_c1 3300050516 Bacteria 1223
688 nmdc:mga0sz30_192608_c1 3300050516 Bacteria 905
689 nmdc:mga0sz30_29700_c1 3300050516 Bacteria 2255
690 nmdc:mga0sz30_430126_c1 3300050516 Bacteria 592
691 Ga0495601_0421057 3300053077 Bacteria 865
692 Ga0500610_0000021 3300053079 Bacteria 66361
693 Ga0500610_0000677 3300053079 Bacteria 10542
694 Ga0500578_0557896 3300053086 Bacteria 636
695 Ga0500643_100658 3300053087 Bacteria 784
696 Ga0500644_0005021 3300053088 Bacteria 3329
697 Ga0500644_0315107 3300053088 Bacteria 672
698 Ga0500646_0000478 3300053090 Bacteria 11767
699 Ga0500583_0011112 3300053092 Bacteria 3379
700 Ga0500583_0044618 3300053092 Bacteria 2031
701 Ga0500641_0059377 3300053096 Bacteria 1590
702 Ga0500641_0079698 3300053096 Bacteria 1388
703 Ga0500562_150293 3300053108 Bacteria 634
704 Ga0500572_165161 3300053111 Bacteria 725
705 Ga0500593_001100 3300053117 Bacteria 9757
706 Ga0500593_013505 3300053117 Bacteria 3487
707 Ga0500594_0000449 3300053118 Bacteria 9096
708 Ga0500595_108028 3300053119 Bacteria 793
709 Ga0500608_001832 3300053122 Bacteria 7570
710 Ga0500608_038603 3300053122 Bacteria 2285
711 Ga0500618_000391 3300053125 Bacteria 30070
712 Ga0500618_001954 3300053125 Bacteria 8440
713 Ga0500642_0037600 3300053130 Bacteria 2070
714 Ga0500658_0000058 3300053134 Bacteria 55299
715 Ga0500568_0001884 3300053139 Bacteria 12913
716 Ga0500568_0062986 3300053139 Bacteria 1431
717 Ga0500574_000542 3300053141 Bacteria 4866
718 Ga0500588_0126387 3300053146 Bacteria 907
719 Ga0500604_0221116 3300053151 Bacteria 653
720 Ga0500616_0046055 3300053153 Bacteria 2320
721 Ga0500616_0102948 3300053153 Bacteria 1392
722 Ga0500616_0238596 3300053153 Bacteria 783
723 Ga0500622_0035326 3300053156 Bacteria 2616
724 Ga0500622_0262419 3300053156 Bacteria 753
725 Ga0500627_0000142 3300053158 Bacteria 21143
726 Ga0500634_0015233 3300053161 Bacteria 4079
727 Ga0500636_0029969 3300053177 Bacteria 3216
728 Ga0500637_0181325 3300053178 Bacteria 1207
729 Ga0500645_000346 3300053730 Bacteria 33036
730 Ga0500645_005752 3300053730 Bacteria 4511
731 Ga0500645_017058 3300053730 Bacteria 2280
732 Ga0501084_0379441 3300054114 Bacteria 1195
733 Ga0500661_002516 3300055283 Bacteria 3461
734 Ga0501082_0029493 3300060353 Bacteria 4726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050495 nmdc:mga04h51_13215_c1 nmdc:mga04h51_13215_c1_11_469 152
2 iso_pu_bacteria 2599185236 2599718336 154
3 3300028379 Ga0268266_10431082 Ga0268266_104310821 158
4 3300049571 Ga0501034_1562900 Ga0501034_1562900_42_518 158
5 3300049574 Ga0501038_0964620 Ga0501038_0964620_123_599 158
6 3300048929 Ga0496126_0777875 Ga0496126_0777875_224_721 165
7 3300041512 Ga0451853_3403264 Ga0451853_3403264_64_576 166
8 3300054114 Ga0501084_0379441 Ga0501084_0379441_645_1157 170
9 3300025899 Ga0207642_10069208 Ga0207642_100692082 175
10 iso_pu_bacteria 2508501050 2508729941 175
11 iso_pu_bacteria 2511231002 2511242700 175
12 iso_pu_bacteria 2511231026 2511385418 175
13 iso_pu_bacteria 2513237087 2513590996 175
14 iso_pu_bacteria 2522572158 2523104726 175
15 iso_pu_bacteria 2528768022 2528849304 175
16 iso_pu_bacteria 2547132374 2548497218 175
17 iso_pu_bacteria 2548876994 2550693049 175
18 iso_pu_bacteria 2597490356 2599104062 175
19 iso_pu_bacteria 2599185214 2599624825 175
20 iso_pu_bacteria 2599185226 2599672837 175
21 iso_pu_bacteria 2599185227 2599682713 175
22 iso_pu_bacteria 2599185229 2599694446 175
23 iso_pu_bacteria 2599185292 2599905045 175
24 iso_pu_bacteria 2643221569 2643860312 175
25 iso_pu_bacteria 2643221596 2643993054 175
26 iso_pu_bacteria 2643221621 2644119951 175
27 iso_pu_bacteria 2643221658 2644329159 175
28 iso_pu_bacteria 2643221672 2644401746 175
29 iso_pu_bacteria 2643221683 2644464904 175
30 iso_pu_bacteria 2643221717 2644647541 175
31 iso_pu_bacteria 2643221733 2644729722 175
32 iso_pu_bacteria 2643221734 2644736405 175
33 iso_pu_bacteria 2643221736 2644743523 175
34 iso_pu_bacteria 2671180139 2671692394 175
35 iso_pu_bacteria 2738541277 2738717300 175
36 iso_pu_bacteria 2738541307 2738878872 175
37 iso_pu_bacteria 2738543019 2739277986 175
38 iso_pu_bacteria 2739367655 2739613503 175
39 iso_pu_bacteria 2765235838 2765568016 175
40 iso_pu_bacteria 2775506901 2776262531 175
41 iso_pu_bacteria 2808606386 2808983691 175
42 iso_pu_bacteria 2808606395 2809035738 175
43 iso_pu_bacteria 2808606415 2809129355 175
44 iso_pu_bacteria 2808606419 2809149590 175
45 iso_pu_bacteria 2818991445 2819595319 175
46 iso_pu_bacteria 2818991446 2819601046 175
47 iso_pu_bacteria 2818991467 2819721757 175
48 iso_pu_bacteria 2821123053 2821130840 175
49 iso_pu_bacteria 2824661429 2824667509 175
50 iso_pu_bacteria 2831265667 2831265882 175
51 iso_pu_bacteria 2838054893 2838060790 175
52 iso_pu_bacteria 2839094727 2839097685 175
53 iso_pu_bacteria 2841760612 2841764554 175
54 iso_pu_bacteria 2841911363 2841914093 175
55 iso_pu_bacteria 2841917233 2841919584 175
56 iso_pu_bacteria 2842718218 2842719491 175
57 iso_pu_bacteria 2842775625 2842776459 175
58 iso_pu_bacteria 2844104063 2844107998 175
59 iso_pu_bacteria 2846952575 2846957102 175
60 iso_pu_bacteria 2848858292 2848863109 175
61 iso_pu_bacteria 2851182111 2851187929 175
62 iso_pu_bacteria 2851246043 2851250104 175
63 iso_pu_bacteria 2852618963 2852619742 175
64 iso_pu_bacteria 2855730933 2855735381 175
65 iso_pu_bacteria 2855767633 2855771164 175
66 iso_pu_bacteria 2857531043 2857537620 175
67 iso_pu_bacteria 2857537821 2857538993 175
68 iso_pu_bacteria 2857542790 2857544790 175
69 iso_pu_bacteria 2858950400 2858950836 175
70 iso_pu_bacteria 2879099564 2879106119 175
71 iso_pu_bacteria 2881412998 2881416964 175
72 iso_pu_bacteria 2884811622 2884813715 175
73 iso_pu_bacteria 2884836552 2884841162 175
74 iso_pu_bacteria 2884852848 2884856037 175
75 iso_pu_bacteria 2889790730 2889794623 175
76 iso_pu_bacteria 2896154374 2896157038 175
77 iso_pu_bacteria 2897803580 2897805399 175
78 iso_pu_bacteria 2899924645 2899927877 175
79 iso_pu_bacteria 2904449895 2904454968 175
80 iso_pu_bacteria 2904456579 2904457325 175
81 iso_pu_bacteria 2904479285 2904482140 175
82 iso_pu_bacteria 2904541872 2904547533 175
83 iso_pu_bacteria 2917699015 2917702429 175
84 iso_pu_bacteria 2919462493 2919468081 175
85 iso_pu_bacteria 2922368715 2922372833 175
86 iso_pu_bacteria 2928037797 2928044463 175
87 iso_pu_bacteria 2928044640 2928051333 175
88 iso_pu_bacteria 2928051484 2928056332 175
89 iso_pu_bacteria 2928070936 2928074866 175
90 iso_pu_bacteria 2928084124 2928088342 175
91 iso_pu_bacteria 2929160207 2929164965 175
92 iso_pu_bacteria 2929520902 2929525236 175
93 iso_pu_bacteria 2929615660 2929620654 175
94 iso_pu_bacteria 2929624759 2929626547 175
95 iso_pu_bacteria 2932784394 2932784588 175
96 iso_pu_bacteria 2932809354 2932809568 175
97 iso_pu_bacteria 2932818245 2932818689 175
98 iso_pu_bacteria 2932828146 2932828356 175
