F483898

General Info

Members Datasets Scaffolds Average Seq Length
862 381 812 254

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0041819|Ga0496116_0041819_1919_2764
Length 281
Sequence VFRIVFALPPIIRMNMTLSRRSMAEPRPETSLRTRAARSTGEGAAFSPLYRQIKDLLVQSLERGEWKPGELIPSEIDLAARFQVSQGTVRKAVDELAAEHMLLRRQGKGTFVATHHEARVRYRFLRLAADEEGEPGRAESRILECRRLRAPAEIARALDLRAGETVVMIRRLLSMGQTPTVVDDIWLPGSIFRGLTLELLTANKAPLYGLFESEFGVSMVRADEKLRAVIAPAEVCPLLNVPAGTPLLQVDRVSYTYGDRPMEIRRGLYLTDRYHYRNSLN

Samples

Sample ID Description Type Environment
1 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
2 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
3 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
4 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
5 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
6 2643221569 Achromobacter sp. Root565 Isolate Unclassified
7 2643221594 Achromobacter sp. Root170 Isolate Unclassified
8 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
9 2643221621 Achromobacter sp. Root83 Isolate Unclassified
10 2643221638 Duganella sp. Root336D2 Isolate Unclassified
11 2643221645 Massilia sp. Root351 Isolate Unclassified
12 2643221664 Massilia sp. Root418 Isolate Unclassified
13 2738541280 Massilia sp. GV090 Isolate Unclassified
14 2738541300 Massilia sp. GV016 Isolate Unclassified
15 2738541357 Duganella sp. GV053 Isolate Unclassified
16 2738543003 Duganella sp. GV066 Isolate Unclassified
17 2738543018 Massilia sp. GV045 Isolate Unclassified
18 2738543026 Duganella sp. GV089 Isolate Unclassified
19 2738543029 Duganella sp. GV039 Isolate Unclassified
20 2738543030 Massilia sp. GV097 Isolate Unclassified
21 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
22 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
23 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
24 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
25 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
26 2821131069 Duganella sp. 1224 Isolate Unclassified
27 2855730933 Achromobacter sp. HZ28 Isolate Nodule
28 2855767633 Achromobacter sp. HZ34 Isolate Nodule
29 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
30 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
31 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
32 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
33 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
34 2857558681 Duganella sp. R-74565 Isolate Unclassified
35 2857564685 Duganella sp. R-74599 Isolate Unclassified
36 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
37 2858950400 Achromobacter sp. K91 Isolate Unclassified
38 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
39 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
40 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
41 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
42 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
43 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
44 2919476304 Duganella sp. 3397 Isolate Unclassified
45 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
46 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
47 2941479691
48 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
49 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
50 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
51 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
52 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
53 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
54 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
55 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
56 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
57 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
58 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
59 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
60 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
61 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
62 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
63 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
65 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
66 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
67 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
68 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
69 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
70 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
71 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
72 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
73 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
74 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
75 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
76 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
77 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
78 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
79 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
80 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
81 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
82 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
107 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
108 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
128 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
129 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
134 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
135 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
136 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
137 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
138 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
147 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
169 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
175 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
176 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
177 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
178 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
184 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
185 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
199 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
200 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
203 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
206 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
207 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
216 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
224 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
225 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
231 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
234 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
235 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
236 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
237 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
238 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
239 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
240 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
241 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
242 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
243 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
244 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
248 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
249 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
250 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
251 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
252 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
253 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
254 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
255 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
258 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
259 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
260 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
263 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
264 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
265 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
266 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
267 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
268 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
269 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
270 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
271 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
272 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
275 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
276 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
277 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
278 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
279 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
280 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
281 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
282 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
283 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
284 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
285 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
286 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
287 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
288 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
289 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
290 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
291 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
297 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
298 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
299 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
300 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
301 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
302 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
303 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
304 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
305 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
306 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
307 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
308 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
309 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
327 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
328 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
329 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
330 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
331 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
332 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
333 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
334 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
335 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
336 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
337 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
338 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
339 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
354 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
355 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
356 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
357 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
358 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
359 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
361 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
362 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
363 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
364 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
365 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
366 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
367 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
368 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
369 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
370 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
371 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
372 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
373 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
374 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
375 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
376 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere
377 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
379 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
380 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
381 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.62
Metatranscriptomes 0.58
Isolates 5.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.88
Nodule 0.7
Rhizoplane 5.22
Rhizosphere 69.95
Stem 0
Stem Tuber 0
Unclassified 11.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000708 3300002067 Bacteria 11803
2 JGI24735J21928_10000719 3300002067 Bacteria 11750
3 JGI25154J39366_1000747 3300002738 Bacteria 14585
4 JGI25158J39367_1008480 3300002739 Bacteria 1428
5 JGI25158J39367_1016487 3300002739 Bacteria 934
6 JGI25152J39213_1002923 3300002773 Bacteria 6090
7 JGI25159J45721_1006004 3300002987 Bacteria 3711
8 JGI25159J45721_1007311 3300002987 Bacteria 3177
9 JGI25159J45721_1015535 3300002987 Bacteria 1663
10 JGI25151J46595_10000754 3300003187 Bacteria 26355
11 JGI25153J46596_10031865 3300003215 Bacteria 1767
12 rootH1_10036699 3300003316 Bacteria 2062
13 rootH2_10077414 3300003320 Bacteria 2003
14 rootH1_10083808 3300003323 Bacteria 1180
15 JGI25160J50197_1003901 3300003354 Bacteria 6536
16 JGI25161J50226_1004022 3300003374 Bacteria 3177
17 JGI25161J50226_1008087 3300003374 Bacteria 1663
18 Ga0007417J51691_1043165 3300003544 Bacteria 2513
19 Ga0007409J51694_1012205 3300003575 Bacteria 6710
20 Ga0007416J51690_1016785 3300003577 Bacteria 6700
21 Ga0032354_1025073 3300003693 Bacteria 6712
22 Ga0055529_1000095 3300003763 Bacteria 134030
23 Ga0055529_1000980 3300003763 Bacteria 14245
24 Ga0055526_1000066 3300003771 Bacteria 101329
25 Ga0055526_1004314 3300003771 Bacteria 8592
26 Ga0055526_1007455 3300003771 Bacteria 5679
27 Ga0055537_1001124 3300003773 Bacteria 11528
28 Ga0055537_1004930 3300003773 Bacteria 3690
29 Ga0055524_1001075 3300003775 Bacteria 16780
30 Ga0055524_1010843 3300003775 Bacteria 3603
31 Ga0055524_1047124 3300003775 Bacteria 1018
32 Ga0055524_1047152 3300003775 Bacteria 1018
33 Ga0055534_1001481 3300003784 Bacteria 9319
34 Ga0055534_1001729 3300003784 Bacteria 8261
35 Ga0055528_1000089 3300003790 Bacteria 72690
36 Ga0055528_1004116 3300003790 Bacteria 7090
37 Ga0055530_10020486 3300003791 Bacteria 1974
38 Ga0055531_10013188 3300003794 Bacteria 3830
39 Ga0055531_10027502 3300003794 Bacteria 1993
40 Ga0055543_1009953 3300004625 Bacteria 2016
41 Ga0055543_1009954 3300004625 Bacteria 2016
42 Ga0055543_1017203 3300004625 Bacteria 1363
43 Ga0065165_1006735 3300005262 Bacteria 5892
44 Ga0065165_1031911 3300005262 Bacteria 1658
45 Ga0070658_10054369 3300005327 Bacteria 3251
46 Ga0070682_100003516 3300005337 Bacteria 8669
47 Ga0070682_100190768 3300005337 Bacteria 1439
48 Ga0070660_100001488 3300005339 Bacteria 16033
49 Ga0070660_100074357 3300005339 Bacteria 2658
50 Ga0070661_100003676 3300005344 Bacteria 10569
51 Ga0070675_100133398 3300005354 Bacteria 2118
52 Ga0070659_100032204 3300005366 Bacteria 4065
53 Ga0070701_10039430 3300005438 Bacteria 2396
54 Ga0070663_100051650 3300005455 Bacteria 2930
55 Ga0070698_100588188 3300005471 Bacteria 1053
56 Ga0070679_100223171 3300005530 Bacteria 1845
57 Ga0068853_100029851 3300005539 Bacteria 4600
58 Ga0070693_100239355 3300005547 Bacteria 1198
59 Ga0068855_100009698 3300005563 Bacteria 11623
60 Ga0068855_100301870 3300005563 Bacteria 1773
61 Ga0070664_100018147 3300005564 Bacteria 5775
62 Ga0068857_100219076 3300005577 Bacteria 1738
63 Ga0068852_100011442 3300005616 Bacteria 6680
64 Ga0068859_100058550 3300005617 Bacteria 3881
65 Ga0068851_10003355 3300005834 Bacteria 7121
66 Ga0068860_100617989 3300005843 Bacteria 1090
67 Ga0075365_10064714 3300006038 Bacteria 2450
68 Ga0075368_10030698 3300006042 Bacteria 2081
69 Ga0075364_10000886 3300006051 Bacteria 15806
70 Ga0075364_10001152 3300006051 Bacteria 14128
71 Ga0075364_10001980 3300006051 Bacteria 11417
72 Ga0075364_10087594 3300006051 Bacteria 2064
73 Ga0075364_10341785 3300006051 Bacteria 1020
74 Ga0075432_10030849 3300006058 Bacteria 1854
75 Ga0070716_100063383 3300006173 Bacteria 2146
76 Ga0075362_10202969 3300006177 Bacteria 965
77 Ga0075367_10022549 3300006178 Bacteria 3533
78 Ga0075366_10042195 3300006195 Bacteria 2701
79 Ga0097621_100021443 3300006237 Bacteria 4998
80 Ga0075370_10161447 3300006353 Bacteria 1315
81 Ga0068871_100073517 3300006358 Bacteria 2818
82 Ga0075428_100041048 3300006844 Bacteria 5089
83 Ga0097620_100058551 3300006931 Bacteria 3881
84 Ga0099826_10000001 3300006948 Bacteria 1155201
85 Ga0105251_10015012 3300009011 Bacteria 4250
86 Ga0105244_10006792 3300009036 Bacteria 7359
87 Ga0105244_10013139 3300009036 Bacteria 4851
88 Ga0105240_10010653 3300009093 Bacteria 12910
89 Ga0105240_10043233 3300009093 Bacteria 5734
90 Ga0105240_10096722 3300009093 Bacteria 3598
91 Ga0105240_10211287 3300009093 Bacteria 2267
92 Ga0111539_10000107 3300009094 Bacteria 89993
