F483898
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 862 | 381 | 812 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300048919|Ga0496116_0041819|Ga0496116_0041819_1919_2764 |
| Length | 281 |
| Sequence | VFRIVFALPPIIRMNMTLSRRSMAEPRPETSLRTRAARSTGEGAAFSPLYRQIKDLLVQSLERGEWKPGELIPSEIDLAARFQVSQGTVRKAVDELAAEHMLLRRQGKGTFVATHHEARVRYRFLRLAADEEGEPGRAESRILECRRLRAPAEIARALDLRAGETVVMIRRLLSMGQTPTVVDDIWLPGSIFRGLTLELLTANKAPLYGLFESEFGVSMVRADEKLRAVIAPAEVCPLLNVPAGTPLLQVDRVSYTYGDRPMEIRRGLYLTDRYHYRNSLN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 2 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 3 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 4 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 5 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 6 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 7 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 8 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 9 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 10 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 11 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 12 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 13 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 14 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 15 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 16 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 17 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 18 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 19 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 20 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 21 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 22 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 23 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 24 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 25 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 26 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 27 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 28 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 29 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 30 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 31 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 32 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 33 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 34 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 35 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 36 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 37 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 38 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 39 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 40 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 41 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 42 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 43 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 44 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 45 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 46 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 47 | 2941479691 | |||
| 48 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 49 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 50 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 51 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 52 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 53 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 54 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 55 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 56 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 57 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 58 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 59 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 60 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 61 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 62 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 63 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 64 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 65 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 66 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 67 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 68 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 69 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 70 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 71 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 72 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 73 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 74 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 97 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 99 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 100 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 101 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 103 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 104 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 107 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 128 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 129 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 136 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 137 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 169 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 174 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 177 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 178 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 179 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 182 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 184 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 185 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 188 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 189 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 190 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 191 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 192 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 194 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 195 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 199 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 200 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 201 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 202 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 203 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 204 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 205 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 206 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 207 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 208 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 209 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 210 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 211 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 212 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 213 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 214 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 215 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 216 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 217 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 218 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 219 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 220 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 221 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 222 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 223 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 314 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 322 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 323 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 324 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 325 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 326 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 327 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 328 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 329 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 330 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 331 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 332 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 333 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 334 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 335 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 336 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 337 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 355 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 356 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 357 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 358 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 359 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 362 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 363 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 364 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 365 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 366 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 368 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 369 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 371 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 372 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 373 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 374 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 375 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 376 | 3300053738 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere | Metagenome | Endosphere |
| 377 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 379 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 380 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 381 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.62 |
| Metatranscriptomes | 0.58 |
| Isolates | 5.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.88 |
| Nodule | 0.7 |
| Rhizoplane | 5.22 |
| Rhizosphere | 69.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10000708 | 3300002067 | Bacteria | 11803 |
| 2 | JGI24735J21928_10000719 | 3300002067 | Bacteria | 11750 |
| 3 | JGI25154J39366_1000747 | 3300002738 | Bacteria | 14585 |
| 4 | JGI25158J39367_1008480 | 3300002739 | Bacteria | 1428 |
| 5 | JGI25158J39367_1016487 | 3300002739 | Bacteria | 934 |
| 6 | JGI25152J39213_1002923 | 3300002773 | Bacteria | 6090 |
| 7 | JGI25159J45721_1006004 | 3300002987 | Bacteria | 3711 |
| 8 | JGI25159J45721_1007311 | 3300002987 | Bacteria | 3177 |
| 9 | JGI25159J45721_1015535 | 3300002987 | Bacteria | 1663 |
| 10 | JGI25151J46595_10000754 | 3300003187 | Bacteria | 26355 |
| 11 | JGI25153J46596_10031865 | 3300003215 | Bacteria | 1767 |
| 12 | rootH1_10036699 | 3300003316 | Bacteria | 2062 |
| 13 | rootH2_10077414 | 3300003320 | Bacteria | 2003 |
| 14 | rootH1_10083808 | 3300003323 | Bacteria | 1180 |
| 15 | JGI25160J50197_1003901 | 3300003354 | Bacteria | 6536 |
| 16 | JGI25161J50226_1004022 | 3300003374 | Bacteria | 3177 |
| 17 | JGI25161J50226_1008087 | 3300003374 | Bacteria | 1663 |
| 18 | Ga0007417J51691_1043165 | 3300003544 | Bacteria | 2513 |
| 19 | Ga0007409J51694_1012205 | 3300003575 | Bacteria | 6710 |
| 20 | Ga0007416J51690_1016785 | 3300003577 | Bacteria | 6700 |
| 21 | Ga0032354_1025073 | 3300003693 | Bacteria | 6712 |
| 22 | Ga0055529_1000095 | 3300003763 | Bacteria | 134030 |
| 23 | Ga0055529_1000980 | 3300003763 | Bacteria | 14245 |
| 24 | Ga0055526_1000066 | 3300003771 | Bacteria | 101329 |
| 25 | Ga0055526_1004314 | 3300003771 | Bacteria | 8592 |
| 26 | Ga0055526_1007455 | 3300003771 | Bacteria | 5679 |
| 27 | Ga0055537_1001124 | 3300003773 | Bacteria | 11528 |
| 28 | Ga0055537_1004930 | 3300003773 | Bacteria | 3690 |
| 29 | Ga0055524_1001075 | 3300003775 | Bacteria | 16780 |
| 30 | Ga0055524_1010843 | 3300003775 | Bacteria | 3603 |
| 31 | Ga0055524_1047124 | 3300003775 | Bacteria | 1018 |
| 32 | Ga0055524_1047152 | 3300003775 | Bacteria | 1018 |
| 33 | Ga0055534_1001481 | 3300003784 | Bacteria | 9319 |
| 34 | Ga0055534_1001729 | 3300003784 | Bacteria | 8261 |
| 35 | Ga0055528_1000089 | 3300003790 | Bacteria | 72690 |
| 36 | Ga0055528_1004116 | 3300003790 | Bacteria | 7090 |
| 37 | Ga0055530_10020486 | 3300003791 | Bacteria | 1974 |
| 38 | Ga0055531_10013188 | 3300003794 | Bacteria | 3830 |
| 39 | Ga0055531_10027502 | 3300003794 | Bacteria | 1993 |
| 40 | Ga0055543_1009953 | 3300004625 | Bacteria | 2016 |
| 41 | Ga0055543_1009954 | 3300004625 | Bacteria | 2016 |
| 42 | Ga0055543_1017203 | 3300004625 | Bacteria | 1363 |
| 43 | Ga0065165_1006735 | 3300005262 | Bacteria | 5892 |
| 44 | Ga0065165_1031911 | 3300005262 | Bacteria | 1658 |
| 45 | Ga0070658_10054369 | 3300005327 | Bacteria | 3251 |
| 46 | Ga0070682_100003516 | 3300005337 | Bacteria | 8669 |
| 47 | Ga0070682_100190768 | 3300005337 | Bacteria | 1439 |
| 48 | Ga0070660_100001488 | 3300005339 | Bacteria | 16033 |
| 49 | Ga0070660_100074357 | 3300005339 | Bacteria | 2658 |
| 50 | Ga0070661_100003676 | 3300005344 | Bacteria | 10569 |
| 51 | Ga0070675_100133398 | 3300005354 | Bacteria | 2118 |
| 52 | Ga0070659_100032204 | 3300005366 | Bacteria | 4065 |
| 53 | Ga0070701_10039430 | 3300005438 | Bacteria | 2396 |
| 54 | Ga0070663_100051650 | 3300005455 | Bacteria | 2930 |
| 55 | Ga0070698_100588188 | 3300005471 | Bacteria | 1053 |
| 56 | Ga0070679_100223171 | 3300005530 | Bacteria | 1845 |
| 57 | Ga0068853_100029851 | 3300005539 | Bacteria | 4600 |
| 58 | Ga0070693_100239355 | 3300005547 | Bacteria | 1198 |
| 59 | Ga0068855_100009698 | 3300005563 | Bacteria | 11623 |
| 60 | Ga0068855_100301870 | 3300005563 | Bacteria | 1773 |
| 61 | Ga0070664_100018147 | 3300005564 | Bacteria | 5775 |
| 62 | Ga0068857_100219076 | 3300005577 | Bacteria | 1738 |
| 63 | Ga0068852_100011442 | 3300005616 | Bacteria | 6680 |
| 64 | Ga0068859_100058550 | 3300005617 | Bacteria | 3881 |
| 65 | Ga0068851_10003355 | 3300005834 | Bacteria | 7121 |
| 66 | Ga0068860_100617989 | 3300005843 | Bacteria | 1090 |
| 67 | Ga0075365_10064714 | 3300006038 | Bacteria | 2450 |
| 68 | Ga0075368_10030698 | 3300006042 | Bacteria | 2081 |
| 69 | Ga0075364_10000886 | 3300006051 | Bacteria | 15806 |
| 70 | Ga0075364_10001152 | 3300006051 | Bacteria | 14128 |
| 71 | Ga0075364_10001980 | 3300006051 | Bacteria | 11417 |
| 72 | Ga0075364_10087594 | 3300006051 | Bacteria | 2064 |
| 73 | Ga0075364_10341785 | 3300006051 | Bacteria | 1020 |
| 74 | Ga0075432_10030849 | 3300006058 | Bacteria | 1854 |
| 75 | Ga0070716_100063383 | 3300006173 | Bacteria | 2146 |
| 76 | Ga0075362_10202969 | 3300006177 | Bacteria | 965 |
| 77 | Ga0075367_10022549 | 3300006178 | Bacteria | 3533 |
| 78 | Ga0075366_10042195 | 3300006195 | Bacteria | 2701 |
| 79 | Ga0097621_100021443 | 3300006237 | Bacteria | 4998 |
| 80 | Ga0075370_10161447 | 3300006353 | Bacteria | 1315 |
| 81 | Ga0068871_100073517 | 3300006358 | Bacteria | 2818 |
| 82 | Ga0075428_100041048 | 3300006844 | Bacteria | 5089 |
| 83 | Ga0097620_100058551 | 3300006931 | Bacteria | 3881 |
| 84 | Ga0099826_10000001 | 3300006948 | Bacteria | 1155201 |