99 iso_pu_bacteria 2933577622 2933582569 175
100 iso_pu_bacteria 2935616580 2935617329 175
101 iso_pu_bacteria 2935638405 2935639189 175
102 iso_pu_bacteria 2935665750 2935665959 175
103 iso_pu_bacteria 2935675223 2935675606 175
104 iso_pu_bacteria 2935684952 2935685384 175
105 iso_pu_bacteria 2935694250 2935698633 175
106 iso_pu_bacteria 2935703347 2935704196 175
107 iso_pu_bacteria 2935713505 2935713937 175
108 iso_pu_bacteria 2935722832 2935724556 175
109 iso_pu_bacteria 2935732158 2935733086 175
110 iso_pu_bacteria 2935741537 2935742465 175
111 iso_pu_bacteria 2935750917 2935751349 175
112 iso_pu_bacteria 2935760218 2935765879 175
113 iso_pu_bacteria 2935801545 2935802279 175
114 iso_pu_bacteria 2935810662 2935811103 175
115 iso_pu_bacteria 2935827899 2935828684 175
116 iso_pu_bacteria 2935837841 2935840060 175
117 iso_pu_bacteria 2935855204 2935855954 175
118 iso_pu_bacteria 2935864058 2935866102 175
119 iso_pu_bacteria 2935873716 2935877573 175
120 iso_pu_bacteria 2935992306 2935992517 175
121 iso_pu_bacteria 2936002035 2936002389 175
122 iso_pu_bacteria 2936037263 2936037477 175
123 iso_pu_bacteria 2940556831 2940557849 175
124 iso_pu_bacteria 2941479691 2941485476 175
125 iso_pu_bacteria 2941538514 2941540600 175
126 iso_pu_bacteria 2945909444 2945911112 175
127 iso_pu_bacteria 2945945610 2945947922 175
128 iso_pu_bacteria 2945972063 2945972814 175
129 iso_pu_bacteria 2945984333 2945986587 175
130 iso_pu_bacteria 2974320154 2974323451 175
131 iso_pu_bacteria 2990710928 2990712520 175
132 iso_pu_bacteria 8016511872 8016521165 175
133 iso_pu_bacteria 8017057580 8017064444 175
134 iso_pu_bacteria 8019586578 8019591613 175
135 iso_pu_bacteria 8019608314 8019618822 175
136 iso_pu_bacteria 8054002106 8054005487 175
137 iso_pu_bacteria 8054563764 8054566659 175
138 iso_pu_bacteria 8055742211 8055745516 175
139 iso_pu_bacteria 8057529695 8057533373 175
140 3300013306 Ga0163162_11425735 Ga0163162_114257352 177
141 3300042436 Ga0439435_0026993 Ga0439435_0026993_615_1148 177
142 3300050489 nmdc:mga03683_2511_c1 nmdc:mga03683_2511_c1_4366_4899 177
143 3300050491 nmdc:mga00v17_8064_c1 nmdc:mga00v17_8064_c1_4386_4919 177
144 3300050493 nmdc:mga0k408_2092_c1 nmdc:mga0k408_2092_c1_8081_8614 177
145 3300050494 nmdc:mga06z11_179918_c1 nmdc:mga06z11_179918_c1_138_671 177
146 3300050496 nmdc:mga07m45_353692_c1 nmdc:mga07m45_353692_c1_84_617 177
147 3300050511 nmdc:mga08y16_127745_c1 nmdc:mga08y16_127745_c1_412_945 177
148 3300050516 nmdc:mga0sz30_430126_c1 nmdc:mga0sz30_430126_c1_38_571 177
149 3300002704 JGI25155J39150_1000179 JGI25155J39150_100017925 179
150 3300002704 JGI25155J39150_1001060 JGI25155J39150_10010603 179
151 3300002705 JGI25156J39149_1000387 JGI25156J39149_10003871 179
152 3300002705 JGI25156J39149_1004087 JGI25156J39149_10040872 179
153 3300002737 JGI25162J39368_1003728 JGI25162J39368_10037284 179
154 3300002738 JGI25154J39366_1000254 JGI25154J39366_100025428 179
155 3300002738 JGI25154J39366_1000325 JGI25154J39366_100032526 179
156 3300002741 JGI25157J39369_1001567 JGI25157J39369_10015671 179
157 3300002987 JGI25159J45721_1001968 JGI25159J45721_10019686 179
158 3300002987 JGI25159J45721_1006051 JGI25159J45721_10060512 179
159 3300003187 JGI25151J46595_10000015 JGI25151J46595_1000001581 179
160 3300003187 JGI25151J46595_10002602 JGI25151J46595_100026026 179
161 3300003187 JGI25151J46595_10009706 JGI25151J46595_100097062 179
162 3300003203 JGI25406J46586_10007868 JGI25406J46586_100078683 179
163 3300003215 JGI25153J46596_10009431 JGI25153J46596_100094312 179
164 3300003316 rootH1_10076755 rootH1_100767552 179
165 3300003320 rootH2_10024720 rootH2_100247204 179
166 3300003320 rootH2_10035441 rootH2_100354412 179
167 3300003323 rootH1_10074964 rootH1_100749642 179
168 3300003354 JGI25160J50197_1001959 JGI25160J50197_10019594 179
169 3300003578 Ga0006562J51391_1021334 Ga0006562J51391_10213346 179
170 3300003578 Ga0006562J51391_1066283 Ga0006562J51391_10662832 179
171 3300003578 Ga0006562J51391_1066285 Ga0006562J51391_10662851 179
172 3300003751 Ga0055538_1000008 Ga0055538_1000008136 179
173 3300003752 Ga0055539_1000012 Ga0055539_1000012136 179
174 3300003756 Ga0055533_1000015 Ga0055533_1000015136 179
175 3300003758 Ga0055532_1000296 Ga0055532_100029629 179
176 3300003759 Ga0055525_1000017 Ga0055525_1000017207 179
177 3300003761 Ga0055535_1000343 Ga0055535_10003439 179
178 3300003762 Ga0055542_1000126 Ga0055542_10001263 179
179 3300003763 Ga0055529_1021079 Ga0055529_10210791 179
180 3300003771 Ga0055526_1000609 Ga0055526_100060919 179
181 3300003771 Ga0055526_1002143 Ga0055526_10021437 179
182 3300003771 Ga0055526_1002522 Ga0055526_100252212 179
183 3300003773 Ga0055537_1000448 Ga0055537_100044816 179
184 3300003773 Ga0055537_1004389 Ga0055537_10043893 179
185 3300003773 Ga0055537_1013245 Ga0055537_10132452 179
186 3300003775 Ga0055524_1000051 Ga0055524_1000051124 179
187 3300003775 Ga0055524_1001475 Ga0055524_10014758 179
188 3300003781 Ga0055536_1000789 Ga0055536_10007898 179
189 3300003781 Ga0055536_1012291 Ga0055536_10122912 179
190 3300003784 Ga0055534_1000473 Ga0055534_100047311 179
191 3300003784 Ga0055534_1001389 Ga0055534_10013898 179
192 3300003784 Ga0055534_1019691 Ga0055534_10196912 179
193 3300003790 Ga0055528_1001744 Ga0055528_10017443 179
194 3300003790 Ga0055528_1009552 Ga0055528_10095522 179
195 3300003790 Ga0055528_1045886 Ga0055528_10458862 179
196 3300003791 Ga0055530_10000311 Ga0055530_1000031132 179
197 3300003791 Ga0055530_10008806 Ga0055530_100088063 179
198 3300003791 Ga0055530_10059819 Ga0055530_100598192 179
199 3300003792 Ga0055540_1001220 Ga0055540_10012208 179
200 3300003792 Ga0055540_1001502 Ga0055540_100150212 179
201 3300003792 Ga0055540_1006880 Ga0055540_10068802 179
202 3300003794 Ga0055531_10001247 Ga0055531_1000124712 179
203 3300003794 Ga0055531_10001433 Ga0055531_100014338 179
204 3300003841 Ga0055541_1000009 Ga0055541_1000009136 179
205 3300004625 Ga0055543_1001701 Ga0055543_10017013 179
206 3300005262 Ga0065165_1000132 Ga0065165_100013277 179
207 3300005262 Ga0065165_1012862 Ga0065165_10128622 179
208 3300005288 Ga0065714_10005309 Ga0065714_100053092 179
209 3300005289 Ga0065704_10226558 Ga0065704_102265582 179
210 3300005293 Ga0065715_10615207 Ga0065715_106152071 179
211 3300005327 Ga0070658_10571372 Ga0070658_105713721 179
212 3300005328 Ga0070676_10000836 Ga0070676_1000083614 179
213 3300005328 Ga0070676_10044337 Ga0070676_100443372 179
214 3300005328 Ga0070676_10288143 Ga0070676_102881432 179
215 3300005331 Ga0070670_100040721 Ga0070670_1000407212 179
216 3300005331 Ga0070670_100162239 Ga0070670_1001622392 179
217 3300005333 Ga0070677_10007554 Ga0070677_100075542 179
218 3300005333 Ga0070677_10009782 Ga0070677_100097822 179
219 3300005334 Ga0068869_100002364 Ga0068869_1000023645 179
220 3300005334 Ga0068869_100592122 Ga0068869_1005921222 179