93 Ga0111539_10001299 3300009094 Bacteria 33371
94 Ga0105245_10421619 3300009098 Bacteria 1338
95 Ga0105248_10088952 3300009177 Bacteria 3476
96 Ga0105237_10012467 3300009545 Bacteria 8959
97 Ga0105238_10226557 3300009551 Bacteria 1846
98 Ga0105238_10705511 3300009551 Bacteria 1021
99 Ga0105239_10016723 3300010375 Bacteria 8108
100 Ga0157373_10006691 3300013100 Bacteria 8582
101 Ga0157371_10000001 3300013102 Bacteria 1162285
102 Ga0157371_10233358 3300013102 Bacteria 1323
103 Ga0157370_10002758 3300013104 Bacteria 20991
104 Ga0157369_10038628 3300013105 Bacteria 5219
105 Ga0157369_10247455 3300013105 Bacteria 1861
106 Ga0157374_10000081 3300013296 Bacteria 95406
107 Ga0157374_10104290 3300013296 Bacteria 2722
108 Ga0157374_10189232 3300013296 Bacteria 2013
109 Ga0163162_10203933 3300013306 Bacteria 2107
110 Ga0163162_10358257 3300013306 Bacteria 1592
111 Ga0157372_10008688 3300013307 Bacteria 10787
112 Ga0182006_1000002 3300015261 Bacteria 887990
113 Ga0182006_1000117 3300015261 Bacteria 85963
114 Ga0182006_1059580 3300015261 Bacteria 1445
115 Ga0182007_10000045 3300015262 Bacteria 106028
116 Ga0182007_10033599 3300015262 Bacteria 1737
117 Ga0182005_1000002 3300015265 Bacteria 908499
118 Ga0182005_1000041 3300015265 Bacteria 150123
119 Ga0163161_10057149 3300017792 Bacteria 2835
120 Ga0163161_10104398 3300017792 Bacteria 2112
121 Ga0163161_10420463 3300017792 Bacteria 1075
122 Ga0213872_10002205 3300021361 Bacteria 11672
123 Ga0213872_10010040 3300021361 Bacteria 4517
124 Ga0213872_10059969 3300021361 Bacteria 1721
125 Ga0209435_105127 3300025206 Bacteria 1471
126 Ga0209436_101177 3300025208 Bacteria 9625
127 Ga0209672_100248 3300025228 Bacteria 40285
128 Ga0209672_103946 3300025228 Bacteria 2894
129 Ga0209437_102900 3300025233 Bacteria 3204
130 Ga0209258_105681 3300025242 Bacteria 2071
131 Ga0207425_1000001 3300025245 Bacteria 2525432
132 Ga0207425_1000479 3300025245 Bacteria 25399
133 Ga0207425_1001380 3300025245 Bacteria 10272
134 Ga0207425_1022812 3300025245 Bacteria 1315
135 Ga0209646_1000010 3300025246 Bacteria 573803
136 Ga0209026_1004031 3300025250 Bacteria 4549
137 Ga0209759_1001733 3300025256 Bacteria 11218
138 Ga0209759_1023697 3300025256 Bacteria 1344
139 Ga0209129_1000001 3300025258 Bacteria 1452436
140 Ga0209565_1000009 3300025263 Bacteria 751701
141 Ga0209565_1001770 3300025263 Bacteria 8775
142 Ga0209565_1003171 3300025263 Bacteria 5464
143 Ga0209565_1010035 3300025263 Bacteria 2366
144 Ga0209565_1019027 3300025263 Bacteria 1474
145 Ga0209455_1000121 3300025272 Bacteria 173350
146 Ga0209455_1000305 3300025272 Bacteria 50363
147 Ga0209673_1000019 3300025273 Bacteria 449094
148 Ga0209673_1004672 3300025273 Bacteria 7229
149 Ga0209130_1001997 3300025284 Bacteria 11153
150 Ga0209130_1003045 3300025284 Bacteria 7558
151 Ga0209675_1000028 3300025291 Bacteria 281253
152 Ga0209675_1001513 3300025291 Bacteria 13295
153 Ga0209675_1015107 3300025291 Bacteria 2311
154 Ga0209676_1006174 3300025292 Bacteria 6001
155 Ga0209025_1000040 3300025294 Bacteria 376228
156 Ga0209025_1007797 3300025294 Bacteria 7874
157 Ga0209564_1000009 3300025295 Bacteria 950196
158 Ga0209564_1000033 3300025295 Bacteria 446200
159 Ga0209564_1000058 3300025295 Bacteria 332955
160 Ga0209564_1002185 3300025295 Bacteria 16412
161 Ga0209564_1005493 3300025295 Bacteria 7208
162 Ga0209758_1000116 3300025297 Bacteria 198356
163 Ga0209758_1000842 3300025297 Bacteria 42797
164 Ga0209050_1002447 3300025298 Bacteria 15918
165 Ga0209050_1006232 3300025298 Bacteria 7145
166 Ga0209256_1000005 3300025299 Bacteria 1315082
167 Ga0209256_1000052 3300025299 Bacteria 299374
168 Ga0209256_1000872 3300025299 Bacteria 37384
169 Ga0209256_1015166 3300025299 Bacteria 2715
170 Ga0209256_1046659 3300025299 Bacteria 1070
171 Ga0207426_1002443 3300025302 Bacteria 11859
172 Ga0207426_1018276 3300025302 Bacteria 2473
173 Ga0207426_1043648 3300025302 Bacteria 1376
174 Ga0209051_1030316 3300025303 Bacteria 2101
175 Ga0209257_1000107 3300025304 Bacteria 240937
176 Ga0207656_10029214 3300025321 Bacteria 2269
177 Ga0207713_1014316 3300025735 Bacteria 4130
178 Ga0207647_10000377 3300025904 Bacteria 36280
179 Ga0207647_10011303 3300025904 Bacteria 6267
180 Ga0207695_10050171 3300025913 Bacteria 4392
181 Ga0207695_10244596 3300025913 Bacteria 1694
182 Ga0207671_10048109 3300025914 Bacteria 3156
183 Ga0207671_10130312 3300025914 Bacteria 1930
184 Ga0207657_10003157 3300025919 Bacteria 17624
185 Ga0207657_10006756 3300025919 Bacteria 11851
186 Ga0207649_10002906 3300025920 Bacteria 9428
187 Ga0207659_10137954 3300025926 Bacteria 1890
188 Ga0207690_10020255 3300025932 Bacteria 4107
189 Ga0207665_10113327 3300025939 Bacteria 1908
190 Ga0207711_10025198 3300025941 Bacteria 4990
191 Ga0207679_10001073 3300025945 Bacteria 17411
192 Ga0207667_10009877 3300025949 Bacteria 11200
193 Ga0207667_10315435 3300025949 Bacteria 1597
194 Ga0207639_10021597 3300026041 Bacteria 4626
195 Ga0207674_10124466 3300026116 Bacteria 2544
196 Ga0207698_10009505 3300026142 Bacteria 6203
197 Ga0209282_1000001 3300027666 Bacteria 2450367
198 Ga0209813_10021743 3300027866 Bacteria 1807
199 Ga0207428_10000040 3300027907 Bacteria 210887
200 Ga0207428_10007402 3300027907 Bacteria 10011
201 Ga0268264_10484293 3300028381 Bacteria 1204
202 Ga0265336_10000151 3300028666 Bacteria 49239
203 Ga0307515_10204967 3300028794 Bacteria 1836
204 Ga0265324_10000001 3300029957 Bacteria 562975
205 Ga0265324_10067957 3300029957 Bacteria 1215
206 Ga0268256_1022011 3300030500 Bacteria 1682
207 Ga0316180_1030800 3300030736 Bacteria 6023
208 Ga0316181_1157853 3300030744 Bacteria 2409
209 Ga0265325_10000046 3300031241 Bacteria 83850
210 Ga0265327_10001290 3300031251 Bacteria 32882
211 Ga0307408_100010634 3300031548 Bacteria 6071
212 Ga0307408_100054958 3300031548 Bacteria 2880
213 Ga0307408_100178407 3300031548 Bacteria 1701
214 Ga0316575_10012821 3300031665 Bacteria 3125
215 Ga0265314_10029905 3300031711 Bacteria 4041
216 Ga0316576_10006838 3300031727 Bacteria 7128
217 Ga0316577_10040651 3300031733 Bacteria 2601
218 Ga0307518_10005417 3300031838 Bacteria 9125
219 Ga0307412_10012228 3300031911 Bacteria 4994
220 Ga0307414_10086664 3300032004 Bacteria 2311
221 Ga0307414_10126035 3300032004 Bacteria 1979
222 Ga0307414_10378650 3300032004 Bacteria 1223
223 Ga0316574_0001661 3300035398 Bacteria 10714
224 Ga0316574_0040301 3300035398 Bacteria 2876
225 Ga0373927_0086727 3300035695 Bacteria 2032
226 Ga0373947_0089646 3300035725 Bacteria 1916
227 Ga0316584_0408033 3300036712 Unclassified 967
228 Ga0373925_0015424 3300037068 Bacteria 5525
229 Ga0395899_0000028 3300037312 Bacteria 334378
230 Ga0395899_0013076 3300037312 Bacteria 6347
231 Ga0395899_0017856 3300037312 Bacteria 5402
232 Ga0395900_0025979 3300037418 Bacteria 5996
233 Ga0395900_0085072 3300037418 Bacteria 3250
234 Ga0395900_0101287 3300037418 Bacteria 2958
235 Ga0395900_0761271 3300037418 Bacteria 898
236 Ga0395898_0036464 3300037466 Bacteria 4882
237 Ga0395905_0041046 3300037471 Bacteria 4341
238 Ga0395905_0068788 3300037471 Bacteria 3317
239 Ga0395905_0139357 3300037471 Bacteria 2282
240 Ga0395905_0235480 3300037471 Bacteria 1712
241 Ga0395901_0027154 3300038443 Bacteria 5880
242 Ga0395901_0033321 3300038443 Bacteria 5318
243 Ga0395901_0098516 3300038443 Bacteria 3065
244 Ga0395901_0228169 3300038443 Bacteria 1945
245 Ga0400489_50965 3300039093 Bacteria 2963
246 Ga0400487_55311 3300039110 Bacteria 1709
247 Ga0436361_0031202 3300039447 Bacteria 17500
248 Ga0436361_0139948 3300039447 Bacteria 3190
249 Ga0436361_0404930 3300039447 Bacteria 2737
250 Ga0436361_0834273 3300039447 Bacteria 2222
251 Ga0436361_0974268 3300039447 Bacteria 66829
252 Ga0439448_0007230 3300042005 Bacteria 3212
253 Ga0450897_001563 3300042128 Bacteria 1576
254 Ga0450904_001501 3300042139 Bacteria 3221
255 Ga0451577_0013625 3300042876 Bacteria 7603
256 Ga0451577_0044750 3300042876 Bacteria 3962
257 Ga0451577_0046163 3300042876 Bacteria 3897
258 Ga0451577_0479241 3300042876 Bacteria 1129
259 Ga0466969_0008614 3300044656 Bacteria 5410
260 Ga0466969_0053685 3300044656 Bacteria 1976
261 Ga0466972_0000192 3300044658 Bacteria 47005
262 Ga0466972_0043587 3300044658 Bacteria 2178
263 Ga0466973_0083952 3300044659 Bacteria 2775
264 Ga0453683_0018493 3300044673 Bacteria 4475
265 Ga0453683_0171527 3300044673 Bacteria 1374
266 Ga0453683_0192197 3300044673 Bacteria 1295
267 Ga0466965_0001849 3300044683 Bacteria 8798
268 Ga0466966_0009507 3300044684 Bacteria 6437
269 Ga0466966_0062085 3300044684 Bacteria 2356
270 Ga0466961_0030473 3300044693 Bacteria 3467
271 Ga0466961_0049598 3300044693 Bacteria 2682
272 Ga0466963_0000942 3300044694 Bacteria 14885
273 Ga0466964_0005338 3300044706 Bacteria 4772
274 Ga0466964_0038970 3300044706 Bacteria 1912
275 Ga0453684_0051919 3300044712 Bacteria 5367
276 Ga0453684_0077881 3300044712 Bacteria 4151
277 Ga0453684_0086145 3300044712 Bacteria 3899
278 Ga0453684_0150202 3300044712 Bacteria 2770
279 Ga0453684_0161015 3300044712 Bacteria 2655
280 Ga0453684_0220431 3300044712 Bacteria 2198
281 Ga0453684_0361886 3300044712 Bacteria 1633
282 Ga0453684_0602684 3300044712 Bacteria 1204
283 Ga0466971_0005212 3300044719 Bacteria 5627
284 Ga0466968_0192437 3300044735 Bacteria 952
285 Ga0466970_0002958 3300044765 Bacteria 8237
286 Ga0466957_0007250 3300044842 Bacteria 6266
287 Ga0466959_0015021 3300045049 Bacteria 5642
288 Ga0451576_0013616 3300045051 Bacteria 9091
289 Ga0451576_0018250 3300045051 Bacteria 7693
290 Ga0451576_0308673 3300045051 Bacteria 1655
291 Ga0451576_0422582 3300045051 Bacteria 1398
292 Ga0466958_0002486 3300045836 Bacteria 9280
293 Ga0466967_0130670 3300045976 Bacteria 2331
294 Ga0495617_000029 3300046452 Bacteria 153239
295 Ga0495617_000049 3300046452 Bacteria 113032
296 Ga0495617_010347 3300046452 Bacteria 3196
297 Ga0495617_010848 3300046452 Bacteria 3119
298 Ga0495617_060263 3300046452 Bacteria 1256
299 Ga0495627_000055 3300046453 Bacteria 149482
300 Ga0495627_002501 3300046453 Bacteria 8772
301 Ga0495627_050932 3300046453 Bacteria 1246
302 Ga0495590_0000003 3300046457 Bacteria 478593
303 Ga0495590_0003715 3300046457 Bacteria 6215
304 Ga0495590_0052106 3300046457 Bacteria 1430
305 Ga0495629_0012395 3300046459 Bacteria 6173
306 Ga0495629_0017554 3300046459 Bacteria 5129
307 Ga0495629_0019645 3300046459 Bacteria 4824
308 Ga0495629_0094384 3300046459 Bacteria 2087
309 Ga0495629_0161255 3300046459 Bacteria 1557
310 Ga0495638_0000091 3300046460 Bacteria 146548
311 Ga0495638_0027695 3300046460 Bacteria 3666
312 Ga0495638_0050470 3300046460 Bacteria 2598
313 Ga0495638_0053769 3300046460 Bacteria 2505
314 Ga0495638_0202885 3300046460 Bacteria 1118
315 Ga0495638_0275995 3300046460 Bacteria 915
316 Ga0495651_0084919 3300046462 Bacteria 2384
317 Ga0495653_0000013 3300046463 Bacteria 250453
318 Ga0495653_0054550 3300046463 Bacteria 3053
319 Ga0495653_0069332 3300046463 Bacteria 2642
320 Ga0495653_0126508 3300046463 Bacteria 1814
321 Ga0495650_0000097 3300046471 Bacteria 216051
322 Ga0495650_0000272 3300046471 Bacteria 98846
323 Ga0495650_0002039 3300046471 Bacteria 17659
324 Ga0495650_0003861 3300046471 Bacteria 10624
325 Ga0495650_0011137 3300046471 Bacteria 4953
326 Ga0495650_0013311 3300046471 Bacteria 4358
327 Ga0495650_0043334 3300046471 Bacteria 1910
328 Ga0495580_0023253 3300046472 Bacteria 4553
329 Ga0495580_0447359 3300046472 Bacteria 867
330 Ga0495582_0015183 3300046473 Bacteria 4235
331 Ga0495582_0081784 3300046473 Bacteria 1794
332 Ga0495582_0209825 3300046473 Bacteria 1113
333 Ga0495605_0000234 3300046474 Bacteria 68169
334 Ga0495605_0005259 3300046474 Bacteria 7552
335 Ga0495605_0067074 3300046474 Bacteria 1703
336 Ga0495605_0151299 3300046474 Bacteria 1035
337 Ga0495664_0066884 3300046477 Bacteria 2143
338 Ga0495584_0000924 3300046491 Bacteria 18616
339 Ga0495584_0003900 3300046491 Bacteria 8067
340 Ga0495584_0035283 3300046491 Bacteria 2529
341 Ga0495584_0040858 3300046491 Bacteria 2341
342 Ga0495584_0061131 3300046491 Bacteria 1893
343 Ga0495584_0135943 3300046491 Bacteria 1248
344 Ga0495584_0141550 3300046491 Bacteria 1221
345 Ga0495584_0229839 3300046491 Bacteria 943
346 Ga0495585_0009117 3300046492 Bacteria 5974
347 Ga0495585_0009367 3300046492 Bacteria 5876
348 Ga0495585_0011031 3300046492 Bacteria 5365
349 Ga0495585_0011537 3300046492 Bacteria 5228
350 Ga0495585_0018564 3300046492 Bacteria 4010
351 Ga0495585_0087211 3300046492 Bacteria 1684
352 Ga0495585_0087352 3300046492 Bacteria 1683
353 Ga0495594_0006450 3300046499 Bacteria 6036
354 Ga0495594_0012518 3300046499 Bacteria 4419
355 Ga0495594_0078633 3300046499 Bacteria 1840
356 Ga0495594_0140568 3300046499 Bacteria 1369
357 Ga0495596_0005327 3300046500 Bacteria 6092
358 Ga0495596_0008828 3300046500 Bacteria 4460
359 Ga0495596_0025597 3300046500 Bacteria 2384
360 Ga0495596_0035132 3300046500 Bacteria 1988
361 Ga0495596_0059819 3300046500 Bacteria 1484
362 Ga0495607_0004852 3300046501 Bacteria 9799
363 Ga0495607_0008135 3300046501 Bacteria 7194
364 Ga0495607_0029025 3300046501 Bacteria 3407
365 Ga0495607_0033666 3300046501 Bacteria 3116
366 Ga0495607_0069953 3300046501 Bacteria 1962
367 Ga0495583_0000155 3300046506 Bacteria 114870
368 Ga0495583_0004737 3300046506 Bacteria 9565
369 Ga0495606_0000141 3300046507 Bacteria 123586
370 Ga0495606_0000152 3300046507 Bacteria 119522
371 Ga0495606_0001575 3300046507 Bacteria 29893
372 Ga0495606_0008580 3300046507 Bacteria 8842
373 Ga0495606_0015878 3300046507 Bacteria 5778
374 Ga0495606_0018064 3300046507 Bacteria 5303
375 Ga0495606_0018769 3300046507 Bacteria 5173
376 Ga0495606_0035336 3300046507 Bacteria 3417
377 Ga0495606_0045886 3300046507 Bacteria 2892
378 Ga0495606_0046399 3300046507 Bacteria 2872
379 Ga0495606_0048380 3300046507 Bacteria 2797
380 Ga0495606_0060224 3300046507 Bacteria 2432
381 Ga0495606_0154856 3300046507 Bacteria 1342
382 Ga0495606_0245644 3300046507 Bacteria 995
383 Ga0495610_0000003 3300046512 Bacteria 1203910
384 Ga0495610_0007317 3300046512 Bacteria 7383
385 Ga0495610_0049877 3300046512 Bacteria 2046
386 Ga0495610_0079240 3300046512 Bacteria 1512
387 Ga0495610_0089529 3300046512 Bacteria 1397
388 Ga0495616_0019387 3300046513 Bacteria 3712
389 Ga0495616_0097318 3300046513 Bacteria 1384
390 Ga0495616_0120226 3300046513 Bacteria 1213
391 Ga0495620_0004808 3300046515 Bacteria 7589
392 Ga0495628_0009289 3300046516 Bacteria 8402
393 Ga0495628_0069039 3300046516 Bacteria 2756
394 Ga0495630_0064151 3300046517 Bacteria 2759
395 Ga0495631_0005851 3300046518 Bacteria 6409
396 Ga0495631_0011618 3300046518 Bacteria 4326
397 Ga0495631_0026426 3300046518 Bacteria 2666
398 Ga0495631_0039226 3300046518 Bacteria 2102
399 Ga0495631_0047032 3300046518 Bacteria 1895
400 Ga0495631_0047731 3300046518 Bacteria 1879
401 Ga0495632_0201490 3300046519 Bacteria 906
402 Ga0495637_0000881 3300046520 Bacteria 19418
403 Ga0495637_0006176 3300046520 Bacteria 6027
404 Ga0495637_0024309 3300046520 Bacteria 2741
405 Ga0495643_0017465 3300046522 Bacteria 4193
406 Ga0495643_0018959 3300046522 Bacteria 3985
407 Ga0495643_0020177 3300046522 Bacteria 3848
408 Ga0495643_0026091 3300046522 Bacteria 3301
409 Ga0495643_0035832 3300046522 Bacteria 2730
410 Ga0495643_0048861 3300046522 Bacteria 2284
411 Ga0495643_0067900 3300046522 Bacteria 1877
412 Ga0495644_0009368 3300046523 Bacteria 3776
413 Ga0495648_0000058 3300046524 Bacteria 156717
414 Ga0495648_0009549 3300046524 Bacteria 7488
415 Ga0495648_0020982 3300046524 Bacteria 4540
416 Ga0495648_0032180 3300046524 Bacteria 3445
417 Ga0495648_0046270 3300046524 Bacteria 2698
418 Ga0495648_0047442 3300046524 Bacteria 2654
419 Ga0495663_0010248 3300046525 Bacteria 2605
420 Ga0495666_0004094 3300046526 Bacteria 7367
421 Ga0495666_0014442 3300046526 Bacteria 3932
422 Ga0495666_0061016 3300046526 Bacteria 1802
423 Ga0495666_0068438 3300046526 Bacteria 1690
424 Ga0495666_0077116 3300046526 Bacteria 1579
425 Ga0495642_0007666 3300046528 Bacteria 4137
426 Ga0495642_0008387 3300046528 Bacteria 3955
427 Ga0495642_0012849 3300046528 Bacteria 3231
428 Ga0495642_0021650 3300046528 Bacteria 2529
429 Ga0495642_0024009 3300046528 Bacteria 2410
430 Ga0495642_0059231 3300046528 Bacteria 1587
431 Ga0495642_0065351 3300046528 Bacteria 1514
432 Ga0495642_0082258 3300046528 Bacteria 1357
433 Ga0495652_0105790 3300046529 Bacteria 2273
434 Ga0495654_0000261 3300046530 Bacteria 47872
435 Ga0495654_0027302 3300046530 Bacteria 2928
436 Ga0495654_0044445 3300046530 Bacteria 2197
437 Ga0495654_0069624 3300046530 Bacteria 1670
438 Ga0495665_0013679 3300046531 Bacteria 4383
439 Ga0495665_0018229 3300046531 Bacteria 3772
440 Ga0495665_0021734 3300046531 Bacteria 3450
441 Ga0495665_0199772 3300046531 Bacteria 1036
442 Ga0495640_0114862 3300046533 Bacteria 1755
443 Ga0495586_0004391 3300046535 Bacteria 7533
444 Ga0495586_0030122 3300046535 Bacteria 2904
445 Ga0495586_0058199 3300046535 Bacteria 2098
446 Ga0495587_0197083 3300046536 Bacteria 1139
447 Ga0495598_0010948 3300046537 Bacteria 2186
448 Ga0495609_0000426 3300046538 Bacteria 35215
449 Ga0495609_0003109 3300046538 Bacteria 9715
450 Ga0495609_0004507 3300046538 Bacteria 7596
451 Ga0495609_0008469 3300046538 Bacteria 5037