| 85 | Ga0105251_10015012 | 3300009011 | Bacteria | 4250 |
| 86 | Ga0105244_10006792 | 3300009036 | Bacteria | 7359 |
| 87 | Ga0105244_10013139 | 3300009036 | Bacteria | 4851 |
| 88 | Ga0105240_10010653 | 3300009093 | Bacteria | 12910 |
| 89 | Ga0105240_10043233 | 3300009093 | Bacteria | 5734 |
| 90 | Ga0105240_10096722 | 3300009093 | Bacteria | 3598 |
| 91 | Ga0105240_10211287 | 3300009093 | Bacteria | 2267 |
| 92 | Ga0111539_10000107 | 3300009094 | Bacteria | 89993 |
| 93 | Ga0111539_10001299 | 3300009094 | Bacteria | 33371 |
| 94 | Ga0105245_10421619 | 3300009098 | Bacteria | 1338 |
| 95 | Ga0105248_10088952 | 3300009177 | Bacteria | 3476 |
| 96 | Ga0105237_10012467 | 3300009545 | Bacteria | 8959 |
| 97 | Ga0105238_10226557 | 3300009551 | Bacteria | 1846 |
| 98 | Ga0105238_10705511 | 3300009551 | Bacteria | 1021 |
| 99 | Ga0105239_10016723 | 3300010375 | Bacteria | 8108 |
| 100 | Ga0157373_10006691 | 3300013100 | Bacteria | 8582 |
| 101 | Ga0157371_10000001 | 3300013102 | Bacteria | 1162285 |
| 102 | Ga0157371_10233358 | 3300013102 | Bacteria | 1323 |
| 103 | Ga0157370_10002758 | 3300013104 | Bacteria | 20991 |
| 104 | Ga0157369_10038628 | 3300013105 | Bacteria | 5219 |
| 105 | Ga0157369_10247455 | 3300013105 | Bacteria | 1861 |
| 106 | Ga0157374_10000081 | 3300013296 | Bacteria | 95406 |
| 107 | Ga0157374_10104290 | 3300013296 | Bacteria | 2722 |
| 108 | Ga0157374_10189232 | 3300013296 | Bacteria | 2013 |
| 109 | Ga0163162_10203933 | 3300013306 | Bacteria | 2107 |
| 110 | Ga0163162_10358257 | 3300013306 | Bacteria | 1592 |
| 111 | Ga0157372_10008688 | 3300013307 | Bacteria | 10787 |
| 112 | Ga0182006_1000002 | 3300015261 | Bacteria | 887990 |
| 113 | Ga0182006_1000117 | 3300015261 | Bacteria | 85963 |
| 114 | Ga0182006_1059580 | 3300015261 | Bacteria | 1445 |
| 115 | Ga0182007_10000045 | 3300015262 | Bacteria | 106028 |
| 116 | Ga0182007_10033599 | 3300015262 | Bacteria | 1737 |
| 117 | Ga0182005_1000002 | 3300015265 | Bacteria | 908499 |
| 118 | Ga0182005_1000041 | 3300015265 | Bacteria | 150123 |
| 119 | Ga0163161_10057149 | 3300017792 | Bacteria | 2835 |
| 120 | Ga0163161_10104398 | 3300017792 | Bacteria | 2112 |
| 121 | Ga0163161_10420463 | 3300017792 | Bacteria | 1075 |
| 122 | Ga0213872_10002205 | 3300021361 | Bacteria | 11672 |
| 123 | Ga0213872_10010040 | 3300021361 | Bacteria | 4517 |
| 124 | Ga0213872_10059969 | 3300021361 | Bacteria | 1721 |
| 125 | Ga0209435_105127 | 3300025206 | Bacteria | 1471 |
| 126 | Ga0209436_101177 | 3300025208 | Bacteria | 9625 |
| 127 | Ga0209672_100248 | 3300025228 | Bacteria | 40285 |
| 128 | Ga0209672_103946 | 3300025228 | Bacteria | 2894 |
| 129 | Ga0209437_102900 | 3300025233 | Bacteria | 3204 |
| 130 | Ga0209258_105681 | 3300025242 | Bacteria | 2071 |
| 131 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 132 | Ga0207425_1000479 | 3300025245 | Bacteria | 25399 |
| 133 | Ga0207425_1001380 | 3300025245 | Bacteria | 10272 |
| 134 | Ga0207425_1022812 | 3300025245 | Bacteria | 1315 |
| 135 | Ga0209646_1000010 | 3300025246 | Bacteria | 573803 |
| 136 | Ga0209026_1004031 | 3300025250 | Bacteria | 4549 |
| 137 | Ga0209759_1001733 | 3300025256 | Bacteria | 11218 |
| 138 | Ga0209759_1023697 | 3300025256 | Bacteria | 1344 |
| 139 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 140 | Ga0209565_1000009 | 3300025263 | Bacteria | 751701 |
| 141 | Ga0209565_1001770 | 3300025263 | Bacteria | 8775 |
| 142 | Ga0209565_1003171 | 3300025263 | Bacteria | 5464 |
| 143 | Ga0209565_1010035 | 3300025263 | Bacteria | 2366 |
| 144 | Ga0209565_1019027 | 3300025263 | Bacteria | 1474 |
| 145 | Ga0209455_1000121 | 3300025272 | Bacteria | 173350 |
| 146 | Ga0209455_1000305 | 3300025272 | Bacteria | 50363 |
| 147 | Ga0209673_1000019 | 3300025273 | Bacteria | 449094 |
| 148 | Ga0209673_1004672 | 3300025273 | Bacteria | 7229 |
| 149 | Ga0209130_1001997 | 3300025284 | Bacteria | 11153 |
| 150 | Ga0209130_1003045 | 3300025284 | Bacteria | 7558 |
| 151 | Ga0209675_1000028 | 3300025291 | Bacteria | 281253 |
| 152 | Ga0209675_1001513 | 3300025291 | Bacteria | 13295 |
| 153 | Ga0209675_1015107 | 3300025291 | Bacteria | 2311 |
| 154 | Ga0209676_1006174 | 3300025292 | Bacteria | 6001 |
| 155 | Ga0209025_1000040 | 3300025294 | Bacteria | 376228 |
| 156 | Ga0209025_1007797 | 3300025294 | Bacteria | 7874 |
| 157 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 158 | Ga0209564_1000033 | 3300025295 | Bacteria | 446200 |
| 159 | Ga0209564_1000058 | 3300025295 | Bacteria | 332955 |
| 160 | Ga0209564_1002185 | 3300025295 | Bacteria | 16412 |
| 161 | Ga0209564_1005493 | 3300025295 | Bacteria | 7208 |
| 162 | Ga0209758_1000116 | 3300025297 | Bacteria | 198356 |
| 163 | Ga0209758_1000842 | 3300025297 | Bacteria | 42797 |
| 164 | Ga0209050_1002447 | 3300025298 | Bacteria | 15918 |
| 165 | Ga0209050_1006232 | 3300025298 | Bacteria | 7145 |
| 166 | Ga0209256_1000005 | 3300025299 | Bacteria | 1315082 |
| 167 | Ga0209256_1000052 | 3300025299 | Bacteria | 299374 |
| 168 | Ga0209256_1000872 | 3300025299 | Bacteria | 37384 |
| 169 | Ga0209256_1015166 | 3300025299 | Bacteria | 2715 |
| 170 | Ga0209256_1046659 | 3300025299 | Bacteria | 1070 |
| 171 | Ga0207426_1002443 | 3300025302 | Bacteria | 11859 |
| 172 | Ga0207426_1018276 | 3300025302 | Bacteria | 2473 |
| 173 | Ga0207426_1043648 | 3300025302 | Bacteria | 1376 |
| 174 | Ga0209051_1030316 | 3300025303 | Bacteria | 2101 |
| 175 | Ga0209257_1000107 | 3300025304 | Bacteria | 240937 |
| 176 | Ga0207656_10029214 | 3300025321 | Bacteria | 2269 |
| 177 | Ga0207713_1014316 | 3300025735 | Bacteria | 4130 |
| 178 | Ga0207647_10000377 | 3300025904 | Bacteria | 36280 |
| 179 | Ga0207647_10011303 | 3300025904 | Bacteria | 6267 |
| 180 | Ga0207695_10050171 | 3300025913 | Bacteria | 4392 |
| 181 | Ga0207695_10244596 | 3300025913 | Bacteria | 1694 |
| 182 | Ga0207671_10048109 | 3300025914 | Bacteria | 3156 |
| 183 | Ga0207671_10130312 | 3300025914 | Bacteria | 1930 |
| 184 | Ga0207657_10003157 | 3300025919 | Bacteria | 17624 |
| 185 | Ga0207657_10006756 | 3300025919 | Bacteria | 11851 |
| 186 | Ga0207649_10002906 | 3300025920 | Bacteria | 9428 |
| 187 | Ga0207659_10137954 | 3300025926 | Bacteria | 1890 |
| 188 | Ga0207690_10020255 | 3300025932 | Bacteria | 4107 |
| 189 | Ga0207665_10113327 | 3300025939 | Bacteria | 1908 |
| 190 | Ga0207711_10025198 | 3300025941 | Bacteria | 4990 |
| 191 | Ga0207679_10001073 | 3300025945 | Bacteria | 17411 |
| 192 | Ga0207667_10009877 | 3300025949 | Bacteria | 11200 |
| 193 | Ga0207667_10315435 | 3300025949 | Bacteria | 1597 |
| 194 | Ga0207639_10021597 | 3300026041 | Bacteria | 4626 |
| 195 | Ga0207674_10124466 | 3300026116 | Bacteria | 2544 |
| 196 | Ga0207698_10009505 | 3300026142 | Bacteria | 6203 |
| 197 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 198 | Ga0209813_10021743 | 3300027866 | Bacteria | 1807 |
| 199 | Ga0207428_10000040 | 3300027907 | Bacteria | 210887 |
| 200 | Ga0207428_10007402 | 3300027907 | Bacteria | 10011 |
| 201 | Ga0268264_10484293 | 3300028381 | Bacteria | 1204 |
| 202 | Ga0265336_10000151 | 3300028666 | Bacteria | 49239 |
| 203 | Ga0307515_10204967 | 3300028794 | Bacteria | 1836 |
| 204 | Ga0265324_10000001 | 3300029957 | Bacteria | 562975 |
| 205 | Ga0265324_10067957 | 3300029957 | Bacteria | 1215 |
| 206 | Ga0268256_1022011 | 3300030500 | Bacteria | 1682 |
| 207 | Ga0316180_1030800 | 3300030736 | Bacteria | 6023 |
| 208 | Ga0316181_1157853 | 3300030744 | Bacteria | 2409 |
| 209 | Ga0265325_10000046 | 3300031241 | Bacteria | 83850 |
| 210 | Ga0265327_10001290 | 3300031251 | Bacteria | 32882 |
| 211 | Ga0307408_100010634 | 3300031548 | Bacteria | 6071 |
| 212 | Ga0307408_100054958 | 3300031548 | Bacteria | 2880 |
| 213 | Ga0307408_100178407 | 3300031548 | Bacteria | 1701 |
| 214 | Ga0316575_10012821 | 3300031665 | Bacteria | 3125 |
| 215 | Ga0265314_10029905 | 3300031711 | Bacteria | 4041 |
| 216 | Ga0316576_10006838 | 3300031727 | Bacteria | 7128 |
| 217 | Ga0316577_10040651 | 3300031733 | Bacteria | 2601 |
| 218 | Ga0307518_10005417 | 3300031838 | Bacteria | 9125 |
| 219 | Ga0307412_10012228 | 3300031911 | Bacteria | 4994 |
| 220 | Ga0307414_10086664 | 3300032004 | Bacteria | 2311 |
| 221 | Ga0307414_10126035 | 3300032004 | Bacteria | 1979 |
| 222 | Ga0307414_10378650 | 3300032004 | Bacteria | 1223 |
| 223 | Ga0316574_0001661 | 3300035398 | Bacteria | 10714 |
| 224 | Ga0316574_0040301 | 3300035398 | Bacteria | 2876 |
| 225 | Ga0373927_0086727 | 3300035695 | Bacteria | 2032 |
| 226 | Ga0373947_0089646 | 3300035725 | Bacteria | 1916 |
| 227 | Ga0316584_0408033 | 3300036712 | Unclassified | 967 |
| 228 | Ga0373925_0015424 | 3300037068 | Bacteria | 5525 |
| 229 | Ga0395899_0000028 | 3300037312 | Bacteria | 334378 |
| 230 | Ga0395899_0013076 | 3300037312 | Bacteria | 6347 |
| 231 | Ga0395899_0017856 | 3300037312 | Bacteria | 5402 |
| 232 | Ga0395900_0025979 | 3300037418 | Bacteria | 5996 |
| 233 | Ga0395900_0085072 | 3300037418 | Bacteria | 3250 |
| 234 | Ga0395900_0101287 | 3300037418 | Bacteria | 2958 |
| 235 | Ga0395900_0761271 | 3300037418 | Bacteria | 898 |
| 236 | Ga0395898_0036464 | 3300037466 | Bacteria | 4882 |
| 237 | Ga0395905_0041046 | 3300037471 | Bacteria | 4341 |
| 238 | Ga0395905_0068788 | 3300037471 | Bacteria | 3317 |
| 239 | Ga0395905_0139357 | 3300037471 | Bacteria | 2282 |
| 240 | Ga0395905_0235480 | 3300037471 | Bacteria | 1712 |
| 241 | Ga0395901_0027154 | 3300038443 | Bacteria | 5880 |
| 242 | Ga0395901_0033321 | 3300038443 | Bacteria | 5318 |
| 243 | Ga0395901_0098516 | 3300038443 | Bacteria | 3065 |
| 244 | Ga0395901_0228169 | 3300038443 | Bacteria | 1945 |
| 245 | Ga0400489_50965 | 3300039093 | Bacteria | 2963 |
| 246 | Ga0400487_55311 | 3300039110 | Bacteria | 1709 |
| 247 | Ga0436361_0031202 | 3300039447 | Bacteria | 17500 |
| 248 | Ga0436361_0139948 | 3300039447 | Bacteria | 3190 |
| 249 | Ga0436361_0404930 | 3300039447 | Bacteria | 2737 |
| 250 | Ga0436361_0834273 | 3300039447 | Bacteria | 2222 |
| 251 | Ga0436361_0974268 | 3300039447 | Bacteria | 66829 |
| 252 | Ga0439448_0007230 | 3300042005 | Bacteria | 3212 |
| 253 | Ga0450897_001563 | 3300042128 | Bacteria | 1576 |
| 254 | Ga0450904_001501 | 3300042139 | Bacteria | 3221 |
| 255 | Ga0451577_0013625 | 3300042876 | Bacteria | 7603 |
| 256 | Ga0451577_0044750 | 3300042876 | Bacteria | 3962 |
| 257 | Ga0451577_0046163 | 3300042876 | Bacteria | 3897 |
| 258 | Ga0451577_0479241 | 3300042876 | Bacteria | 1129 |
| 259 | Ga0466969_0008614 | 3300044656 | Bacteria | 5410 |
| 260 | Ga0466969_0053685 | 3300044656 | Bacteria | 1976 |
| 261 | Ga0466972_0000192 | 3300044658 | Bacteria | 47005 |
| 262 | Ga0466972_0043587 | 3300044658 | Bacteria | 2178 |
| 263 | Ga0466973_0083952 | 3300044659 | Bacteria | 2775 |
| 264 | Ga0453683_0018493 | 3300044673 | Bacteria | 4475 |
| 265 | Ga0453683_0171527 | 3300044673 | Bacteria | 1374 |
| 266 | Ga0453683_0192197 | 3300044673 | Bacteria | 1295 |
| 267 | Ga0466965_0001849 | 3300044683 | Bacteria | 8798 |
| 268 | Ga0466966_0009507 | 3300044684 | Bacteria | 6437 |
| 269 | Ga0466966_0062085 | 3300044684 | Bacteria | 2356 |
| 270 | Ga0466961_0030473 | 3300044693 | Bacteria | 3467 |
| 271 | Ga0466961_0049598 | 3300044693 | Bacteria | 2682 |
| 272 | Ga0466963_0000942 | 3300044694 | Bacteria | 14885 |
| 273 | Ga0466964_0005338 | 3300044706 | Bacteria | 4772 |
| 274 | Ga0466964_0038970 | 3300044706 | Bacteria | 1912 |
| 275 | Ga0453684_0051919 | 3300044712 | Bacteria | 5367 |
| 276 | Ga0453684_0077881 | 3300044712 | Bacteria | 4151 |
| 277 | Ga0453684_0086145 | 3300044712 | Bacteria | 3899 |
| 278 | Ga0453684_0150202 | 3300044712 | Bacteria | 2770 |
| 279 | Ga0453684_0161015 | 3300044712 | Bacteria | 2655 |
| 280 | Ga0453684_0220431 | 3300044712 | Bacteria | 2198 |
| 281 | Ga0453684_0361886 | 3300044712 | Bacteria | 1633 |
| 282 | Ga0453684_0602684 | 3300044712 | Bacteria | 1204 |
| 283 | Ga0466971_0005212 | 3300044719 | Bacteria | 5627 |
| 284 | Ga0466968_0192437 | 3300044735 | Bacteria | 952 |
| 285 | Ga0466970_0002958 | 3300044765 | Bacteria | 8237 |
| 286 | Ga0466957_0007250 | 3300044842 | Bacteria | 6266 |
| 287 | Ga0466959_0015021 | 3300045049 | Bacteria | 5642 |
| 288 | Ga0451576_0013616 | 3300045051 | Bacteria | 9091 |
| 289 | Ga0451576_0018250 | 3300045051 | Bacteria | 7693 |
| 290 | Ga0451576_0308673 | 3300045051 | Bacteria | 1655 |
| 291 | Ga0451576_0422582 | 3300045051 | Bacteria | 1398 |
| 292 | Ga0466958_0002486 | 3300045836 | Bacteria | 9280 |
| 293 | Ga0466967_0130670 | 3300045976 | Bacteria | 2331 |
| 294 | Ga0495617_000029 | 3300046452 | Bacteria | 153239 |
| 295 | Ga0495617_000049 | 3300046452 | Bacteria | 113032 |
| 296 | Ga0495617_010347 | 3300046452 | Bacteria | 3196 |
| 297 | Ga0495617_010848 | 3300046452 | Bacteria | 3119 |
| 298 | Ga0495617_060263 | 3300046452 | Bacteria | 1256 |
| 299 | Ga0495627_000055 | 3300046453 | Bacteria | 149482 |
| 300 | Ga0495627_002501 | 3300046453 | Bacteria | 8772 |
| 301 | Ga0495627_050932 | 3300046453 | Bacteria | 1246 |
| 302 | Ga0495590_0000003 | 3300046457 | Bacteria | 478593 |
| 303 | Ga0495590_0003715 | 3300046457 | Bacteria | 6215 |
| 304 | Ga0495590_0052106 | 3300046457 | Bacteria | 1430 |
| 305 | Ga0495629_0012395 | 3300046459 | Bacteria | 6173 |
| 306 | Ga0495629_0017554 | 3300046459 | Bacteria | 5129 |
| 307 | Ga0495629_0019645 | 3300046459 | Bacteria | 4824 |
| 308 | Ga0495629_0094384 | 3300046459 | Bacteria | 2087 |
| 309 | Ga0495629_0161255 | 3300046459 | Bacteria | 1557 |
| 310 | Ga0495638_0000091 | 3300046460 | Bacteria | 146548 |
| 311 | Ga0495638_0027695 | 3300046460 | Bacteria | 3666 |
| 312 | Ga0495638_0050470 | 3300046460 | Bacteria | 2598 |
| 313 | Ga0495638_0053769 | 3300046460 | Bacteria | 2505 |
| 314 | Ga0495638_0202885 | 3300046460 | Bacteria | 1118 |
| 315 | Ga0495638_0275995 | 3300046460 | Bacteria | 915 |
| 316 | Ga0495651_0084919 | 3300046462 | Bacteria | 2384 |
| 317 | Ga0495653_0000013 | 3300046463 | Bacteria | 250453 |
| 318 | Ga0495653_0054550 | 3300046463 | Bacteria | 3053 |
| 319 | Ga0495653_0069332 | 3300046463 | Bacteria | 2642 |
| 320 | Ga0495653_0126508 | 3300046463 | Bacteria | 1814 |
| 321 | Ga0495650_0000097 | 3300046471 | Bacteria | 216051 |
| 322 | Ga0495650_0000272 | 3300046471 | Bacteria | 98846 |
| 323 | Ga0495650_0002039 | 3300046471 | Bacteria | 17659 |
| 324 | Ga0495650_0003861 | 3300046471 | Bacteria | 10624 |
| 325 | Ga0495650_0011137 | 3300046471 | Bacteria | 4953 |
| 326 | Ga0495650_0013311 | 3300046471 | Bacteria | 4358 |
| 327 | Ga0495650_0043334 | 3300046471 | Bacteria | 1910 |
| 328 | Ga0495580_0023253 | 3300046472 | Bacteria | 4553 |
| 329 | Ga0495580_0447359 | 3300046472 | Bacteria | 867 |
| 330 | Ga0495582_0015183 | 3300046473 | Bacteria | 4235 |
| 331 | Ga0495582_0081784 | 3300046473 | Bacteria | 1794 |
| 332 | Ga0495582_0209825 | 3300046473 | Bacteria | 1113 |
| 333 | Ga0495605_0000234 | 3300046474 | Bacteria | 68169 |
| 334 | Ga0495605_0005259 | 3300046474 | Bacteria | 7552 |
| 335 | Ga0495605_0067074 | 3300046474 | Bacteria | 1703 |
| 336 | Ga0495605_0151299 | 3300046474 | Bacteria | 1035 |
| 337 | Ga0495664_0066884 | 3300046477 | Bacteria | 2143 |
| 338 | Ga0495584_0000924 | 3300046491 | Bacteria | 18616 |
| 339 | Ga0495584_0003900 | 3300046491 | Bacteria | 8067 |
| 340 | Ga0495584_0035283 | 3300046491 | Bacteria | 2529 |