221 3300005335 Ga0070666_10002536 Ga0070666_100025367 179
222 3300005337 Ga0070682_100321995 Ga0070682_1003219951 179
223 3300005338 Ga0068868_100004050 Ga0068868_1000040507 179
224 3300005338 Ga0068868_100241641 Ga0068868_1002416412 179
225 3300005338 Ga0068868_100366844 Ga0068868_1003668442 179
226 3300005338 Ga0068868_100493468 Ga0068868_1004934682 179
227 3300005340 Ga0070689_100110819 Ga0070689_1001108192 179
228 3300005344 Ga0070661_100184500 Ga0070661_1001845002 179
229 3300005347 Ga0070668_100005115 Ga0070668_1000051153 179
230 3300005347 Ga0070668_100026991 Ga0070668_1000269914 179
231 3300005347 Ga0070668_100247359 Ga0070668_1002473592 179
232 3300005354 Ga0070675_100008930 Ga0070675_1000089306 179
233 3300005355 Ga0070671_100000599 Ga0070671_1000005993 179
234 3300005355 Ga0070671_100319014 Ga0070671_1003190142 179
235 3300005356 Ga0070674_100008482 Ga0070674_1000084821 179
236 3300005356 Ga0070674_100013048 Ga0070674_1000130484 179
237 3300005356 Ga0070674_100281207 Ga0070674_1002812072 179
238 3300005356 Ga0070674_100422375 Ga0070674_1004223752 179
239 3300005364 Ga0070673_100000267 Ga0070673_10000026722 179
240 3300005364 Ga0070673_100248835 Ga0070673_1002488352 179
241 3300005366 Ga0070659_100044528 Ga0070659_1000445283 179
242 3300005367 Ga0070667_100028450 Ga0070667_1000284502 179
243 3300005367 Ga0070667_100147097 Ga0070667_1001470972 179
244 3300005434 Ga0070709_10019614 Ga0070709_100196142 179
245 3300005436 Ga0070713_100011483 Ga0070713_1000114833 179
246 3300005437 Ga0070710_10000449 Ga0070710_100004496 179
247 3300005439 Ga0070711_100005210 Ga0070711_1000052106 179
248 3300005455 Ga0070663_100007358 Ga0070663_1000073583 179
249 3300005455 Ga0070663_100207736 Ga0070663_1002077362 179
250 3300005455 Ga0070663_100994419 Ga0070663_1009944191 179
251 3300005456 Ga0070678_100000237 Ga0070678_1000002372 179
252 3300005456 Ga0070678_100029771 Ga0070678_1000297715 179
253 3300005456 Ga0070678_100226805 Ga0070678_1002268052 179
254 3300005456 Ga0070678_100603641 Ga0070678_1006036412 179
255 3300005457 Ga0070662_100118584 Ga0070662_1001185842 179
256 3300005457 Ga0070662_100213019 Ga0070662_1002130192 179
257 3300005459 Ga0068867_100007594 Ga0068867_1000075942 179
258 3300005459 Ga0068867_100016101 Ga0068867_1000161014 179
259 3300005459 Ga0068867_100580109 Ga0068867_1005801091 179
260 3300005459 Ga0068867_100595909 Ga0068867_1005959091 179
261 3300005466 Ga0070685_10052232 Ga0070685_100522322 179
262 3300005468 Ga0070707_101047930 Ga0070707_1010479301 179
263 3300005471 Ga0070698_101247596 Ga0070698_1012475961 179
264 3300005539 Ga0068853_100019877 Ga0068853_1000198772 179
265 3300005539 Ga0068853_100213156 Ga0068853_1002131562 179
266 3300005539 Ga0068853_100777451 Ga0068853_1007774511 179
267 3300005543 Ga0070672_100004191 Ga0070672_1000041913 179
268 3300005543 Ga0070672_100086670 Ga0070672_1000866702 179
269 3300005544 Ga0070686_100102553 Ga0070686_1001025532 179
270 3300005547 Ga0070693_100806614 Ga0070693_1008066141 179
271 3300005548 Ga0070665_100009082 Ga0070665_1000090827 179
272 3300005548 Ga0070665_100018899 Ga0070665_1000188992 179
273 3300005548 Ga0070665_100337753 Ga0070665_1003377532 179
274 3300005548 Ga0070665_100526374 Ga0070665_1005263742 179
275 3300005549 Ga0070704_100404801 Ga0070704_1004048011 179
276 3300005563 Ga0068855_100171564 Ga0068855_1001715642 179
277 3300005563 Ga0068855_101490263 Ga0068855_1014902632 179
278 3300005577 Ga0068857_100119715 Ga0068857_1001197152 179
279 3300005578 Ga0068854_100031253 Ga0068854_1000312534 179
280 3300005616 Ga0068852_100001911 Ga0068852_1000019113 179
281 3300005616 Ga0068852_100026765 Ga0068852_1000267654 179
282 3300005616 Ga0068852_100707387 Ga0068852_1007073872 179
283 3300005617 Ga0068859_100027377 Ga0068859_1000273776 179
284 3300005617 Ga0068859_100347510 Ga0068859_1003475102 179
285 3300005618 Ga0068864_100040816 Ga0068864_1000408162 179
286 3300005718 Ga0068866_10031652 Ga0068866_100316523 179
287 3300005719 Ga0068861_100143902 Ga0068861_1001439022 179
288 3300005719 Ga0068861_100184249 Ga0068861_1001842492 179
289 3300005834 Ga0068851_10000220 Ga0068851_1000022022 179
290 3300005834 Ga0068851_10011189 Ga0068851_100111892 179
291 3300005840 Ga0068870_10002587 Ga0068870_100025876 179
292 3300005841 Ga0068863_100033620 Ga0068863_1000336204 179
293 3300005841 Ga0068863_100581000 Ga0068863_1005810002 179
294 3300005842 Ga0068858_100044399 Ga0068858_1000443995 179
295 3300005842 Ga0068858_100194212 Ga0068858_1001942122 179
296 3300005843 Ga0068860_100000222 Ga0068860_10000022241 179
297 3300005843 Ga0068860_100038152 Ga0068860_1000381523 179
298 3300005843 Ga0068860_101659581 Ga0068860_1016595811 179
299 3300005844 Ga0068862_100024728 Ga0068862_1000247282 179
300 3300005844 Ga0068862_100430011 Ga0068862_1004300112 179
301 3300005983 Ga0081540_1001161 Ga0081540_100116113 179
302 3300005983 Ga0081540_1127240 Ga0081540_11272401 179
303 3300005985 Ga0081539_10002771 Ga0081539_100027714 179
304 3300005985 Ga0081539_10151524 Ga0081539_101515242 179
305 3300006028 Ga0070717_10170016 Ga0070717_101700162 179
306 3300006038 Ga0075365_10025414 Ga0075365_100254143 179
307 3300006038 Ga0075365_10052635 Ga0075365_100526352 179
308 3300006038 Ga0075365_10264862 Ga0075365_102648622 179
309 3300006042 Ga0075368_10016748 Ga0075368_100167482 179
310 3300006042 Ga0075368_10133928 Ga0075368_101339282 179
311 3300006048 Ga0075363_100005976 Ga0075363_1000059765 179
312 3300006048 Ga0075363_100024223 Ga0075363_1000242233 179
313 3300006048 Ga0075363_100033640 Ga0075363_1000336402 179
314 3300006048 Ga0075363_100043367 Ga0075363_1000433671 179
315 3300006048 Ga0075363_100193326 Ga0075363_1001933262 179
316 3300006048 Ga0075363_100198736 Ga0075363_1001987362 179
317 3300006051 Ga0075364_10003868 Ga0075364_100038686 179
318 3300006051 Ga0075364_10017219 Ga0075364_100172192 179
319 3300006051 Ga0075364_10028130 Ga0075364_100281301 179
320 3300006051 Ga0075364_10438279 Ga0075364_104382792 179
321 3300006051 Ga0075364_10464447 Ga0075364_104644472 179
322 3300006173 Ga0070716_100008383 Ga0070716_1000083835 179
323 3300006175 Ga0070712_100012417 Ga0070712_1000124173 179
324 3300006177 Ga0075362_10008824 Ga0075362_100088242 179
325 3300006177 Ga0075362_10010440 Ga0075362_100104403 179
326 3300006177 Ga0075362_10036224 Ga0075362_100362241 179
327 3300006177 Ga0075362_10157238 Ga0075362_101572382 179
328 3300006177 Ga0075362_10575610 Ga0075362_105756101 179
329 3300006177 Ga0075362_10605460 Ga0075362_106054601 179
330 3300006178 Ga0075367_10098742 Ga0075367_100987422 179
331 3300006178 Ga0075367_10099593 Ga0075367_100995932 179
332 3300006178 Ga0075367_10163896 Ga0075367_101638962 179
333 3300006178 Ga0075367_10575648 Ga0075367_105756482 179
334 3300006186 Ga0075369_10372519 Ga0075369_103725191 179