452 Ga0495609_0028175 3300046538 Bacteria 2564
453 Ga0495609_0053778 3300046538 Bacteria 1789
454 Ga0495609_0113488 3300046538 Bacteria 1168
455 Ga0495597_0001525 3300046542 Bacteria 16468
456 Ga0495597_0007071 3300046542 Bacteria 5745
457 Ga0495597_0007373 3300046542 Bacteria 5592
458 Ga0495597_0018648 3300046542 Bacteria 3254
459 Ga0495597_0036030 3300046542 Bacteria 2229
460 Ga0495597_0063234 3300046542 Bacteria 1609
461 Ga0495645_0054969 3300046543 Bacteria 2891
462 Ga0495622_0002586 3300046557 Bacteria 8734
463 Ga0495622_0003320 3300046557 Bacteria 7599
464 Ga0495622_0011541 3300046557 Bacteria 4083
465 Ga0495622_0026490 3300046557 Bacteria 2706
466 Ga0495622_0028950 3300046557 Bacteria 2588
467 Ga0495622_0038512 3300046557 Bacteria 2226
468 Ga0495622_0042586 3300046557 Bacteria 2111
469 Ga0495622_0053437 3300046557 Bacteria 1874
470 Ga0495633_0000362 3300046558 Bacteria 48938
471 Ga0495633_0008936 3300046558 Bacteria 5584
472 Ga0495633_0012536 3300046558 Bacteria 4502
473 Ga0495633_0012757 3300046558 Bacteria 4454
474 Ga0495633_0017946 3300046558 Bacteria 3602
475 Ga0495633_0034336 3300046558 Bacteria 2440
476 Ga0495633_0043371 3300046558 Bacteria 2134
477 Ga0495633_0049603 3300046558 Bacteria 1980
478 Ga0495633_0064497 3300046558 Bacteria 1712
479 Ga0495633_0077887 3300046558 Bacteria 1543
480 Ga0495633_0113830 3300046558 Bacteria 1254
481 Ga0495656_0003076 3300046615 Bacteria 5605
482 Ga0495656_0014969 3300046615 Bacteria 2918
483 Ga0495656_0019882 3300046615 Bacteria 2597
484 Ga0495668_0000290 3300046616 Bacteria 68805
485 Ga0495668_0007441 3300046616 Bacteria 6995
486 Ga0495668_0007548 3300046616 Bacteria 6939
487 Ga0495668_0008482 3300046616 Bacteria 6405
488 Ga0495668_0012651 3300046616 Bacteria 5000
489 Ga0495668_0036165 3300046616 Bacteria 2767
490 Ga0495668_0037857 3300046616 Bacteria 2697
491 Ga0495668_0045379 3300046616 Bacteria 2443
492 Ga0495668_0046372 3300046616 Bacteria 2414
493 Ga0495668_0059353 3300046616 Bacteria 2111
494 Ga0495668_0166483 3300046616 Bacteria 1207
495 Ga0495668_0203607 3300046616 Bacteria 1083
496 Ga0495668_0250272 3300046616 Bacteria 970
497 Ga0495634_0331449 3300046642 Bacteria 914
498 Ga0495611_0035193 3300046648 Bacteria 2217
499 Ga0495611_0038476 3300046648 Bacteria 2127
500 Ga0495611_0045571 3300046648 Bacteria 1964
501 Ga0495625_0017675 3300046660 Bacteria 5580
502 Ga0495625_0027829 3300046660 Bacteria 4248
503 Ga0495625_0030783 3300046660 Bacteria 3999
504 Ga0495625_0041908 3300046660 Bacteria 3329
505 Ga0495625_0049883 3300046660 Bacteria 3006
506 Ga0495625_0064616 3300046660 Bacteria 2581
507 Ga0495625_0064954 3300046660 Bacteria 2573
508 Ga0495625_0170920 3300046660 Bacteria 1451
509 Ga0495635_0007114 3300046663 Bacteria 7825
510 Ga0495659_0000073 3300046664 Bacteria 42850
511 Ga0495659_0006944 3300046664 Bacteria 3583
512 Ga0495659_0007441 3300046664 Bacteria 3474
513 Ga0495659_0050963 3300046664 Bacteria 1507
514 Ga0495661_0012192 3300046665 Bacteria 5805
515 Ga0495661_0026571 3300046665 Bacteria 3727
516 Ga0495661_0029521 3300046665 Bacteria 3498
517 Ga0495661_0037553 3300046665 Bacteria 3023
518 Ga0495661_0051150 3300046665 Bacteria 2496
519 Ga0495661_0063510 3300046665 Bacteria 2182
520 Ga0495661_0083870 3300046665 Bacteria 1830
521 Ga0495661_0101896 3300046665 Bacteria 1614
522 Ga0495588_0013666 3300046674 Bacteria 3870
523 Ga0495588_0014151 3300046674 Bacteria 3814
524 Ga0495588_0015342 3300046674 Bacteria 3685
525 Ga0495588_0043506 3300046674 Bacteria 2298
526 Ga0495588_0053207 3300046674 Bacteria 2087
527 Ga0495588_0079899 3300046674 Bacteria 1706
528 Ga0495588_0109274 3300046674 Bacteria 1456
529 Ga0495588_0141804 3300046674 Bacteria 1269
530 Ga0495599_0230282 3300046678 Bacteria 1131
531 Ga0495599_0278751 3300046678 Bacteria 1013
532 Ga0495623_0006061 3300046679 Bacteria 7858
533 Ga0495623_0008290 3300046679 Bacteria 6760
534 Ga0495646_0004544 3300046680 Bacteria 8739
535 Ga0495646_0052355 3300046680 Bacteria 2466
536 Ga0495669_0004622 3300046684 Bacteria 5703
537 Ga0495669_0033098 3300046684 Bacteria 2274
538 Ga0495669_0062407 3300046684 Bacteria 1688
539 Ga0495613_0095663 3300046689 Bacteria 2148
540 Ga0495613_0106389 3300046689 Bacteria 2024
541 Ga0495624_0016989 3300046690 Bacteria 4891
542 Ga0495624_0026017 3300046690 Bacteria 3838
543 Ga0495624_0057797 3300046690 Bacteria 2438
544 Ga0495624_0150981 3300046690 Bacteria 1421
545 Ga0495670_0013397 3300046691 Bacteria 4034
546 Ga0495670_0013844 3300046691 Bacteria 3966
547 Ga0495670_0023891 3300046691 Bacteria 3018
548 Ga0495670_0048684 3300046691 Bacteria 2120
549 Ga0495670_0118518 3300046691 Bacteria 1374
550 Ga0495670_0128950 3300046691 Bacteria 1317
551 Ga0495670_0194016 3300046691 Bacteria 1074
552 Ga0495671_0000309 3300046692 Bacteria 41290
553 Ga0495671_0016752 3300046692 Bacteria 3907
554 Ga0495671_0067146 3300046692 Bacteria 1764
555 Ga0495649_0019829 3300046694 Bacteria 3776
556 Ga0495649_0021357 3300046694 Bacteria 3627
557 Ga0495649_0028389 3300046694 Bacteria 3101
558 Ga0495649_0031177 3300046694 Bacteria 2941
559 Ga0495649_0046758 3300046694 Bacteria 2356
560 Ga0495649_0074304 3300046694 Bacteria 1821
561 Ga0495589_0036858 3300046794 Bacteria 2450
562 Ga0495589_0069974 3300046794 Bacteria 1716
563 Ga0495600_0129233 3300046809 Bacteria 1642
564 Ga0495660_0021513 3300046810 Bacteria 3693
565 Ga0495660_0023684 3300046810 Bacteria 3502
566 Ga0495660_0074657 3300046810 Bacteria 1791
567 Ga0495660_0104854 3300046810 Bacteria 1450
568 Ga0495660_0162173 3300046810 Bacteria 1095
569 Ga0495581_0015375 3300047315 Bacteria 4444
570 Ga0495581_0039795 3300047315 Bacteria 2721
571 Ga0495581_0050558 3300047315 Bacteria 2401
572 Ga0495581_0173822 3300047315 Bacteria 1260
573 Ga0495604_0065846 3300047317 Bacteria 2757
574 Ga0495604_0065883 3300047317 Bacteria 2756
575 Ga0495604_0071816 3300047317 Bacteria 2617
576 Ga0495604_0081395 3300047317 Bacteria 2424
577 Ga0495636_0001622 3300047318 Bacteria 8558
578 Ga0495636_0007644 3300047318 Bacteria 4251
579 Ga0495636_0011164 3300047318 Bacteria 3553
580 Ga0495636_0032135 3300047318 Bacteria 2152
581 Ga0495636_0074556 3300047318 Bacteria 1453
582 Ga0495636_0272673 3300047318 Bacteria 786
583 Ga0495674_0019293 3300047319 Bacteria 6331
584 Ga0495674_0052612 3300047319 Bacteria 3582
585 Ga0495674_0142125 3300047319 Bacteria 2017
586 Ga0495672_0000093 3300047320 Bacteria 145111
587 Ga0495672_0000176 3300047320 Bacteria 92728
588 Ga0495672_0000263 3300047320 Bacteria 72879
589 Ga0495672_0013531 3300047320 Bacteria 5626
590 Ga0495672_0050654 3300047320 Bacteria 2449
591 Ga0495676_0016373 3300047321 Bacteria 6584
592 Ga0495676_0069686 3300047321 Bacteria 2712
593 Ga0495676_0087321 3300047321 Bacteria 2344
594 Ga0495676_0093020 3300047321 Bacteria 2249
595 Ga0495680_0030223 3300047322 Bacteria 4426
596 Ga0495680_0045840 3300047322 Bacteria 3450
597 Ga0495683_0005742 3300047323 Bacteria 6839
598 Ga0495683_0006197 3300047323 Bacteria 6549
599 Ga0495683_0009260 3300047323 Bacteria 5247
600 Ga0495683_0039174 3300047323 Bacteria 2396
601 Ga0495683_0078141 3300047323 Bacteria 1617
602 Ga0495683_0116354 3300047323 Bacteria 1272
603 Ga0495683_0147375 3300047323 Bacteria 1098
604 Ga0495687_000021 3300047443 Bacteria 334681
605 Ga0495687_000149 3300047443 Bacteria 106301
606 Ga0495687_000296 3300047443 Bacteria 65626
607 Ga0495687_005542 3300047443 Bacteria 8006
608 Ga0495687_008783 3300047443 Bacteria 5734
609 Ga0495687_018937 3300047443 Bacteria 3390
610 Ga0495687_102422 3300047443 Bacteria 1071
611 Ga0495675_0034341 3300047444 Bacteria 3238
612 Ga0495677_0001373 3300047445 Bacteria 9736
613 Ga0495677_0006058 3300047445 Bacteria 4572
614 Ga0495677_0012318 3300047445 Bacteria 3119
615 Ga0495677_0020063 3300047445 Bacteria 2422
616 Ga0495677_0028488 3300047445 Bacteria 2028
617 Ga0495677_0040379 3300047445 Bacteria 1706
618 Ga0495677_0096830 3300047445 Bacteria 1115
619 Ga0495679_009450 3300047446 Bacteria 3902
620 Ga0495679_025306 3300047446 Bacteria 1986
621 Ga0495685_000250 3300047447 Bacteria 18582
622 Ga0495685_007493 3300047447 Bacteria 3604
623 Ga0495685_016233 3300047447 Bacteria 2543
624 Ga0495685_038351 3300047447 Bacteria 1642
625 Ga0495673_0000006 3300047469 Bacteria 908691
626 Ga0495673_0000024 3300047469 Bacteria 521349
627 Ga0495673_0000049 3300047469 Bacteria 265878
628 Ga0495673_0007809 3300047469 Bacteria 6092
629 Ga0495673_0015916 3300047469 Bacteria 3859
630 Ga0495681_0025094 3300047470 Bacteria 3124
631 Ga0495686_0000359 3300047472 Bacteria 73907
632 Ga0495686_0012141 3300047472 Bacteria 6042
633 Ga0495686_0022789 3300047472 Bacteria 4139
634 Ga0495686_0025509 3300047472 Bacteria 3874
635 Ga0495686_0062331 3300047472 Bacteria 2313
636 Ga0495686_0115432 3300047472 Bacteria 1606
637 Ga0495686_0212640 3300047472 Bacteria 1104
638 Ga0495593_0005097 3300047673 Bacteria 7768
639 Ga0495593_0021192 3300047673 Bacteria 3633
640 Ga0495593_0069724 3300047673 Bacteria 1827
641 Ga0495593_0100385 3300047673 Bacteria 1484
642 Ga0495602_0031307 3300048088 Bacteria 5031
643 Ga0495602_0043464 3300048088 Bacteria 4084
644 Ga0495614_0019793 3300048089 Bacteria 2912
645 Ga0495614_0027165 3300048089 Bacteria 2468
646 Ga0495615_0005881 3300048090 Bacteria 2237
647 Ga0495626_0007491 3300048091 Bacteria 6074
648 Ga0495626_0034003 3300048091 Bacteria 2440
649 Ga0495626_0036986 3300048091 Bacteria 2322
650 Ga0495626_0052577 3300048091 Bacteria 1877
651 Ga0495626_0121132 3300048091 Bacteria 1124
652 Ga0496100_0054399 3300048903 Bacteria 2610
653 Ga0496100_0175886 3300048903 Bacteria 1545
654 Ga0496101_0010094 3300048904 Bacteria 6225
655 Ga0496101_0157887 3300048904 Bacteria 1738
656 Ga0496101_0213506 3300048904 Bacteria 1495
657 Ga0496101_0226877 3300048904 Bacteria 1451
658 Ga0496102_0000463 3300048905 Bacteria 45105
659 Ga0496102_0034285 3300048905 Bacteria 4564
660 Ga0496102_0097127 3300048905 Bacteria 2732
661 Ga0496102_0273841 3300048905 Bacteria 1591
662 Ga0496102_0532509 3300048905 Bacteria 1097
663 Ga0496103_0002220 3300048906 Bacteria 12303
664 Ga0496103_0015400 3300048906 Bacteria 4548
665 Ga0496103_0043004 3300048906 Bacteria 2781
666 Ga0496104_0010667 3300048907 Bacteria 8212
667 Ga0496104_0055517 3300048907 Bacteria 3745
668 Ga0496104_0130203 3300048907 Bacteria 2417
669 Ga0496104_0395003 3300048907 Bacteria 1295
670 Ga0496105_0032536 3300048908 Bacteria 4280
671 Ga0496105_0093134 3300048908 Bacteria 2488
672 Ga0496105_0157955 3300048908 Bacteria 1862
673 Ga0496105_0227534 3300048908 Bacteria 1516
674 Ga0496106_0029689 3300048909 Bacteria 4076
675 Ga0496106_0105061 3300048909 Bacteria 2194
676 Ga0496107_0034666 3300048910 Bacteria 3615
677 Ga0496108_0228553 3300048911 Bacteria 1617
678 Ga0496109_0044419 3300048912 Bacteria 4031
679 Ga0496109_0061983 3300048912 Bacteria 3420
680 Ga0496109_0108740 3300048912 Bacteria 2577
681 Ga0496109_0161834 3300048912 Bacteria 2097
682 Ga0496109_0254646 3300048912 Bacteria 1653
683 Ga0496110_0043506 3300048913 Bacteria 3921
684 Ga0496110_0067822 3300048913 Bacteria 3157
685 Ga0496110_0186126 3300048913 Bacteria 1885
686 Ga0496111_0012600 3300048914 Bacteria 5730
687 Ga0496111_0012790 3300048914 Bacteria 5693
688 Ga0496111_0210459 3300048914 Bacteria 1444
689 Ga0496112_0089730 3300048915 Bacteria 3042
690 Ga0496112_0117000 3300048915 Bacteria 2636
691 Ga0496113_0061979 3300048916 Bacteria 2823
692 Ga0496113_0126741 3300048916 Bacteria 2000
693 Ga0496114_0478042 3300048917 Bacteria 1102
694 Ga0496115_0364063 3300048918 Bacteria 1178
695 Ga0496116_0010198 3300048919 Bacteria 7904
696 Ga0496116_0024544 3300048919 Bacteria 4455
697 Ga0496116_0037867 3300048919 Bacteria 3357
698 Ga0496116_0041819 3300048919 Bacteria 3140
699 Ga0496116_0091391 3300048919 Bacteria 1850
700 Ga0496116_0226591 3300048919 Bacteria 952
701 Ga0496117_0000001 3300048920 Bacteria 2526244
702 Ga0496117_0041521 3300048920 Bacteria 3369
703 Ga0496117_0056443 3300048920 Bacteria 2735
704 Ga0496117_0068370 3300048920 Bacteria 2398
705 Ga0496118_0000078 3300048921 Bacteria 190946
706 Ga0496118_0039039 3300048921 Bacteria 3795
707 Ga0496118_0055612 3300048921 Bacteria 2984
708 Ga0496118_0085707 3300048921 Bacteria 2192
709 Ga0496119_0016500 3300048922 Bacteria 5617
710 Ga0496119_0027964 3300048922 Bacteria 3862
711 Ga0496119_0101566 3300048922 Bacteria 1614
712 Ga0496119_0196603 3300048922 Bacteria 1047
713 Ga0496120_0015571 3300048923 Bacteria 5009
714 Ga0496121_0000629 3300048924 Bacteria 65811
715 Ga0496121_0008619 3300048924 Bacteria 11936
716 Ga0496121_0033068 3300048924 Bacteria 4688
717 Ga0496121_0075172 3300048924 Bacteria 2700
718 Ga0496121_0128319 3300048924 Bacteria 1903
719 Ga0496122_0000706 3300048925 Bacteria 65908
720 Ga0496122_0021480 3300048925 Bacteria 5777
721 Ga0496122_0054686 3300048925 Bacteria 2995
722 Ga0496122_0055319 3300048925 Bacteria 2970
723 Ga0496122_0115739 3300048925 Bacteria 1745
724 Ga0496122_0117489 3300048925 Bacteria 1726
725 Ga0496122_0159956 3300048925 Bacteria 1375
726 Ga0496123_0002213 3300048926 Bacteria 24703
727 Ga0496123_0007938 3300048926 Bacteria 9852
728 Ga0496123_0014321 3300048926 Bacteria 6582
729 Ga0496123_0015581 3300048926 Bacteria 6224
730 Ga0496123_0050713 3300048926 Bacteria 2770
731 Ga0496124_0000024 3300048927 Bacteria 414291
732 Ga0496124_0000125 3300048927 Bacteria 159942
733 Ga0496124_0015653 3300048927 Bacteria 7258
734 Ga0496124_0025451 3300048927 Bacteria 5359
735 Ga0496124_0034686 3300048927 Bacteria 4423
736 Ga0496124_0213585 3300048927 Bacteria 1457
737 Ga0496124_0331414 3300048927 Bacteria 1085
738 Ga0496125_0000011 3300048928 Bacteria 655895
739 Ga0496125_0017315 3300048928 Bacteria 6879
740 Ga0496125_0054414 3300048928 Bacteria 3270
741 Ga0496125_0059962 3300048928 Bacteria 3062
742 Ga0496125_0060012 3300048928 Bacteria 3060
743 Ga0496126_0020682 3300048929 Bacteria 6446
744 Ga0496126_0211321 3300048929 Bacteria 1633
745 Ga0496126_0366789 3300048929 Bacteria 1175
746 Ga0495678_000155 3300049459 Bacteria 81324
747 Ga0495678_018497 3300049459 Bacteria 3131
748 Ga0495678_031280 3300049459 Bacteria 2220
749 Ga0495682_0050037 3300049460 Bacteria 1521
750 Ga0501031_0024531 3300049568 Bacteria 3930
751 Ga0501031_0087749 3300049568 Bacteria 2028
752 Ga0501032_0019404 3300049569 Bacteria 4756
753 Ga0501032_0074404 3300049569 Bacteria 2264
754 Ga0501033_0004989 3300049570 Bacteria 10555
755 Ga0501033_0129390 3300049570 Bacteria 1830
756 Ga0501033_0151746 3300049570 Bacteria 1671
757 Ga0501034_0006995 3300049571 Bacteria 12047
758 Ga0501036_0006814 3300049572 Bacteria 9281
759 Ga0501036_0385777 3300049572 Bacteria 1169
760 Ga0501037_0003741 3300049573 Bacteria 11038
761 Ga0501037_0122769 3300049573 Bacteria 1866
762 Ga0501038_0023096 3300049574 Bacteria 5565
763 Ga0501039_0052204 3300049575 Bacteria 3164
764 Ga0501039_0516859 3300049575 Bacteria 937
765 Ga0501040_0000016 3300049576 Bacteria 75260
766 Ga0501042_0000046 3300049578 Bacteria 41284
767 Ga0501043_0011320 3300049579 Bacteria 6982
768 Ga0501043_0205506 3300049579 Bacteria 1527
769 Ga0501046_0021099 3300049580 Bacteria 5379
770 Ga0501046_0088842 3300049580 Bacteria 2379
771 Ga0501047_0001841 3300049581 Bacteria 20466
772 Ga0501047_0103511 3300049581 Bacteria 2727
773 Ga0501047_0239861 3300049581 Bacteria 1664
774 Ga0501048_0101418 3300049582 Bacteria 2031
775 Ga0501071_0274594 3300049587 Bacteria 1275
776 Ga0501227_006695 3300049665 Bacteria 2471
777 Ga0501227_013193 3300049665 Bacteria 1817
778 Ga0501249_002398 3300049679 Bacteria 3787
779 Ga0501263_021092 3300049760 Bacteria 878
780 Ga0501269_000168 3300049766 Bacteria 20001
781 Ga0501279_001743 3300049775 Bacteria 2863
782 Ga0501279_005098 3300049775 Bacteria 1723
783 Ga0501035_0027613 3300049822 Bacteria 5186
784 Ga0501035_0038419 3300049822 Bacteria 4334
785 Ga0501035_0041176 3300049822 Bacteria 4172
786 Ga0501044_0004041 3300049823 Bacteria 16457
787 Ga0501044_0006255 3300049823 Bacteria 13164
788 Ga0501044_0046534 3300049823 Bacteria 4490
789 Ga0501044_0049752 3300049823 Bacteria 4326
790 nmdc:mga03683_13644_c1 3300050489 Bacteria 2995
791 nmdc:mga03n38_27623_c1 3300050490 Bacteria 2356
792 nmdc:mga00v17_128548_c1 3300050491 Bacteria 1618
793 nmdc:mga00v17_1600_c1 3300050491 Bacteria 11825
794 nmdc:mga00v17_28181_c1 3300050491 Bacteria 3288
795 nmdc:mga0k408_345_c1 3300050493 Bacteria 25333
796 nmdc:mga06z11_91395_c1 3300050494 Bacteria 1653
797 nmdc:mga08y16_11124_c1 3300050511 Bacteria 9451
798 nmdc:mga08y16_233_c1 3300050511 Bacteria 49640
799 Ga0500594_0016394 3300053118 Bacteria 1800
800 Ga0500594_0018577 3300053118 Bacteria 1714
801 Ga0500607_055813 3300053121 Bacteria 2087
802 Ga0500618_000786 3300053125 Bacteria 17782
803 Ga0500618_008373 3300053125 Bacteria 2891
804 Ga0500586_009115 3300053145 Bacteria 2737
805 Ga0500600_0049219 3300053149 Bacteria 2397
806 Ga0500622_0000001 3300053156 Bacteria 657715
807 Ga0500634_0021734 3300053161 Bacteria 3478
808 Ga0500636_0003719 3300053177 Bacteria 8611
809 Ga0500637_0026771 3300053178 Bacteria 3179
810 Ga0500613_007527 3300053738 Bacteria 1139
811 Ga0587082_000365 3300059504 Bacteria 3609
812 Ga0466962_0015018 3300061719 Bacteria 3733