| 341 | Ga0495584_0040858 | 3300046491 | Bacteria | 2341 |
| 342 | Ga0495584_0061131 | 3300046491 | Bacteria | 1893 |
| 343 | Ga0495584_0135943 | 3300046491 | Bacteria | 1248 |
| 344 | Ga0495584_0141550 | 3300046491 | Bacteria | 1221 |
| 345 | Ga0495584_0229839 | 3300046491 | Bacteria | 943 |
| 346 | Ga0495585_0009117 | 3300046492 | Bacteria | 5974 |
| 347 | Ga0495585_0009367 | 3300046492 | Bacteria | 5876 |
| 348 | Ga0495585_0011031 | 3300046492 | Bacteria | 5365 |
| 349 | Ga0495585_0011537 | 3300046492 | Bacteria | 5228 |
| 350 | Ga0495585_0018564 | 3300046492 | Bacteria | 4010 |
| 351 | Ga0495585_0087211 | 3300046492 | Bacteria | 1684 |
| 352 | Ga0495585_0087352 | 3300046492 | Bacteria | 1683 |
| 353 | Ga0495594_0006450 | 3300046499 | Bacteria | 6036 |
| 354 | Ga0495594_0012518 | 3300046499 | Bacteria | 4419 |
| 355 | Ga0495594_0078633 | 3300046499 | Bacteria | 1840 |
| 356 | Ga0495594_0140568 | 3300046499 | Bacteria | 1369 |
| 357 | Ga0495596_0005327 | 3300046500 | Bacteria | 6092 |
| 358 | Ga0495596_0008828 | 3300046500 | Bacteria | 4460 |
| 359 | Ga0495596_0025597 | 3300046500 | Bacteria | 2384 |
| 360 | Ga0495596_0035132 | 3300046500 | Bacteria | 1988 |
| 361 | Ga0495596_0059819 | 3300046500 | Bacteria | 1484 |
| 362 | Ga0495607_0004852 | 3300046501 | Bacteria | 9799 |
| 363 | Ga0495607_0008135 | 3300046501 | Bacteria | 7194 |
| 364 | Ga0495607_0029025 | 3300046501 | Bacteria | 3407 |
| 365 | Ga0495607_0033666 | 3300046501 | Bacteria | 3116 |
| 366 | Ga0495607_0069953 | 3300046501 | Bacteria | 1962 |
| 367 | Ga0495583_0000155 | 3300046506 | Bacteria | 114870 |
| 368 | Ga0495583_0004737 | 3300046506 | Bacteria | 9565 |
| 369 | Ga0495606_0000141 | 3300046507 | Bacteria | 123586 |
| 370 | Ga0495606_0000152 | 3300046507 | Bacteria | 119522 |
| 371 | Ga0495606_0001575 | 3300046507 | Bacteria | 29893 |
| 372 | Ga0495606_0008580 | 3300046507 | Bacteria | 8842 |
| 373 | Ga0495606_0015878 | 3300046507 | Bacteria | 5778 |
| 374 | Ga0495606_0018064 | 3300046507 | Bacteria | 5303 |
| 375 | Ga0495606_0018769 | 3300046507 | Bacteria | 5173 |
| 376 | Ga0495606_0035336 | 3300046507 | Bacteria | 3417 |
| 377 | Ga0495606_0045886 | 3300046507 | Bacteria | 2892 |
| 378 | Ga0495606_0046399 | 3300046507 | Bacteria | 2872 |
| 379 | Ga0495606_0048380 | 3300046507 | Bacteria | 2797 |
| 380 | Ga0495606_0060224 | 3300046507 | Bacteria | 2432 |
| 381 | Ga0495606_0154856 | 3300046507 | Bacteria | 1342 |
| 382 | Ga0495606_0245644 | 3300046507 | Bacteria | 995 |
| 383 | Ga0495610_0000003 | 3300046512 | Bacteria | 1203910 |
| 384 | Ga0495610_0007317 | 3300046512 | Bacteria | 7383 |
| 385 | Ga0495610_0049877 | 3300046512 | Bacteria | 2046 |
| 386 | Ga0495610_0079240 | 3300046512 | Bacteria | 1512 |
| 387 | Ga0495610_0089529 | 3300046512 | Bacteria | 1397 |
| 388 | Ga0495616_0019387 | 3300046513 | Bacteria | 3712 |
| 389 | Ga0495616_0097318 | 3300046513 | Bacteria | 1384 |
| 390 | Ga0495616_0120226 | 3300046513 | Bacteria | 1213 |
| 391 | Ga0495620_0004808 | 3300046515 | Bacteria | 7589 |
| 392 | Ga0495628_0009289 | 3300046516 | Bacteria | 8402 |
| 393 | Ga0495628_0069039 | 3300046516 | Bacteria | 2756 |
| 394 | Ga0495630_0064151 | 3300046517 | Bacteria | 2759 |
| 395 | Ga0495631_0005851 | 3300046518 | Bacteria | 6409 |
| 396 | Ga0495631_0011618 | 3300046518 | Bacteria | 4326 |
| 397 | Ga0495631_0026426 | 3300046518 | Bacteria | 2666 |
| 398 | Ga0495631_0039226 | 3300046518 | Bacteria | 2102 |
| 399 | Ga0495631_0047032 | 3300046518 | Bacteria | 1895 |
| 400 | Ga0495631_0047731 | 3300046518 | Bacteria | 1879 |
| 401 | Ga0495632_0201490 | 3300046519 | Bacteria | 906 |
| 402 | Ga0495637_0000881 | 3300046520 | Bacteria | 19418 |
| 403 | Ga0495637_0006176 | 3300046520 | Bacteria | 6027 |
| 404 | Ga0495637_0024309 | 3300046520 | Bacteria | 2741 |
| 405 | Ga0495643_0017465 | 3300046522 | Bacteria | 4193 |
| 406 | Ga0495643_0018959 | 3300046522 | Bacteria | 3985 |
| 407 | Ga0495643_0020177 | 3300046522 | Bacteria | 3848 |
| 408 | Ga0495643_0026091 | 3300046522 | Bacteria | 3301 |
| 409 | Ga0495643_0035832 | 3300046522 | Bacteria | 2730 |
| 410 | Ga0495643_0048861 | 3300046522 | Bacteria | 2284 |
| 411 | Ga0495643_0067900 | 3300046522 | Bacteria | 1877 |
| 412 | Ga0495644_0009368 | 3300046523 | Bacteria | 3776 |
| 413 | Ga0495648_0000058 | 3300046524 | Bacteria | 156717 |
| 414 | Ga0495648_0009549 | 3300046524 | Bacteria | 7488 |
| 415 | Ga0495648_0020982 | 3300046524 | Bacteria | 4540 |
| 416 | Ga0495648_0032180 | 3300046524 | Bacteria | 3445 |
| 417 | Ga0495648_0046270 | 3300046524 | Bacteria | 2698 |
| 418 | Ga0495648_0047442 | 3300046524 | Bacteria | 2654 |
| 419 | Ga0495663_0010248 | 3300046525 | Bacteria | 2605 |
| 420 | Ga0495666_0004094 | 3300046526 | Bacteria | 7367 |
| 421 | Ga0495666_0014442 | 3300046526 | Bacteria | 3932 |
| 422 | Ga0495666_0061016 | 3300046526 | Bacteria | 1802 |
| 423 | Ga0495666_0068438 | 3300046526 | Bacteria | 1690 |
| 424 | Ga0495666_0077116 | 3300046526 | Bacteria | 1579 |
| 425 | Ga0495642_0007666 | 3300046528 | Bacteria | 4137 |
| 426 | Ga0495642_0008387 | 3300046528 | Bacteria | 3955 |
| 427 | Ga0495642_0012849 | 3300046528 | Bacteria | 3231 |
| 428 | Ga0495642_0021650 | 3300046528 | Bacteria | 2529 |
| 429 | Ga0495642_0024009 | 3300046528 | Bacteria | 2410 |
| 430 | Ga0495642_0059231 | 3300046528 | Bacteria | 1587 |
| 431 | Ga0495642_0065351 | 3300046528 | Bacteria | 1514 |
| 432 | Ga0495642_0082258 | 3300046528 | Bacteria | 1357 |
| 433 | Ga0495652_0105790 | 3300046529 | Bacteria | 2273 |
| 434 | Ga0495654_0000261 | 3300046530 | Bacteria | 47872 |
| 435 | Ga0495654_0027302 | 3300046530 | Bacteria | 2928 |
| 436 | Ga0495654_0044445 | 3300046530 | Bacteria | 2197 |
| 437 | Ga0495654_0069624 | 3300046530 | Bacteria | 1670 |
| 438 | Ga0495665_0013679 | 3300046531 | Bacteria | 4383 |
| 439 | Ga0495665_0018229 | 3300046531 | Bacteria | 3772 |
| 440 | Ga0495665_0021734 | 3300046531 | Bacteria | 3450 |
| 441 | Ga0495665_0199772 | 3300046531 | Bacteria | 1036 |
| 442 | Ga0495640_0114862 | 3300046533 | Bacteria | 1755 |
| 443 | Ga0495586_0004391 | 3300046535 | Bacteria | 7533 |
| 444 | Ga0495586_0030122 | 3300046535 | Bacteria | 2904 |
| 445 | Ga0495586_0058199 | 3300046535 | Bacteria | 2098 |
| 446 | Ga0495587_0197083 | 3300046536 | Bacteria | 1139 |
| 447 | Ga0495598_0010948 | 3300046537 | Bacteria | 2186 |
| 448 | Ga0495609_0000426 | 3300046538 | Bacteria | 35215 |
| 449 | Ga0495609_0003109 | 3300046538 | Bacteria | 9715 |
| 450 | Ga0495609_0004507 | 3300046538 | Bacteria | 7596 |
| 451 | Ga0495609_0008469 | 3300046538 | Bacteria | 5037 |
| 452 | Ga0495609_0028175 | 3300046538 | Bacteria | 2564 |
| 453 | Ga0495609_0053778 | 3300046538 | Bacteria | 1789 |
| 454 | Ga0495609_0113488 | 3300046538 | Bacteria | 1168 |
| 455 | Ga0495597_0001525 | 3300046542 | Bacteria | 16468 |
| 456 | Ga0495597_0007071 | 3300046542 | Bacteria | 5745 |
| 457 | Ga0495597_0007373 | 3300046542 | Bacteria | 5592 |
| 458 | Ga0495597_0018648 | 3300046542 | Bacteria | 3254 |
| 459 | Ga0495597_0036030 | 3300046542 | Bacteria | 2229 |
| 460 | Ga0495597_0063234 | 3300046542 | Bacteria | 1609 |
| 461 | Ga0495645_0054969 | 3300046543 | Bacteria | 2891 |
| 462 | Ga0495622_0002586 | 3300046557 | Bacteria | 8734 |
| 463 | Ga0495622_0003320 | 3300046557 | Bacteria | 7599 |
| 464 | Ga0495622_0011541 | 3300046557 | Bacteria | 4083 |
| 465 | Ga0495622_0026490 | 3300046557 | Bacteria | 2706 |
| 466 | Ga0495622_0028950 | 3300046557 | Bacteria | 2588 |
| 467 | Ga0495622_0038512 | 3300046557 | Bacteria | 2226 |
| 468 | Ga0495622_0042586 | 3300046557 | Bacteria | 2111 |
| 469 | Ga0495622_0053437 | 3300046557 | Bacteria | 1874 |
| 470 | Ga0495633_0000362 | 3300046558 | Bacteria | 48938 |
| 471 | Ga0495633_0008936 | 3300046558 | Bacteria | 5584 |
| 472 | Ga0495633_0012536 | 3300046558 | Bacteria | 4502 |
| 473 | Ga0495633_0012757 | 3300046558 | Bacteria | 4454 |
| 474 | Ga0495633_0017946 | 3300046558 | Bacteria | 3602 |
| 475 | Ga0495633_0034336 | 3300046558 | Bacteria | 2440 |
| 476 | Ga0495633_0043371 | 3300046558 | Bacteria | 2134 |
| 477 | Ga0495633_0049603 | 3300046558 | Bacteria | 1980 |
| 478 | Ga0495633_0064497 | 3300046558 | Bacteria | 1712 |
| 479 | Ga0495633_0077887 | 3300046558 | Bacteria | 1543 |
| 480 | Ga0495633_0113830 | 3300046558 | Bacteria | 1254 |
| 481 | Ga0495656_0003076 | 3300046615 | Bacteria | 5605 |
| 482 | Ga0495656_0014969 | 3300046615 | Bacteria | 2918 |
| 483 | Ga0495656_0019882 | 3300046615 | Bacteria | 2597 |
| 484 | Ga0495668_0000290 | 3300046616 | Bacteria | 68805 |
| 485 | Ga0495668_0007441 | 3300046616 | Bacteria | 6995 |
| 486 | Ga0495668_0007548 | 3300046616 | Bacteria | 6939 |
| 487 | Ga0495668_0008482 | 3300046616 | Bacteria | 6405 |
| 488 | Ga0495668_0012651 | 3300046616 | Bacteria | 5000 |
| 489 | Ga0495668_0036165 | 3300046616 | Bacteria | 2767 |
| 490 | Ga0495668_0037857 | 3300046616 | Bacteria | 2697 |
| 491 | Ga0495668_0045379 | 3300046616 | Bacteria | 2443 |
| 492 | Ga0495668_0046372 | 3300046616 | Bacteria | 2414 |
| 493 | Ga0495668_0059353 | 3300046616 | Bacteria | 2111 |
| 494 | Ga0495668_0166483 | 3300046616 | Bacteria | 1207 |
| 495 | Ga0495668_0203607 | 3300046616 | Bacteria | 1083 |
| 496 | Ga0495668_0250272 | 3300046616 | Bacteria | 970 |
| 497 | Ga0495634_0331449 | 3300046642 | Bacteria | 914 |
| 498 | Ga0495611_0035193 | 3300046648 | Bacteria | 2217 |
| 499 | Ga0495611_0038476 | 3300046648 | Bacteria | 2127 |
| 500 | Ga0495611_0045571 | 3300046648 | Bacteria | 1964 |
| 501 | Ga0495625_0017675 | 3300046660 | Bacteria | 5580 |
| 502 | Ga0495625_0027829 | 3300046660 | Bacteria | 4248 |
| 503 | Ga0495625_0030783 | 3300046660 | Bacteria | 3999 |
| 504 | Ga0495625_0041908 | 3300046660 | Bacteria | 3329 |
| 505 | Ga0495625_0049883 | 3300046660 | Bacteria | 3006 |
| 506 | Ga0495625_0064616 | 3300046660 | Bacteria | 2581 |
| 507 | Ga0495625_0064954 | 3300046660 | Bacteria | 2573 |
| 508 | Ga0495625_0170920 | 3300046660 | Bacteria | 1451 |
| 509 | Ga0495635_0007114 | 3300046663 | Bacteria | 7825 |
| 510 | Ga0495659_0000073 | 3300046664 | Bacteria | 42850 |
| 511 | Ga0495659_0006944 | 3300046664 | Bacteria | 3583 |
| 512 | Ga0495659_0007441 | 3300046664 | Bacteria | 3474 |
| 513 | Ga0495659_0050963 | 3300046664 | Bacteria | 1507 |
| 514 | Ga0495661_0012192 | 3300046665 | Bacteria | 5805 |
| 515 | Ga0495661_0026571 | 3300046665 | Bacteria | 3727 |
| 516 | Ga0495661_0029521 | 3300046665 | Bacteria | 3498 |
| 517 | Ga0495661_0037553 | 3300046665 | Bacteria | 3023 |
| 518 | Ga0495661_0051150 | 3300046665 | Bacteria | 2496 |
| 519 | Ga0495661_0063510 | 3300046665 | Bacteria | 2182 |
| 520 | Ga0495661_0083870 | 3300046665 | Bacteria | 1830 |
| 521 | Ga0495661_0101896 | 3300046665 | Bacteria | 1614 |
| 522 | Ga0495588_0013666 | 3300046674 | Bacteria | 3870 |
| 523 | Ga0495588_0014151 | 3300046674 | Bacteria | 3814 |
| 524 | Ga0495588_0015342 | 3300046674 | Bacteria | 3685 |
| 525 | Ga0495588_0043506 | 3300046674 | Bacteria | 2298 |
| 526 | Ga0495588_0053207 | 3300046674 | Bacteria | 2087 |
| 527 | Ga0495588_0079899 | 3300046674 | Bacteria | 1706 |
| 528 | Ga0495588_0109274 | 3300046674 | Bacteria | 1456 |
| 529 | Ga0495588_0141804 | 3300046674 | Bacteria | 1269 |
| 530 | Ga0495599_0230282 | 3300046678 | Bacteria | 1131 |
| 531 | Ga0495599_0278751 | 3300046678 | Bacteria | 1013 |
| 532 | Ga0495623_0006061 | 3300046679 | Bacteria | 7858 |
| 533 | Ga0495623_0008290 | 3300046679 | Bacteria | 6760 |
| 534 | Ga0495646_0004544 | 3300046680 | Bacteria | 8739 |
| 535 | Ga0495646_0052355 | 3300046680 | Bacteria | 2466 |
| 536 | Ga0495669_0004622 | 3300046684 | Bacteria | 5703 |
| 537 | Ga0495669_0033098 | 3300046684 | Bacteria | 2274 |
| 538 | Ga0495669_0062407 | 3300046684 | Bacteria | 1688 |
| 539 | Ga0495613_0095663 | 3300046689 | Bacteria | 2148 |
| 540 | Ga0495613_0106389 | 3300046689 | Bacteria | 2024 |
| 541 | Ga0495624_0016989 | 3300046690 | Bacteria | 4891 |
| 542 | Ga0495624_0026017 | 3300046690 | Bacteria | 3838 |
| 543 | Ga0495624_0057797 | 3300046690 | Bacteria | 2438 |
| 544 | Ga0495624_0150981 | 3300046690 | Bacteria | 1421 |
| 545 | Ga0495670_0013397 | 3300046691 | Bacteria | 4034 |
| 546 | Ga0495670_0013844 | 3300046691 | Bacteria | 3966 |
| 547 | Ga0495670_0023891 | 3300046691 | Bacteria | 3018 |
| 548 | Ga0495670_0048684 | 3300046691 | Bacteria | 2120 |
| 549 | Ga0495670_0118518 | 3300046691 | Bacteria | 1374 |
| 550 | Ga0495670_0128950 | 3300046691 | Bacteria | 1317 |
| 551 | Ga0495670_0194016 | 3300046691 | Bacteria | 1074 |
| 552 | Ga0495671_0000309 | 3300046692 | Bacteria | 41290 |
| 553 | Ga0495671_0016752 | 3300046692 | Bacteria | 3907 |
| 554 | Ga0495671_0067146 | 3300046692 | Bacteria | 1764 |
| 555 | Ga0495649_0019829 | 3300046694 | Bacteria | 3776 |
| 556 | Ga0495649_0021357 | 3300046694 | Bacteria | 3627 |
| 557 | Ga0495649_0028389 | 3300046694 | Bacteria | 3101 |
| 558 | Ga0495649_0031177 | 3300046694 | Bacteria | 2941 |
| 559 | Ga0495649_0046758 | 3300046694 | Bacteria | 2356 |
| 560 | Ga0495649_0074304 | 3300046694 | Bacteria | 1821 |
| 561 | Ga0495589_0036858 | 3300046794 | Bacteria | 2450 |
| 562 | Ga0495589_0069974 | 3300046794 | Bacteria | 1716 |
| 563 | Ga0495600_0129233 | 3300046809 | Bacteria | 1642 |
| 564 | Ga0495660_0021513 | 3300046810 | Bacteria | 3693 |
| 565 | Ga0495660_0023684 | 3300046810 | Bacteria | 3502 |
| 566 | Ga0495660_0074657 | 3300046810 | Bacteria | 1791 |
| 567 | Ga0495660_0104854 | 3300046810 | Bacteria | 1450 |
| 568 | Ga0495660_0162173 | 3300046810 | Bacteria | 1095 |
| 569 | Ga0495581_0015375 | 3300047315 | Bacteria | 4444 |
| 570 | Ga0495581_0039795 | 3300047315 | Bacteria | 2721 |
| 571 | Ga0495581_0050558 | 3300047315 | Bacteria | 2401 |
| 572 | Ga0495581_0173822 | 3300047315 | Bacteria | 1260 |
| 573 | Ga0495604_0065846 | 3300047317 | Bacteria | 2757 |
| 574 | Ga0495604_0065883 | 3300047317 | Bacteria | 2756 |
| 575 | Ga0495604_0071816 | 3300047317 | Bacteria | 2617 |
| 576 | Ga0495604_0081395 | 3300047317 | Bacteria | 2424 |
| 577 | Ga0495636_0001622 | 3300047318 | Bacteria | 8558 |
| 578 | Ga0495636_0007644 | 3300047318 | Bacteria | 4251 |
| 579 | Ga0495636_0011164 | 3300047318 | Bacteria | 3553 |
| 580 | Ga0495636_0032135 | 3300047318 | Bacteria | 2152 |
| 581 | Ga0495636_0074556 | 3300047318 | Bacteria | 1453 |
| 582 | Ga0495636_0272673 | 3300047318 | Bacteria | 786 |
| 583 | Ga0495674_0019293 | 3300047319 | Bacteria | 6331 |
| 584 | Ga0495674_0052612 | 3300047319 | Bacteria | 3582 |
| 585 | Ga0495674_0142125 | 3300047319 | Bacteria | 2017 |
| 586 | Ga0495672_0000093 | 3300047320 | Bacteria | 145111 |
| 587 | Ga0495672_0000176 | 3300047320 | Bacteria | 92728 |
| 588 | Ga0495672_0000263 | 3300047320 | Bacteria | 72879 |
| 589 | Ga0495672_0013531 | 3300047320 | Bacteria | 5626 |
| 590 | Ga0495672_0050654 | 3300047320 | Bacteria | 2449 |
| 591 | Ga0495676_0016373 | 3300047321 | Bacteria | 6584 |
| 592 | Ga0495676_0069686 | 3300047321 | Bacteria | 2712 |
| 593 | Ga0495676_0087321 | 3300047321 | Bacteria | 2344 |
| 594 | Ga0495676_0093020 | 3300047321 | Bacteria | 2249 |
| 595 | Ga0495680_0030223 | 3300047322 | Bacteria | 4426 |
| 596 | Ga0495680_0045840 | 3300047322 | Bacteria | 3450 |
| 597 | Ga0495683_0005742 | 3300047323 | Bacteria | 6839 |