335 3300006195 Ga0075366_10001052 Ga0075366_1000105210 179
336 3300006195 Ga0075366_10052923 Ga0075366_100529232 179
337 3300006195 Ga0075366_10064539 Ga0075366_100645392 179
338 3300006195 Ga0075366_10297351 Ga0075366_102973512 179
339 3300006237 Ga0097621_100733870 Ga0097621_1007338702 179
340 3300006237 Ga0097621_101079448 Ga0097621_1010794482 179
341 3300006353 Ga0075370_10190706 Ga0075370_101907062 179
342 3300006353 Ga0075370_10255296 Ga0075370_102552962 179
343 3300006353 Ga0075370_10297946 Ga0075370_102979462 179
344 3300006353 Ga0075370_10326142 Ga0075370_103261422 179
345 3300006353 Ga0075370_10349313 Ga0075370_103493132 179
346 3300006353 Ga0075370_10500432 Ga0075370_105004321 179
347 3300006358 Ga0068871_100036092 Ga0068871_1000360923 179
348 3300006846 Ga0075430_100235229 Ga0075430_1002352292 179
349 3300006881 Ga0068865_100500122 Ga0068865_1005001222 179
350 3300006881 Ga0068865_100734927 Ga0068865_1007349271 179
351 3300006931 Ga0097620_100027377 Ga0097620_1000273772 179
352 3300006931 Ga0097620_100347512 Ga0097620_1003475122 179
353 3300006946 Ga0079104_1000014 Ga0079104_1000014236 179
354 3300006946 Ga0079104_1043240 Ga0079104_10432402 179
355 3300006948 Ga0099826_10000671 Ga0099826_100006713 179
356 3300009092 Ga0105250_10167444 Ga0105250_101674442 179
357 3300009093 Ga0105240_10020115 Ga0105240_100201153 179
358 3300009093 Ga0105240_10031768 Ga0105240_100317685 179
359 3300009093 Ga0105240_10258346 Ga0105240_102583462 179
360 3300009094 Ga0111539_10141238 Ga0111539_101412382 179
361 3300009098 Ga0105245_10279072 Ga0105245_102790722 179
362 3300009098 Ga0105245_11412575 Ga0105245_114125751 179
363 3300009101 Ga0105247_10080682 Ga0105247_100806822 179
364 3300009101 Ga0105247_10086543 Ga0105247_100865432 179
365 3300009148 Ga0105243_10182188 Ga0105243_101821882 179
366 3300009148 Ga0105243_10959417 Ga0105243_109594171 179
367 3300009174 Ga0105241_10949265 Ga0105241_109492651 179
368 3300009177 Ga0105248_10191070 Ga0105248_101910702 179
369 3300009545 Ga0105237_10017067 Ga0105237_100170672 179
370 3300009545 Ga0105237_10225506 Ga0105237_102255062 179
371 3300009545 Ga0105237_10750806 Ga0105237_107508062 179
372 3300009551 Ga0105238_10126253 Ga0105238_101262533 179
373 3300009551 Ga0105238_10223585 Ga0105238_102235852 179
374 3300009551 Ga0105238_10884773 Ga0105238_108847732 179
375 3300009551 Ga0105238_11117932 Ga0105238_111179322 179
376 3300009553 Ga0105249_10671704 Ga0105249_106717042 179
377 3300010375 Ga0105239_10011838 Ga0105239_1001183810 179
378 3300010375 Ga0105239_10192154 Ga0105239_101921542 179
379 3300010375 Ga0105239_11401067 Ga0105239_114010672 179
380 3300011119 Ga0105246_10398275 Ga0105246_103982752 179
381 3300011119 Ga0105246_11208375 Ga0105246_112083751 179
382 3300013100 Ga0157373_10016931 Ga0157373_100169312 179
383 3300013100 Ga0157373_10187461 Ga0157373_101874612 179
384 3300013102 Ga0157371_10245755 Ga0157371_102457551 179
385 3300013104 Ga0157370_10199218 Ga0157370_101992182 179
386 3300013104 Ga0157370_11296196 Ga0157370_112961961 179
387 3300013105 Ga0157369_10003086 Ga0157369_100030864 179
388 3300013250 Ga0171462_1007 Ga0171462_1007192 179
389 3300013296 Ga0157374_10141705 Ga0157374_101417052 179
390 3300013296 Ga0157374_10550310 Ga0157374_105503101 179
391 3300013297 Ga0157378_10352602 Ga0157378_103526022 179
392 3300013297 Ga0157378_10848352 Ga0157378_108483521 179
393 3300013306 Ga0163162_10087647 Ga0163162_100876472 179
394 3300013306 Ga0163162_10242657 Ga0163162_102426572 179
395 3300013306 Ga0163162_11528040 Ga0163162_115280402 179
396 3300013306 Ga0163162_11818368 Ga0163162_118183681 179
397 3300013307 Ga0157372_10869210 Ga0157372_108692102 179
398 3300013308 Ga0157375_10003695 Ga0157375_100036956 179
399 3300013308 Ga0157375_10213388 Ga0157375_102133882 179
400 3300014325 Ga0163163_10081276 Ga0163163_100812762 179
401 3300014326 Ga0157380_10319304 Ga0157380_103193041 179
402 3300014326 Ga0157380_10328010 Ga0157380_103280102 179
403 3300014326 Ga0157380_11258998 Ga0157380_112589982 179
404 3300014497 Ga0182008_10053014 Ga0182008_100530142 179
405 3300014968 Ga0157379_10486614 Ga0157379_104866142 179
406 3300014969 Ga0157376_10017569 Ga0157376_100175693 179
407 3300014969 Ga0157376_10127372 Ga0157376_101273723 179
408 3300014969 Ga0157376_10457434 Ga0157376_104574342 179
409 3300015261 Ga0182006_1062347 Ga0182006_10623472 179
410 3300017792 Ga0163161_10000162 Ga0163161_1000016219 179
411 3300017792 Ga0163161_10010689 Ga0163161_100106892 179
412 3300017792 Ga0163161_10089671 Ga0163161_100896712 179
413 3300017792 Ga0163161_10500784 Ga0163161_105007842 179
414 3300017792 Ga0163161_10949738 Ga0163161_109497381 179
415 3300021361 Ga0213872_10013357 Ga0213872_100133573 179
416 3300025206 Ga0209435_100018 Ga0209435_100018219 179
417 3300025206 Ga0209435_100240 Ga0209435_1002407 179
418 3300025208 Ga0209436_101550 Ga0209436_1015506 179
419 3300025224 Ga0209784_100005 Ga0209784_100005135 179
420 3300025225 Ga0209566_100005 Ga0209566_100005135 179
421 3300025226 Ga0209674_100009 Ga0209674_100009135 179
422 3300025228 Ga0209672_100223 Ga0209672_10022340 179
423 3300025228 Ga0209672_112083 Ga0209672_1120832 179
424 3300025229 Ga0209147_100051 Ga0209147_100051219 179
425 3300025229 Ga0209147_102363 Ga0209147_1023632 179
426 3300025230 Ga0209563_100012 Ga0209563_100012135 179
427 3300025233 Ga0209437_100117 Ga0209437_1001172 179
428 3300025242 Ga0209258_100018 Ga0209258_10001844 179
429 3300025242 Ga0209258_100540 Ga0209258_10054029 179
430 3300025242 Ga0209258_113561 Ga0209258_1135612 179
431 3300025245 Ga0207425_1001643 Ga0207425_10016436 179
432 3300025245 Ga0207425_1006207 Ga0207425_10062073 179
433 3300025246 Ga0209646_1000090 Ga0209646_1000090138 179
434 3300025246 Ga0209646_1000105 Ga0209646_1000105144 179
435 3300025250 Ga0209026_1000042 Ga0209026_100004227 179
436 3300025250 Ga0209026_1023782 Ga0209026_10237822 179
437 3300025253 Ga0209677_100006 Ga0209677_100006135 179
438 3300025254 Ga0209148_1000030 Ga0209148_100003044 179
439 3300025254 Ga0209148_1012446 Ga0209148_10124462 179
440 3300025256 Ga0209759_1000538 Ga0209759_10005387 179
441 3300025256 Ga0209759_1000625 Ga0209759_10006254 179
442 3300025258 Ga0209129_1002222 Ga0209129_10022222 179
443 3300025261 Ga0209233_1002155 Ga0209233_10021552 179
444 3300025263 Ga0209565_1000175 Ga0209565_100017546 179
445 3300025263 Ga0209565_1001044 Ga0209565_100104412 179
446 3300025263 Ga0209565_1002838 Ga0209565_10028385 179
447 3300025272 Ga0209455_1001445 Ga0209455_10014453 179
448 3300025272 Ga0209455_1003989 Ga0209455_10039894 179
449 3300025273 Ga0209673_1000099 Ga0209673_100009946 179
450 3300025273 Ga0209673_1000559 Ga0209673_100055931 179
451 3300025273 Ga0209673_1011026 Ga0209673_10110261 179
452 3300025273 Ga0209673_1076371 Ga0209673_10763712 179
453 3300025284 Ga0209130_1000215 Ga0209130_100021541 179