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0408033 Ga0316584_0408033_247_930 221
2 3300005530 Ga0070679_100223171 Ga0070679_1002231711 222
3 3300006038 Ga0075365_10064714 Ga0075365_100647143 222
4 3300006042 Ga0075368_10030698 Ga0075368_100306982 222
5 3300006177 Ga0075362_10202969 Ga0075362_102029691 222
6 3300006178 Ga0075367_10022549 Ga0075367_100225493 222
7 3300006353 Ga0075370_10161447 Ga0075370_101614472 222
8 3300027866 Ga0209813_10021743 Ga0209813_100217432 222
9 3300050494 nmdc:mga06z11_91395_c1 nmdc:mga06z11_91395_c1_734_1522 222
10 3300046536 Ga0495587_0197083 Ga0495587_0197083_401_1078 225
11 3300050490 nmdc:mga03n38_27623_c1 nmdc:mga03n38_27623_c1_463_1284 225
12 3300009551 Ga0105238_10705511 Ga0105238_107055112 227
13 3300048927 Ga0496124_0000125 Ga0496124_0000125_153893_154669 230
14 3300048928 Ga0496125_0059962 Ga0496125_0059962_650_1426 230
15 3300039110 Ga0400487_55311 Ga0400487_55311_741_1475 232
16 3300046507 Ga0495606_0154856 Ga0495606_0154856_28_726 232
17 3300046678 Ga0495599_0230282 Ga0495599_0230282_34_732 232
18 3300049572 Ga0501036_0385777 Ga0501036_0385777_418_1116 232
19 3300048904 Ga0496101_0226877 Ga0496101_0226877_364_1152 233
20 3300048905 Ga0496102_0532509 Ga0496102_0532509_56_844 233
21 3300048906 Ga0496103_0043004 Ga0496103_0043004_96_884 233
22 3300048907 Ga0496104_0395003 Ga0496104_0395003_196_984 233
23 3300048908 Ga0496105_0157955 Ga0496105_0157955_37_825 233
24 3300048909 Ga0496106_0105061 Ga0496106_0105061_1352_2140 233
25 3300048911 Ga0496108_0228553 Ga0496108_0228553_328_1116 233
26 3300048912 Ga0496109_0254646 Ga0496109_0254646_629_1417 233
27 3300048913 Ga0496110_0186126 Ga0496110_0186126_677_1465 233
28 3300048914 Ga0496111_0012600 Ga0496111_0012600_4338_5126 233
29 3300048917 Ga0496114_0478042 Ga0496114_0478042_209_997 233
30 3300005339 Ga0070660_100074357 Ga0070660_1000743573 234
31 3300005344 Ga0070661_100003676 Ga0070661_1000036768 234
32 3300005366 Ga0070659_100032204 Ga0070659_1000322043 234
33 3300005564 Ga0070664_100018147 Ga0070664_1000181474 234
34 3300025919 Ga0207657_10006756 Ga0207657_100067568 234
35 3300025920 Ga0207649_10002906 Ga0207649_100029062 234
36 3300025932 Ga0207690_10020255 Ga0207690_100202553 234
37 3300025945 Ga0207679_10001073 Ga0207679_100010734 234
38 3300031733 Ga0316577_10040651 Ga0316577_100406512 235
39 3300031727 Ga0316576_10006838 Ga0316576_100068387 236
40 3300035398 Ga0316574_0040301 Ga0316574_0040301_13_747 237
41 3300039093 Ga0400489_50965 Ga0400489_50965_178_918 237
42 3300044712 Ga0453684_0602684 Ga0453684_0602684_135_893 237
43 3300046674 Ga0495588_0043506 Ga0495588_0043506_374_1180 237
44 iso_pu_bacteria 2895511927 2895518627 237
45 3300003763 Ga0055529_1000980 Ga0055529_10009806 239
46 3300025228 Ga0209672_103946 Ga0209672_1039462 239
47 3300025242 Ga0209258_105681 Ga0209258_1056812 239
48 3300025272 Ga0209455_1000305 Ga0209455_100030515 239
49 3300046507 Ga0495606_0045886 Ga0495606_0045886_1679_2479 239
50 3300046512 Ga0495610_0000003 Ga0495610_0000003_170443_171228 239
51 3300047318 Ga0495636_0272673 Ga0495636_0272673_17_736 239
52 3300049570 Ga0501033_0129390 Ga0501033_0129390_316_1137 239
53 3300049822 Ga0501035_0038419 Ga0501035_0038419_2185_3006 239
54 3300005547 Ga0070693_100239355 Ga0070693_1002393552 240
55 3300013102 Ga0157371_10000001 Ga0157371_10000001235 240
56 3300015262 Ga0182007_10033599 Ga0182007_100335992 240
57 3300028666 Ga0265336_10000151 Ga0265336_1000015134 240
58 3300029957 Ga0265324_10000001 Ga0265324_10000001125 240
59 3300030736 Ga0316180_1030800 Ga0316180_10308005 240
60 3300031241 Ga0265325_10000046 Ga0265325_1000004612 240
61 3300031251 Ga0265327_10001290 Ga0265327_1000129017 240
62 3300031665 Ga0316575_10012821 Ga0316575_100128212 240
63 3300031711 Ga0265314_10029905 Ga0265314_100299053 240
64 3300032004 Ga0307414_10126035 Ga0307414_101260352 240
65 3300035398 Ga0316574_0001661 Ga0316574_0001661_359_1081 240
66 3300039447 Ga0436361_0404930 Ga0436361_0404930_1186_1992 240
67 3300046463 Ga0495653_0000013 Ga0495653_0000013_244750_245547 240
68 3300046471 Ga0495650_0003861 Ga0495650_0003861_4548_5387 240
69 3300046471 Ga0495650_0043334 Ga0495650_0043334_893_1690 240
70 3300046507 Ga0495606_0001575 Ga0495606_0001575_4750_5547 240
71 3300046520 Ga0495637_0000881 Ga0495637_0000881_1710_2507 240
72 3300046524 Ga0495648_0020982 Ga0495648_0020982_1167_2006 240
73 3300046530 Ga0495654_0000261 Ga0495654_0000261_4761_5558 240
74 3300046538 Ga0495609_0028175 Ga0495609_0028175_468_1307 240
75 3300046660 Ga0495625_0064954 Ga0495625_0064954_288_1130 240
76 3300048919 Ga0496116_0226591 Ga0496116_0226591_85_882 240
77 3300048925 Ga0496122_0054686 Ga0496122_0054686_1161_1958 240
78 3300048926 Ga0496123_0014321 Ga0496123_0014321_2402_3199 240
79 3300053118 Ga0500594_0016394 Ga0500594_0016394_605_1402 240
80 iso_pu_bacteria 8048746797 8048748934 240
81 3300025233 Ga0209437_102900 Ga0209437_1029002 241
82 3300046452 Ga0495617_000049 Ga0495617_000049_4722_5519 241
83 3300046460 Ga0495638_0202885 Ga0495638_0202885_149_946 241
84 3300046471 Ga0495650_0002039 Ga0495650_0002039_15009_15806 241
85 3300046491 Ga0495584_0061131 Ga0495584_0061131_641_1432 241
86 3300046492 Ga0495585_0009117 Ga0495585_0009117_3366_4157 241
87 3300046492 Ga0495585_0011537 Ga0495585_0011537_3453_4274 241
88 3300046500 Ga0495596_0008828 Ga0495596_0008828_1294_2133 241
89 3300046500 Ga0495596_0035132 Ga0495596_0035132_781_1572 241
90 3300046518 Ga0495631_0005851 Ga0495631_0005851_1964_2755 241
91 3300046519 Ga0495632_0201490 Ga0495632_0201490_15_791 241
92 3300046524 Ga0495648_0046270 Ga0495648_0046270_1550_2347 241
93 3300046528 Ga0495642_0021650 Ga0495642_0021650_599_1390 241
94 3300046530 Ga0495654_0044445 Ga0495654_0044445_289_1086 241
95 3300046537 Ga0495598_0010948 Ga0495598_0010948_357_1187 241
96 3300046542 Ga0495597_0007373 Ga0495597_0007373_3743_4534 241
97 3300046558 Ga0495633_0012757 Ga0495633_0012757_2942_3733 241
98 3300046558 Ga0495633_0043371 Ga0495633_0043371_665_1456 241
99 3300046558 Ga0495633_0064497 Ga0495633_0064497_676_1473 241
100 3300046615 Ga0495656_0003076 Ga0495656_0003076_4245_5036 241
101 3300046616 Ga0495668_0007548 Ga0495668_0007548_4803_5600 241
102 3300046616 Ga0495668_0012651 Ga0495668_0012651_1059_1850 241
103 3300046665 Ga0495661_0012192 Ga0495661_0012192_3059_3850 241
104 3300046665 Ga0495661_0037553 Ga0495661_0037553_976_1773 241
105 3300046684 Ga0495669_0033098 Ga0495669_0033098_427_1218 241
106 3300046684 Ga0495669_0062407 Ga0495669_0062407_382_1203 241
107 3300046691 Ga0495670_0013397 Ga0495670_0013397_1949_2740 241
108 3300046692 Ga0495671_0067146 Ga0495671_0067146_585_1376 241
109 3300046794 Ga0495589_0069974 Ga0495589_0069974_295_1086 241
110 3300047320 Ga0495672_0013531 Ga0495672_0013531_3424_4263 241
111 3300047323 Ga0495683_0009260 Ga0495683_0009260_1214_2053 241
112 3300047323 Ga0495683_0078141 Ga0495683_0078141_480_1277 241
113 3300047445 Ga0495677_0012318 Ga0495677_0012318_846_1637 241
114 3300047446 Ga0495679_009450 Ga0495679_009450_2456_3253 241
115 3300047469 Ga0495673_0000006 Ga0495673_0000006_699364_700161 241
116 3300047469 Ga0495673_0000024 Ga0495673_0000024_313255_314064 241
117 3300047469 Ga0495673_0000049 Ga0495673_0000049_122495_123292 241
118 3300047472 Ga0495686_0115432 Ga0495686_0115432_565_1362 241
119 3300048091 Ga0495626_0036986 Ga0495626_0036986_261_1082 241
120 3300048091 Ga0495626_0052577 Ga0495626_0052577_528_1367 241
121 3300048905 Ga0496102_0273841 Ga0496102_0273841_446_1276 241
122 3300048906 Ga0496103_0002220 Ga0496103_0002220_5993_6847 241
123 3300048929 Ga0496126_0020682 Ga0496126_0020682_3350_4147 241
124 3300053125 Ga0500618_000786 Ga0500618_000786_15689_16486 241
125 3300002738 JGI25154J39366_1000747 JGI25154J39366_10007473 242
126 3300006195 Ga0075366_10042195 Ga0075366_100421953 242
127 3300025245 Ga0207425_1000479 Ga0207425_100047918 242
128 3300025246 Ga0209646_1000010 Ga0209646_1000010457 242
129 3300025294 Ga0209025_1007797 Ga0209025_10077978 242
130 3300025297 Ga0209758_1000842 Ga0209758_100084228 242
131 3300044673 Ga0453683_0192197 Ga0453683_0192197_16_744 242
132 3300044712 Ga0453684_0361886 Ga0453684_0361886_204_932 242
133 3300046524 Ga0495648_0047442 Ga0495648_0047442_300_1121 242
134 3300046616 Ga0495668_0166483 Ga0495668_0166483_199_984 242
135 3300046694 Ga0495649_0046758 Ga0495649_0046758_462_1262 242
136 3300048091 Ga0495626_0034003 Ga0495626_0034003_1349_2170 242
137 3300048927 Ga0496124_0331414 Ga0496124_0331414_230_1015 242
138 3300053121 Ga0500607_055813 Ga0500607_055813_337_1065 242
139 3300053177 Ga0500636_0003719 Ga0500636_0003719_4616_5344 242
140 3300053178 Ga0500637_0026771 Ga0500637_0026771_1781_2509 242
141 iso_pu_bacteria 2885080285 2885083653 242
142 3300003763 Ga0055529_1000095 Ga0055529_100009572 243
143 3300009098 Ga0105245_10421619 Ga0105245_104216192 243
144 3300013306 Ga0163162_10358257 Ga0163162_103582572 243
145 3300025272 Ga0209455_1000121 Ga0209455_100012178 243
146 3300029957 Ga0265324_10067957 Ga0265324_100679572 243
147 3300031838 Ga0307518_10005417 Ga0307518_100054173 243
148 3300039447 Ga0436361_0139948 Ga0436361_0139948_148_918 243
149 3300044712 Ga0453684_0220431 Ga0453684_0220431_578_1324 243
150 3300045051 Ga0451576_0422582 Ga0451576_0422582_379_1125 243
151 3300046452 Ga0495617_010347 Ga0495617_010347_1079_1900 243
152 3300046520 Ga0495637_0024309 Ga0495637_0024309_509_1330 243
153 3300046522 Ga0495643_0067900 Ga0495643_0067900_478_1374 243
154 3300046694 Ga0495649_0074304 Ga0495649_0074304_466_1362 243
155 3300047317 Ga0495604_0081395 Ga0495604_0081395_1191_1997 243
156 3300047472 Ga0495686_0000359 Ga0495686_0000359_38894_39682 243
157 3300049823 Ga0501044_0004041 Ga0501044_0004041_9299_10192 243
158 3300017792 Ga0163161_10104398 Ga0163161_101043982 244
159 3300037418 Ga0395900_0085072 Ga0395900_0085072_1993_2727 244
160 3300037471 Ga0395905_0235480 Ga0395905_0235480_941_1675 244
161 3300046452 Ga0495617_000029 Ga0495617_000029_62650_63456 244
162 3300046453 Ga0495627_000055 Ga0495627_000055_25895_26746 244
163 3300046453 Ga0495627_002501 Ga0495627_002501_3447_4253 244
164 3300046460 Ga0495638_0275995 Ga0495638_0275995_57_866 244
165 3300046474 Ga0495605_0000234 Ga0495605_0000234_4714_5520 244
166 3300046474 Ga0495605_0151299 Ga0495605_0151299_137_934 244
167 3300046491 Ga0495584_0229839 Ga0495584_0229839_92_889 244
168 3300046492 Ga0495585_0087211 Ga0495585_0087211_358_1164 244
169 3300046500 Ga0495596_0005327 Ga0495596_0005327_1571_2368 244
170 3300046500 Ga0495596_0025597 Ga0495596_0025597_666_1472 244
171 3300046501 Ga0495607_0033666 Ga0495607_0033666_953_1759 244
172 3300046513 Ga0495616_0120226 Ga0495616_0120226_110_916 244
173 3300046518 Ga0495631_0011618 Ga0495631_0011618_1508_2305 244
174 3300046518 Ga0495631_0039226 Ga0495631_0039226_384_1190 244
175 3300046522 Ga0495643_0026091 Ga0495643_0026091_1284_2135 244
176 3300046522 Ga0495643_0035832 Ga0495643_0035832_734_1531 244
177 3300046524 Ga0495648_0032180 Ga0495648_0032180_1875_2681 244
178 3300046528 Ga0495642_0007666 Ga0495642_0007666_2539_3345 244
179 3300046538 Ga0495609_0004507 Ga0495609_0004507_1503_2354 244
180 3300046538 Ga0495609_0008469 Ga0495609_0008469_3723_4520 244
181 3300046557 Ga0495622_0053437 Ga0495622_0053437_166_963 244
182 3300046558 Ga0495633_0034336 Ga0495633_0034336_411_1217 244
183 3300046615 Ga0495656_0019882 Ga0495656_0019882_1391_2197 244
184 3300046616 Ga0495668_0036165 Ga0495668_0036165_384_1190 244
185 3300046616 Ga0495668_0059353 Ga0495668_0059353_167_964 244
186 3300046616 Ga0495668_0203607 Ga0495668_0203607_177_974 244
187 3300046648 Ga0495611_0035193 Ga0495611_0035193_286_1083 244
188 3300046665 Ga0495661_0026571 Ga0495661_0026571_1831_2637 244
189 3300046665 Ga0495661_0051150 Ga0495661_0051150_432_1238 244
190 3300046691 Ga0495670_0023891 Ga0495670_0023891_432_1238 244
191 3300046692 Ga0495671_0016752 Ga0495671_0016752_1961_2767 244
192 3300046694 Ga0495649_0028389 Ga0495649_0028389_962_1783 244
193 3300046794 Ga0495589_0036858 Ga0495589_0036858_82_888 244
194 3300046810 Ga0495660_0023684 Ga0495660_0023684_360_1211 244
195 3300047443 Ga0495687_000149 Ga0495687_000149_31050_31916 244
196 3300047445 Ga0495677_0028488 Ga0495677_0028488_617_1414 244
197 3300047469 Ga0495673_0007809 Ga0495673_0007809_1582_2379 244
198 3300048905 Ga0496102_0000463 Ga0496102_0000463_40924_41730 244
199 3300048919 Ga0496116_0091391 Ga0496116_0091391_680_1531 244
200 3300048924 Ga0496121_0128319 Ga0496121_0128319_587_1393 244
201 3300053161 Ga0500634_0021734 Ga0500634_0021734_913_1656 244
202 iso_pu_bacteria 2919476304 2919478744 244
203 3300003775 Ga0055524_1001075 Ga0055524_10010755 245
204 3300006173 Ga0070716_100063383 Ga0070716_1000633831 245
205 3300006948 Ga0099826_10000001 Ga0099826_100000011075 245
206 3300025263 Ga0209565_1019027 Ga0209565_10190272 245
207 3300025299 Ga0209256_1000005 Ga0209256_1000005544 245
208 3300025939 Ga0207665_10113327 Ga0207665_101133271 245
209 3300027666 Ga0209282_1000001 Ga0209282_10000012199 245
210 3300042128 Ga0450897_001563 Ga0450897_001563_104_868 245
211 3300044712 Ga0453684_0051919 Ga0453684_0051919_1235_1972 245
212 3300046512 Ga0495610_0079240 Ga0495610_0079240_451_1272 245
213 3300046522 Ga0495643_0020177 Ga0495643_0020177_2686_3507 245
214 3300047320 Ga0495672_0000263 Ga0495672_0000263_1837_2658 245