| 598 | Ga0495683_0006197 | 3300047323 | Bacteria | 6549 |
| 599 | Ga0495683_0009260 | 3300047323 | Bacteria | 5247 |
| 600 | Ga0495683_0039174 | 3300047323 | Bacteria | 2396 |
| 601 | Ga0495683_0078141 | 3300047323 | Bacteria | 1617 |
| 602 | Ga0495683_0116354 | 3300047323 | Bacteria | 1272 |
| 603 | Ga0495683_0147375 | 3300047323 | Bacteria | 1098 |
| 604 | Ga0495687_000021 | 3300047443 | Bacteria | 334681 |
| 605 | Ga0495687_000149 | 3300047443 | Bacteria | 106301 |
| 606 | Ga0495687_000296 | 3300047443 | Bacteria | 65626 |
| 607 | Ga0495687_005542 | 3300047443 | Bacteria | 8006 |
| 608 | Ga0495687_008783 | 3300047443 | Bacteria | 5734 |
| 609 | Ga0495687_018937 | 3300047443 | Bacteria | 3390 |
| 610 | Ga0495687_102422 | 3300047443 | Bacteria | 1071 |
| 611 | Ga0495675_0034341 | 3300047444 | Bacteria | 3238 |
| 612 | Ga0495677_0001373 | 3300047445 | Bacteria | 9736 |
| 613 | Ga0495677_0006058 | 3300047445 | Bacteria | 4572 |
| 614 | Ga0495677_0012318 | 3300047445 | Bacteria | 3119 |
| 615 | Ga0495677_0020063 | 3300047445 | Bacteria | 2422 |
| 616 | Ga0495677_0028488 | 3300047445 | Bacteria | 2028 |
| 617 | Ga0495677_0040379 | 3300047445 | Bacteria | 1706 |
| 618 | Ga0495677_0096830 | 3300047445 | Bacteria | 1115 |
| 619 | Ga0495679_009450 | 3300047446 | Bacteria | 3902 |
| 620 | Ga0495679_025306 | 3300047446 | Bacteria | 1986 |
| 621 | Ga0495685_000250 | 3300047447 | Bacteria | 18582 |
| 622 | Ga0495685_007493 | 3300047447 | Bacteria | 3604 |
| 623 | Ga0495685_016233 | 3300047447 | Bacteria | 2543 |
| 624 | Ga0495685_038351 | 3300047447 | Bacteria | 1642 |
| 625 | Ga0495673_0000006 | 3300047469 | Bacteria | 908691 |
| 626 | Ga0495673_0000024 | 3300047469 | Bacteria | 521349 |
| 627 | Ga0495673_0000049 | 3300047469 | Bacteria | 265878 |
| 628 | Ga0495673_0007809 | 3300047469 | Bacteria | 6092 |
| 629 | Ga0495673_0015916 | 3300047469 | Bacteria | 3859 |
| 630 | Ga0495681_0025094 | 3300047470 | Bacteria | 3124 |
| 631 | Ga0495686_0000359 | 3300047472 | Bacteria | 73907 |
| 632 | Ga0495686_0012141 | 3300047472 | Bacteria | 6042 |
| 633 | Ga0495686_0022789 | 3300047472 | Bacteria | 4139 |
| 634 | Ga0495686_0025509 | 3300047472 | Bacteria | 3874 |
| 635 | Ga0495686_0062331 | 3300047472 | Bacteria | 2313 |
| 636 | Ga0495686_0115432 | 3300047472 | Bacteria | 1606 |
| 637 | Ga0495686_0212640 | 3300047472 | Bacteria | 1104 |
| 638 | Ga0495593_0005097 | 3300047673 | Bacteria | 7768 |
| 639 | Ga0495593_0021192 | 3300047673 | Bacteria | 3633 |
| 640 | Ga0495593_0069724 | 3300047673 | Bacteria | 1827 |
| 641 | Ga0495593_0100385 | 3300047673 | Bacteria | 1484 |
| 642 | Ga0495602_0031307 | 3300048088 | Bacteria | 5031 |
| 643 | Ga0495602_0043464 | 3300048088 | Bacteria | 4084 |
| 644 | Ga0495614_0019793 | 3300048089 | Bacteria | 2912 |
| 645 | Ga0495614_0027165 | 3300048089 | Bacteria | 2468 |
| 646 | Ga0495615_0005881 | 3300048090 | Bacteria | 2237 |
| 647 | Ga0495626_0007491 | 3300048091 | Bacteria | 6074 |
| 648 | Ga0495626_0034003 | 3300048091 | Bacteria | 2440 |
| 649 | Ga0495626_0036986 | 3300048091 | Bacteria | 2322 |
| 650 | Ga0495626_0052577 | 3300048091 | Bacteria | 1877 |
| 651 | Ga0495626_0121132 | 3300048091 | Bacteria | 1124 |
| 652 | Ga0496100_0054399 | 3300048903 | Bacteria | 2610 |
| 653 | Ga0496100_0175886 | 3300048903 | Bacteria | 1545 |
| 654 | Ga0496101_0010094 | 3300048904 | Bacteria | 6225 |
| 655 | Ga0496101_0157887 | 3300048904 | Bacteria | 1738 |
| 656 | Ga0496101_0213506 | 3300048904 | Bacteria | 1495 |
| 657 | Ga0496101_0226877 | 3300048904 | Bacteria | 1451 |
| 658 | Ga0496102_0000463 | 3300048905 | Bacteria | 45105 |
| 659 | Ga0496102_0034285 | 3300048905 | Bacteria | 4564 |
| 660 | Ga0496102_0097127 | 3300048905 | Bacteria | 2732 |
| 661 | Ga0496102_0273841 | 3300048905 | Bacteria | 1591 |
| 662 | Ga0496102_0532509 | 3300048905 | Bacteria | 1097 |
| 663 | Ga0496103_0002220 | 3300048906 | Bacteria | 12303 |
| 664 | Ga0496103_0015400 | 3300048906 | Bacteria | 4548 |
| 665 | Ga0496103_0043004 | 3300048906 | Bacteria | 2781 |
| 666 | Ga0496104_0010667 | 3300048907 | Bacteria | 8212 |
| 667 | Ga0496104_0055517 | 3300048907 | Bacteria | 3745 |
| 668 | Ga0496104_0130203 | 3300048907 | Bacteria | 2417 |
| 669 | Ga0496104_0395003 | 3300048907 | Bacteria | 1295 |
| 670 | Ga0496105_0032536 | 3300048908 | Bacteria | 4280 |
| 671 | Ga0496105_0093134 | 3300048908 | Bacteria | 2488 |
| 672 | Ga0496105_0157955 | 3300048908 | Bacteria | 1862 |
| 673 | Ga0496105_0227534 | 3300048908 | Bacteria | 1516 |
| 674 | Ga0496106_0029689 | 3300048909 | Bacteria | 4076 |
| 675 | Ga0496106_0105061 | 3300048909 | Bacteria | 2194 |
| 676 | Ga0496107_0034666 | 3300048910 | Bacteria | 3615 |
| 677 | Ga0496108_0228553 | 3300048911 | Bacteria | 1617 |
| 678 | Ga0496109_0044419 | 3300048912 | Bacteria | 4031 |
| 679 | Ga0496109_0061983 | 3300048912 | Bacteria | 3420 |
| 680 | Ga0496109_0108740 | 3300048912 | Bacteria | 2577 |
| 681 | Ga0496109_0161834 | 3300048912 | Bacteria | 2097 |
| 682 | Ga0496109_0254646 | 3300048912 | Bacteria | 1653 |
| 683 | Ga0496110_0043506 | 3300048913 | Bacteria | 3921 |
| 684 | Ga0496110_0067822 | 3300048913 | Bacteria | 3157 |
| 685 | Ga0496110_0186126 | 3300048913 | Bacteria | 1885 |
| 686 | Ga0496111_0012600 | 3300048914 | Bacteria | 5730 |
| 687 | Ga0496111_0012790 | 3300048914 | Bacteria | 5693 |
| 688 | Ga0496111_0210459 | 3300048914 | Bacteria | 1444 |
| 689 | Ga0496112_0089730 | 3300048915 | Bacteria | 3042 |
| 690 | Ga0496112_0117000 | 3300048915 | Bacteria | 2636 |
| 691 | Ga0496113_0061979 | 3300048916 | Bacteria | 2823 |
| 692 | Ga0496113_0126741 | 3300048916 | Bacteria | 2000 |
| 693 | Ga0496114_0478042 | 3300048917 | Bacteria | 1102 |
| 694 | Ga0496115_0364063 | 3300048918 | Bacteria | 1178 |
| 695 | Ga0496116_0010198 | 3300048919 | Bacteria | 7904 |
| 696 | Ga0496116_0024544 | 3300048919 | Bacteria | 4455 |
| 697 | Ga0496116_0037867 | 3300048919 | Bacteria | 3357 |
| 698 | Ga0496116_0041819 | 3300048919 | Bacteria | 3140 |
| 699 | Ga0496116_0091391 | 3300048919 | Bacteria | 1850 |
| 700 | Ga0496116_0226591 | 3300048919 | Bacteria | 952 |
| 701 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 702 | Ga0496117_0041521 | 3300048920 | Bacteria | 3369 |
| 703 | Ga0496117_0056443 | 3300048920 | Bacteria | 2735 |
| 704 | Ga0496117_0068370 | 3300048920 | Bacteria | 2398 |
| 705 | Ga0496118_0000078 | 3300048921 | Bacteria | 190946 |
| 706 | Ga0496118_0039039 | 3300048921 | Bacteria | 3795 |
| 707 | Ga0496118_0055612 | 3300048921 | Bacteria | 2984 |
| 708 | Ga0496118_0085707 | 3300048921 | Bacteria | 2192 |
| 709 | Ga0496119_0016500 | 3300048922 | Bacteria | 5617 |
| 710 | Ga0496119_0027964 | 3300048922 | Bacteria | 3862 |
| 711 | Ga0496119_0101566 | 3300048922 | Bacteria | 1614 |
| 712 | Ga0496119_0196603 | 3300048922 | Bacteria | 1047 |
| 713 | Ga0496120_0015571 | 3300048923 | Bacteria | 5009 |
| 714 | Ga0496121_0000629 | 3300048924 | Bacteria | 65811 |
| 715 | Ga0496121_0008619 | 3300048924 | Bacteria | 11936 |
| 716 | Ga0496121_0033068 | 3300048924 | Bacteria | 4688 |
| 717 | Ga0496121_0075172 | 3300048924 | Bacteria | 2700 |
| 718 | Ga0496121_0128319 | 3300048924 | Bacteria | 1903 |
| 719 | Ga0496122_0000706 | 3300048925 | Bacteria | 65908 |
| 720 | Ga0496122_0021480 | 3300048925 | Bacteria | 5777 |
| 721 | Ga0496122_0054686 | 3300048925 | Bacteria | 2995 |
| 722 | Ga0496122_0055319 | 3300048925 | Bacteria | 2970 |
| 723 | Ga0496122_0115739 | 3300048925 | Bacteria | 1745 |
| 724 | Ga0496122_0117489 | 3300048925 | Bacteria | 1726 |
| 725 | Ga0496122_0159956 | 3300048925 | Bacteria | 1375 |
| 726 | Ga0496123_0002213 | 3300048926 | Bacteria | 24703 |
| 727 | Ga0496123_0007938 | 3300048926 | Bacteria | 9852 |
| 728 | Ga0496123_0014321 | 3300048926 | Bacteria | 6582 |
| 729 | Ga0496123_0015581 | 3300048926 | Bacteria | 6224 |
| 730 | Ga0496123_0050713 | 3300048926 | Bacteria | 2770 |
| 731 | Ga0496124_0000024 | 3300048927 | Bacteria | 414291 |
| 732 | Ga0496124_0000125 | 3300048927 | Bacteria | 159942 |
| 733 | Ga0496124_0015653 | 3300048927 | Bacteria | 7258 |
| 734 | Ga0496124_0025451 | 3300048927 | Bacteria | 5359 |
| 735 | Ga0496124_0034686 | 3300048927 | Bacteria | 4423 |
| 736 | Ga0496124_0213585 | 3300048927 | Bacteria | 1457 |
| 737 | Ga0496124_0331414 | 3300048927 | Bacteria | 1085 |
| 738 | Ga0496125_0000011 | 3300048928 | Bacteria | 655895 |
| 739 | Ga0496125_0017315 | 3300048928 | Bacteria | 6879 |
| 740 | Ga0496125_0054414 | 3300048928 | Bacteria | 3270 |
| 741 | Ga0496125_0059962 | 3300048928 | Bacteria | 3062 |
| 742 | Ga0496125_0060012 | 3300048928 | Bacteria | 3060 |
| 743 | Ga0496126_0020682 | 3300048929 | Bacteria | 6446 |
| 744 | Ga0496126_0211321 | 3300048929 | Bacteria | 1633 |
| 745 | Ga0496126_0366789 | 3300048929 | Bacteria | 1175 |
| 746 | Ga0495678_000155 | 3300049459 | Bacteria | 81324 |
| 747 | Ga0495678_018497 | 3300049459 | Bacteria | 3131 |
| 748 | Ga0495678_031280 | 3300049459 | Bacteria | 2220 |
| 749 | Ga0495682_0050037 | 3300049460 | Bacteria | 1521 |
| 750 | Ga0501031_0024531 | 3300049568 | Bacteria | 3930 |
| 751 | Ga0501031_0087749 | 3300049568 | Bacteria | 2028 |
| 752 | Ga0501032_0019404 | 3300049569 | Bacteria | 4756 |
| 753 | Ga0501032_0074404 | 3300049569 | Bacteria | 2264 |
| 754 | Ga0501033_0004989 | 3300049570 | Bacteria | 10555 |
| 755 | Ga0501033_0129390 | 3300049570 | Bacteria | 1830 |
| 756 | Ga0501033_0151746 | 3300049570 | Bacteria | 1671 |
| 757 | Ga0501034_0006995 | 3300049571 | Bacteria | 12047 |
| 758 | Ga0501036_0006814 | 3300049572 | Bacteria | 9281 |
| 759 | Ga0501036_0385777 | 3300049572 | Bacteria | 1169 |
| 760 | Ga0501037_0003741 | 3300049573 | Bacteria | 11038 |
| 761 | Ga0501037_0122769 | 3300049573 | Bacteria | 1866 |
| 762 | Ga0501038_0023096 | 3300049574 | Bacteria | 5565 |
| 763 | Ga0501039_0052204 | 3300049575 | Bacteria | 3164 |
| 764 | Ga0501039_0516859 | 3300049575 | Bacteria | 937 |
| 765 | Ga0501040_0000016 | 3300049576 | Bacteria | 75260 |
| 766 | Ga0501042_0000046 | 3300049578 | Bacteria | 41284 |
| 767 | Ga0501043_0011320 | 3300049579 | Bacteria | 6982 |
| 768 | Ga0501043_0205506 | 3300049579 | Bacteria | 1527 |
| 769 | Ga0501046_0021099 | 3300049580 | Bacteria | 5379 |
| 770 | Ga0501046_0088842 | 3300049580 | Bacteria | 2379 |
| 771 | Ga0501047_0001841 | 3300049581 | Bacteria | 20466 |
| 772 | Ga0501047_0103511 | 3300049581 | Bacteria | 2727 |
| 773 | Ga0501047_0239861 | 3300049581 | Bacteria | 1664 |
| 774 | Ga0501048_0101418 | 3300049582 | Bacteria | 2031 |
| 775 | Ga0501071_0274594 | 3300049587 | Bacteria | 1275 |
| 776 | Ga0501227_006695 | 3300049665 | Bacteria | 2471 |
| 777 | Ga0501227_013193 | 3300049665 | Bacteria | 1817 |
| 778 | Ga0501249_002398 | 3300049679 | Bacteria | 3787 |
| 779 | Ga0501263_021092 | 3300049760 | Bacteria | 878 |
| 780 | Ga0501269_000168 | 3300049766 | Bacteria | 20001 |
| 781 | Ga0501279_001743 | 3300049775 | Bacteria | 2863 |
| 782 | Ga0501279_005098 | 3300049775 | Bacteria | 1723 |
| 783 | Ga0501035_0027613 | 3300049822 | Bacteria | 5186 |
| 784 | Ga0501035_0038419 | 3300049822 | Bacteria | 4334 |
| 785 | Ga0501035_0041176 | 3300049822 | Bacteria | 4172 |
| 786 | Ga0501044_0004041 | 3300049823 | Bacteria | 16457 |
| 787 | Ga0501044_0006255 | 3300049823 | Bacteria | 13164 |
| 788 | Ga0501044_0046534 | 3300049823 | Bacteria | 4490 |
| 789 | Ga0501044_0049752 | 3300049823 | Bacteria | 4326 |
| 790 | nmdc:mga03683_13644_c1 | 3300050489 | Bacteria | 2995 |
| 791 | nmdc:mga03n38_27623_c1 | 3300050490 | Bacteria | 2356 |
| 792 | nmdc:mga00v17_128548_c1 | 3300050491 | Bacteria | 1618 |
| 793 | nmdc:mga00v17_1600_c1 | 3300050491 | Bacteria | 11825 |
| 794 | nmdc:mga00v17_28181_c1 | 3300050491 | Bacteria | 3288 |
| 795 | nmdc:mga0k408_345_c1 | 3300050493 | Bacteria | 25333 |
| 796 | nmdc:mga06z11_91395_c1 | 3300050494 | Bacteria | 1653 |
| 797 | nmdc:mga08y16_11124_c1 | 3300050511 | Bacteria | 9451 |
| 798 | nmdc:mga08y16_233_c1 | 3300050511 | Bacteria | 49640 |
| 799 | Ga0500594_0016394 | 3300053118 | Bacteria | 1800 |
| 800 | Ga0500594_0018577 | 3300053118 | Bacteria | 1714 |
| 801 | Ga0500607_055813 | 3300053121 | Bacteria | 2087 |
| 802 | Ga0500618_000786 | 3300053125 | Bacteria | 17782 |
| 803 | Ga0500618_008373 | 3300053125 | Bacteria | 2891 |
| 804 | Ga0500586_009115 | 3300053145 | Bacteria | 2737 |
| 805 | Ga0500600_0049219 | 3300053149 | Bacteria | 2397 |
| 806 | Ga0500622_0000001 | 3300053156 | Bacteria | 657715 |
| 807 | Ga0500634_0021734 | 3300053161 | Bacteria | 3478 |
| 808 | Ga0500636_0003719 | 3300053177 | Bacteria | 8611 |
| 809 | Ga0500637_0026771 | 3300053178 | Bacteria | 3179 |
| 810 | Ga0500613_007527 | 3300053738 | Bacteria | 1139 |
| 811 | Ga0587082_000365 | 3300059504 | Bacteria | 3609 |
| 812 | Ga0466962_0015018 | 3300061719 | Bacteria | 3733 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036712 | Ga0316584_0408033 | Ga0316584_0408033_247_930 | 221 |
| 2 | 3300005530 | Ga0070679_100223171 | Ga0070679_1002231711 | 222 |
| 3 | 3300006038 | Ga0075365_10064714 | Ga0075365_100647143 | 222 |
| 4 | 3300006042 | Ga0075368_10030698 | Ga0075368_100306982 | 222 |
| 5 | 3300006177 | Ga0075362_10202969 | Ga0075362_102029691 | 222 |
| 6 | 3300006178 | Ga0075367_10022549 | Ga0075367_100225493 | 222 |
| 7 | 3300006353 | Ga0075370_10161447 | Ga0075370_101614472 | 222 |
| 8 | 3300027866 | Ga0209813_10021743 | Ga0209813_100217432 | 222 |
| 9 | 3300050494 | nmdc:mga06z11_91395_c1 | nmdc:mga06z11_91395_c1_734_1522 | 222 |
| 10 | 3300046536 | Ga0495587_0197083 | Ga0495587_0197083_401_1078 | 225 |
| 11 | 3300050490 | nmdc:mga03n38_27623_c1 | nmdc:mga03n38_27623_c1_463_1284 | 225 |
| 12 | 3300009551 | Ga0105238_10705511 | Ga0105238_107055112 | 227 |
| 13 | 3300048927 | Ga0496124_0000125 | Ga0496124_0000125_153893_154669 | 230 |
| 14 | 3300048928 | Ga0496125_0059962 | Ga0496125_0059962_650_1426 | 230 |
| 15 | 3300039110 | Ga0400487_55311 | Ga0400487_55311_741_1475 | 232 |
| 16 | 3300046507 | Ga0495606_0154856 | Ga0495606_0154856_28_726 | 232 |
| 17 | 3300046678 | Ga0495599_0230282 | Ga0495599_0230282_34_732 | 232 |
| 18 | 3300049572 | Ga0501036_0385777 | Ga0501036_0385777_418_1116 | 232 |
| 19 | 3300048904 | Ga0496101_0226877 | Ga0496101_0226877_364_1152 | 233 |
| 20 | 3300048905 | Ga0496102_0532509 | Ga0496102_0532509_56_844 | 233 |
| 21 | 3300048906 | Ga0496103_0043004 | Ga0496103_0043004_96_884 | 233 |
| 22 | 3300048907 | Ga0496104_0395003 | Ga0496104_0395003_196_984 | 233 |
| 23 | 3300048908 | Ga0496105_0157955 | Ga0496105_0157955_37_825 | 233 |
| 24 | 3300048909 | Ga0496106_0105061 | Ga0496106_0105061_1352_2140 | 233 |
| 25 | 3300048911 | Ga0496108_0228553 | Ga0496108_0228553_328_1116 | 233 |
| 26 | 3300048912 | Ga0496109_0254646 | Ga0496109_0254646_629_1417 | 233 |
| 27 | 3300048913 | Ga0496110_0186126 | Ga0496110_0186126_677_1465 | 233 |
| 28 | 3300048914 | Ga0496111_0012600 | Ga0496111_0012600_4338_5126 | 233 |
| 29 | 3300048917 | Ga0496114_0478042 | Ga0496114_0478042_209_997 | 233 |
| 30 | 3300005339 | Ga0070660_100074357 | Ga0070660_1000743573 | 234 |
| 31 | 3300005344 | Ga0070661_100003676 | Ga0070661_1000036768 | 234 |
| 32 | 3300005366 | Ga0070659_100032204 | Ga0070659_1000322043 | 234 |
| 33 | 3300005564 | Ga0070664_100018147 | Ga0070664_1000181474 | 234 |