454 3300025284 Ga0209130_1000327 Ga0209130_10003272 179
455 3300025291 Ga0209675_1000054 Ga0209675_100005446 179
456 3300025291 Ga0209675_1000523 Ga0209675_10005235 179
457 3300025291 Ga0209675_1000603 Ga0209675_10006039 179
458 3300025291 Ga0209675_1000703 Ga0209675_10007035 179
459 3300025291 Ga0209675_1005881 Ga0209675_10058815 179
460 3300025292 Ga0209676_1000004 Ga0209676_1000004772 179
461 3300025292 Ga0209676_1000172 Ga0209676_100017240 179
462 3300025292 Ga0209676_1000214 Ga0209676_100021416 179
463 3300025292 Ga0209676_1010705 Ga0209676_10107053 179
464 3300025294 Ga0209025_1000010 Ga0209025_1000010780 179
465 3300025294 Ga0209025_1000039 Ga0209025_1000039198 179
466 3300025294 Ga0209025_1000343 Ga0209025_100034371 179
467 3300025294 Ga0209025_1004962 Ga0209025_100496211 179
468 3300025294 Ga0209025_1006817 Ga0209025_10068174 179
469 3300025294 Ga0209025_1017362 Ga0209025_10173622 179
470 3300025294 Ga0209025_1020360 Ga0209025_10203602 179
471 3300025294 Ga0209025_1037168 Ga0209025_10371682 179
472 3300025295 Ga0209564_1000048 Ga0209564_1000048140 179
473 3300025295 Ga0209564_1000065 Ga0209564_1000065173 179
474 3300025295 Ga0209564_1000413 Ga0209564_100041360 179
475 3300025297 Ga0209758_1005464 Ga0209758_10054644 179
476 3300025297 Ga0209758_1020982 Ga0209758_10209823 179
477 3300025297 Ga0209758_1023214 Ga0209758_10232142 179
478 3300025297 Ga0209758_1053854 Ga0209758_10538542 179
479 3300025298 Ga0209050_1000002 Ga0209050_10000021282 179
480 3300025298 Ga0209050_1000509 Ga0209050_100050929 179
481 3300025298 Ga0209050_1006610 Ga0209050_10066105 179
482 3300025298 Ga0209050_1012301 Ga0209050_10123013 179
483 3300025298 Ga0209050_1027702 Ga0209050_10277022 179
484 3300025298 Ga0209050_1079540 Ga0209050_10795402 179
485 3300025299 Ga0209256_1000041 Ga0209256_1000041140 179
486 3300025299 Ga0209256_1000067 Ga0209256_100006741 179
487 3300025299 Ga0209256_1001487 Ga0209256_10014877 179
488 3300025299 Ga0209256_1020709 Ga0209256_10207091 179
489 3300025299 Ga0209256_1074473 Ga0209256_10744731 179
490 3300025302 Ga0207426_1000178 Ga0207426_100017886 179
491 3300025302 Ga0207426_1000264 Ga0207426_100026483 179
492 3300025303 Ga0209051_1000002 Ga0209051_10000021052 179
493 3300025303 Ga0209051_1000074 Ga0209051_1000074203 179
494 3300025303 Ga0209051_1000096 Ga0209051_1000096133 179
495 3300025303 Ga0209051_1000211 Ga0209051_10002114 179
496 3300025303 Ga0209051_1088683 Ga0209051_10886832 179
497 3300025304 Ga0209257_1000002 Ga0209257_10000021193 179
498 3300025304 Ga0209257_1000072 Ga0209257_1000072204 179
499 3300025315 Ga0207697_10019012 Ga0207697_100190122 179
500 3300025321 Ga0207656_10006995 Ga0207656_100069952 179
501 3300025321 Ga0207656_10117062 Ga0207656_101170622 179
502 3300025893 Ga0207682_10000345 Ga0207682_100003456 179
503 3300025893 Ga0207682_10010037 Ga0207682_100100372 179
504 3300025898 Ga0207692_10013490 Ga0207692_100134902 179
505 3300025900 Ga0207710_10036871 Ga0207710_100368712 179
506 3300025900 Ga0207710_10357535 Ga0207710_103575351 179
507 3300025901 Ga0207688_10038004 Ga0207688_100380042 179
508 3300025903 Ga0207680_10012948 Ga0207680_100129482 179
509 3300025904 Ga0207647_10129705 Ga0207647_101297052 179
510 3300025906 Ga0207699_10001182 Ga0207699_1000118211 179
511 3300025907 Ga0207645_10000607 Ga0207645_1000060719 179
512 3300025907 Ga0207645_10042823 Ga0207645_100428233 179
513 3300025908 Ga0207643_10004161 Ga0207643_100041613 179
514 3300025913 Ga0207695_10003709 Ga0207695_1000370918 179
515 3300025913 Ga0207695_10044520 Ga0207695_100445203 179
516 3300025913 Ga0207695_10415003 Ga0207695_104150032 179
517 3300025914 Ga0207671_10147505 Ga0207671_101475052 179
518 3300025916 Ga0207663_10037001 Ga0207663_100370012 179
519 3300025923 Ga0207681_10069040 Ga0207681_100690402 179
520 3300025924 Ga0207694_10146640 Ga0207694_101466402 179
521 3300025924 Ga0207694_10240227 Ga0207694_102402272 179
522 3300025924 Ga0207694_10642015 Ga0207694_106420152 179
523 3300025924 Ga0207694_10810966 Ga0207694_108109662 179
524 3300025925 Ga0207650_10049287 Ga0207650_100492873 179
525 3300025925 Ga0207650_10093371 Ga0207650_100933711 179
526 3300025926 Ga0207659_10011128 Ga0207659_100111283 179
527 3300025926 Ga0207659_10023076 Ga0207659_100230764 179
528 3300025928 Ga0207700_10102240 Ga0207700_101022402 179
529 3300025929 Ga0207664_10023118 Ga0207664_100231187 179
530 3300025931 Ga0207644_10104292 Ga0207644_101042921 179
531 3300025932 Ga0207690_10028024 Ga0207690_100280243 179
532 3300025932 Ga0207690_10190597 Ga0207690_101905972 179
533 3300025933 Ga0207706_10007642 Ga0207706_100076423 179
534 3300025933 Ga0207706_10177212 Ga0207706_101772122 179
535 3300025937 Ga0207669_10008887 Ga0207669_100088873 179
536 3300025937 Ga0207669_10168864 Ga0207669_101688641 179
537 3300025937 Ga0207669_10247761 Ga0207669_102477611 179
538 3300025937 Ga0207669_10584568 Ga0207669_105845681 179
539 3300025938 Ga0207704_10125393 Ga0207704_101253932 179
540 3300025938 Ga0207704_10567189 Ga0207704_105671891 179
541 3300025939 Ga0207665_10009013 Ga0207665_100090132 179
542 3300025940 Ga0207691_10003533 Ga0207691_100035337 179
543 3300025942 Ga0207689_10001874 Ga0207689_100018747 179
544 3300025942 Ga0207689_10246599 Ga0207689_102465992 179
545 3300025942 Ga0207689_10553273 Ga0207689_105532732 179
546 3300025949 Ga0207667_10035907 Ga0207667_100359074 179
547 3300025949 Ga0207667_11230472 Ga0207667_112304722 179
548 3300025960 Ga0207651_10031082 Ga0207651_100310822 179
549 3300025960 Ga0207651_10264198 Ga0207651_102641982 179
550 3300025972 Ga0207668_10033473 Ga0207668_100334732 179
551 3300025972 Ga0207668_10050917 Ga0207668_100509173 179
552 3300025972 Ga0207668_10166921 Ga0207668_101669212 179
553 3300025972 Ga0207668_10447490 Ga0207668_104474902 179
554 3300025972 Ga0207668_10596139 Ga0207668_105961392 179
555 3300025981 Ga0207640_10140266 Ga0207640_101402662 179
556 3300025986 Ga0207658_10003030 Ga0207658_100030302 179
557 3300025986 Ga0207658_10506745 Ga0207658_105067452 179
558 3300025986 Ga0207658_10604850 Ga0207658_106048502 179
559 3300026023 Ga0207677_10015110 Ga0207677_100151103 179
560 3300026023 Ga0207677_10371424 Ga0207677_103714242 179
561 3300026035 Ga0207703_10291745 Ga0207703_102917452 179
562 3300026041 Ga0207639_10149371 Ga0207639_101493711 179
563 3300026067 Ga0207678_10002641 Ga0207678_1000264111 179
564 3300026067 Ga0207678_10016002 Ga0207678_100160022 179
565 3300026067 Ga0207678_10540218 Ga0207678_105402181 179
566 3300026088 Ga0207641_10009515 Ga0207641_100095155 179
567 3300026088 Ga0207641_10605691 Ga0207641_106056912 179
568 3300026089 Ga0207648_10001598 Ga0207648_100015987 179
569 3300026089 Ga0207648_10019748 Ga0207648_100197485 179
570 3300026089 Ga0207648_10154059 Ga0207648_101540592 179
571 3300026095 Ga0207676_10122896 Ga0207676_101228962 179