215 3300047321 Ga0495676_0087321 Ga0495676_0087321_473_1270 245
216 3300047472 Ga0495686_0012141 Ga0495686_0012141_1949_2752 245
217 3300047472 Ga0495686_0062331 Ga0495686_0062331_209_1054 245
218 3300050489 nmdc:mga03683_13644_c1 nmdc:mga03683_13644_c1_1425_2288 245
219 3300050493 nmdc:mga0k408_345_c1 nmdc:mga0k408_345_c1_18569_19306 245
220 3300053738 Ga0500613_007527 Ga0500613_007527_266_1003 245
221 3300003771 Ga0055526_1000066 Ga0055526_100006691 246
222 3300009036 Ga0105244_10006792 Ga0105244_100067925 246
223 3300009036 Ga0105244_10013139 Ga0105244_100131392 246
224 3300021361 Ga0213872_10002205 Ga0213872_100022052 246
225 3300025295 Ga0209564_1000009 Ga0209564_1000009551 246
226 3300025295 Ga0209564_1000033 Ga0209564_100003345 246
227 3300025949 Ga0207667_10315435 Ga0207667_103154352 246
228 3300039447 Ga0436361_0974268 Ga0436361_0974268_60751_61542 246
229 3300042876 Ga0451577_0479241 Ga0451577_0479241_296_1036 246
230 3300044673 Ga0453683_0171527 Ga0453683_0171527_559_1299 246
231 3300044712 Ga0453684_0086145 Ga0453684_0086145_1959_2699 246
232 3300045051 Ga0451576_0013616 Ga0451576_0013616_4538_5278 246
233 3300046460 Ga0495638_0050470 Ga0495638_0050470_967_1752 246
234 3300046471 Ga0495650_0000272 Ga0495650_0000272_96866_97651 246
235 3300046507 Ga0495606_0000141 Ga0495606_0000141_4723_5508 246
236 3300046507 Ga0495606_0046399 Ga0495606_0046399_1297_2118 246
237 3300046512 Ga0495610_0007317 Ga0495610_0007317_4485_5306 246
238 3300046558 Ga0495633_0077887 Ga0495633_0077887_79_864 246
239 3300046616 Ga0495668_0000290 Ga0495668_0000290_67797_68582 246
240 3300046660 Ga0495625_0017675 Ga0495625_0017675_1155_1940 246
241 3300046694 Ga0495649_0031177 Ga0495649_0031177_1662_2447 246
242 3300046810 Ga0495660_0021513 Ga0495660_0021513_2465_3310 246
243 3300046810 Ga0495660_0074657 Ga0495660_0074657_16_879 246
244 3300046810 Ga0495660_0162173 Ga0495660_0162173_137_1009 246
245 3300047472 Ga0495686_0022789 Ga0495686_0022789_2198_2983 246
246 3300006844 Ga0075428_100041048 Ga0075428_1000410483 247
247 3300009094 Ga0111539_10001299 Ga0111539_1000129928 247
248 3300015262 Ga0182007_10000045 Ga0182007_1000004578 247
249 3300015265 Ga0182005_1000002 Ga0182005_1000002816 247
250 3300021361 Ga0213872_10059969 Ga0213872_100599692 247
251 3300025250 Ga0209026_1004031 Ga0209026_10040314 247
252 3300027907 Ga0207428_10007402 Ga0207428_100074024 247
253 3300044765 Ga0466970_0002958 Ga0466970_0002958_3222_4013 247
254 3300046515 Ga0495620_0004808 Ga0495620_0004808_5178_5975 247
255 3300046528 Ga0495642_0012849 Ga0495642_0012849_759_1556 247
256 3300048920 Ga0496117_0000001 Ga0496117_0000001_1762982_1763860 247
257 3300048921 Ga0496118_0000078 Ga0496118_0000078_72094_72972 247
258 3300050511 nmdc:mga08y16_11124_c1 nmdc:mga08y16_11124_c1_2460_3203 247
259 iso_pu_bacteria 2739367655 2739610936 247
260 iso_pu_bacteria 2881927736 2881929395 247
261 iso_pu_bacteria 2887375801 2887380303 247
262 iso_pu_bacteria 8055225921 8055226810 247
263 3300003320 rootH2_10077414 rootH2_100774142 248
264 3300015261 Ga0182006_1000002 Ga0182006_1000002274 248
265 3300046492 Ga0495585_0009367 Ga0495585_0009367_1440_2237 248
266 3300046492 Ga0495585_0087352 Ga0495585_0087352_371_1252 248
267 3300046507 Ga0495606_0015878 Ga0495606_0015878_1175_1996 248
268 3300046660 Ga0495625_0170920 Ga0495625_0170920_284_1147 248
269 3300046691 Ga0495670_0128950 Ga0495670_0128950_29_826 248
270 3300049679 Ga0501249_002398 Ga0501249_002398_1948_2826 248
271 3300049766 Ga0501269_000168 Ga0501269_000168_13333_14211 248
272 3300053156 Ga0500622_0000001 Ga0500622_0000001_443262_444068 248
273 3300005455 Ga0070663_100051650 Ga0070663_1000516502 249
274 3300005539 Ga0068853_100029851 Ga0068853_1000298514 249
275 3300005563 Ga0068855_100301870 Ga0068855_1003018702 249
276 3300005577 Ga0068857_100219076 Ga0068857_1002190762 249
277 3300009094 Ga0111539_10000107 Ga0111539_1000010751 249
278 3300026041 Ga0207639_10021597 Ga0207639_100215974 249
279 3300026116 Ga0207674_10124466 Ga0207674_101244664 249
280 3300027907 Ga0207428_10000040 Ga0207428_1000004037 249
281 3300032004 Ga0307414_10378650 Ga0307414_103786501 249
282 3300037418 Ga0395900_0025979 Ga0395900_0025979_3173_3943 249
283 3300038443 Ga0395901_0033321 Ga0395901_0033321_1106_1876 249
284 3300038443 Ga0395901_0228169 Ga0395901_0228169_172_942 249
285 3300045051 Ga0451576_0308673 Ga0451576_0308673_690_1448 249
286 3300046507 Ga0495606_0048380 Ga0495606_0048380_1652_2464 249
287 3300046522 Ga0495643_0048861 Ga0495643_0048861_230_1051 249
288 3300046526 Ga0495666_0004094 Ga0495666_0004094_1239_2045 249
289 3300046538 Ga0495609_0053778 Ga0495609_0053778_756_1568 249
290 3300046665 Ga0495661_0083870 Ga0495661_0083870_296_1147 249
291 3300046674 Ga0495588_0053207 Ga0495588_0053207_899_1705 249
292 3300047321 Ga0495676_0016373 Ga0495676_0016373_4767_5573 249
293 3300048904 Ga0496101_0010094 Ga0496101_0010094_4355_5176 249
294 3300048912 Ga0496109_0061983 Ga0496109_0061983_2185_3006 249
295 3300048915 Ga0496112_0117000 Ga0496112_0117000_1147_1968 249
296 3300048916 Ga0496113_0126741 Ga0496113_0126741_386_1207 249
297 3300048925 Ga0496122_0021480 Ga0496122_0021480_3311_4132 249
298 3300048926 Ga0496123_0015581 Ga0496123_0015581_2079_2900 249
299 3300048928 Ga0496125_0017315 Ga0496125_0017315_4106_4927 249
300 3300049459 Ga0495678_000155 Ga0495678_000155_75403_76281 249
301 3300049568 Ga0501031_0024531 Ga0501031_0024531_405_1175 249
302 3300049568 Ga0501031_0087749 Ga0501031_0087749_1084_1854 249
303 3300049569 Ga0501032_0019404 Ga0501032_0019404_3641_4411 249
304 3300049570 Ga0501033_0004989 Ga0501033_0004989_1536_2306 249
305 3300049570 Ga0501033_0151746 Ga0501033_0151746_660_1430 249
306 3300049571 Ga0501034_0006995 Ga0501034_0006995_3720_4490 249
307 3300049572 Ga0501036_0006814 Ga0501036_0006814_4156_4926 249
308 3300049573 Ga0501037_0003741 Ga0501037_0003741_2607_3377 249
309 3300049573 Ga0501037_0122769 Ga0501037_0122769_361_1131 249
310 3300049574 Ga0501038_0023096 Ga0501038_0023096_4412_5182 249
311 3300049575 Ga0501039_0052204 Ga0501039_0052204_1640_2410 249
312 3300049579 Ga0501043_0011320 Ga0501043_0011320_6095_6865 249
313 3300049579 Ga0501043_0205506 Ga0501043_0205506_56_826 249
314 3300049580 Ga0501046_0021099 Ga0501046_0021099_332_1102 249
315 3300049580 Ga0501046_0088842 Ga0501046_0088842_1144_1914 249
316 3300049581 Ga0501047_0001841 Ga0501047_0001841_2677_3447 249
317 3300049581 Ga0501047_0239861 Ga0501047_0239861_357_1127 249
318 3300049582 Ga0501048_0101418 Ga0501048_0101418_90_860 249
319 3300049822 Ga0501035_0027613 Ga0501035_0027613_1322_2092 249
320 3300049823 Ga0501044_0046534 Ga0501044_0046534_2616_3386 249
321 3300049823 Ga0501044_0049752 Ga0501044_0049752_3257_4027 249
322 3300050511 nmdc:mga08y16_233_c1 nmdc:mga08y16_233_c1_10684_11442 249
323 3300005471 Ga0070698_100588188 Ga0070698_1005881881 250
324 3300005616 Ga0068852_100011442 Ga0068852_1000114424 250
325 3300005834 Ga0068851_10003355 Ga0068851_100033554 250
326 3300006237 Ga0097621_100021443 Ga0097621_1000214434 250
327 3300006358 Ga0068871_100073517 Ga0068871_1000735174 250
328 3300009093 Ga0105240_10043233 Ga0105240_100432335 250
329 3300009177 Ga0105248_10088952 Ga0105248_100889523 250
330 3300013296 Ga0157374_10104290 Ga0157374_101042904 250
331 3300013306 Ga0163162_10203933 Ga0163162_102039333 250
332 3300025321 Ga0207656_10029214 Ga0207656_100292144 250
333 3300025913 Ga0207695_10050171 Ga0207695_100501713 250
334 3300025941 Ga0207711_10025198 Ga0207711_100251982 250
335 3300026142 Ga0207698_10009505 Ga0207698_100095055 250
336 3300030744 Ga0316181_1157853 Ga0316181_11578532 250
337 3300031548 Ga0307408_100010634 Ga0307408_1000106344 250
338 3300035725 Ga0373947_0089646 Ga0373947_0089646_799_1557 250
339 3300046452 Ga0495617_060263 Ga0495617_060263_323_1129 250
340 3300046453 Ga0495627_050932 Ga0495627_050932_189_995 250
341 3300046473 Ga0495582_0015183 Ga0495582_0015183_1664_2470 250
342 3300046491 Ga0495584_0040858 Ga0495584_0040858_1072_1878 250
343 3300046492 Ga0495585_0018564 Ga0495585_0018564_1140_1946 250
344 3300046499 Ga0495594_0012518 Ga0495594_0012518_1713_2519 250
345 3300046500 Ga0495596_0059819 Ga0495596_0059819_11_817 250
346 3300046501 Ga0495607_0029025 Ga0495607_0029025_181_1038 250
347 3300046501 Ga0495607_0069953 Ga0495607_0069953_418_1224 250
348 3300046513 Ga0495616_0019387 Ga0495616_0019387_1139_1945 250
349 3300046518 Ga0495631_0047032 Ga0495631_0047032_18_824 250
350 3300046523 Ga0495644_0009368 Ga0495644_0009368_1486_2292 250
351 3300046528 Ga0495642_0024009 Ga0495642_0024009_533_1339 250
352 3300046557 Ga0495622_0026490 Ga0495622_0026490_955_1761 250
353 3300046558 Ga0495633_0012536 Ga0495633_0012536_418_1224 250
354 3300046616 Ga0495668_0037857 Ga0495668_0037857_1291_2097 250
355 3300046660 Ga0495625_0064616 Ga0495625_0064616_1303_2109 250
356 3300046665 Ga0495661_0029521 Ga0495661_0029521_1322_2128 250
357 3300046674 Ga0495588_0014151 Ga0495588_0014151_1308_2114 250
358 3300046684 Ga0495669_0004622 Ga0495669_0004622_3317_4123 250
359 3300046691 Ga0495670_0013844 Ga0495670_0013844_1233_2039 250
360 3300047315 Ga0495581_0039795 Ga0495581_0039795_538_1344 250
361 3300047323 Ga0495683_0147375 Ga0495683_0147375_139_945 250
362 3300047443 Ga0495687_005542 Ga0495687_005542_3962_4783 250
363 3300047445 Ga0495677_0020063 Ga0495677_0020063_397_1203 250
364 3300047445 Ga0495677_0040379 Ga0495677_0040379_447_1268 250
365 3300047446 Ga0495679_025306 Ga0495679_025306_518_1324 250
366 3300047447 Ga0495685_016233 Ga0495685_016233_371_1177 250
367 3300048089 Ga0495614_0019793 Ga0495614_0019793_554_1360 250
368 3300048907 Ga0496104_0010667 Ga0496104_0010667_4600_5358 250
369 3300048908 Ga0496105_0093134 Ga0496105_0093134_812_1570 250
370 3300048912 Ga0496109_0108740 Ga0496109_0108740_1416_2174 250
371 3300048913 Ga0496110_0067822 Ga0496110_0067822_886_1644 250
372 3300048914 Ga0496111_0210459 Ga0496111_0210459_304_1182 250
373 3300048919 Ga0496116_0037867 Ga0496116_0037867_1493_2371 250
374 3300048925 Ga0496122_0055319 Ga0496122_0055319_301_1179 250
375 3300048926 Ga0496123_0050713 Ga0496123_0050713_1160_2038 250
376 3300042876 Ga0451577_0046163 Ga0451577_0046163_234_992 251
377 3300044673 Ga0453683_0018493 Ga0453683_0018493_1136_1966 251
378 3300044712 Ga0453684_0077881 Ga0453684_0077881_2356_3114 251
379 3300044712 Ga0453684_0161015 Ga0453684_0161015_1430_2188 251
380 3300046460 Ga0495638_0053769 Ga0495638_0053769_1370_2167 251
381 3300046491 Ga0495584_0000924 Ga0495584_0000924_4662_5459 251
382 3300046501 Ga0495607_0008135 Ga0495607_0008135_1323_2120 251
383 3300046533 Ga0495640_0114862 Ga0495640_0114862_705_1511 251
384 3300046538 Ga0495609_0000426 Ga0495609_0000426_4616_5413 251
385 3300046558 Ga0495633_0017946 Ga0495633_0017946_1819_2628 251
386 3300046616 Ga0495668_0008482 Ga0495668_0008482_1149_1946 251
387 3300046660 Ga0495625_0041908 Ga0495625_0041908_1199_1996 251
388 3300046664 Ga0495659_0007441 Ga0495659_0007441_1083_1880 251
389 3300046665 Ga0495661_0063510 Ga0495661_0063510_379_1176 251
390 3300046694 Ga0495649_0021357 Ga0495649_0021357_1017_1814 251
391 3300047318 Ga0495636_0011164 Ga0495636_0011164_2685_3482 251
392 3300047320 Ga0495672_0000093 Ga0495672_0000093_92207_93085 251
393 3300047443 Ga0495687_008783 Ga0495687_008783_3038_3835 251
394 3300047445 Ga0495677_0001373 Ga0495677_0001373_4565_5362 251
395 3300047447 Ga0495685_007493 Ga0495685_007493_2350_3147 251
396 3300047470 Ga0495681_0025094 Ga0495681_0025094_929_1726 251
397 3300049587 Ga0501071_0274594 Ga0501071_0274594_470_1234 251
398 3300028794 Ga0307515_10204967 Ga0307515_102049673 252
399 3300037312 Ga0395899_0000028 Ga0395899_0000028_201324_202133 252
400 3300037471 Ga0395905_0068788 Ga0395905_0068788_1234_2025 252
401 3300042876 Ga0451577_0013625 Ga0451577_0013625_4464_5228 252
402 3300046457 Ga0495590_0000003 Ga0495590_0000003_474627_475448 252
403 3300046474 Ga0495605_0067074 Ga0495605_0067074_204_1007 252
404 3300046507 Ga0495606_0000152 Ga0495606_0000152_25211_26053 252
405 3300046522 Ga0495643_0017465 Ga0495643_0017465_2611_3432 252
406 3300046530 Ga0495654_0069624 Ga0495654_0069624_376_1179 252
407 3300046535 Ga0495586_0030122 Ga0495586_0030122_1272_2078 252
408 3300046538 Ga0495609_0113488 Ga0495609_0113488_103_906 252
409 3300046542 Ga0495597_0001525 Ga0495597_0001525_1308_2129 252
410 3300046542 Ga0495597_0036030 Ga0495597_0036030_476_1279 252
411 3300046616 Ga0495668_0007441 Ga0495668_0007441_4358_5179 252
412 3300046616 Ga0495668_0046372 Ga0495668_0046372_1198_2001 252
413 3300046663 Ga0495635_0007114 Ga0495635_0007114_1887_2693 252
414 3300046689 Ga0495613_0095663 Ga0495613_0095663_711_1517 252
415 3300047317 Ga0495604_0065846 Ga0495604_0065846_1509_2315 252
416 3300047322 Ga0495680_0045840 Ga0495680_0045840_1336_2142 252
417 3300047444 Ga0495675_0034341 Ga0495675_0034341_417_1223 252
418 3300047673 Ga0495593_0021192 Ga0495593_0021192_1721_2527 252
419 3300048089 Ga0495614_0027165 Ga0495614_0027165_399_1205 252
420 3300050491 nmdc:mga00v17_1600_c1 nmdc:mga00v17_1600_c1_6028_6810 252
421 iso_pu_bacteria 2857542790 2857545185 252
422 iso_pu_bacteria 8002392321 8002393370 252
423 3300005337 Ga0070682_100190768 Ga0070682_1001907681 253
424 3300005354 Ga0070675_100133398 Ga0070675_1001333984 253
425 3300005438 Ga0070701_10039430 Ga0070701_100394301 253
426 3300005617 Ga0068859_100058550 Ga0068859_1000585503 253