| 34 | 3300025919 | Ga0207657_10006756 | Ga0207657_100067568 | 234 |
| 35 | 3300025920 | Ga0207649_10002906 | Ga0207649_100029062 | 234 |
| 36 | 3300025932 | Ga0207690_10020255 | Ga0207690_100202553 | 234 |
| 37 | 3300025945 | Ga0207679_10001073 | Ga0207679_100010734 | 234 |
| 38 | 3300031733 | Ga0316577_10040651 | Ga0316577_100406512 | 235 |
| 39 | 3300031727 | Ga0316576_10006838 | Ga0316576_100068387 | 236 |
| 40 | 3300035398 | Ga0316574_0040301 | Ga0316574_0040301_13_747 | 237 |
| 41 | 3300039093 | Ga0400489_50965 | Ga0400489_50965_178_918 | 237 |
| 42 | 3300044712 | Ga0453684_0602684 | Ga0453684_0602684_135_893 | 237 |
| 43 | 3300046674 | Ga0495588_0043506 | Ga0495588_0043506_374_1180 | 237 |
| 44 | iso_pu_bacteria | 2895511927 | 2895518627 | 237 |
| 45 | 3300003763 | Ga0055529_1000980 | Ga0055529_10009806 | 239 |
| 46 | 3300025228 | Ga0209672_103946 | Ga0209672_1039462 | 239 |
| 47 | 3300025242 | Ga0209258_105681 | Ga0209258_1056812 | 239 |
| 48 | 3300025272 | Ga0209455_1000305 | Ga0209455_100030515 | 239 |
| 49 | 3300046507 | Ga0495606_0045886 | Ga0495606_0045886_1679_2479 | 239 |
| 50 | 3300046512 | Ga0495610_0000003 | Ga0495610_0000003_170443_171228 | 239 |
| 51 | 3300047318 | Ga0495636_0272673 | Ga0495636_0272673_17_736 | 239 |
| 52 | 3300049570 | Ga0501033_0129390 | Ga0501033_0129390_316_1137 | 239 |
| 53 | 3300049822 | Ga0501035_0038419 | Ga0501035_0038419_2185_3006 | 239 |
| 54 | 3300005547 | Ga0070693_100239355 | Ga0070693_1002393552 | 240 |
| 55 | 3300013102 | Ga0157371_10000001 | Ga0157371_10000001235 | 240 |
| 56 | 3300015262 | Ga0182007_10033599 | Ga0182007_100335992 | 240 |
| 57 | 3300028666 | Ga0265336_10000151 | Ga0265336_1000015134 | 240 |
| 58 | 3300029957 | Ga0265324_10000001 | Ga0265324_10000001125 | 240 |
| 59 | 3300030736 | Ga0316180_1030800 | Ga0316180_10308005 | 240 |
| 60 | 3300031241 | Ga0265325_10000046 | Ga0265325_1000004612 | 240 |
| 61 | 3300031251 | Ga0265327_10001290 | Ga0265327_1000129017 | 240 |
| 62 | 3300031665 | Ga0316575_10012821 | Ga0316575_100128212 | 240 |
| 63 | 3300031711 | Ga0265314_10029905 | Ga0265314_100299053 | 240 |
| 64 | 3300032004 | Ga0307414_10126035 | Ga0307414_101260352 | 240 |
| 65 | 3300035398 | Ga0316574_0001661 | Ga0316574_0001661_359_1081 | 240 |
| 66 | 3300039447 | Ga0436361_0404930 | Ga0436361_0404930_1186_1992 | 240 |
| 67 | 3300046463 | Ga0495653_0000013 | Ga0495653_0000013_244750_245547 | 240 |
| 68 | 3300046471 | Ga0495650_0003861 | Ga0495650_0003861_4548_5387 | 240 |
| 69 | 3300046471 | Ga0495650_0043334 | Ga0495650_0043334_893_1690 | 240 |
| 70 | 3300046507 | Ga0495606_0001575 | Ga0495606_0001575_4750_5547 | 240 |
| 71 | 3300046520 | Ga0495637_0000881 | Ga0495637_0000881_1710_2507 | 240 |
| 72 | 3300046524 | Ga0495648_0020982 | Ga0495648_0020982_1167_2006 | 240 |
| 73 | 3300046530 | Ga0495654_0000261 | Ga0495654_0000261_4761_5558 | 240 |
| 74 | 3300046538 | Ga0495609_0028175 | Ga0495609_0028175_468_1307 | 240 |
| 75 | 3300046660 | Ga0495625_0064954 | Ga0495625_0064954_288_1130 | 240 |
| 76 | 3300048919 | Ga0496116_0226591 | Ga0496116_0226591_85_882 | 240 |
| 77 | 3300048925 | Ga0496122_0054686 | Ga0496122_0054686_1161_1958 | 240 |
| 78 | 3300048926 | Ga0496123_0014321 | Ga0496123_0014321_2402_3199 | 240 |
| 79 | 3300053118 | Ga0500594_0016394 | Ga0500594_0016394_605_1402 | 240 |
| 80 | iso_pu_bacteria | 8048746797 | 8048748934 | 240 |
| 81 | 3300025233 | Ga0209437_102900 | Ga0209437_1029002 | 241 |
| 82 | 3300046452 | Ga0495617_000049 | Ga0495617_000049_4722_5519 | 241 |
| 83 | 3300046460 | Ga0495638_0202885 | Ga0495638_0202885_149_946 | 241 |
| 84 | 3300046471 | Ga0495650_0002039 | Ga0495650_0002039_15009_15806 | 241 |
| 85 | 3300046491 | Ga0495584_0061131 | Ga0495584_0061131_641_1432 | 241 |
| 86 | 3300046492 | Ga0495585_0009117 | Ga0495585_0009117_3366_4157 | 241 |
| 87 | 3300046492 | Ga0495585_0011537 | Ga0495585_0011537_3453_4274 | 241 |
| 88 | 3300046500 | Ga0495596_0008828 | Ga0495596_0008828_1294_2133 | 241 |
| 89 | 3300046500 | Ga0495596_0035132 | Ga0495596_0035132_781_1572 | 241 |
| 90 | 3300046518 | Ga0495631_0005851 | Ga0495631_0005851_1964_2755 | 241 |
| 91 | 3300046519 | Ga0495632_0201490 | Ga0495632_0201490_15_791 | 241 |
| 92 | 3300046524 | Ga0495648_0046270 | Ga0495648_0046270_1550_2347 | 241 |
| 93 | 3300046528 | Ga0495642_0021650 | Ga0495642_0021650_599_1390 | 241 |
| 94 | 3300046530 | Ga0495654_0044445 | Ga0495654_0044445_289_1086 | 241 |
| 95 | 3300046537 | Ga0495598_0010948 | Ga0495598_0010948_357_1187 | 241 |
| 96 | 3300046542 | Ga0495597_0007373 | Ga0495597_0007373_3743_4534 | 241 |
| 97 | 3300046558 | Ga0495633_0012757 | Ga0495633_0012757_2942_3733 | 241 |
| 98 | 3300046558 | Ga0495633_0043371 | Ga0495633_0043371_665_1456 | 241 |
| 99 | 3300046558 | Ga0495633_0064497 | Ga0495633_0064497_676_1473 | 241 |
| 100 | 3300046615 | Ga0495656_0003076 | Ga0495656_0003076_4245_5036 | 241 |
| 101 | 3300046616 | Ga0495668_0007548 | Ga0495668_0007548_4803_5600 | 241 |
| 102 | 3300046616 | Ga0495668_0012651 | Ga0495668_0012651_1059_1850 | 241 |
| 103 | 3300046665 | Ga0495661_0012192 | Ga0495661_0012192_3059_3850 | 241 |
| 104 | 3300046665 | Ga0495661_0037553 | Ga0495661_0037553_976_1773 | 241 |
| 105 | 3300046684 | Ga0495669_0033098 | Ga0495669_0033098_427_1218 | 241 |
| 106 | 3300046684 | Ga0495669_0062407 | Ga0495669_0062407_382_1203 | 241 |
| 107 | 3300046691 | Ga0495670_0013397 | Ga0495670_0013397_1949_2740 | 241 |
| 108 | 3300046692 | Ga0495671_0067146 | Ga0495671_0067146_585_1376 | 241 |
| 109 | 3300046794 | Ga0495589_0069974 | Ga0495589_0069974_295_1086 | 241 |
| 110 | 3300047320 | Ga0495672_0013531 | Ga0495672_0013531_3424_4263 | 241 |
| 111 | 3300047323 | Ga0495683_0009260 | Ga0495683_0009260_1214_2053 | 241 |
| 112 | 3300047323 | Ga0495683_0078141 | Ga0495683_0078141_480_1277 | 241 |
| 113 | 3300047445 | Ga0495677_0012318 | Ga0495677_0012318_846_1637 | 241 |
| 114 | 3300047446 | Ga0495679_009450 | Ga0495679_009450_2456_3253 | 241 |
| 115 | 3300047469 | Ga0495673_0000006 | Ga0495673_0000006_699364_700161 | 241 |
| 116 | 3300047469 | Ga0495673_0000024 | Ga0495673_0000024_313255_314064 | 241 |
| 117 | 3300047469 | Ga0495673_0000049 | Ga0495673_0000049_122495_123292 | 241 |
| 118 | 3300047472 | Ga0495686_0115432 | Ga0495686_0115432_565_1362 | 241 |
| 119 | 3300048091 | Ga0495626_0036986 | Ga0495626_0036986_261_1082 | 241 |
| 120 | 3300048091 | Ga0495626_0052577 | Ga0495626_0052577_528_1367 | 241 |
| 121 | 3300048905 | Ga0496102_0273841 | Ga0496102_0273841_446_1276 | 241 |
| 122 | 3300048906 | Ga0496103_0002220 | Ga0496103_0002220_5993_6847 | 241 |
| 123 | 3300048929 | Ga0496126_0020682 | Ga0496126_0020682_3350_4147 | 241 |
| 124 | 3300053125 | Ga0500618_000786 | Ga0500618_000786_15689_16486 | 241 |
| 125 | 3300002738 | JGI25154J39366_1000747 | JGI25154J39366_10007473 | 242 |
| 126 | 3300006195 | Ga0075366_10042195 | Ga0075366_100421953 | 242 |
| 127 | 3300025245 | Ga0207425_1000479 | Ga0207425_100047918 | 242 |
| 128 | 3300025246 | Ga0209646_1000010 | Ga0209646_1000010457 | 242 |
| 129 | 3300025294 | Ga0209025_1007797 | Ga0209025_10077978 | 242 |
| 130 | 3300025297 | Ga0209758_1000842 | Ga0209758_100084228 | 242 |
| 131 | 3300044673 | Ga0453683_0192197 | Ga0453683_0192197_16_744 | 242 |
| 132 | 3300044712 | Ga0453684_0361886 | Ga0453684_0361886_204_932 | 242 |
| 133 | 3300046524 | Ga0495648_0047442 | Ga0495648_0047442_300_1121 | 242 |
| 134 | 3300046616 | Ga0495668_0166483 | Ga0495668_0166483_199_984 | 242 |
| 135 | 3300046694 | Ga0495649_0046758 | Ga0495649_0046758_462_1262 | 242 |
| 136 | 3300048091 | Ga0495626_0034003 | Ga0495626_0034003_1349_2170 | 242 |
| 137 | 3300048927 | Ga0496124_0331414 | Ga0496124_0331414_230_1015 | 242 |
| 138 | 3300053121 | Ga0500607_055813 | Ga0500607_055813_337_1065 | 242 |
| 139 | 3300053177 | Ga0500636_0003719 | Ga0500636_0003719_4616_5344 | 242 |
| 140 | 3300053178 | Ga0500637_0026771 | Ga0500637_0026771_1781_2509 | 242 |
| 141 | iso_pu_bacteria | 2885080285 | 2885083653 | 242 |
| 142 | 3300003763 | Ga0055529_1000095 | Ga0055529_100009572 | 243 |
| 143 | 3300009098 | Ga0105245_10421619 | Ga0105245_104216192 | 243 |
| 144 | 3300013306 | Ga0163162_10358257 | Ga0163162_103582572 | 243 |
| 145 | 3300025272 | Ga0209455_1000121 | Ga0209455_100012178 | 243 |
| 146 | 3300029957 | Ga0265324_10067957 | Ga0265324_100679572 | 243 |
| 147 | 3300031838 | Ga0307518_10005417 | Ga0307518_100054173 | 243 |
| 148 | 3300039447 | Ga0436361_0139948 | Ga0436361_0139948_148_918 | 243 |
| 149 | 3300044712 | Ga0453684_0220431 | Ga0453684_0220431_578_1324 | 243 |
| 150 | 3300045051 | Ga0451576_0422582 | Ga0451576_0422582_379_1125 | 243 |
| 151 | 3300046452 | Ga0495617_010347 | Ga0495617_010347_1079_1900 | 243 |
| 152 | 3300046520 | Ga0495637_0024309 | Ga0495637_0024309_509_1330 | 243 |
| 153 | 3300046522 | Ga0495643_0067900 | Ga0495643_0067900_478_1374 | 243 |
| 154 | 3300046694 | Ga0495649_0074304 | Ga0495649_0074304_466_1362 | 243 |
| 155 | 3300047317 | Ga0495604_0081395 | Ga0495604_0081395_1191_1997 | 243 |
| 156 | 3300047472 | Ga0495686_0000359 | Ga0495686_0000359_38894_39682 | 243 |
| 157 | 3300049823 | Ga0501044_0004041 | Ga0501044_0004041_9299_10192 | 243 |
| 158 | 3300017792 | Ga0163161_10104398 | Ga0163161_101043982 | 244 |
| 159 | 3300037418 | Ga0395900_0085072 | Ga0395900_0085072_1993_2727 | 244 |
| 160 | 3300037471 | Ga0395905_0235480 | Ga0395905_0235480_941_1675 | 244 |
| 161 | 3300046452 | Ga0495617_000029 | Ga0495617_000029_62650_63456 | 244 |
| 162 | 3300046453 | Ga0495627_000055 | Ga0495627_000055_25895_26746 | 244 |
| 163 | 3300046453 | Ga0495627_002501 | Ga0495627_002501_3447_4253 | 244 |
| 164 | 3300046460 | Ga0495638_0275995 | Ga0495638_0275995_57_866 | 244 |
| 165 | 3300046474 | Ga0495605_0000234 | Ga0495605_0000234_4714_5520 | 244 |
| 166 | 3300046474 | Ga0495605_0151299 | Ga0495605_0151299_137_934 | 244 |
| 167 | 3300046491 | Ga0495584_0229839 | Ga0495584_0229839_92_889 | 244 |
| 168 | 3300046492 | Ga0495585_0087211 | Ga0495585_0087211_358_1164 | 244 |
| 169 | 3300046500 | Ga0495596_0005327 | Ga0495596_0005327_1571_2368 | 244 |
| 170 | 3300046500 | Ga0495596_0025597 | Ga0495596_0025597_666_1472 | 244 |
| 171 | 3300046501 | Ga0495607_0033666 | Ga0495607_0033666_953_1759 | 244 |
| 172 | 3300046513 | Ga0495616_0120226 | Ga0495616_0120226_110_916 | 244 |
| 173 | 3300046518 | Ga0495631_0011618 | Ga0495631_0011618_1508_2305 | 244 |
| 174 | 3300046518 | Ga0495631_0039226 | Ga0495631_0039226_384_1190 | 244 |
| 175 | 3300046522 | Ga0495643_0026091 | Ga0495643_0026091_1284_2135 | 244 |
| 176 | 3300046522 | Ga0495643_0035832 | Ga0495643_0035832_734_1531 | 244 |
| 177 | 3300046524 | Ga0495648_0032180 | Ga0495648_0032180_1875_2681 | 244 |
| 178 | 3300046528 | Ga0495642_0007666 | Ga0495642_0007666_2539_3345 | 244 |
| 179 | 3300046538 | Ga0495609_0004507 | Ga0495609_0004507_1503_2354 | 244 |
| 180 | 3300046538 | Ga0495609_0008469 | Ga0495609_0008469_3723_4520 | 244 |
| 181 | 3300046557 | Ga0495622_0053437 | Ga0495622_0053437_166_963 | 244 |
| 182 | 3300046558 | Ga0495633_0034336 | Ga0495633_0034336_411_1217 | 244 |
| 183 | 3300046615 | Ga0495656_0019882 | Ga0495656_0019882_1391_2197 | 244 |
| 184 | 3300046616 | Ga0495668_0036165 | Ga0495668_0036165_384_1190 | 244 |
| 185 | 3300046616 | Ga0495668_0059353 | Ga0495668_0059353_167_964 | 244 |
| 186 | 3300046616 | Ga0495668_0203607 | Ga0495668_0203607_177_974 | 244 |
| 187 | 3300046648 | Ga0495611_0035193 | Ga0495611_0035193_286_1083 | 244 |
| 188 | 3300046665 | Ga0495661_0026571 | Ga0495661_0026571_1831_2637 | 244 |
| 189 | 3300046665 | Ga0495661_0051150 | Ga0495661_0051150_432_1238 | 244 |
| 190 | 3300046691 | Ga0495670_0023891 | Ga0495670_0023891_432_1238 | 244 |
| 191 | 3300046692 | Ga0495671_0016752 | Ga0495671_0016752_1961_2767 | 244 |
| 192 | 3300046694 | Ga0495649_0028389 | Ga0495649_0028389_962_1783 | 244 |
| 193 | 3300046794 | Ga0495589_0036858 | Ga0495589_0036858_82_888 | 244 |
| 194 | 3300046810 | Ga0495660_0023684 | Ga0495660_0023684_360_1211 | 244 |
| 195 | 3300047443 | Ga0495687_000149 | Ga0495687_000149_31050_31916 | 244 |
| 196 | 3300047445 | Ga0495677_0028488 | Ga0495677_0028488_617_1414 | 244 |
| 197 | 3300047469 | Ga0495673_0007809 | Ga0495673_0007809_1582_2379 | 244 |
| 198 | 3300048905 | Ga0496102_0000463 | Ga0496102_0000463_40924_41730 | 244 |
| 199 | 3300048919 | Ga0496116_0091391 | Ga0496116_0091391_680_1531 | 244 |
| 200 | 3300048924 | Ga0496121_0128319 | Ga0496121_0128319_587_1393 | 244 |
| 201 | 3300053161 | Ga0500634_0021734 | Ga0500634_0021734_913_1656 | 244 |
| 202 | iso_pu_bacteria | 2919476304 | 2919478744 | 244 |
| 203 | 3300003775 | Ga0055524_1001075 | Ga0055524_10010755 | 245 |
| 204 | 3300006173 | Ga0070716_100063383 | Ga0070716_1000633831 | 245 |
| 205 | 3300006948 | Ga0099826_10000001 | Ga0099826_100000011075 | 245 |
| 206 | 3300025263 | Ga0209565_1019027 | Ga0209565_10190272 | 245 |
| 207 | 3300025299 | Ga0209256_1000005 | Ga0209256_1000005544 | 245 |
| 208 | 3300025939 | Ga0207665_10113327 | Ga0207665_101133271 | 245 |
| 209 | 3300027666 | Ga0209282_1000001 | Ga0209282_10000012199 | 245 |
| 210 | 3300042128 | Ga0450897_001563 | Ga0450897_001563_104_868 | 245 |
| 211 | 3300044712 | Ga0453684_0051919 | Ga0453684_0051919_1235_1972 | 245 |
| 212 | 3300046512 | Ga0495610_0079240 | Ga0495610_0079240_451_1272 | 245 |
| 213 | 3300046522 | Ga0495643_0020177 | Ga0495643_0020177_2686_3507 | 245 |
| 214 | 3300047320 | Ga0495672_0000263 | Ga0495672_0000263_1837_2658 | 245 |
| 215 | 3300047321 | Ga0495676_0087321 | Ga0495676_0087321_473_1270 | 245 |
| 216 | 3300047472 | Ga0495686_0012141 | Ga0495686_0012141_1949_2752 | 245 |
| 217 | 3300047472 | Ga0495686_0062331 | Ga0495686_0062331_209_1054 | 245 |
| 218 | 3300050489 | nmdc:mga03683_13644_c1 | nmdc:mga03683_13644_c1_1425_2288 | 245 |
| 219 | 3300050493 | nmdc:mga0k408_345_c1 | nmdc:mga0k408_345_c1_18569_19306 | 245 |
| 220 | 3300053738 | Ga0500613_007527 | Ga0500613_007527_266_1003 | 245 |
| 221 | 3300003771 | Ga0055526_1000066 | Ga0055526_100006691 | 246 |
| 222 | 3300009036 | Ga0105244_10006792 | Ga0105244_100067925 | 246 |
| 223 | 3300009036 | Ga0105244_10013139 | Ga0105244_100131392 | 246 |
| 224 | 3300021361 | Ga0213872_10002205 | Ga0213872_100022052 | 246 |
| 225 | 3300025295 | Ga0209564_1000009 | Ga0209564_1000009551 | 246 |
| 226 | 3300025295 | Ga0209564_1000033 | Ga0209564_100003345 | 246 |
| 227 | 3300025949 | Ga0207667_10315435 | Ga0207667_103154352 | 246 |
| 228 | 3300039447 | Ga0436361_0974268 | Ga0436361_0974268_60751_61542 | 246 |
| 229 | 3300042876 | Ga0451577_0479241 | Ga0451577_0479241_296_1036 | 246 |
| 230 | 3300044673 | Ga0453683_0171527 | Ga0453683_0171527_559_1299 | 246 |
| 231 | 3300044712 | Ga0453684_0086145 | Ga0453684_0086145_1959_2699 | 246 |
| 232 | 3300045051 | Ga0451576_0013616 | Ga0451576_0013616_4538_5278 | 246 |
| 233 | 3300046460 | Ga0495638_0050470 | Ga0495638_0050470_967_1752 | 246 |
| 234 | 3300046471 | Ga0495650_0000272 | Ga0495650_0000272_96866_97651 | 246 |
| 235 | 3300046507 | Ga0495606_0000141 | Ga0495606_0000141_4723_5508 | 246 |
| 236 | 3300046507 | Ga0495606_0046399 | Ga0495606_0046399_1297_2118 | 246 |
| 237 | 3300046512 | Ga0495610_0007317 | Ga0495610_0007317_4485_5306 | 246 |
| 238 | 3300046558 | Ga0495633_0077887 | Ga0495633_0077887_79_864 | 246 |