572 3300026095 Ga0207676_10166314 Ga0207676_101663142 179
573 3300026116 Ga0207674_10260179 Ga0207674_102601792 179
574 3300026116 Ga0207674_11577307 Ga0207674_115773071 179
575 3300026118 Ga0207675_100077185 Ga0207675_1000771852 179
576 3300026118 Ga0207675_100163209 Ga0207675_1001632092 179
577 3300026121 Ga0207683_10000003 Ga0207683_100000036 179
578 3300026121 Ga0207683_10006708 Ga0207683_100067086 179
579 3300026121 Ga0207683_10328392 Ga0207683_103283922 179
580 3300026121 Ga0207683_11195766 Ga0207683_111957662 179
581 3300026142 Ga0207698_10009172 Ga0207698_100091725 179
582 3300026142 Ga0207698_10239404 Ga0207698_102394042 179
583 3300026142 Ga0207698_10295587 Ga0207698_102955872 179
584 3300027111 Ga0209281_1000032 Ga0209281_1000032236 179
585 3300027666 Ga0209282_1000560 Ga0209282_10005605 179
586 3300027666 Ga0209282_1001565 Ga0209282_10015655 179
587 3300027907 Ga0207428_10084084 Ga0207428_100840843 179
588 3300028379 Ga0268266_10001663 Ga0268266_1000166314 179
589 3300028379 Ga0268266_10026221 Ga0268266_100262213 179
590 3300028379 Ga0268266_10291416 Ga0268266_102914162 179
591 3300028379 Ga0268266_10500413 Ga0268266_105004132 179
592 3300028379 Ga0268266_10862270 Ga0268266_108622701 179
593 3300028380 Ga0268265_10032680 Ga0268265_100326804 179
594 3300028380 Ga0268265_10084880 Ga0268265_100848802 179
595 3300028381 Ga0268264_10000042 Ga0268264_10000042140 179
596 3300028381 Ga0268264_10080012 Ga0268264_100800122 179
597 3300028794 Ga0307515_10133611 Ga0307515_101336113 179
598 3300028794 Ga0307515_10214821 Ga0307515_102148212 179
599 3300030500 Ga0268256_1016829 Ga0268256_10168292 179
600 3300030521 Ga0307511_10000269 Ga0307511_1000026915 179
601 3300030742 Ga0316183_1151865 Ga0316183_11518652 179
602 3300031456 Ga0307513_10000363 Ga0307513_1000036317 179
603 3300031456 Ga0307513_10660273 Ga0307513_106602732 179
604 3300031507 Ga0307509_10528024 Ga0307509_105280241 179
605 3300031548 Ga0307408_100232502 Ga0307408_1002325022 179
606 3300031548 Ga0307408_100267201 Ga0307408_1002672012 179
607 3300031548 Ga0307408_101006136 Ga0307408_1010061362 179
608 3300031548 Ga0307408_101683314 Ga0307408_1016833141 179
609 3300031616 Ga0307508_10340181 Ga0307508_103401812 179
610 3300031649 Ga0307514_10145777 Ga0307514_101457772 179
611 3300031731 Ga0307405_10225398 Ga0307405_102253982 179
612 3300031901 Ga0307406_10005714 Ga0307406_100057143 179
613 3300031903 Ga0307407_10290201 Ga0307407_102902012 179
614 3300031903 Ga0307407_10309329 Ga0307407_103093291 179
615 3300031911 Ga0307412_10015136 Ga0307412_100151363 179
616 3300031911 Ga0307412_10062574 Ga0307412_100625742 179
617 3300032004 Ga0307414_10563807 Ga0307414_105638072 179
618 3300032004 Ga0307414_10679017 Ga0307414_106790172 179
619 3300032004 Ga0307414_11392463 Ga0307414_113924631 179
620 3300032005 Ga0307411_10136427 Ga0307411_101364272 179
621 3300033179 Ga0307507_10010960 Ga0307507_100109603 179
622 3300033180 Ga0307510_10278123 Ga0307510_102781232 179
623 3300037418 Ga0395900_0008958 Ga0395900_0008958_2909_3448 179
624 3300038443 Ga0395901_0401651 Ga0395901_0401651_629_1168 179
625 3300039447 Ga0436361_0721781 Ga0436361_0721781_4399_4947 179
626 3300041404 Ga0439436_0053994 Ga0439436_0053994_306_845 179
627 3300041411 Ga0439466_0168027 Ga0439466_0168027_89_628 179
628 3300041458 Ga0451798_0745458 Ga0451798_0745458_149_688 179
629 3300041498 Ga0451841_0361748 Ga0451841_0361748_251_790 179
630 3300042007 Ga0439449_0012030 Ga0439449_0012030_1419_1958 179
631 3300044684 Ga0466966_0703205 Ga0466966_0703205_56_595 179
632 3300044712 Ga0453684_0316588 Ga0453684_0316588_647_1189 179
633 3300044765 Ga0466970_0135437 Ga0466970_0135437_586_1125 179
634 3300044901 Ga0466960_0162483 Ga0466960_0162483_57_596 179
635 3300046453 Ga0495627_005063 Ga0495627_005063_86_625 179
636 3300046460 Ga0495638_0005314 Ga0495638_0005314_8425_8964 179
637 3300046460 Ga0495638_0018313 Ga0495638_0018313_407_946 179
638 3300046460 Ga0495638_0226317 Ga0495638_0226317_219_758 179
639 3300046471 Ga0495650_0022697 Ga0495650_0022697_446_985 179
640 3300046477 Ga0495664_0053665 Ga0495664_0053665_1202_1741 179
641 3300046491 Ga0495584_0037163 Ga0495584_0037163_664_1203 179
642 3300046492 Ga0495585_0028235 Ga0495585_0028235_387_926 179
643 3300046499 Ga0495594_0536460 Ga0495594_0536460_69_608 179
644 3300046501 Ga0495607_0110863 Ga0495607_0110863_861_1400 179
645 3300046511 Ga0495608_0498007 Ga0495608_0498007_58_597 179
646 3300046513 Ga0495616_0005308 Ga0495616_0005308_5927_6466 179
647 3300046515 Ga0495620_0014162 Ga0495620_0014162_74_613 179
648 3300046518 Ga0495631_0000426 Ga0495631_0000426_6775_7314 179
649 3300046519 Ga0495632_0185450 Ga0495632_0185450_328_867 179
650 3300046520 Ga0495637_0009500 Ga0495637_0009500_1812_2351 179
651 3300046523 Ga0495644_0067625 Ga0495644_0067625_598_1137 179
652 3300046525 Ga0495663_0012053 Ga0495663_0012053_1309_1848 179
653 3300046530 Ga0495654_0004161 Ga0495654_0004161_6051_6590 179
654 3300046530 Ga0495654_0008510 Ga0495654_0008510_426_965 179
655 3300046530 Ga0495654_0066111 Ga0495654_0066111_179_718 179
656 3300046537 Ga0495598_0017539 Ga0495598_0017539_363_908 179
657 3300046538 Ga0495609_0053194 Ga0495609_0053194_859_1398 179
658 3300046539 Ga0495621_0011984 Ga0495621_0011984_978_1517 179
659 3300046539 Ga0495621_0031051 Ga0495621_0031051_570_1115 179
660 3300046558 Ga0495633_0005187 Ga0495633_0005187_3135_3674 179
661 3300046558 Ga0495633_0041997 Ga0495633_0041997_636_1175 179
662 3300046615 Ga0495656_0009763 Ga0495656_0009763_1954_2493 179
663 3300046615 Ga0495656_0021536 Ga0495656_0021536_960_1499 179
664 3300046616 Ga0495668_0316661 Ga0495668_0316661_241_780 179
665 3300046616 Ga0495668_0370607 Ga0495668_0370607_152_691 179
666 3300046648 Ga0495611_0049460 Ga0495611_0049460_641_1180 179
667 3300046648 Ga0495611_0155522 Ga0495611_0155522_515_1054 179
668 3300046660 Ga0495625_0000012 Ga0495625_0000012_133899_134438 179
669 3300046660 Ga0495625_0001388 Ga0495625_0001388_28827_29366 179
670 3300046660 Ga0495625_0068658 Ga0495625_0068658_701_1240 179
671 3300046660 Ga0495625_0761493 Ga0495625_0761493_11_550 179
672 3300046664 Ga0495659_0038268 Ga0495659_0038268_813_1352 179
673 3300046665 Ga0495661_0269118 Ga0495661_0269118_218_757 179
674 3300046674 Ga0495588_0007705 Ga0495588_0007705_3334_3873 179
675 3300046674 Ga0495588_0023899 Ga0495588_0023899_1346_1885 179
676 3300046674 Ga0495588_0081007 Ga0495588_0081007_648_1187 179
677 3300046674 Ga0495588_0087892 Ga0495588_0087892_385_924 179
678 3300046684 Ga0495669_0018324 Ga0495669_0018324_807_1346 179
679 3300046684 Ga0495669_0042218 Ga0495669_0042218_1420_1959 179
680 3300046691 Ga0495670_0017971 Ga0495670_0017971_2825_3364 179
681 3300046691 Ga0495670_0079404 Ga0495670_0079404_101_640 179
682 3300046691 Ga0495670_0227721 Ga0495670_0227721_401_940 179