427 3300005843 Ga0068860_100617989 Ga0068860_1006179892 253
428 3300006931 Ga0097620_100058551 Ga0097620_1000585513 253
429 3300025926 Ga0207659_10137954 Ga0207659_101379542 253
430 3300028381 Ga0268264_10484293 Ga0268264_104842931 253
431 3300035695 Ga0373927_0086727 Ga0373927_0086727_190_960 253
432 3300037068 Ga0373925_0015424 Ga0373925_0015424_4008_4778 253
433 3300046522 Ga0495643_0018959 Ga0495643_0018959_1724_2521 253
434 3300046810 Ga0495660_0104854 Ga0495660_0104854_52_873 253
435 3300047445 Ga0495677_0096830 Ga0495677_0096830_113_910 253
436 3300049576 Ga0501040_0000016 Ga0501040_0000016_6762_7571 253
437 3300049578 Ga0501042_0000046 Ga0501042_0000046_31667_32476 253
438 iso_pu_bacteria 2599185292 2599903298 253
439 iso_pu_bacteria 2643221569 2643862204 253
440 iso_pu_bacteria 2643221621 2644122194 253
441 iso_pu_bacteria 2857537821 2857538398 253
442 iso_pu_bacteria 2858950400 2858955658 253
443 iso_pu_bacteria 2941479691 2941482006 253
444 3300006051 Ga0075364_10000886 Ga0075364_1000088610 254
445 3300037418 Ga0395900_0761271 Ga0395900_0761271_108_878 254
446 3300042876 Ga0451577_0044750 Ga0451577_0044750_1832_2647 254
447 3300044712 Ga0453684_0150202 Ga0453684_0150202_1362_2177 254
448 3300045051 Ga0451576_0018250 Ga0451576_0018250_5666_6481 254
449 3300046452 Ga0495617_010848 Ga0495617_010848_706_1512 254
450 3300046459 Ga0495629_0012395 Ga0495629_0012395_4728_5492 254
451 3300046459 Ga0495629_0017554 Ga0495629_0017554_3266_4066 254
452 3300046459 Ga0495629_0019645 Ga0495629_0019645_971_1735 254
453 3300046459 Ga0495629_0094384 Ga0495629_0094384_64_864 254
454 3300046462 Ga0495651_0084919 Ga0495651_0084919_975_1775 254
455 3300046463 Ga0495653_0054550 Ga0495653_0054550_1035_1835 254
456 3300046472 Ga0495580_0023253 Ga0495580_0023253_3680_4480 254
457 3300046473 Ga0495582_0081784 Ga0495582_0081784_805_1569 254
458 3300046473 Ga0495582_0209825 Ga0495582_0209825_134_934 254
459 3300046491 Ga0495584_0035283 Ga0495584_0035283_1231_1995 254
460 3300046499 Ga0495594_0006450 Ga0495594_0006450_3814_4578 254
461 3300046499 Ga0495594_0078633 Ga0495594_0078633_72_836 254
462 3300046516 Ga0495628_0069039 Ga0495628_0069039_786_1586 254
463 3300046517 Ga0495630_0064151 Ga0495630_0064151_525_1289 254
464 3300046526 Ga0495666_0014442 Ga0495666_0014442_970_1734 254
465 3300046526 Ga0495666_0061016 Ga0495666_0061016_932_1696 254
466 3300046526 Ga0495666_0068438 Ga0495666_0068438_861_1625 254
467 3300046528 Ga0495642_0065351 Ga0495642_0065351_463_1227 254
468 3300046528 Ga0495642_0082258 Ga0495642_0082258_101_865 254
469 3300046529 Ga0495652_0105790 Ga0495652_0105790_375_1139 254
470 3300046530 Ga0495654_0027302 Ga0495654_0027302_703_1533 254
471 3300046531 Ga0495665_0013679 Ga0495665_0013679_3137_3901 254
472 3300046531 Ga0495665_0021734 Ga0495665_0021734_2091_2855 254
473 3300046531 Ga0495665_0199772 Ga0495665_0199772_49_849 254
474 3300046535 Ga0495586_0004391 Ga0495586_0004391_4533_5297 254
475 3300046535 Ga0495586_0058199 Ga0495586_0058199_1049_1813 254
476 3300046542 Ga0495597_0063234 Ga0495597_0063234_327_1091 254
477 3300046557 Ga0495622_0002586 Ga0495622_0002586_4925_5725 254
478 3300046557 Ga0495622_0028950 Ga0495622_0028950_247_1011 254
479 3300046557 Ga0495622_0038512 Ga0495622_0038512_1062_1826 254
480 3300046558 Ga0495633_0008936 Ga0495633_0008936_1420_2307 254
481 3300046558 Ga0495633_0049603 Ga0495633_0049603_846_1652 254
482 3300046558 Ga0495633_0113830 Ga0495633_0113830_244_1065 254
483 3300046642 Ga0495634_0331449 Ga0495634_0331449_68_832 254
484 3300046660 Ga0495625_0030783 Ga0495625_0030783_265_1029 254
485 3300046664 Ga0495659_0000073 Ga0495659_0000073_1308_2138 254
486 3300046674 Ga0495588_0015342 Ga0495588_0015342_526_1290 254
487 3300046674 Ga0495588_0141804 Ga0495588_0141804_419_1183 254
488 3300046678 Ga0495599_0278751 Ga0495599_0278751_212_976 254
489 3300046679 Ga0495623_0006061 Ga0495623_0006061_5758_6522 254
490 3300046680 Ga0495646_0052355 Ga0495646_0052355_722_1522 254
491 3300046689 Ga0495613_0106389 Ga0495613_0106389_125_889 254
492 3300046690 Ga0495624_0026017 Ga0495624_0026017_2725_3525 254
493 3300046690 Ga0495624_0057797 Ga0495624_0057797_291_1055 254
494 3300046690 Ga0495624_0150981 Ga0495624_0150981_63_827 254
495 3300046692 Ga0495671_0000309 Ga0495671_0000309_39214_40044 254
496 3300046809 Ga0495600_0129233 Ga0495600_0129233_145_909 254
497 3300047315 Ga0495581_0015375 Ga0495581_0015375_1054_1818 254
498 3300047315 Ga0495581_0050558 Ga0495581_0050558_1011_1775 254
499 3300047317 Ga0495604_0065883 Ga0495604_0065883_150_914 254
500 3300047319 Ga0495674_0019293 Ga0495674_0019293_46_810 254
501 3300047319 Ga0495674_0052612 Ga0495674_0052612_58_858 254
502 3300047319 Ga0495674_0142125 Ga0495674_0142125_455_1219 254
503 3300047320 Ga0495672_0000176 Ga0495672_0000176_17955_18785 254
504 3300047320 Ga0495672_0050654 Ga0495672_0050654_128_934 254
505 3300047321 Ga0495676_0093020 Ga0495676_0093020_1186_1950 254
506 3300047673 Ga0495593_0100385 Ga0495593_0100385_25_789 254
507 3300048088 Ga0495602_0043464 Ga0495602_0043464_3124_3888 254
508 3300048091 Ga0495626_0007491 Ga0495626_0007491_2047_2811 254
509 3300048927 Ga0496124_0025451 Ga0496124_0025451_2195_2959 254
510 3300053145 Ga0500586_009115 Ga0500586_009115_1231_2052 254
511 iso_pu_bacteria 2643221554 2643787382 254
512 iso_pu_bacteria 2643221638 2644214103 254
513 3300003771 Ga0055526_1004314 Ga0055526_10043149 255
514 3300003773 Ga0055537_1001124 Ga0055537_10011244 255
515 3300003775 Ga0055524_1010843 Ga0055524_10108433 255
516 3300003784 Ga0055534_1001481 Ga0055534_10014816 255
517 3300003784 Ga0055534_1001729 Ga0055534_10017299 255
518 3300003790 Ga0055528_1000089 Ga0055528_100008956 255
519 3300017792 Ga0163161_10420463 Ga0163161_104204631 255
520 3300025263 Ga0209565_1000009 Ga0209565_1000009179 255
521 3300025273 Ga0209673_1000019 Ga0209673_1000019203 255
522 3300025291 Ga0209675_1000028 Ga0209675_1000028153 255
523 3300025295 Ga0209564_1000058 Ga0209564_1000058141 255
524 3300025299 Ga0209256_1000052 Ga0209256_100005213 255
525 3300042139 Ga0450904_001501 Ga0450904_001501_847_1614 255
526 3300044656 Ga0466969_0053685 Ga0466969_0053685_106_903 255
527 3300044684 Ga0466966_0009507 Ga0466966_0009507_4501_5298 255
528 3300044684 Ga0466966_0062085 Ga0466966_0062085_329_1135 255
529 3300044693 Ga0466961_0030473 Ga0466961_0030473_1166_1972 255
530 3300046460 Ga0495638_0027695 Ga0495638_0027695_1656_2462 255
531 3300046474 Ga0495605_0005259 Ga0495605_0005259_1841_2647 255
532 3300046491 Ga0495584_0003900 Ga0495584_0003900_1032_1838 255
533 3300046491 Ga0495584_0141550 Ga0495584_0141550_30_836 255
534 3300046506 Ga0495583_0000155 Ga0495583_0000155_33827_34633 255
535 3300046513 Ga0495616_0097318 Ga0495616_0097318_85_891 255
536 3300046520 Ga0495637_0006176 Ga0495637_0006176_890_1657 255
537 3300046524 Ga0495648_0009549 Ga0495648_0009549_3754_4560 255
538 3300046525 Ga0495663_0010248 Ga0495663_0010248_1223_2020 255
539 3300046538 Ga0495609_0003109 Ga0495609_0003109_6085_6891 255
540 3300046557 Ga0495622_0042586 Ga0495622_0042586_578_1471 255
541 3300046615 Ga0495656_0014969 Ga0495656_0014969_318_1115 255
542 3300046648 Ga0495611_0045571 Ga0495611_0045571_468_1274 255
543 3300046664 Ga0495659_0006944 Ga0495659_0006944_1049_1855 255
544 3300046665 Ga0495661_0101896 Ga0495661_0101896_480_1286 255
545 3300047318 Ga0495636_0007644 Ga0495636_0007644_1634_2440 255
546 3300047323 Ga0495683_0039174 Ga0495683_0039174_505_1311 255
547 3300047443 Ga0495687_000296 Ga0495687_000296_1788_2594 255
548 3300047445 Ga0495677_0006058 Ga0495677_0006058_2708_3514 255
549 3300047447 Ga0495685_000250 Ga0495685_000250_3524_4330 255
550 3300047469 Ga0495673_0015916 Ga0495673_0015916_1509_2315 255
551 3300047472 Ga0495686_0212640 Ga0495686_0212640_82_888 255
552 3300048090 Ga0495615_0005881 Ga0495615_0005881_166_963 255
553 3300048091 Ga0495626_0121132 Ga0495626_0121132_199_966 255
554 3300048925 Ga0496122_0159956 Ga0496122_0159956_52_828 255
555 3300048927 Ga0496124_0000024 Ga0496124_0000024_143791_144567 255
556 3300049459 Ga0495678_018497 Ga0495678_018497_860_1666 255
557 3300049460 Ga0495682_0050037 Ga0495682_0050037_468_1274 255
558 3300053118 Ga0500594_0018577 Ga0500594_0018577_661_1494 255
559 iso_pu_bacteria 2643221645 2644252405 255
560 iso_pu_bacteria 2738541280 2738741562 255
561 iso_pu_bacteria 2738541300 2738843819 255
562 iso_pu_bacteria 2738541357 2739153393 255
563 iso_pu_bacteria 2738543003 2739195313 255
564 iso_pu_bacteria 2738543018 2739277642 255
565 iso_pu_bacteria 2738543026 2739321789 255
566 iso_pu_bacteria 2738543029 2739339655 255
567 iso_pu_bacteria 2738543030 2739346673 255
568 iso_pu_bacteria 2821131069 2821131233 255
569 iso_pu_bacteria 2855730933 2855736619 255
570 iso_pu_bacteria 2855767633 2855773556 255
571 iso_pu_bacteria 2857564685 2857565094 255
572 iso_pu_bacteria 2857576091 2857576731 255
573 iso_pu_bacteria 2881412998 2881418441 255
574 3300025292 Ga0209676_1006174 Ga0209676_10061744 256
575 3300025298 Ga0209050_1002447 Ga0209050_100244712 256
576 3300025303 Ga0209051_1030316 Ga0209051_10303162 256
577 3300031911 Ga0307412_10012228 Ga0307412_100122284 256
578 3300032004 Ga0307414_10086664 Ga0307414_100866644 256
579 3300046471 Ga0495650_0000097 Ga0495650_0000097_4854_5675 256
580 3300046507 Ga0495606_0008580 Ga0495606_0008580_3283_4104 256
581 3300046507 Ga0495606_0018064 Ga0495606_0018064_1058_1849 256
582 3300046512 Ga0495610_0049877 Ga0495610_0049877_989_1810 256
583 3300046557 Ga0495622_0011541 Ga0495622_0011541_820_1641 256
584 3300046558 Ga0495633_0000362 Ga0495633_0000362_586_1407 256
585 3300046660 Ga0495625_0027829 Ga0495625_0027829_3102_3923 256
586 3300046664 Ga0495659_0050963 Ga0495659_0050963_38_808 256
587 3300046674 Ga0495588_0079899 Ga0495588_0079899_885_1655 256
588 3300048919 Ga0496116_0010198 Ga0496116_0010198_4716_5495 256
589 3300048920 Ga0496117_0041521 Ga0496117_0041521_926_1705 256
590 3300048920 Ga0496117_0056443 Ga0496117_0056443_298_1077 256
591 3300048921 Ga0496118_0039039 Ga0496118_0039039_1997_2776 256
592 3300048922 Ga0496119_0016500 Ga0496119_0016500_2284_3063 256
593 3300048922 Ga0496119_0101566 Ga0496119_0101566_383_1162 256
594 3300048923 Ga0496120_0015571 Ga0496120_0015571_1024_1803 256
595 3300048924 Ga0496121_0000629 Ga0496121_0000629_49326_50105 256
596 3300048924 Ga0496121_0008619 Ga0496121_0008619_2631_3509 256
597 3300048925 Ga0496122_0117489 Ga0496122_0117489_448_1227 256
598 3300048927 Ga0496124_0034686 Ga0496124_0034686_1270_2049 256
599 3300048927 Ga0496124_0213585 Ga0496124_0213585_415_1194 256
600 3300048928 Ga0496125_0000011 Ga0496125_0000011_244991_245770 256
601 3300048928 Ga0496125_0054414 Ga0496125_0054414_2341_3219 256
602 3300048929 Ga0496126_0211321 Ga0496126_0211321_450_1229 256
603 iso_pu_bacteria 2600255292 2601667357 256
604 iso_pu_bacteria 2643221664 2644357095 256
605 iso_pu_bacteria 2856287931 2856289720 256
606 iso_pu_bacteria 2857357740 2857364452 256
607 iso_pu_bacteria 2857547612 2857551919 256
608 iso_pu_bacteria 2932410948 2932410975 256
609 iso_pu_bacteria 2932416698 2932419458 256
610 3300006051 Ga0075364_10341785 Ga0075364_103417852 257
611 3300006058 Ga0075432_10030849 Ga0075432_100308492 257
612 3300015261 Ga0182006_1000117 Ga0182006_100011723 257
613 3300015265 Ga0182005_1000041 Ga0182005_1000041124 257
614 3300046492 Ga0495585_0011031 Ga0495585_0011031_545_1336 257
615 3300046499 Ga0495594_0140568 Ga0495594_0140568_312_1124 257
616 3300046507 Ga0495606_0018769 Ga0495606_0018769_1671_2453 257
617 3300046507 Ga0495606_0245644 Ga0495606_0245644_185_982 257
618 3300046518 Ga0495631_0026426 Ga0495631_0026426_905_1687 257
619 3300046518 Ga0495631_0047731 Ga0495631_0047731_509_1300 257
620 3300046526 Ga0495666_0077116 Ga0495666_0077116_260_1072 257
621 3300046616 Ga0495668_0045379 Ga0495668_0045379_517_1299 257
622 3300046648 Ga0495611_0038476 Ga0495611_0038476_1273_2064 257
623 3300047318 Ga0495636_0074556 Ga0495636_0074556_40_831 257
624 3300047321 Ga0495676_0069686 Ga0495676_0069686_1542_2333 257
625 3300047323 Ga0495683_0116354 Ga0495683_0116354_464_1246 257
626 3300048924 Ga0496121_0075172 Ga0496121_0075172_1188_1970 257
627 3300049575 Ga0501039_0516859 Ga0501039_0516859_116_898 257
628 3300050491 nmdc:mga00v17_128548_c1 nmdc:mga00v17_128548_c1_54_839 257
629 3300053149 Ga0500600_0049219 Ga0500600_0049219_1426_2211 257
630 iso_pu_bacteria 2643221603 2644028908 257
631 3300002739 JGI25158J39367_1008480 JGI25158J39367_10084802 258
632 3300002739 JGI25158J39367_1016487 JGI25158J39367_10164871 258
633 3300002773 JGI25152J39213_1002923 JGI25152J39213_10029232 258
634 3300002987 JGI25159J45721_1006004 JGI25159J45721_10060044 258
635 3300002987 JGI25159J45721_1007311 JGI25159J45721_10073112 258
636 3300002987 JGI25159J45721_1015535 JGI25159J45721_10155352 258
637 3300003187 JGI25151J46595_10000754 JGI25151J46595_100007545 258
638 3300003215 JGI25153J46596_10031865 JGI25153J46596_100318652 258
639 3300003323 rootH1_10083808 rootH1_100838081 258
640 3300003354 JGI25160J50197_1003901 JGI25160J50197_10039017 258
641 3300003374 JGI25161J50226_1004022 JGI25161J50226_10040222 258
642 3300003374 JGI25161J50226_1008087 JGI25161J50226_10080872 258
643 3300003771 Ga0055526_1007455 Ga0055526_10074556 258
644 3300003773 Ga0055537_1004930 Ga0055537_10049301 258
645 3300003775 Ga0055524_1047124 Ga0055524_10471241 258