| 239 | 3300046616 | Ga0495668_0000290 | Ga0495668_0000290_67797_68582 | 246 |
| 240 | 3300046660 | Ga0495625_0017675 | Ga0495625_0017675_1155_1940 | 246 |
| 241 | 3300046694 | Ga0495649_0031177 | Ga0495649_0031177_1662_2447 | 246 |
| 242 | 3300046810 | Ga0495660_0021513 | Ga0495660_0021513_2465_3310 | 246 |
| 243 | 3300046810 | Ga0495660_0074657 | Ga0495660_0074657_16_879 | 246 |
| 244 | 3300046810 | Ga0495660_0162173 | Ga0495660_0162173_137_1009 | 246 |
| 245 | 3300047472 | Ga0495686_0022789 | Ga0495686_0022789_2198_2983 | 246 |
| 246 | 3300006844 | Ga0075428_100041048 | Ga0075428_1000410483 | 247 |
| 247 | 3300009094 | Ga0111539_10001299 | Ga0111539_1000129928 | 247 |
| 248 | 3300015262 | Ga0182007_10000045 | Ga0182007_1000004578 | 247 |
| 249 | 3300015265 | Ga0182005_1000002 | Ga0182005_1000002816 | 247 |
| 250 | 3300021361 | Ga0213872_10059969 | Ga0213872_100599692 | 247 |
| 251 | 3300025250 | Ga0209026_1004031 | Ga0209026_10040314 | 247 |
| 252 | 3300027907 | Ga0207428_10007402 | Ga0207428_100074024 | 247 |
| 253 | 3300044765 | Ga0466970_0002958 | Ga0466970_0002958_3222_4013 | 247 |
| 254 | 3300046515 | Ga0495620_0004808 | Ga0495620_0004808_5178_5975 | 247 |
| 255 | 3300046528 | Ga0495642_0012849 | Ga0495642_0012849_759_1556 | 247 |
| 256 | 3300048920 | Ga0496117_0000001 | Ga0496117_0000001_1762982_1763860 | 247 |
| 257 | 3300048921 | Ga0496118_0000078 | Ga0496118_0000078_72094_72972 | 247 |
| 258 | 3300050511 | nmdc:mga08y16_11124_c1 | nmdc:mga08y16_11124_c1_2460_3203 | 247 |
| 259 | iso_pu_bacteria | 2739367655 | 2739610936 | 247 |
| 260 | iso_pu_bacteria | 2881927736 | 2881929395 | 247 |
| 261 | iso_pu_bacteria | 2887375801 | 2887380303 | 247 |
| 262 | iso_pu_bacteria | 8055225921 | 8055226810 | 247 |
| 263 | 3300003320 | rootH2_10077414 | rootH2_100774142 | 248 |
| 264 | 3300015261 | Ga0182006_1000002 | Ga0182006_1000002274 | 248 |
| 265 | 3300046492 | Ga0495585_0009367 | Ga0495585_0009367_1440_2237 | 248 |
| 266 | 3300046492 | Ga0495585_0087352 | Ga0495585_0087352_371_1252 | 248 |
| 267 | 3300046507 | Ga0495606_0015878 | Ga0495606_0015878_1175_1996 | 248 |
| 268 | 3300046660 | Ga0495625_0170920 | Ga0495625_0170920_284_1147 | 248 |
| 269 | 3300046691 | Ga0495670_0128950 | Ga0495670_0128950_29_826 | 248 |
| 270 | 3300049679 | Ga0501249_002398 | Ga0501249_002398_1948_2826 | 248 |
| 271 | 3300049766 | Ga0501269_000168 | Ga0501269_000168_13333_14211 | 248 |
| 272 | 3300053156 | Ga0500622_0000001 | Ga0500622_0000001_443262_444068 | 248 |
| 273 | 3300005455 | Ga0070663_100051650 | Ga0070663_1000516502 | 249 |
| 274 | 3300005539 | Ga0068853_100029851 | Ga0068853_1000298514 | 249 |
| 275 | 3300005563 | Ga0068855_100301870 | Ga0068855_1003018702 | 249 |
| 276 | 3300005577 | Ga0068857_100219076 | Ga0068857_1002190762 | 249 |
| 277 | 3300009094 | Ga0111539_10000107 | Ga0111539_1000010751 | 249 |
| 278 | 3300026041 | Ga0207639_10021597 | Ga0207639_100215974 | 249 |
| 279 | 3300026116 | Ga0207674_10124466 | Ga0207674_101244664 | 249 |
| 280 | 3300027907 | Ga0207428_10000040 | Ga0207428_1000004037 | 249 |
| 281 | 3300032004 | Ga0307414_10378650 | Ga0307414_103786501 | 249 |
| 282 | 3300037418 | Ga0395900_0025979 | Ga0395900_0025979_3173_3943 | 249 |
| 283 | 3300038443 | Ga0395901_0033321 | Ga0395901_0033321_1106_1876 | 249 |
| 284 | 3300038443 | Ga0395901_0228169 | Ga0395901_0228169_172_942 | 249 |
| 285 | 3300045051 | Ga0451576_0308673 | Ga0451576_0308673_690_1448 | 249 |
| 286 | 3300046507 | Ga0495606_0048380 | Ga0495606_0048380_1652_2464 | 249 |
| 287 | 3300046522 | Ga0495643_0048861 | Ga0495643_0048861_230_1051 | 249 |
| 288 | 3300046526 | Ga0495666_0004094 | Ga0495666_0004094_1239_2045 | 249 |
| 289 | 3300046538 | Ga0495609_0053778 | Ga0495609_0053778_756_1568 | 249 |
| 290 | 3300046665 | Ga0495661_0083870 | Ga0495661_0083870_296_1147 | 249 |
| 291 | 3300046674 | Ga0495588_0053207 | Ga0495588_0053207_899_1705 | 249 |
| 292 | 3300047321 | Ga0495676_0016373 | Ga0495676_0016373_4767_5573 | 249 |
| 293 | 3300048904 | Ga0496101_0010094 | Ga0496101_0010094_4355_5176 | 249 |
| 294 | 3300048912 | Ga0496109_0061983 | Ga0496109_0061983_2185_3006 | 249 |
| 295 | 3300048915 | Ga0496112_0117000 | Ga0496112_0117000_1147_1968 | 249 |
| 296 | 3300048916 | Ga0496113_0126741 | Ga0496113_0126741_386_1207 | 249 |
| 297 | 3300048925 | Ga0496122_0021480 | Ga0496122_0021480_3311_4132 | 249 |
| 298 | 3300048926 | Ga0496123_0015581 | Ga0496123_0015581_2079_2900 | 249 |
| 299 | 3300048928 | Ga0496125_0017315 | Ga0496125_0017315_4106_4927 | 249 |
| 300 | 3300049459 | Ga0495678_000155 | Ga0495678_000155_75403_76281 | 249 |
| 301 | 3300049568 | Ga0501031_0024531 | Ga0501031_0024531_405_1175 | 249 |
| 302 | 3300049568 | Ga0501031_0087749 | Ga0501031_0087749_1084_1854 | 249 |
| 303 | 3300049569 | Ga0501032_0019404 | Ga0501032_0019404_3641_4411 | 249 |
| 304 | 3300049570 | Ga0501033_0004989 | Ga0501033_0004989_1536_2306 | 249 |
| 305 | 3300049570 | Ga0501033_0151746 | Ga0501033_0151746_660_1430 | 249 |
| 306 | 3300049571 | Ga0501034_0006995 | Ga0501034_0006995_3720_4490 | 249 |
| 307 | 3300049572 | Ga0501036_0006814 | Ga0501036_0006814_4156_4926 | 249 |
| 308 | 3300049573 | Ga0501037_0003741 | Ga0501037_0003741_2607_3377 | 249 |
| 309 | 3300049573 | Ga0501037_0122769 | Ga0501037_0122769_361_1131 | 249 |
| 310 | 3300049574 | Ga0501038_0023096 | Ga0501038_0023096_4412_5182 | 249 |
| 311 | 3300049575 | Ga0501039_0052204 | Ga0501039_0052204_1640_2410 | 249 |
| 312 | 3300049579 | Ga0501043_0011320 | Ga0501043_0011320_6095_6865 | 249 |
| 313 | 3300049579 | Ga0501043_0205506 | Ga0501043_0205506_56_826 | 249 |
| 314 | 3300049580 | Ga0501046_0021099 | Ga0501046_0021099_332_1102 | 249 |
| 315 | 3300049580 | Ga0501046_0088842 | Ga0501046_0088842_1144_1914 | 249 |
| 316 | 3300049581 | Ga0501047_0001841 | Ga0501047_0001841_2677_3447 | 249 |
| 317 | 3300049581 | Ga0501047_0239861 | Ga0501047_0239861_357_1127 | 249 |
| 318 | 3300049582 | Ga0501048_0101418 | Ga0501048_0101418_90_860 | 249 |
| 319 | 3300049822 | Ga0501035_0027613 | Ga0501035_0027613_1322_2092 | 249 |
| 320 | 3300049823 | Ga0501044_0046534 | Ga0501044_0046534_2616_3386 | 249 |
| 321 | 3300049823 | Ga0501044_0049752 | Ga0501044_0049752_3257_4027 | 249 |
| 322 | 3300050511 | nmdc:mga08y16_233_c1 | nmdc:mga08y16_233_c1_10684_11442 | 249 |
| 323 | 3300005471 | Ga0070698_100588188 | Ga0070698_1005881881 | 250 |
| 324 | 3300005616 | Ga0068852_100011442 | Ga0068852_1000114424 | 250 |
| 325 | 3300005834 | Ga0068851_10003355 | Ga0068851_100033554 | 250 |
| 326 | 3300006237 | Ga0097621_100021443 | Ga0097621_1000214434 | 250 |
| 327 | 3300006358 | Ga0068871_100073517 | Ga0068871_1000735174 | 250 |
| 328 | 3300009093 | Ga0105240_10043233 | Ga0105240_100432335 | 250 |
| 329 | 3300009177 | Ga0105248_10088952 | Ga0105248_100889523 | 250 |
| 330 | 3300013296 | Ga0157374_10104290 | Ga0157374_101042904 | 250 |
| 331 | 3300013306 | Ga0163162_10203933 | Ga0163162_102039333 | 250 |
| 332 | 3300025321 | Ga0207656_10029214 | Ga0207656_100292144 | 250 |
| 333 | 3300025913 | Ga0207695_10050171 | Ga0207695_100501713 | 250 |
| 334 | 3300025941 | Ga0207711_10025198 | Ga0207711_100251982 | 250 |
| 335 | 3300026142 | Ga0207698_10009505 | Ga0207698_100095055 | 250 |
| 336 | 3300030744 | Ga0316181_1157853 | Ga0316181_11578532 | 250 |
| 337 | 3300031548 | Ga0307408_100010634 | Ga0307408_1000106344 | 250 |
| 338 | 3300035725 | Ga0373947_0089646 | Ga0373947_0089646_799_1557 | 250 |
| 339 | 3300046452 | Ga0495617_060263 | Ga0495617_060263_323_1129 | 250 |
| 340 | 3300046453 | Ga0495627_050932 | Ga0495627_050932_189_995 | 250 |
| 341 | 3300046473 | Ga0495582_0015183 | Ga0495582_0015183_1664_2470 | 250 |
| 342 | 3300046491 | Ga0495584_0040858 | Ga0495584_0040858_1072_1878 | 250 |
| 343 | 3300046492 | Ga0495585_0018564 | Ga0495585_0018564_1140_1946 | 250 |
| 344 | 3300046499 | Ga0495594_0012518 | Ga0495594_0012518_1713_2519 | 250 |
| 345 | 3300046500 | Ga0495596_0059819 | Ga0495596_0059819_11_817 | 250 |
| 346 | 3300046501 | Ga0495607_0029025 | Ga0495607_0029025_181_1038 | 250 |
| 347 | 3300046501 | Ga0495607_0069953 | Ga0495607_0069953_418_1224 | 250 |
| 348 | 3300046513 | Ga0495616_0019387 | Ga0495616_0019387_1139_1945 | 250 |
| 349 | 3300046518 | Ga0495631_0047032 | Ga0495631_0047032_18_824 | 250 |
| 350 | 3300046523 | Ga0495644_0009368 | Ga0495644_0009368_1486_2292 | 250 |
| 351 | 3300046528 | Ga0495642_0024009 | Ga0495642_0024009_533_1339 | 250 |
| 352 | 3300046557 | Ga0495622_0026490 | Ga0495622_0026490_955_1761 | 250 |
| 353 | 3300046558 | Ga0495633_0012536 | Ga0495633_0012536_418_1224 | 250 |
| 354 | 3300046616 | Ga0495668_0037857 | Ga0495668_0037857_1291_2097 | 250 |
| 355 | 3300046660 | Ga0495625_0064616 | Ga0495625_0064616_1303_2109 | 250 |
| 356 | 3300046665 | Ga0495661_0029521 | Ga0495661_0029521_1322_2128 | 250 |
| 357 | 3300046674 | Ga0495588_0014151 | Ga0495588_0014151_1308_2114 | 250 |
| 358 | 3300046684 | Ga0495669_0004622 | Ga0495669_0004622_3317_4123 | 250 |
| 359 | 3300046691 | Ga0495670_0013844 | Ga0495670_0013844_1233_2039 | 250 |
| 360 | 3300047315 | Ga0495581_0039795 | Ga0495581_0039795_538_1344 | 250 |
| 361 | 3300047323 | Ga0495683_0147375 | Ga0495683_0147375_139_945 | 250 |
| 362 | 3300047443 | Ga0495687_005542 | Ga0495687_005542_3962_4783 | 250 |
| 363 | 3300047445 | Ga0495677_0020063 | Ga0495677_0020063_397_1203 | 250 |
| 364 | 3300047445 | Ga0495677_0040379 | Ga0495677_0040379_447_1268 | 250 |
| 365 | 3300047446 | Ga0495679_025306 | Ga0495679_025306_518_1324 | 250 |
| 366 | 3300047447 | Ga0495685_016233 | Ga0495685_016233_371_1177 | 250 |
| 367 | 3300048089 | Ga0495614_0019793 | Ga0495614_0019793_554_1360 | 250 |
| 368 | 3300048907 | Ga0496104_0010667 | Ga0496104_0010667_4600_5358 | 250 |
| 369 | 3300048908 | Ga0496105_0093134 | Ga0496105_0093134_812_1570 | 250 |
| 370 | 3300048912 | Ga0496109_0108740 | Ga0496109_0108740_1416_2174 | 250 |
| 371 | 3300048913 | Ga0496110_0067822 | Ga0496110_0067822_886_1644 | 250 |
| 372 | 3300048914 | Ga0496111_0210459 | Ga0496111_0210459_304_1182 | 250 |
| 373 | 3300048919 | Ga0496116_0037867 | Ga0496116_0037867_1493_2371 | 250 |
| 374 | 3300048925 | Ga0496122_0055319 | Ga0496122_0055319_301_1179 | 250 |
| 375 | 3300048926 | Ga0496123_0050713 | Ga0496123_0050713_1160_2038 | 250 |
| 376 | 3300042876 | Ga0451577_0046163 | Ga0451577_0046163_234_992 | 251 |
| 377 | 3300044673 | Ga0453683_0018493 | Ga0453683_0018493_1136_1966 | 251 |
| 378 | 3300044712 | Ga0453684_0077881 | Ga0453684_0077881_2356_3114 | 251 |
| 379 | 3300044712 | Ga0453684_0161015 | Ga0453684_0161015_1430_2188 | 251 |
| 380 | 3300046460 | Ga0495638_0053769 | Ga0495638_0053769_1370_2167 | 251 |
| 381 | 3300046491 | Ga0495584_0000924 | Ga0495584_0000924_4662_5459 | 251 |
| 382 | 3300046501 | Ga0495607_0008135 | Ga0495607_0008135_1323_2120 | 251 |
| 383 | 3300046533 | Ga0495640_0114862 | Ga0495640_0114862_705_1511 | 251 |
| 384 | 3300046538 | Ga0495609_0000426 | Ga0495609_0000426_4616_5413 | 251 |
| 385 | 3300046558 | Ga0495633_0017946 | Ga0495633_0017946_1819_2628 | 251 |
| 386 | 3300046616 | Ga0495668_0008482 | Ga0495668_0008482_1149_1946 | 251 |
| 387 | 3300046660 | Ga0495625_0041908 | Ga0495625_0041908_1199_1996 | 251 |
| 388 | 3300046664 | Ga0495659_0007441 | Ga0495659_0007441_1083_1880 | 251 |
| 389 | 3300046665 | Ga0495661_0063510 | Ga0495661_0063510_379_1176 | 251 |
| 390 | 3300046694 | Ga0495649_0021357 | Ga0495649_0021357_1017_1814 | 251 |
| 391 | 3300047318 | Ga0495636_0011164 | Ga0495636_0011164_2685_3482 | 251 |
| 392 | 3300047320 | Ga0495672_0000093 | Ga0495672_0000093_92207_93085 | 251 |
| 393 | 3300047443 | Ga0495687_008783 | Ga0495687_008783_3038_3835 | 251 |
| 394 | 3300047445 | Ga0495677_0001373 | Ga0495677_0001373_4565_5362 | 251 |
| 395 | 3300047447 | Ga0495685_007493 | Ga0495685_007493_2350_3147 | 251 |
| 396 | 3300047470 | Ga0495681_0025094 | Ga0495681_0025094_929_1726 | 251 |
| 397 | 3300049587 | Ga0501071_0274594 | Ga0501071_0274594_470_1234 | 251 |
| 398 | 3300028794 | Ga0307515_10204967 | Ga0307515_102049673 | 252 |
| 399 | 3300037312 | Ga0395899_0000028 | Ga0395899_0000028_201324_202133 | 252 |
| 400 | 3300037471 | Ga0395905_0068788 | Ga0395905_0068788_1234_2025 | 252 |
| 401 | 3300042876 | Ga0451577_0013625 | Ga0451577_0013625_4464_5228 | 252 |
| 402 | 3300046457 | Ga0495590_0000003 | Ga0495590_0000003_474627_475448 | 252 |
| 403 | 3300046474 | Ga0495605_0067074 | Ga0495605_0067074_204_1007 | 252 |
| 404 | 3300046507 | Ga0495606_0000152 | Ga0495606_0000152_25211_26053 | 252 |
| 405 | 3300046522 | Ga0495643_0017465 | Ga0495643_0017465_2611_3432 | 252 |
| 406 | 3300046530 | Ga0495654_0069624 | Ga0495654_0069624_376_1179 | 252 |
| 407 | 3300046535 | Ga0495586_0030122 | Ga0495586_0030122_1272_2078 | 252 |
| 408 | 3300046538 | Ga0495609_0113488 | Ga0495609_0113488_103_906 | 252 |
| 409 | 3300046542 | Ga0495597_0001525 | Ga0495597_0001525_1308_2129 | 252 |
| 410 | 3300046542 | Ga0495597_0036030 | Ga0495597_0036030_476_1279 | 252 |
| 411 | 3300046616 | Ga0495668_0007441 | Ga0495668_0007441_4358_5179 | 252 |
| 412 | 3300046616 | Ga0495668_0046372 | Ga0495668_0046372_1198_2001 | 252 |
| 413 | 3300046663 | Ga0495635_0007114 | Ga0495635_0007114_1887_2693 | 252 |
| 414 | 3300046689 | Ga0495613_0095663 | Ga0495613_0095663_711_1517 | 252 |
| 415 | 3300047317 | Ga0495604_0065846 | Ga0495604_0065846_1509_2315 | 252 |
| 416 | 3300047322 | Ga0495680_0045840 | Ga0495680_0045840_1336_2142 | 252 |
| 417 | 3300047444 | Ga0495675_0034341 | Ga0495675_0034341_417_1223 | 252 |
| 418 | 3300047673 | Ga0495593_0021192 | Ga0495593_0021192_1721_2527 | 252 |
| 419 | 3300048089 | Ga0495614_0027165 | Ga0495614_0027165_399_1205 | 252 |
| 420 | 3300050491 | nmdc:mga00v17_1600_c1 | nmdc:mga00v17_1600_c1_6028_6810 | 252 |
| 421 | iso_pu_bacteria | 2857542790 | 2857545185 | 252 |
| 422 | iso_pu_bacteria | 8002392321 | 8002393370 | 252 |
| 423 | 3300005337 | Ga0070682_100190768 | Ga0070682_1001907681 | 253 |
| 424 | 3300005354 | Ga0070675_100133398 | Ga0070675_1001333984 | 253 |
| 425 | 3300005438 | Ga0070701_10039430 | Ga0070701_100394301 | 253 |
| 426 | 3300005617 | Ga0068859_100058550 | Ga0068859_1000585503 | 253 |
| 427 | 3300005843 | Ga0068860_100617989 | Ga0068860_1006179892 | 253 |
| 428 | 3300006931 | Ga0097620_100058551 | Ga0097620_1000585513 | 253 |
| 429 | 3300025926 | Ga0207659_10137954 | Ga0207659_101379542 | 253 |
| 430 | 3300028381 | Ga0268264_10484293 | Ga0268264_104842931 | 253 |
| 431 | 3300035695 | Ga0373927_0086727 | Ga0373927_0086727_190_960 | 253 |
| 432 | 3300037068 | Ga0373925_0015424 | Ga0373925_0015424_4008_4778 | 253 |
| 433 | 3300046522 | Ga0495643_0018959 | Ga0495643_0018959_1724_2521 | 253 |
| 434 | 3300046810 | Ga0495660_0104854 | Ga0495660_0104854_52_873 | 253 |
| 435 | 3300047445 | Ga0495677_0096830 | Ga0495677_0096830_113_910 | 253 |
| 436 | 3300049576 | Ga0501040_0000016 | Ga0501040_0000016_6762_7571 | 253 |
| 437 | 3300049578 | Ga0501042_0000046 | Ga0501042_0000046_31667_32476 | 253 |
| 438 | iso_pu_bacteria | 2599185292 | 2599903298 | 253 |
| 439 | iso_pu_bacteria | 2643221569 | 2643862204 | 253 |
| 440 | iso_pu_bacteria | 2643221621 | 2644122194 | 253 |
| 441 | iso_pu_bacteria | 2857537821 | 2857538398 | 253 |
| 442 | iso_pu_bacteria | 2858950400 | 2858955658 | 253 |