683 3300046692 Ga0495671_0002982 Ga0495671_0002982_7479_8018 179
684 3300046794 Ga0495589_0188986 Ga0495589_0188986_218_757 179
685 3300046809 Ga0495600_0097520 Ga0495600_0097520_904_1443 179
686 3300046810 Ga0495660_0388902 Ga0495660_0388902_27_566 179
687 3300047318 Ga0495636_0052048 Ga0495636_0052048_1151_1690 179
688 3300047321 Ga0495676_0332960 Ga0495676_0332960_94_633 179
689 3300047322 Ga0495680_0418807 Ga0495680_0418807_278_817 179
690 3300047323 Ga0495683_0096630 Ga0495683_0096630_443_982 179
691 3300047469 Ga0495673_0218911 Ga0495673_0218911_85_624 179
692 3300047472 Ga0495686_0255704 Ga0495686_0255704_154_693 179
693 3300047673 Ga0495593_0381513 Ga0495593_0381513_50_589 179
694 3300048089 Ga0495614_0102385 Ga0495614_0102385_345_884 179
695 3300048904 Ga0496101_0043191 Ga0496101_0043191_715_1254 179
696 3300048904 Ga0496101_0109043 Ga0496101_0109043_1450_1989 179
697 3300048908 Ga0496105_0440522 Ga0496105_0440522_463_1002 179
698 3300048909 Ga0496106_0049526 Ga0496106_0049526_1603_2142 179
699 3300048910 Ga0496107_0043728 Ga0496107_0043728_1291_1830 179
700 3300048915 Ga0496112_0072397 Ga0496112_0072397_1150_1689 179
701 3300048916 Ga0496113_0300495 Ga0496113_0300495_255_809 179
702 3300048917 Ga0496114_0141505 Ga0496114_0141505_853_1392 179
703 3300048918 Ga0496115_0085401 Ga0496115_0085401_1566_2105 179
704 3300048918 Ga0496115_0703080 Ga0496115_0703080_93_632 179
705 3300048919 Ga0496116_0005026 Ga0496116_0005026_753_1292 179
706 3300048919 Ga0496116_0009110 Ga0496116_0009110_4094_4633 179
707 3300048919 Ga0496116_0011042 Ga0496116_0011042_5819_6358 179
708 3300048919 Ga0496116_0157799 Ga0496116_0157799_280_819 179
709 3300048919 Ga0496116_0399264 Ga0496116_0399264_60_599 179
710 3300048920 Ga0496117_0027239 Ga0496117_0027239_3414_3968 179
711 3300048920 Ga0496117_0166326 Ga0496117_0166326_85_624 179
712 3300048921 Ga0496118_0025220 Ga0496118_0025220_2014_2553 179
713 3300048921 Ga0496118_0047194 Ga0496118_0047194_2693_3232 179
714 3300048921 Ga0496118_0071103 Ga0496118_0071103_923_1477 179
715 3300048921 Ga0496118_0092192 Ga0496118_0092192_10_549 179
716 3300048922 Ga0496119_0010553 Ga0496119_0010553_5494_6033 179
717 3300048922 Ga0496119_0038228 Ga0496119_0038228_804_1343 179
718 3300048922 Ga0496119_0131515 Ga0496119_0131515_444_983 179
719 3300048923 Ga0496120_0010542 Ga0496120_0010542_3442_3981 179
720 3300048924 Ga0496121_0003228 Ga0496121_0003228_22770_23309 179
721 3300048924 Ga0496121_0004174 Ga0496121_0004174_15125_15664 179
722 3300048924 Ga0496121_0007031 Ga0496121_0007031_7022_7561 179
723 3300048924 Ga0496121_0035713 Ga0496121_0035713_1536_2075 179
724 3300048924 Ga0496121_0043094 Ga0496121_0043094_1459_1998 179
725 3300048924 Ga0496121_0087466 Ga0496121_0087466_1544_2083 179
726 3300048924 Ga0496121_0095864 Ga0496121_0095864_113_652 179
727 3300048924 Ga0496121_0134977 Ga0496121_0134977_951_1490 179
728 3300048924 Ga0496121_0140589 Ga0496121_0140589_1233_1772 179
729 3300048924 Ga0496121_0148902 Ga0496121_0148902_483_1022 179
730 3300048924 Ga0496121_0253681 Ga0496121_0253681_288_827 179
731 3300048924 Ga0496121_0496697 Ga0496121_0496697_104_643 179
732 3300048925 Ga0496122_0000077 Ga0496122_0000077_146334_146873 179
733 3300048925 Ga0496122_0003370 Ga0496122_0003370_669_1208 179
734 3300048925 Ga0496122_0024195 Ga0496122_0024195_2982_3536 179
735 3300048925 Ga0496122_0107506 Ga0496122_0107506_1125_1664 179
736 3300048926 Ga0496123_0000526 Ga0496123_0000526_41862_42401 179
737 3300048926 Ga0496123_0000532 Ga0496123_0000532_669_1208 179
738 3300048926 Ga0496123_0014659 Ga0496123_0014659_285_824 179
739 3300048926 Ga0496123_0101819 Ga0496123_0101819_168_707 179
740 3300048926 Ga0496123_0171543 Ga0496123_0171543_106_660 179
741 3300048927 Ga0496124_0000038 Ga0496124_0000038_45893_46432 179
742 3300048927 Ga0496124_0013537 Ga0496124_0013537_7294_7833 179
743 3300048927 Ga0496124_0040457 Ga0496124_0040457_1353_1892 179
744 3300048927 Ga0496124_0085351 Ga0496124_0085351_1541_2080 179
745 3300048927 Ga0496124_0385393 Ga0496124_0385393_402_941 179
746 3300048927 Ga0496124_0581560 Ga0496124_0581560_85_624 179
747 3300048927 Ga0496124_0669292 Ga0496124_0669292_41_595 179
748 3300048928 Ga0496125_0000146 Ga0496125_0000146_79688_80227 179
749 3300048928 Ga0496125_0014183 Ga0496125_0014183_6931_7470 179
750 3300048928 Ga0496125_0020425 Ga0496125_0020425_4959_5498 179
751 3300048928 Ga0496125_0031633 Ga0496125_0031633_176_715 179
752 3300048928 Ga0496125_0129021 Ga0496125_0129021_931_1470 179
753 3300048928 Ga0496125_0135356 Ga0496125_0135356_472_1011 179
754 3300048928 Ga0496125_0149719 Ga0496125_0149719_888_1427 179
755 3300048929 Ga0496126_0034370 Ga0496126_0034370_3257_3796 179
756 3300048929 Ga0496126_0083303 Ga0496126_0083303_1743_2297 179
757 3300048929 Ga0496126_0102158 Ga0496126_0102158_806_1345 179
758 3300048929 Ga0496126_0123711 Ga0496126_0123711_532_1071 179
759 3300048929 Ga0496126_0156364 Ga0496126_0156364_150_689 179
760 3300049568 Ga0501031_0039093 Ga0501031_0039093_1520_2059 179
761 3300049568 Ga0501031_0132321 Ga0501031_0132321_676_1215 179
762 3300049569 Ga0501032_0025218 Ga0501032_0025218_1326_1865 179
763 3300049569 Ga0501032_0127623 Ga0501032_0127623_1099_1638 179
764 3300049570 Ga0501033_0005437 Ga0501033_0005437_3267_3806 179
765 3300049570 Ga0501033_0089147 Ga0501033_0089147_1416_1955 179
766 3300049570 Ga0501033_0265988 Ga0501033_0265988_459_998 179
767 3300049571 Ga0501034_0197076 Ga0501034_0197076_26_565 179
768 3300049572 Ga0501036_0273615 Ga0501036_0273615_656_1195 179
769 3300049573 Ga0501037_0002062 Ga0501037_0002062_7481_8020 179
770 3300049574 Ga0501038_0097217 Ga0501038_0097217_1435_1974 179
771 3300049574 Ga0501038_0103052 Ga0501038_0103052_311_850 179
772 3300049575 Ga0501039_0284805 Ga0501039_0284805_247_786 179
773 3300049579 Ga0501043_0000045 Ga0501043_0000045_106496_107035 179
774 3300049579 Ga0501043_0081497 Ga0501043_0081497_1534_2073 179
775 3300049579 Ga0501043_0802061 Ga0501043_0802061_68_607 179
776 3300049581 Ga0501047_0009582 Ga0501047_0009582_3961_4500 179
777 3300049581 Ga0501047_0101205 Ga0501047_0101205_824_1363 179
778 3300049584 Ga0501068_0064102 Ga0501068_0064102_1620_2159 179
779 3300049585 Ga0501069_0000007 Ga0501069_0000007_56968_57507 179
780 3300049587 Ga0501071_0018353 Ga0501071_0018353_1949_2488 179
781 3300049589 Ga0501073_0063290 Ga0501073_0063290_104_643 179
782 3300049590 Ga0501074_0000248 Ga0501074_0000248_10383_10922 179
783 3300049592 Ga0501076_1015289 Ga0501076_1015289_36_575 179
784 3300049686 Ga0501257_044790 Ga0501257_044790_486_1025 179
785 3300049704 Ga0501221_054557 Ga0501221_054557_119_658 179
786 3300049741 Ga0501079_0933273 Ga0501079_0933273_91_630 179
787 3300049742 Ga0501080_0003117 Ga0501080_0003117_3488_4027 179
788 3300049744 Ga0501083_0000029 Ga0501083_0000029_4390_4929 179