646 3300003775 Ga0055524_1047152 Ga0055524_10471521 258
647 3300003790 Ga0055528_1004116 Ga0055528_10041163 258
648 3300003791 Ga0055530_10020486 Ga0055530_100204863 258
649 3300003794 Ga0055531_10013188 Ga0055531_100131885 258
650 3300003794 Ga0055531_10027502 Ga0055531_100275021 258
651 3300004625 Ga0055543_1009953 Ga0055543_10099531 258
652 3300004625 Ga0055543_1009954 Ga0055543_10099543 258
653 3300004625 Ga0055543_1017203 Ga0055543_10172031 258
654 3300005262 Ga0065165_1006735 Ga0065165_10067354 258
655 3300005262 Ga0065165_1031911 Ga0065165_10319111 258
656 3300013102 Ga0157371_10233358 Ga0157371_102333582 258
657 3300017792 Ga0163161_10057149 Ga0163161_100571493 258
658 3300025208 Ga0209436_101177 Ga0209436_1011775 258
659 3300025245 Ga0207425_1000001 Ga0207425_10000011737 258
660 3300025245 Ga0207425_1001380 Ga0207425_10013805 258
661 3300025245 Ga0207425_1022812 Ga0207425_10228122 258
662 3300025258 Ga0209129_1000001 Ga0209129_1000001914 258
663 3300025263 Ga0209565_1001770 Ga0209565_10017708 258
664 3300025263 Ga0209565_1003171 Ga0209565_10031715 258
665 3300025263 Ga0209565_1010035 Ga0209565_10100354 258
666 3300025273 Ga0209673_1004672 Ga0209673_10046727 258
667 3300025284 Ga0209130_1001997 Ga0209130_10019977 258
668 3300025284 Ga0209130_1003045 Ga0209130_10030455 258
669 3300025291 Ga0209675_1001513 Ga0209675_10015138 258
670 3300025291 Ga0209675_1015107 Ga0209675_10151071 258
671 3300025294 Ga0209025_1000040 Ga0209025_100004021 258
672 3300025295 Ga0209564_1002185 Ga0209564_100218514 258
673 3300025295 Ga0209564_1005493 Ga0209564_10054937 258
674 3300025297 Ga0209758_1000116 Ga0209758_1000116175 258
675 3300025298 Ga0209050_1006232 Ga0209050_10062327 258
676 3300025299 Ga0209256_1000872 Ga0209256_100087235 258
677 3300025299 Ga0209256_1015166 Ga0209256_10151662 258
678 3300025299 Ga0209256_1046659 Ga0209256_10466591 258
679 3300025302 Ga0207426_1002443 Ga0207426_10024435 258
680 3300025302 Ga0207426_1018276 Ga0207426_10182762 258
681 3300025304 Ga0209257_1000107 Ga0209257_10001077 258
682 3300030500 Ga0268256_1022011 Ga0268256_10220112 258
683 3300031548 Ga0307408_100054958 Ga0307408_1000549584 258
684 3300031548 Ga0307408_100178407 Ga0307408_1001784073 258
685 3300046460 Ga0495638_0000091 Ga0495638_0000091_38592_39413 258
686 3300046471 Ga0495650_0011137 Ga0495650_0011137_3015_3815 258
687 3300046471 Ga0495650_0013311 Ga0495650_0013311_318_1139 258
688 3300046506 Ga0495583_0004737 Ga0495583_0004737_4644_5465 258
689 3300046524 Ga0495648_0000058 Ga0495648_0000058_153230_154051 258
690 3300046528 Ga0495642_0008387 Ga0495642_0008387_1615_2436 258
691 3300046691 Ga0495670_0194016 Ga0495670_0194016_22_843 258
692 3300048912 Ga0496109_0161834 Ga0496109_0161834_186_1022 258
693 3300048919 Ga0496116_0041819 Ga0496116_0041819_1919_2764 258
694 3300048925 Ga0496122_0000706 Ga0496122_0000706_54193_54999 258
695 3300048926 Ga0496123_0002213 Ga0496123_0002213_4433_5239 258
696 3300049459 Ga0495678_031280 Ga0495678_031280_685_1506 258
697 3300049665 Ga0501227_006695 Ga0501227_006695_34_810 258
698 3300049665 Ga0501227_013193 Ga0501227_013193_527_1303 258
699 3300049760 Ga0501263_021092 Ga0501263_021092_44_820 258
700 3300049775 Ga0501279_001743 Ga0501279_001743_828_1604 258
701 3300049775 Ga0501279_005098 Ga0501279_005098_375_1151 258
702 iso_pu_bacteria 2643221594 2643980767 258
703 iso_pu_bacteria 2808606395 2809031916 258
704 3300006051 Ga0075364_10001152 Ga0075364_100011529 259
705 3300006051 Ga0075364_10001980 Ga0075364_100019802 259
706 3300037312 Ga0395899_0013076 Ga0395899_0013076_199_1038 259
707 3300037466 Ga0395898_0036464 Ga0395898_0036464_1120_1959 259
708 3300038443 Ga0395901_0027154 Ga0395901_0027154_4694_5533 259
709 3300046501 Ga0495607_0004852 Ga0495607_0004852_4085_4885 259
710 3300046507 Ga0495606_0060224 Ga0495606_0060224_1042_1872 259
711 3300046512 Ga0495610_0089529 Ga0495610_0089529_554_1360 259
712 3300046542 Ga0495597_0007071 Ga0495597_0007071_249_1079 259
713 3300046616 Ga0495668_0250272 Ga0495668_0250272_88_918 259
714 3300046660 Ga0495625_0049883 Ga0495625_0049883_1033_1863 259
715 3300047472 Ga0495686_0025509 Ga0495686_0025509_1340_2137 259
716 3300049569 Ga0501032_0074404 Ga0501032_0074404_188_1030 259
717 3300049581 Ga0501047_0103511 Ga0501047_0103511_1494_2336 259
718 3300049822 Ga0501035_0041176 Ga0501035_0041176_3125_3967 259
719 3300049823 Ga0501044_0006255 Ga0501044_0006255_2212_3054 259
720 3300050491 nmdc:mga00v17_28181_c1 nmdc:mga00v17_28181_c1_1965_2768 259
721 iso_pu_bacteria 2512047030 2512349859 259
722 iso_pu_bacteria 2515154122 2515683279 259
723 iso_pu_bacteria 2751185846 2753567407 259
724 iso_pu_bacteria 2857558681 2857561542 259
725 iso_pu_bacteria 2902682994 2902684042 259
726 3300039447 Ga0436361_0031202 Ga0436361_0031202_14910_15707 260
727 3300046557 Ga0495622_0003320 Ga0495622_0003320_3163_3984 260
728 3300046674 Ga0495588_0013666 Ga0495588_0013666_1158_1949 260
729 3300046674 Ga0495588_0109274 Ga0495588_0109274_304_1101 260
730 3300046691 Ga0495670_0118518 Ga0495670_0118518_485_1282 260
731 3300047318 Ga0495636_0001622 Ga0495636_0001622_6164_6961 260
732 3300047318 Ga0495636_0032135 Ga0495636_0032135_1332_2129 260
733 3300047447 Ga0495685_038351 Ga0495685_038351_809_1606 260
734 3300048905 Ga0496102_0034285 Ga0496102_0034285_1107_1904 260
735 3300048905 Ga0496102_0097127 Ga0496102_0097127_553_1350 260
736 3300003316 rootH1_10036699 rootH1_100366992 261
737 3300003544 Ga0007417J51691_1043165 Ga0007417J51691_10431652 261
738 3300003575 Ga0007409J51694_1012205 Ga0007409J51694_10122052 261
739 3300003577 Ga0007416J51690_1016785 Ga0007416J51690_10167852 261
740 3300003693 Ga0032354_1025073 Ga0032354_10250732 261
741 3300005337 Ga0070682_100003516 Ga0070682_1000035165 261
742 3300006051 Ga0075364_10087594 Ga0075364_100875941 261
743 3300037312 Ga0395899_0017856 Ga0395899_0017856_1517_2308 261
744 3300037418 Ga0395900_0101287 Ga0395900_0101287_380_1171 261
745 3300037471 Ga0395905_0139357 Ga0395905_0139357_769_1560 261
746 3300038443 Ga0395901_0098516 Ga0395901_0098516_1292_2083 261
747 3300039447 Ga0436361_0834273 Ga0436361_0834273_956_1741 261
748 3300044656 Ga0466969_0008614 Ga0466969_0008614_971_1759 261
749 3300044658 Ga0466972_0000192 Ga0466972_0000192_35450_36241 261
750 3300044658 Ga0466972_0043587 Ga0466972_0043587_969_1760 261
751 3300044659 Ga0466973_0083952 Ga0466973_0083952_495_1283 261
752 3300044683 Ga0466965_0001849 Ga0466965_0001849_2101_2892 261
753 3300044693 Ga0466961_0049598 Ga0466961_0049598_383_1171 261
754 3300044694 Ga0466963_0000942 Ga0466963_0000942_3408_4196 261
755 3300044706 Ga0466964_0005338 Ga0466964_0005338_2923_3714 261
756 3300044706 Ga0466964_0038970 Ga0466964_0038970_314_1105 261
757 3300044719 Ga0466971_0005212 Ga0466971_0005212_3825_4613 261
758 3300044735 Ga0466968_0192437 Ga0466968_0192437_12_800 261
759 3300044842 Ga0466957_0007250 Ga0466957_0007250_1120_1908 261
760 3300045049 Ga0466959_0015021 Ga0466959_0015021_1359_2147 261
761 3300045836 Ga0466958_0002486 Ga0466958_0002486_3701_4489 261
762 3300046507 Ga0495606_0035336 Ga0495606_0035336_1373_2158 261
763 3300046691 Ga0495670_0048684 Ga0495670_0048684_305_1090 261
764 3300046694 Ga0495649_0019829 Ga0495649_0019829_1733_2518 261
765 3300047323 Ga0495683_0005742 Ga0495683_0005742_1537_2322 261
766 3300047443 Ga0495687_018937 Ga0495687_018937_29_814 261
767 3300048907 Ga0496104_0130203 Ga0496104_0130203_1406_2191 261
768 3300053125 Ga0500618_008373 Ga0500618_008373_825_1760 261
769 3300059504 Ga0587082_000365 Ga0587082_000365_1117_1908 261
770 3300061719 Ga0466962_0015018 Ga0466962_0015018_335_1123 261
771 3300021361 Ga0213872_10010040 Ga0213872_100100402 262
772 iso_pu_bacteria 2808606390 2809002762 262
773 iso_pu_bacteria 2808606391 2809010040 262
774 3300046457 Ga0495590_0052106 Ga0495590_0052106_329_1129 263
775 3300046528 Ga0495642_0059231 Ga0495642_0059231_689_1489 263
776 3300047443 Ga0495687_000021 Ga0495687_000021_283512_284312 263
777 3300002067 JGI24735J21928_10000719 JGI24735J21928_100007196 264
778 3300005327 Ga0070658_10054369 Ga0070658_100543694 264
779 3300005339 Ga0070660_100001488 Ga0070660_10000148811 264
780 3300005563 Ga0068855_100009698 Ga0068855_1000096987 264
781 3300009093 Ga0105240_10010653 Ga0105240_100106536 264
782 3300009545 Ga0105237_10012467 Ga0105237_100124674 264
783 3300010375 Ga0105239_10016723 Ga0105239_100167236 264
784 3300013100 Ga0157373_10006691 Ga0157373_100066917 264
785 3300013104 Ga0157370_10002758 Ga0157370_1000275810 264
786 3300013105 Ga0157369_10038628 Ga0157369_100386285 264
787 3300013296 Ga0157374_10000081 Ga0157374_1000008150 264
788 3300013307 Ga0157372_10008688 Ga0157372_100086887 264
789 3300015261 Ga0182006_1059580 Ga0182006_10595802 264
790 3300025228 Ga0209672_100248 Ga0209672_10024812 264
791 3300025256 Ga0209759_1001733 Ga0209759_100173310 264
792 3300025904 Ga0207647_10000377 Ga0207647_1000037721 264
793 3300025914 Ga0207671_10048109 Ga0207671_100481094 264
794 3300025919 Ga0207657_10003157 Ga0207657_100031576 264
795 3300025949 Ga0207667_10009877 Ga0207667_1000987710 264
796 3300042005 Ga0439448_0007230 Ga0439448_0007230_159_956 264
797 3300009093 Ga0105240_10096722 Ga0105240_100967224 265
798 3300009551 Ga0105238_10226557 Ga0105238_102265572 265
799 3300013105 Ga0157369_10247455 Ga0157369_102474552 265
800 3300025206 Ga0209435_105127 Ga0209435_1051271 265
801 3300025256 Ga0209759_1023697 Ga0209759_10236972 265
802 3300025914 Ga0207671_10130312 Ga0207671_101303123 265
803 3300037471 Ga0395905_0041046 Ga0395905_0041046_3315_4112 265
804 3300045976 Ga0466967_0130670 Ga0466967_0130670_781_1578 265
805 3300046459 Ga0495629_0161255 Ga0495629_0161255_565_1362 265
806 3300046463 Ga0495653_0069332 Ga0495653_0069332_1349_2146 265
807 3300046463 Ga0495653_0126508 Ga0495653_0126508_887_1684 265
808 3300046472 Ga0495580_0447359 Ga0495580_0447359_26_823 265
809 3300046477 Ga0495664_0066884 Ga0495664_0066884_221_1018 265
810 3300046516 Ga0495628_0009289 Ga0495628_0009289_76_873 265
811 3300046531 Ga0495665_0018229 Ga0495665_0018229_765_1562 265
812 3300046543 Ga0495645_0054969 Ga0495645_0054969_1779_2576 265
813 3300046679 Ga0495623_0008290 Ga0495623_0008290_4879_5676 265
814 3300046680 Ga0495646_0004544 Ga0495646_0004544_364_1161 265
815 3300046690 Ga0495624_0016989 Ga0495624_0016989_3719_4516 265
816 3300047315 Ga0495581_0173822 Ga0495581_0173822_388_1185 265
817 3300047317 Ga0495604_0071816 Ga0495604_0071816_581_1378 265
818 3300047322 Ga0495680_0030223 Ga0495680_0030223_2645_3442 265
819 3300047673 Ga0495593_0005097 Ga0495593_0005097_1629_2426 265
820 3300047673 Ga0495593_0069724 Ga0495593_0069724_833_1630 265
821 3300048088 Ga0495602_0031307 Ga0495602_0031307_392_1189 265
822 3300048903 Ga0496100_0175886 Ga0496100_0175886_420_1217 265
823 3300048904 Ga0496101_0157887 Ga0496101_0157887_636_1433 265
824 3300048907 Ga0496104_0055517 Ga0496104_0055517_400_1197 265
825 3300048908 Ga0496105_0032536 Ga0496105_0032536_3031_3828 265
826 3300048918 Ga0496115_0364063 Ga0496115_0364063_254_1051 265
827 3300048921 Ga0496118_0085707 Ga0496118_0085707_345_1142 265
828 3300048922 Ga0496119_0027964 Ga0496119_0027964_1636_2433 265
829 3300048929 Ga0496126_0366789 Ga0496126_0366789_291_1088 265
830 3300002067 JGI24735J21928_10000708 JGI24735J21928_100007082 266
831 3300009011 Ga0105251_10015012 Ga0105251_100150122 266
832 3300009093 Ga0105240_10211287 Ga0105240_102112871 266
833 3300013296 Ga0157374_10189232 Ga0157374_101892322 266
834 3300025302 Ga0207426_1043648 Ga0207426_10436482 266
835 3300025735 Ga0207713_1014316 Ga0207713_10143162 266
836 3300025904 Ga0207647_10011303 Ga0207647_100113032 266
837 3300025913 Ga0207695_10244596 Ga0207695_102445961 266
838 3300046457 Ga0495590_0003715 Ga0495590_0003715_1644_2444 266
839 3300046491 Ga0495584_0135943 Ga0495584_0135943_222_1022 266
840 3300046542 Ga0495597_0018648 Ga0495597_0018648_1643_2443 266
841 3300047323 Ga0495683_0006197 Ga0495683_0006197_2375_3175 266
842 3300047443 Ga0495687_102422 Ga0495687_102422_241_1041 266
843 3300048903 Ga0496100_0054399 Ga0496100_0054399_1056_1856 266
844 3300048904 Ga0496101_0213506 Ga0496101_0213506_58_858 266
845 3300048906 Ga0496103_0015400 Ga0496103_0015400_3103_3903 266
846 3300048908 Ga0496105_0227534 Ga0496105_0227534_630_1430 266
847 3300048909 Ga0496106_0029689 Ga0496106_0029689_2976_3776 266
848 3300048910 Ga0496107_0034666 Ga0496107_0034666_1292_2092 266
849 3300048912 Ga0496109_0044419 Ga0496109_0044419_1520_2320 266
850 3300048913 Ga0496110_0043506 Ga0496110_0043506_2517_3317 266
851 3300048914 Ga0496111_0012790 Ga0496111_0012790_4616_5416 266
852 3300048915 Ga0496112_0089730 Ga0496112_0089730_1958_2758 266
853 3300048916 Ga0496113_0061979 Ga0496113_0061979_1839_2639 266
854 3300048919 Ga0496116_0024544 Ga0496116_0024544_510_1310 266
855 3300048920 Ga0496117_0068370 Ga0496117_0068370_311_1111 266
856 3300048921 Ga0496118_0055612 Ga0496118_0055612_277_1077 266
857 3300048922 Ga0496119_0196603 Ga0496119_0196603_118_918 266
858 3300048924 Ga0496121_0033068 Ga0496121_0033068_3488_4288 266
859 3300048925 Ga0496122_0115739 Ga0496122_0115739_308_1108 266
860 3300048926 Ga0496123_0007938 Ga0496123_0007938_7680_8480 266
861 3300048927 Ga0496124_0015653 Ga0496124_0015653_4934_5734 266
862 3300048928 Ga0496125_0060012 Ga0496125_0060012_1448_2248 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