| 443 | iso_pu_bacteria | 2941479691 | 2941482006 | 253 |
| 444 | 3300006051 | Ga0075364_10000886 | Ga0075364_1000088610 | 254 |
| 445 | 3300037418 | Ga0395900_0761271 | Ga0395900_0761271_108_878 | 254 |
| 446 | 3300042876 | Ga0451577_0044750 | Ga0451577_0044750_1832_2647 | 254 |
| 447 | 3300044712 | Ga0453684_0150202 | Ga0453684_0150202_1362_2177 | 254 |
| 448 | 3300045051 | Ga0451576_0018250 | Ga0451576_0018250_5666_6481 | 254 |
| 449 | 3300046452 | Ga0495617_010848 | Ga0495617_010848_706_1512 | 254 |
| 450 | 3300046459 | Ga0495629_0012395 | Ga0495629_0012395_4728_5492 | 254 |
| 451 | 3300046459 | Ga0495629_0017554 | Ga0495629_0017554_3266_4066 | 254 |
| 452 | 3300046459 | Ga0495629_0019645 | Ga0495629_0019645_971_1735 | 254 |
| 453 | 3300046459 | Ga0495629_0094384 | Ga0495629_0094384_64_864 | 254 |
| 454 | 3300046462 | Ga0495651_0084919 | Ga0495651_0084919_975_1775 | 254 |
| 455 | 3300046463 | Ga0495653_0054550 | Ga0495653_0054550_1035_1835 | 254 |
| 456 | 3300046472 | Ga0495580_0023253 | Ga0495580_0023253_3680_4480 | 254 |
| 457 | 3300046473 | Ga0495582_0081784 | Ga0495582_0081784_805_1569 | 254 |
| 458 | 3300046473 | Ga0495582_0209825 | Ga0495582_0209825_134_934 | 254 |
| 459 | 3300046491 | Ga0495584_0035283 | Ga0495584_0035283_1231_1995 | 254 |
| 460 | 3300046499 | Ga0495594_0006450 | Ga0495594_0006450_3814_4578 | 254 |
| 461 | 3300046499 | Ga0495594_0078633 | Ga0495594_0078633_72_836 | 254 |
| 462 | 3300046516 | Ga0495628_0069039 | Ga0495628_0069039_786_1586 | 254 |
| 463 | 3300046517 | Ga0495630_0064151 | Ga0495630_0064151_525_1289 | 254 |
| 464 | 3300046526 | Ga0495666_0014442 | Ga0495666_0014442_970_1734 | 254 |
| 465 | 3300046526 | Ga0495666_0061016 | Ga0495666_0061016_932_1696 | 254 |
| 466 | 3300046526 | Ga0495666_0068438 | Ga0495666_0068438_861_1625 | 254 |
| 467 | 3300046528 | Ga0495642_0065351 | Ga0495642_0065351_463_1227 | 254 |
| 468 | 3300046528 | Ga0495642_0082258 | Ga0495642_0082258_101_865 | 254 |
| 469 | 3300046529 | Ga0495652_0105790 | Ga0495652_0105790_375_1139 | 254 |
| 470 | 3300046530 | Ga0495654_0027302 | Ga0495654_0027302_703_1533 | 254 |
| 471 | 3300046531 | Ga0495665_0013679 | Ga0495665_0013679_3137_3901 | 254 |
| 472 | 3300046531 | Ga0495665_0021734 | Ga0495665_0021734_2091_2855 | 254 |
| 473 | 3300046531 | Ga0495665_0199772 | Ga0495665_0199772_49_849 | 254 |
| 474 | 3300046535 | Ga0495586_0004391 | Ga0495586_0004391_4533_5297 | 254 |
| 475 | 3300046535 | Ga0495586_0058199 | Ga0495586_0058199_1049_1813 | 254 |
| 476 | 3300046542 | Ga0495597_0063234 | Ga0495597_0063234_327_1091 | 254 |
| 477 | 3300046557 | Ga0495622_0002586 | Ga0495622_0002586_4925_5725 | 254 |
| 478 | 3300046557 | Ga0495622_0028950 | Ga0495622_0028950_247_1011 | 254 |
| 479 | 3300046557 | Ga0495622_0038512 | Ga0495622_0038512_1062_1826 | 254 |
| 480 | 3300046558 | Ga0495633_0008936 | Ga0495633_0008936_1420_2307 | 254 |
| 481 | 3300046558 | Ga0495633_0049603 | Ga0495633_0049603_846_1652 | 254 |
| 482 | 3300046558 | Ga0495633_0113830 | Ga0495633_0113830_244_1065 | 254 |
| 483 | 3300046642 | Ga0495634_0331449 | Ga0495634_0331449_68_832 | 254 |
| 484 | 3300046660 | Ga0495625_0030783 | Ga0495625_0030783_265_1029 | 254 |
| 485 | 3300046664 | Ga0495659_0000073 | Ga0495659_0000073_1308_2138 | 254 |
| 486 | 3300046674 | Ga0495588_0015342 | Ga0495588_0015342_526_1290 | 254 |
| 487 | 3300046674 | Ga0495588_0141804 | Ga0495588_0141804_419_1183 | 254 |
| 488 | 3300046678 | Ga0495599_0278751 | Ga0495599_0278751_212_976 | 254 |
| 489 | 3300046679 | Ga0495623_0006061 | Ga0495623_0006061_5758_6522 | 254 |
| 490 | 3300046680 | Ga0495646_0052355 | Ga0495646_0052355_722_1522 | 254 |
| 491 | 3300046689 | Ga0495613_0106389 | Ga0495613_0106389_125_889 | 254 |
| 492 | 3300046690 | Ga0495624_0026017 | Ga0495624_0026017_2725_3525 | 254 |
| 493 | 3300046690 | Ga0495624_0057797 | Ga0495624_0057797_291_1055 | 254 |
| 494 | 3300046690 | Ga0495624_0150981 | Ga0495624_0150981_63_827 | 254 |
| 495 | 3300046692 | Ga0495671_0000309 | Ga0495671_0000309_39214_40044 | 254 |
| 496 | 3300046809 | Ga0495600_0129233 | Ga0495600_0129233_145_909 | 254 |
| 497 | 3300047315 | Ga0495581_0015375 | Ga0495581_0015375_1054_1818 | 254 |
| 498 | 3300047315 | Ga0495581_0050558 | Ga0495581_0050558_1011_1775 | 254 |
| 499 | 3300047317 | Ga0495604_0065883 | Ga0495604_0065883_150_914 | 254 |
| 500 | 3300047319 | Ga0495674_0019293 | Ga0495674_0019293_46_810 | 254 |
| 501 | 3300047319 | Ga0495674_0052612 | Ga0495674_0052612_58_858 | 254 |
| 502 | 3300047319 | Ga0495674_0142125 | Ga0495674_0142125_455_1219 | 254 |
| 503 | 3300047320 | Ga0495672_0000176 | Ga0495672_0000176_17955_18785 | 254 |
| 504 | 3300047320 | Ga0495672_0050654 | Ga0495672_0050654_128_934 | 254 |
| 505 | 3300047321 | Ga0495676_0093020 | Ga0495676_0093020_1186_1950 | 254 |
| 506 | 3300047673 | Ga0495593_0100385 | Ga0495593_0100385_25_789 | 254 |
| 507 | 3300048088 | Ga0495602_0043464 | Ga0495602_0043464_3124_3888 | 254 |
| 508 | 3300048091 | Ga0495626_0007491 | Ga0495626_0007491_2047_2811 | 254 |
| 509 | 3300048927 | Ga0496124_0025451 | Ga0496124_0025451_2195_2959 | 254 |
| 510 | 3300053145 | Ga0500586_009115 | Ga0500586_009115_1231_2052 | 254 |
| 511 | iso_pu_bacteria | 2643221554 | 2643787382 | 254 |
| 512 | iso_pu_bacteria | 2643221638 | 2644214103 | 254 |
| 513 | 3300003771 | Ga0055526_1004314 | Ga0055526_10043149 | 255 |
| 514 | 3300003773 | Ga0055537_1001124 | Ga0055537_10011244 | 255 |
| 515 | 3300003775 | Ga0055524_1010843 | Ga0055524_10108433 | 255 |
| 516 | 3300003784 | Ga0055534_1001481 | Ga0055534_10014816 | 255 |
| 517 | 3300003784 | Ga0055534_1001729 | Ga0055534_10017299 | 255 |
| 518 | 3300003790 | Ga0055528_1000089 | Ga0055528_100008956 | 255 |
| 519 | 3300017792 | Ga0163161_10420463 | Ga0163161_104204631 | 255 |
| 520 | 3300025263 | Ga0209565_1000009 | Ga0209565_1000009179 | 255 |
| 521 | 3300025273 | Ga0209673_1000019 | Ga0209673_1000019203 | 255 |
| 522 | 3300025291 | Ga0209675_1000028 | Ga0209675_1000028153 | 255 |
| 523 | 3300025295 | Ga0209564_1000058 | Ga0209564_1000058141 | 255 |
| 524 | 3300025299 | Ga0209256_1000052 | Ga0209256_100005213 | 255 |
| 525 | 3300042139 | Ga0450904_001501 | Ga0450904_001501_847_1614 | 255 |
| 526 | 3300044656 | Ga0466969_0053685 | Ga0466969_0053685_106_903 | 255 |
| 527 | 3300044684 | Ga0466966_0009507 | Ga0466966_0009507_4501_5298 | 255 |
| 528 | 3300044684 | Ga0466966_0062085 | Ga0466966_0062085_329_1135 | 255 |
| 529 | 3300044693 | Ga0466961_0030473 | Ga0466961_0030473_1166_1972 | 255 |
| 530 | 3300046460 | Ga0495638_0027695 | Ga0495638_0027695_1656_2462 | 255 |
| 531 | 3300046474 | Ga0495605_0005259 | Ga0495605_0005259_1841_2647 | 255 |
| 532 | 3300046491 | Ga0495584_0003900 | Ga0495584_0003900_1032_1838 | 255 |
| 533 | 3300046491 | Ga0495584_0141550 | Ga0495584_0141550_30_836 | 255 |
| 534 | 3300046506 | Ga0495583_0000155 | Ga0495583_0000155_33827_34633 | 255 |
| 535 | 3300046513 | Ga0495616_0097318 | Ga0495616_0097318_85_891 | 255 |
| 536 | 3300046520 | Ga0495637_0006176 | Ga0495637_0006176_890_1657 | 255 |
| 537 | 3300046524 | Ga0495648_0009549 | Ga0495648_0009549_3754_4560 | 255 |
| 538 | 3300046525 | Ga0495663_0010248 | Ga0495663_0010248_1223_2020 | 255 |
| 539 | 3300046538 | Ga0495609_0003109 | Ga0495609_0003109_6085_6891 | 255 |
| 540 | 3300046557 | Ga0495622_0042586 | Ga0495622_0042586_578_1471 | 255 |
| 541 | 3300046615 | Ga0495656_0014969 | Ga0495656_0014969_318_1115 | 255 |
| 542 | 3300046648 | Ga0495611_0045571 | Ga0495611_0045571_468_1274 | 255 |
| 543 | 3300046664 | Ga0495659_0006944 | Ga0495659_0006944_1049_1855 | 255 |
| 544 | 3300046665 | Ga0495661_0101896 | Ga0495661_0101896_480_1286 | 255 |
| 545 | 3300047318 | Ga0495636_0007644 | Ga0495636_0007644_1634_2440 | 255 |
| 546 | 3300047323 | Ga0495683_0039174 | Ga0495683_0039174_505_1311 | 255 |
| 547 | 3300047443 | Ga0495687_000296 | Ga0495687_000296_1788_2594 | 255 |
| 548 | 3300047445 | Ga0495677_0006058 | Ga0495677_0006058_2708_3514 | 255 |
| 549 | 3300047447 | Ga0495685_000250 | Ga0495685_000250_3524_4330 | 255 |
| 550 | 3300047469 | Ga0495673_0015916 | Ga0495673_0015916_1509_2315 | 255 |
| 551 | 3300047472 | Ga0495686_0212640 | Ga0495686_0212640_82_888 | 255 |
| 552 | 3300048090 | Ga0495615_0005881 | Ga0495615_0005881_166_963 | 255 |
| 553 | 3300048091 | Ga0495626_0121132 | Ga0495626_0121132_199_966 | 255 |
| 554 | 3300048925 | Ga0496122_0159956 | Ga0496122_0159956_52_828 | 255 |
| 555 | 3300048927 | Ga0496124_0000024 | Ga0496124_0000024_143791_144567 | 255 |
| 556 | 3300049459 | Ga0495678_018497 | Ga0495678_018497_860_1666 | 255 |
| 557 | 3300049460 | Ga0495682_0050037 | Ga0495682_0050037_468_1274 | 255 |
| 558 | 3300053118 | Ga0500594_0018577 | Ga0500594_0018577_661_1494 | 255 |
| 559 | iso_pu_bacteria | 2643221645 | 2644252405 | 255 |
| 560 | iso_pu_bacteria | 2738541280 | 2738741562 | 255 |
| 561 | iso_pu_bacteria | 2738541300 | 2738843819 | 255 |
| 562 | iso_pu_bacteria | 2738541357 | 2739153393 | 255 |
| 563 | iso_pu_bacteria | 2738543003 | 2739195313 | 255 |
| 564 | iso_pu_bacteria | 2738543018 | 2739277642 | 255 |
| 565 | iso_pu_bacteria | 2738543026 | 2739321789 | 255 |
| 566 | iso_pu_bacteria | 2738543029 | 2739339655 | 255 |
| 567 | iso_pu_bacteria | 2738543030 | 2739346673 | 255 |
| 568 | iso_pu_bacteria | 2821131069 | 2821131233 | 255 |
| 569 | iso_pu_bacteria | 2855730933 | 2855736619 | 255 |
| 570 | iso_pu_bacteria | 2855767633 | 2855773556 | 255 |
| 571 | iso_pu_bacteria | 2857564685 | 2857565094 | 255 |
| 572 | iso_pu_bacteria | 2857576091 | 2857576731 | 255 |
| 573 | iso_pu_bacteria | 2881412998 | 2881418441 | 255 |
| 574 | 3300025292 | Ga0209676_1006174 | Ga0209676_10061744 | 256 |
| 575 | 3300025298 | Ga0209050_1002447 | Ga0209050_100244712 | 256 |
| 576 | 3300025303 | Ga0209051_1030316 | Ga0209051_10303162 | 256 |
| 577 | 3300031911 | Ga0307412_10012228 | Ga0307412_100122284 | 256 |
| 578 | 3300032004 | Ga0307414_10086664 | Ga0307414_100866644 | 256 |
| 579 | 3300046471 | Ga0495650_0000097 | Ga0495650_0000097_4854_5675 | 256 |
| 580 | 3300046507 | Ga0495606_0008580 | Ga0495606_0008580_3283_4104 | 256 |
| 581 | 3300046507 | Ga0495606_0018064 | Ga0495606_0018064_1058_1849 | 256 |
| 582 | 3300046512 | Ga0495610_0049877 | Ga0495610_0049877_989_1810 | 256 |
| 583 | 3300046557 | Ga0495622_0011541 | Ga0495622_0011541_820_1641 | 256 |
| 584 | 3300046558 | Ga0495633_0000362 | Ga0495633_0000362_586_1407 | 256 |
| 585 | 3300046660 | Ga0495625_0027829 | Ga0495625_0027829_3102_3923 | 256 |
| 586 | 3300046664 | Ga0495659_0050963 | Ga0495659_0050963_38_808 | 256 |
| 587 | 3300046674 | Ga0495588_0079899 | Ga0495588_0079899_885_1655 | 256 |
| 588 | 3300048919 | Ga0496116_0010198 | Ga0496116_0010198_4716_5495 | 256 |
| 589 | 3300048920 | Ga0496117_0041521 | Ga0496117_0041521_926_1705 | 256 |
| 590 | 3300048920 | Ga0496117_0056443 | Ga0496117_0056443_298_1077 | 256 |
| 591 | 3300048921 | Ga0496118_0039039 | Ga0496118_0039039_1997_2776 | 256 |
| 592 | 3300048922 | Ga0496119_0016500 | Ga0496119_0016500_2284_3063 | 256 |
| 593 | 3300048922 | Ga0496119_0101566 | Ga0496119_0101566_383_1162 | 256 |
| 594 | 3300048923 | Ga0496120_0015571 | Ga0496120_0015571_1024_1803 | 256 |
| 595 | 3300048924 | Ga0496121_0000629 | Ga0496121_0000629_49326_50105 | 256 |
| 596 | 3300048924 | Ga0496121_0008619 | Ga0496121_0008619_2631_3509 | 256 |
| 597 | 3300048925 | Ga0496122_0117489 | Ga0496122_0117489_448_1227 | 256 |
| 598 | 3300048927 | Ga0496124_0034686 | Ga0496124_0034686_1270_2049 | 256 |
| 599 | 3300048927 | Ga0496124_0213585 | Ga0496124_0213585_415_1194 | 256 |
| 600 | 3300048928 | Ga0496125_0000011 | Ga0496125_0000011_244991_245770 | 256 |
| 601 | 3300048928 | Ga0496125_0054414 | Ga0496125_0054414_2341_3219 | 256 |
| 602 | 3300048929 | Ga0496126_0211321 | Ga0496126_0211321_450_1229 | 256 |
| 603 | iso_pu_bacteria | 2600255292 | 2601667357 | 256 |
| 604 | iso_pu_bacteria | 2643221664 | 2644357095 | 256 |
| 605 | iso_pu_bacteria | 2856287931 | 2856289720 | 256 |
| 606 | iso_pu_bacteria | 2857357740 | 2857364452 | 256 |
| 607 | iso_pu_bacteria | 2857547612 | 2857551919 | 256 |
| 608 | iso_pu_bacteria | 2932410948 | 2932410975 | 256 |
| 609 | iso_pu_bacteria | 2932416698 | 2932419458 | 256 |
| 610 | 3300006051 | Ga0075364_10341785 | Ga0075364_103417852 | 257 |
| 611 | 3300006058 | Ga0075432_10030849 | Ga0075432_100308492 | 257 |
| 612 | 3300015261 | Ga0182006_1000117 | Ga0182006_100011723 | 257 |
| 613 | 3300015265 | Ga0182005_1000041 | Ga0182005_1000041124 | 257 |
| 614 | 3300046492 | Ga0495585_0011031 | Ga0495585_0011031_545_1336 | 257 |
| 615 | 3300046499 | Ga0495594_0140568 | Ga0495594_0140568_312_1124 | 257 |
| 616 | 3300046507 | Ga0495606_0018769 | Ga0495606_0018769_1671_2453 | 257 |
| 617 | 3300046507 | Ga0495606_0245644 | Ga0495606_0245644_185_982 | 257 |
| 618 | 3300046518 | Ga0495631_0026426 | Ga0495631_0026426_905_1687 | 257 |
| 619 | 3300046518 | Ga0495631_0047731 | Ga0495631_0047731_509_1300 | 257 |
| 620 | 3300046526 | Ga0495666_0077116 | Ga0495666_0077116_260_1072 | 257 |
| 621 | 3300046616 | Ga0495668_0045379 | Ga0495668_0045379_517_1299 | 257 |
| 622 | 3300046648 | Ga0495611_0038476 | Ga0495611_0038476_1273_2064 | 257 |
| 623 | 3300047318 | Ga0495636_0074556 | Ga0495636_0074556_40_831 | 257 |
| 624 | 3300047321 | Ga0495676_0069686 | Ga0495676_0069686_1542_2333 | 257 |
| 625 | 3300047323 | Ga0495683_0116354 | Ga0495683_0116354_464_1246 | 257 |
| 626 | 3300048924 | Ga0496121_0075172 | Ga0496121_0075172_1188_1970 | 257 |
| 627 | 3300049575 | Ga0501039_0516859 | Ga0501039_0516859_116_898 | 257 |
| 628 | 3300050491 | nmdc:mga00v17_128548_c1 | nmdc:mga00v17_128548_c1_54_839 | 257 |
| 629 | 3300053149 | Ga0500600_0049219 | Ga0500600_0049219_1426_2211 | 257 |
| 630 | iso_pu_bacteria | 2643221603 | 2644028908 | 257 |
| 631 | 3300002739 | JGI25158J39367_1008480 | JGI25158J39367_10084802 | 258 |
| 632 | 3300002739 | JGI25158J39367_1016487 | JGI25158J39367_10164871 | 258 |
| 633 | 3300002773 | JGI25152J39213_1002923 | JGI25152J39213_10029232 | 258 |
| 634 | 3300002987 | JGI25159J45721_1006004 | JGI25159J45721_10060044 | 258 |
| 635 | 3300002987 | JGI25159J45721_1007311 | JGI25159J45721_10073112 | 258 |
| 636 | 3300002987 | JGI25159J45721_1015535 | JGI25159J45721_10155352 | 258 |
| 637 | 3300003187 | JGI25151J46595_10000754 | JGI25151J46595_100007545 | 258 |
| 638 | 3300003215 | JGI25153J46596_10031865 | JGI25153J46596_100318652 | 258 |
| 639 | 3300003323 | rootH1_10083808 | rootH1_100838081 | 258 |
| 640 | 3300003354 | JGI25160J50197_1003901 | JGI25160J50197_10039017 | 258 |
| 641 | 3300003374 | JGI25161J50226_1004022 | JGI25161J50226_10040222 | 258 |
| 642 | 3300003374 | JGI25161J50226_1008087 | JGI25161J50226_10080872 | 258 |
| 643 | 3300003771 | Ga0055526_1007455 | Ga0055526_10074556 | 258 |
| 644 | 3300003773 | Ga0055537_1004930 | Ga0055537_10049301 | 258 |
| 645 | 3300003775 | Ga0055524_1047124 | Ga0055524_10471241 | 258 |
| 646 | 3300003775 | Ga0055524_1047152 | Ga0055524_10471521 | 258 |
| 647 | 3300003790 | Ga0055528_1004116 | Ga0055528_10041163 | 258 |
| 648 | 3300003791 | Ga0055530_10020486 | Ga0055530_100204863 | 258 |
| 649 | 3300003794 | Ga0055531_10013188 | Ga0055531_100131885 | 258 |
| 650 | 3300003794 | Ga0055531_10027502 | Ga0055531_100275021 | 258 |