789 3300049759 Ga0501262_000279 Ga0501262_000279_162_701 179
790 3300049822 Ga0501035_0000274 Ga0501035_0000274_3808_4347 179
791 3300049822 Ga0501035_0006148 Ga0501035_0006148_1868_2407 179
792 3300049822 Ga0501035_0023999 Ga0501035_0023999_4515_5054 179
793 3300049822 Ga0501035_0042149 Ga0501035_0042149_217_756 179
794 3300049822 Ga0501035_0358454 Ga0501035_0358454_71_610 179
795 3300049823 Ga0501044_0000009 Ga0501044_0000009_56952_57491 179
796 3300049823 Ga0501044_0000589 Ga0501044_0000589_25046_25585 179
797 3300049823 Ga0501044_0009703 Ga0501044_0009703_8090_8629 179
798 3300049823 Ga0501044_0013376 Ga0501044_0013376_4067_4606 179
799 3300050489 nmdc:mga03683_1317_c2 nmdc:mga03683_1317_c2_1211_1750 179
800 3300050489 nmdc:mga03683_160396_c1 nmdc:mga03683_160396_c1_247_786 179
801 3300050489 nmdc:mga03683_49227_c1 nmdc:mga03683_49227_c1_337_876 179
802 3300050490 nmdc:mga03n38_412382_c1 nmdc:mga03n38_412382_c1_69_611 179
803 3300050491 nmdc:mga00v17_39821_c1 nmdc:mga00v17_39821_c1_2176_2715 179
804 3300050491 nmdc:mga00v17_6892_c1 nmdc:mga00v17_6892_c1_4321_4860 179
805 3300050491 nmdc:mga00v17_689386_c1 nmdc:mga00v17_689386_c1_102_644 179
806 3300050492 nmdc:mga0yw44_251103_c1 nmdc:mga0yw44_251103_c1_238_777 179
807 3300050492 nmdc:mga0yw44_28608_c1 nmdc:mga0yw44_28608_c1_2178_2717 179
808 3300050492 nmdc:mga0yw44_769_c1 nmdc:mga0yw44_769_c1_4629_5168 179
809 3300050492 nmdc:mga0yw44_899063_c1 nmdc:mga0yw44_899063_c1_47_586 179
810 3300050493 nmdc:mga0k408_174581_c1 nmdc:mga0k408_174581_c1_315_854 179
811 3300050493 nmdc:mga0k408_174613_c1 nmdc:mga0k408_174613_c1_441_980 179
812 3300050493 nmdc:mga0k408_197265_c1 nmdc:mga0k408_197265_c1_153_692 179
813 3300050493 nmdc:mga0k408_45743_c1 nmdc:mga0k408_45743_c1_1657_2196 179
814 3300050494 nmdc:mga06z11_692780_c1 nmdc:mga06z11_692780_c1_67_606 179
815 3300050495 nmdc:mga04h51_81353_c1 nmdc:mga04h51_81353_c1_390_929 179
816 3300050496 nmdc:mga07m45_13404_c1 nmdc:mga07m45_13404_c1_1384_1923 179
817 3300050496 nmdc:mga07m45_28732_c1 nmdc:mga07m45_28732_c1_2226_2765 179
818 3300050496 nmdc:mga07m45_3854_c1 nmdc:mga07m45_3854_c1_2014_2553 179
819 3300050496 nmdc:mga07m45_397137_c1 nmdc:mga07m45_397137_c1_94_633 179
820 3300050516 nmdc:mga0sz30_107066_c1 nmdc:mga0sz30_107066_c1_208_747 179
821 3300050516 nmdc:mga0sz30_192608_c1 nmdc:mga0sz30_192608_c1_69_608 179
822 3300050516 nmdc:mga0sz30_29700_c1 nmdc:mga0sz30_29700_c1_32_571 179
823 3300053077 Ga0495601_0421057 Ga0495601_0421057_78_617 179
824 3300053079 Ga0500610_0000021 Ga0500610_0000021_65252_65791 179
825 3300053079 Ga0500610_0000677 Ga0500610_0000677_9433_9972 179
826 3300053086 Ga0500578_0557896 Ga0500578_0557896_59_598 179
827 3300053087 Ga0500643_100658 Ga0500643_100658_168_707 179
828 3300053088 Ga0500644_0005021 Ga0500644_0005021_1439_1978 179
829 3300053088 Ga0500644_0315107 Ga0500644_0315107_50_589 179
830 3300053090 Ga0500646_0000478 Ga0500646_0000478_1345_1884 179
831 3300053092 Ga0500583_0011112 Ga0500583_0011112_253_792 179
832 3300053092 Ga0500583_0044618 Ga0500583_0044618_1326_1865 179
833 3300053096 Ga0500641_0059377 Ga0500641_0059377_829_1368 179
834 3300053096 Ga0500641_0079698 Ga0500641_0079698_10_549 179
835 3300053108 Ga0500562_150293 Ga0500562_150293_75_614 179
836 3300053111 Ga0500572_165161 Ga0500572_165161_95_634 179
837 3300053117 Ga0500593_001100 Ga0500593_001100_5466_6005 179
838 3300053117 Ga0500593_013505 Ga0500593_013505_2075_2614 179
839 3300053118 Ga0500594_0000449 Ga0500594_0000449_3025_3564 179
840 3300053119 Ga0500595_108028 Ga0500595_108028_193_732 179
841 3300053122 Ga0500608_001832 Ga0500608_001832_4375_4914 179
842 3300053122 Ga0500608_038603 Ga0500608_038603_59_598 179
843 3300053125 Ga0500618_000391 Ga0500618_000391_29220_29759 179
844 3300053125 Ga0500618_001954 Ga0500618_001954_3661_4200 179
845 3300053130 Ga0500642_0037600 Ga0500642_0037600_1520_2059 179
846 3300053134 Ga0500658_0000058 Ga0500658_0000058_47806_48345 179
847 3300053139 Ga0500568_0001884 Ga0500568_0001884_6948_7487 179
848 3300053139 Ga0500568_0062986 Ga0500568_0062986_359_898 179
849 3300053141 Ga0500574_000542 Ga0500574_000542_340_879 179
850 3300053146 Ga0500588_0126387 Ga0500588_0126387_167_706 179
851 3300053151 Ga0500604_0221116 Ga0500604_0221116_39_578 179
852 3300053153 Ga0500616_0046055 Ga0500616_0046055_1492_2031 179
853 3300053153 Ga0500616_0102948 Ga0500616_0102948_819_1358 179
854 3300053153 Ga0500616_0238596 Ga0500616_0238596_161_700 179
855 3300053156 Ga0500622_0035326 Ga0500622_0035326_1542_2081 179
856 3300053156 Ga0500622_0262419 Ga0500622_0262419_83_622 179
857 3300053158 Ga0500627_0000142 Ga0500627_0000142_749_1288 179
858 3300053161 Ga0500634_0015233 Ga0500634_0015233_1445_1984 179
859 3300053177 Ga0500636_0029969 Ga0500636_0029969_208_747 179
860 3300053178 Ga0500637_0181325 Ga0500637_0181325_11_550 179
861 3300053730 Ga0500645_000346 Ga0500645_000346_25671_26210 179
862 3300053730 Ga0500645_005752 Ga0500645_005752_548_1087 179
863 3300053730 Ga0500645_017058 Ga0500645_017058_1361_1900 179
864 3300055283 Ga0500661_002516 Ga0500661_002516_2084_2623 179
865 3300060353 Ga0501082_0029493 Ga0501082_0029493_2630_3169 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

9

134

0.87

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

7

155

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gm5-assembly1.cif.gz_A-2 crystal structure of a putative methylmalonyl-coenzyme a epimerase from thermoanaerobacter tengcongensis at 2.0 a resolution 0.8274 1 145
3gm5-assembly1.cif.gz_A-2 crystal structure of a putative methylmalonyl-coenzyme a epimerase from thermoanaerobacter tengcongensis at 2.0 a resolution 0.7865 1 145
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.7596 7 145
6qh4-assembly2.cif.gz_B crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.73 5 145
6qh4-assembly1.cif.gz_C crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.7224 1 145
ID Description Score Start End Superfamily
3gm5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8274 1 145 3.10.180.10
3gm5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7865 1 145 3.10.180.10
2r5vB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7804 7 145 3.10.180.10
af_Q18347_1_154_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7697 6 146 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7596 7 145 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A329P7R1-F1-model_v4 deleted 0.9818 1 133
AF-A0A4Q3N796-F1-model_v4 deleted 0.9747 1 76
AF-A0A329P7R1-F1-model_v4 deleted 0.9746 1 133
AF-A0A519I1X2-F1-model_v4 VOC family protein 0.9711 12 179 GO:0004493
GO:0046491
GO:0046872
AF-A0A4Q7VSJ2-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein 0.971 1 179 GO:0004493
GO:0046491
GO:0046872
GO:0051213

Feature Viewer

pLDDT pTM Quality
93.45 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map