49

112

0.99

PF07702

UTRA

UTRA domain

134

275

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r1h-assembly1.cif.gz_B gntr family transcriptional regulator from listeria monocytogenes 0.9496 29 97
4h0e-assembly1.cif.gz_A crystal structure of mutant orr3 in complex with ntd of arar 0.9476 29 97
2ek5-assembly4.cif.gz_C crystal structure of the transcriptional factor from c.glutamicum at 2.2 angstrom resolution 0.9461 31 98
2ek5-assembly4.cif.gz_C-3 crystal structure of the transcriptional factor from c.glutamicum at 2.2 angstrom resolution 0.9461 31 98
3cnv-assembly1.cif.gz_A crystal structure of the ligand-binding domain of a putative gntr-family transcriptional regulator from bordetella bronchiseptica 0.9407 104 264
ID Description Score Start End Superfamily
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9948 55 96 1.10.10.10
af_P31475_2_79_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9829 33 98 1.10.10.10
af_Q2FZ17_2_72_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9674 33 98 1.10.10.10
af_P9WMG7_15_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9671 33 98 1.10.10.10
af_P0A8W0_27_98_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9665 31 97 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4R8XME7-F1-model_v4 FadR family transcriptional regulator 0.9891 29 98 GO:0003677
GO:0003700
AF-U2DZG5-F1-model_v4 Transcriptional regulator, GntR family 0.9852 31 98 GO:0003677
GO:0003700
GO:0005737
AF-A0A1V6FD53-F1-model_v4 HTH-type transcriptional regulator GmuR 0.9823 33 101 GO:0003677
GO:0003700
GO:0045892
AF-A0A6I4P2X8-F1-model_v4 FCD domain-containing protein 0.9808 33 98 GO:0003677
GO:0003700
AF-A0A1I5C458-F1-model_v4 DNA-binding transcriptional regulator, FadR family 0.9805 33 99 GO:0003677
GO:0003700

Feature Viewer

pLDDT pTM Quality
84.6 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map