| 651 | 3300004625 | Ga0055543_1009953 | Ga0055543_10099531 | 258 |
| 652 | 3300004625 | Ga0055543_1009954 | Ga0055543_10099543 | 258 |
| 653 | 3300004625 | Ga0055543_1017203 | Ga0055543_10172031 | 258 |
| 654 | 3300005262 | Ga0065165_1006735 | Ga0065165_10067354 | 258 |
| 655 | 3300005262 | Ga0065165_1031911 | Ga0065165_10319111 | 258 |
| 656 | 3300013102 | Ga0157371_10233358 | Ga0157371_102333582 | 258 |
| 657 | 3300017792 | Ga0163161_10057149 | Ga0163161_100571493 | 258 |
| 658 | 3300025208 | Ga0209436_101177 | Ga0209436_1011775 | 258 |
| 659 | 3300025245 | Ga0207425_1000001 | Ga0207425_10000011737 | 258 |
| 660 | 3300025245 | Ga0207425_1001380 | Ga0207425_10013805 | 258 |
| 661 | 3300025245 | Ga0207425_1022812 | Ga0207425_10228122 | 258 |
| 662 | 3300025258 | Ga0209129_1000001 | Ga0209129_1000001914 | 258 |
| 663 | 3300025263 | Ga0209565_1001770 | Ga0209565_10017708 | 258 |
| 664 | 3300025263 | Ga0209565_1003171 | Ga0209565_10031715 | 258 |
| 665 | 3300025263 | Ga0209565_1010035 | Ga0209565_10100354 | 258 |
| 666 | 3300025273 | Ga0209673_1004672 | Ga0209673_10046727 | 258 |
| 667 | 3300025284 | Ga0209130_1001997 | Ga0209130_10019977 | 258 |
| 668 | 3300025284 | Ga0209130_1003045 | Ga0209130_10030455 | 258 |
| 669 | 3300025291 | Ga0209675_1001513 | Ga0209675_10015138 | 258 |
| 670 | 3300025291 | Ga0209675_1015107 | Ga0209675_10151071 | 258 |
| 671 | 3300025294 | Ga0209025_1000040 | Ga0209025_100004021 | 258 |
| 672 | 3300025295 | Ga0209564_1002185 | Ga0209564_100218514 | 258 |
| 673 | 3300025295 | Ga0209564_1005493 | Ga0209564_10054937 | 258 |
| 674 | 3300025297 | Ga0209758_1000116 | Ga0209758_1000116175 | 258 |
| 675 | 3300025298 | Ga0209050_1006232 | Ga0209050_10062327 | 258 |
| 676 | 3300025299 | Ga0209256_1000872 | Ga0209256_100087235 | 258 |
| 677 | 3300025299 | Ga0209256_1015166 | Ga0209256_10151662 | 258 |
| 678 | 3300025299 | Ga0209256_1046659 | Ga0209256_10466591 | 258 |
| 679 | 3300025302 | Ga0207426_1002443 | Ga0207426_10024435 | 258 |
| 680 | 3300025302 | Ga0207426_1018276 | Ga0207426_10182762 | 258 |
| 681 | 3300025304 | Ga0209257_1000107 | Ga0209257_10001077 | 258 |
| 682 | 3300030500 | Ga0268256_1022011 | Ga0268256_10220112 | 258 |
| 683 | 3300031548 | Ga0307408_100054958 | Ga0307408_1000549584 | 258 |
| 684 | 3300031548 | Ga0307408_100178407 | Ga0307408_1001784073 | 258 |
| 685 | 3300046460 | Ga0495638_0000091 | Ga0495638_0000091_38592_39413 | 258 |
| 686 | 3300046471 | Ga0495650_0011137 | Ga0495650_0011137_3015_3815 | 258 |
| 687 | 3300046471 | Ga0495650_0013311 | Ga0495650_0013311_318_1139 | 258 |
| 688 | 3300046506 | Ga0495583_0004737 | Ga0495583_0004737_4644_5465 | 258 |
| 689 | 3300046524 | Ga0495648_0000058 | Ga0495648_0000058_153230_154051 | 258 |
| 690 | 3300046528 | Ga0495642_0008387 | Ga0495642_0008387_1615_2436 | 258 |
| 691 | 3300046691 | Ga0495670_0194016 | Ga0495670_0194016_22_843 | 258 |
| 692 | 3300048912 | Ga0496109_0161834 | Ga0496109_0161834_186_1022 | 258 |
| 693 | 3300048919 | Ga0496116_0041819 | Ga0496116_0041819_1919_2764 | 258 |
| 694 | 3300048925 | Ga0496122_0000706 | Ga0496122_0000706_54193_54999 | 258 |
| 695 | 3300048926 | Ga0496123_0002213 | Ga0496123_0002213_4433_5239 | 258 |
| 696 | 3300049459 | Ga0495678_031280 | Ga0495678_031280_685_1506 | 258 |
| 697 | 3300049665 | Ga0501227_006695 | Ga0501227_006695_34_810 | 258 |
| 698 | 3300049665 | Ga0501227_013193 | Ga0501227_013193_527_1303 | 258 |
| 699 | 3300049760 | Ga0501263_021092 | Ga0501263_021092_44_820 | 258 |
| 700 | 3300049775 | Ga0501279_001743 | Ga0501279_001743_828_1604 | 258 |
| 701 | 3300049775 | Ga0501279_005098 | Ga0501279_005098_375_1151 | 258 |
| 702 | iso_pu_bacteria | 2643221594 | 2643980767 | 258 |
| 703 | iso_pu_bacteria | 2808606395 | 2809031916 | 258 |
| 704 | 3300006051 | Ga0075364_10001152 | Ga0075364_100011529 | 259 |
| 705 | 3300006051 | Ga0075364_10001980 | Ga0075364_100019802 | 259 |
| 706 | 3300037312 | Ga0395899_0013076 | Ga0395899_0013076_199_1038 | 259 |
| 707 | 3300037466 | Ga0395898_0036464 | Ga0395898_0036464_1120_1959 | 259 |
| 708 | 3300038443 | Ga0395901_0027154 | Ga0395901_0027154_4694_5533 | 259 |
| 709 | 3300046501 | Ga0495607_0004852 | Ga0495607_0004852_4085_4885 | 259 |
| 710 | 3300046507 | Ga0495606_0060224 | Ga0495606_0060224_1042_1872 | 259 |
| 711 | 3300046512 | Ga0495610_0089529 | Ga0495610_0089529_554_1360 | 259 |
| 712 | 3300046542 | Ga0495597_0007071 | Ga0495597_0007071_249_1079 | 259 |
| 713 | 3300046616 | Ga0495668_0250272 | Ga0495668_0250272_88_918 | 259 |
| 714 | 3300046660 | Ga0495625_0049883 | Ga0495625_0049883_1033_1863 | 259 |
| 715 | 3300047472 | Ga0495686_0025509 | Ga0495686_0025509_1340_2137 | 259 |
| 716 | 3300049569 | Ga0501032_0074404 | Ga0501032_0074404_188_1030 | 259 |
| 717 | 3300049581 | Ga0501047_0103511 | Ga0501047_0103511_1494_2336 | 259 |
| 718 | 3300049822 | Ga0501035_0041176 | Ga0501035_0041176_3125_3967 | 259 |
| 719 | 3300049823 | Ga0501044_0006255 | Ga0501044_0006255_2212_3054 | 259 |
| 720 | 3300050491 | nmdc:mga00v17_28181_c1 | nmdc:mga00v17_28181_c1_1965_2768 | 259 |
| 721 | iso_pu_bacteria | 2512047030 | 2512349859 | 259 |
| 722 | iso_pu_bacteria | 2515154122 | 2515683279 | 259 |
| 723 | iso_pu_bacteria | 2751185846 | 2753567407 | 259 |
| 724 | iso_pu_bacteria | 2857558681 | 2857561542 | 259 |
| 725 | iso_pu_bacteria | 2902682994 | 2902684042 | 259 |
| 726 | 3300039447 | Ga0436361_0031202 | Ga0436361_0031202_14910_15707 | 260 |
| 727 | 3300046557 | Ga0495622_0003320 | Ga0495622_0003320_3163_3984 | 260 |
| 728 | 3300046674 | Ga0495588_0013666 | Ga0495588_0013666_1158_1949 | 260 |
| 729 | 3300046674 | Ga0495588_0109274 | Ga0495588_0109274_304_1101 | 260 |
| 730 | 3300046691 | Ga0495670_0118518 | Ga0495670_0118518_485_1282 | 260 |
| 731 | 3300047318 | Ga0495636_0001622 | Ga0495636_0001622_6164_6961 | 260 |
| 732 | 3300047318 | Ga0495636_0032135 | Ga0495636_0032135_1332_2129 | 260 |
| 733 | 3300047447 | Ga0495685_038351 | Ga0495685_038351_809_1606 | 260 |
| 734 | 3300048905 | Ga0496102_0034285 | Ga0496102_0034285_1107_1904 | 260 |
| 735 | 3300048905 | Ga0496102_0097127 | Ga0496102_0097127_553_1350 | 260 |
| 736 | 3300003316 | rootH1_10036699 | rootH1_100366992 | 261 |
| 737 | 3300003544 | Ga0007417J51691_1043165 | Ga0007417J51691_10431652 | 261 |
| 738 | 3300003575 | Ga0007409J51694_1012205 | Ga0007409J51694_10122052 | 261 |
| 739 | 3300003577 | Ga0007416J51690_1016785 | Ga0007416J51690_10167852 | 261 |
| 740 | 3300003693 | Ga0032354_1025073 | Ga0032354_10250732 | 261 |
| 741 | 3300005337 | Ga0070682_100003516 | Ga0070682_1000035165 | 261 |
| 742 | 3300006051 | Ga0075364_10087594 | Ga0075364_100875941 | 261 |
| 743 | 3300037312 | Ga0395899_0017856 | Ga0395899_0017856_1517_2308 | 261 |
| 744 | 3300037418 | Ga0395900_0101287 | Ga0395900_0101287_380_1171 | 261 |
| 745 | 3300037471 | Ga0395905_0139357 | Ga0395905_0139357_769_1560 | 261 |
| 746 | 3300038443 | Ga0395901_0098516 | Ga0395901_0098516_1292_2083 | 261 |
| 747 | 3300039447 | Ga0436361_0834273 | Ga0436361_0834273_956_1741 | 261 |
| 748 | 3300044656 | Ga0466969_0008614 | Ga0466969_0008614_971_1759 | 261 |
| 749 | 3300044658 | Ga0466972_0000192 | Ga0466972_0000192_35450_36241 | 261 |
| 750 | 3300044658 | Ga0466972_0043587 | Ga0466972_0043587_969_1760 | 261 |
| 751 | 3300044659 | Ga0466973_0083952 | Ga0466973_0083952_495_1283 | 261 |
| 752 | 3300044683 | Ga0466965_0001849 | Ga0466965_0001849_2101_2892 | 261 |
| 753 | 3300044693 | Ga0466961_0049598 | Ga0466961_0049598_383_1171 | 261 |
| 754 | 3300044694 | Ga0466963_0000942 | Ga0466963_0000942_3408_4196 | 261 |
| 755 | 3300044706 | Ga0466964_0005338 | Ga0466964_0005338_2923_3714 | 261 |
| 756 | 3300044706 | Ga0466964_0038970 | Ga0466964_0038970_314_1105 | 261 |
| 757 | 3300044719 | Ga0466971_0005212 | Ga0466971_0005212_3825_4613 | 261 |
| 758 | 3300044735 | Ga0466968_0192437 | Ga0466968_0192437_12_800 | 261 |
| 759 | 3300044842 | Ga0466957_0007250 | Ga0466957_0007250_1120_1908 | 261 |
| 760 | 3300045049 | Ga0466959_0015021 | Ga0466959_0015021_1359_2147 | 261 |
| 761 | 3300045836 | Ga0466958_0002486 | Ga0466958_0002486_3701_4489 | 261 |
| 762 | 3300046507 | Ga0495606_0035336 | Ga0495606_0035336_1373_2158 | 261 |
| 763 | 3300046691 | Ga0495670_0048684 | Ga0495670_0048684_305_1090 | 261 |
| 764 | 3300046694 | Ga0495649_0019829 | Ga0495649_0019829_1733_2518 | 261 |
| 765 | 3300047323 | Ga0495683_0005742 | Ga0495683_0005742_1537_2322 | 261 |
| 766 | 3300047443 | Ga0495687_018937 | Ga0495687_018937_29_814 | 261 |
| 767 | 3300048907 | Ga0496104_0130203 | Ga0496104_0130203_1406_2191 | 261 |
| 768 | 3300053125 | Ga0500618_008373 | Ga0500618_008373_825_1760 | 261 |
| 769 | 3300059504 | Ga0587082_000365 | Ga0587082_000365_1117_1908 | 261 |
| 770 | 3300061719 | Ga0466962_0015018 | Ga0466962_0015018_335_1123 | 261 |
| 771 | 3300021361 | Ga0213872_10010040 | Ga0213872_100100402 | 262 |
| 772 | iso_pu_bacteria | 2808606390 | 2809002762 | 262 |
| 773 | iso_pu_bacteria | 2808606391 | 2809010040 | 262 |
| 774 | 3300046457 | Ga0495590_0052106 | Ga0495590_0052106_329_1129 | 263 |
| 775 | 3300046528 | Ga0495642_0059231 | Ga0495642_0059231_689_1489 | 263 |
| 776 | 3300047443 | Ga0495687_000021 | Ga0495687_000021_283512_284312 | 263 |
| 777 | 3300002067 | JGI24735J21928_10000719 | JGI24735J21928_100007196 | 264 |
| 778 | 3300005327 | Ga0070658_10054369 | Ga0070658_100543694 | 264 |
| 779 | 3300005339 | Ga0070660_100001488 | Ga0070660_10000148811 | 264 |
| 780 | 3300005563 | Ga0068855_100009698 | Ga0068855_1000096987 | 264 |
| 781 | 3300009093 | Ga0105240_10010653 | Ga0105240_100106536 | 264 |
| 782 | 3300009545 | Ga0105237_10012467 | Ga0105237_100124674 | 264 |
| 783 | 3300010375 | Ga0105239_10016723 | Ga0105239_100167236 | 264 |
| 784 | 3300013100 | Ga0157373_10006691 | Ga0157373_100066917 | 264 |
| 785 | 3300013104 | Ga0157370_10002758 | Ga0157370_1000275810 | 264 |
| 786 | 3300013105 | Ga0157369_10038628 | Ga0157369_100386285 | 264 |
| 787 | 3300013296 | Ga0157374_10000081 | Ga0157374_1000008150 | 264 |
| 788 | 3300013307 | Ga0157372_10008688 | Ga0157372_100086887 | 264 |
| 789 | 3300015261 | Ga0182006_1059580 | Ga0182006_10595802 | 264 |
| 790 | 3300025228 | Ga0209672_100248 | Ga0209672_10024812 | 264 |
| 791 | 3300025256 | Ga0209759_1001733 | Ga0209759_100173310 | 264 |
| 792 | 3300025904 | Ga0207647_10000377 | Ga0207647_1000037721 | 264 |
| 793 | 3300025914 | Ga0207671_10048109 | Ga0207671_100481094 | 264 |
| 794 | 3300025919 | Ga0207657_10003157 | Ga0207657_100031576 | 264 |
| 795 | 3300025949 | Ga0207667_10009877 | Ga0207667_1000987710 | 264 |
| 796 | 3300042005 | Ga0439448_0007230 | Ga0439448_0007230_159_956 | 264 |
| 797 | 3300009093 | Ga0105240_10096722 | Ga0105240_100967224 | 265 |
| 798 | 3300009551 | Ga0105238_10226557 | Ga0105238_102265572 | 265 |
| 799 | 3300013105 | Ga0157369_10247455 | Ga0157369_102474552 | 265 |
| 800 | 3300025206 | Ga0209435_105127 | Ga0209435_1051271 | 265 |
| 801 | 3300025256 | Ga0209759_1023697 | Ga0209759_10236972 | 265 |
| 802 | 3300025914 | Ga0207671_10130312 | Ga0207671_101303123 | 265 |
| 803 | 3300037471 | Ga0395905_0041046 | Ga0395905_0041046_3315_4112 | 265 |
| 804 | 3300045976 | Ga0466967_0130670 | Ga0466967_0130670_781_1578 | 265 |
| 805 | 3300046459 | Ga0495629_0161255 | Ga0495629_0161255_565_1362 | 265 |
| 806 | 3300046463 | Ga0495653_0069332 | Ga0495653_0069332_1349_2146 | 265 |
| 807 | 3300046463 | Ga0495653_0126508 | Ga0495653_0126508_887_1684 | 265 |
| 808 | 3300046472 | Ga0495580_0447359 | Ga0495580_0447359_26_823 | 265 |
| 809 | 3300046477 | Ga0495664_0066884 | Ga0495664_0066884_221_1018 | 265 |
| 810 | 3300046516 | Ga0495628_0009289 | Ga0495628_0009289_76_873 | 265 |
| 811 | 3300046531 | Ga0495665_0018229 | Ga0495665_0018229_765_1562 | 265 |
| 812 | 3300046543 | Ga0495645_0054969 | Ga0495645_0054969_1779_2576 | 265 |
| 813 | 3300046679 | Ga0495623_0008290 | Ga0495623_0008290_4879_5676 | 265 |
| 814 | 3300046680 | Ga0495646_0004544 | Ga0495646_0004544_364_1161 | 265 |
| 815 | 3300046690 | Ga0495624_0016989 | Ga0495624_0016989_3719_4516 | 265 |
| 816 | 3300047315 | Ga0495581_0173822 | Ga0495581_0173822_388_1185 | 265 |
| 817 | 3300047317 | Ga0495604_0071816 | Ga0495604_0071816_581_1378 | 265 |
| 818 | 3300047322 | Ga0495680_0030223 | Ga0495680_0030223_2645_3442 | 265 |
| 819 | 3300047673 | Ga0495593_0005097 | Ga0495593_0005097_1629_2426 | 265 |
| 820 | 3300047673 | Ga0495593_0069724 | Ga0495593_0069724_833_1630 | 265 |
| 821 | 3300048088 | Ga0495602_0031307 | Ga0495602_0031307_392_1189 | 265 |
| 822 | 3300048903 | Ga0496100_0175886 | Ga0496100_0175886_420_1217 | 265 |
| 823 | 3300048904 | Ga0496101_0157887 | Ga0496101_0157887_636_1433 | 265 |
| 824 | 3300048907 | Ga0496104_0055517 | Ga0496104_0055517_400_1197 | 265 |
| 825 | 3300048908 | Ga0496105_0032536 | Ga0496105_0032536_3031_3828 | 265 |
| 826 | 3300048918 | Ga0496115_0364063 | Ga0496115_0364063_254_1051 | 265 |
| 827 | 3300048921 | Ga0496118_0085707 | Ga0496118_0085707_345_1142 | 265 |
| 828 | 3300048922 | Ga0496119_0027964 | Ga0496119_0027964_1636_2433 | 265 |
| 829 | 3300048929 | Ga0496126_0366789 | Ga0496126_0366789_291_1088 | 265 |
| 830 | 3300002067 | JGI24735J21928_10000708 | JGI24735J21928_100007082 | 266 |
| 831 | 3300009011 | Ga0105251_10015012 | Ga0105251_100150122 | 266 |
| 832 | 3300009093 | Ga0105240_10211287 | Ga0105240_102112871 | 266 |
| 833 | 3300013296 | Ga0157374_10189232 | Ga0157374_101892322 | 266 |
| 834 | 3300025302 | Ga0207426_1043648 | Ga0207426_10436482 | 266 |
| 835 | 3300025735 | Ga0207713_1014316 | Ga0207713_10143162 | 266 |
| 836 | 3300025904 | Ga0207647_10011303 | Ga0207647_100113032 | 266 |
| 837 | 3300025913 | Ga0207695_10244596 | Ga0207695_102445961 | 266 |
| 838 | 3300046457 | Ga0495590_0003715 | Ga0495590_0003715_1644_2444 | 266 |
| 839 | 3300046491 | Ga0495584_0135943 | Ga0495584_0135943_222_1022 | 266 |
| 840 | 3300046542 | Ga0495597_0018648 | Ga0495597_0018648_1643_2443 | 266 |
| 841 | 3300047323 | Ga0495683_0006197 | Ga0495683_0006197_2375_3175 | 266 |
| 842 | 3300047443 | Ga0495687_102422 | Ga0495687_102422_241_1041 | 266 |
| 843 | 3300048903 | Ga0496100_0054399 | Ga0496100_0054399_1056_1856 | 266 |
| 844 | 3300048904 | Ga0496101_0213506 | Ga0496101_0213506_58_858 | 266 |
| 845 | 3300048906 | Ga0496103_0015400 | Ga0496103_0015400_3103_3903 | 266 |
| 846 | 3300048908 | Ga0496105_0227534 | Ga0496105_0227534_630_1430 | 266 |
| 847 | 3300048909 | Ga0496106_0029689 | Ga0496106_0029689_2976_3776 | 266 |
| 848 | 3300048910 | Ga0496107_0034666 | Ga0496107_0034666_1292_2092 | 266 |
| 849 | 3300048912 | Ga0496109_0044419 | Ga0496109_0044419_1520_2320 | 266 |
| 850 | 3300048913 | Ga0496110_0043506 | Ga0496110_0043506_2517_3317 | 266 |
| 851 | 3300048914 | Ga0496111_0012790 | Ga0496111_0012790_4616_5416 | 266 |
| 852 | 3300048915 | Ga0496112_0089730 | Ga0496112_0089730_1958_2758 | 266 |
| 853 | 3300048916 | Ga0496113_0061979 | Ga0496113_0061979_1839_2639 | 266 |
| 854 | 3300048919 | Ga0496116_0024544 | Ga0496116_0024544_510_1310 | 266 |
| 855 | 3300048920 | Ga0496117_0068370 | Ga0496117_0068370_311_1111 | 266 |
| 856 | 3300048921 | Ga0496118_0055612 | Ga0496118_0055612_277_1077 | 266 |
| 857 | 3300048922 | Ga0496119_0196603 | Ga0496119_0196603_118_918 | 266 |
| 858 | 3300048924 | Ga0496121_0033068 | Ga0496121_0033068_3488_4288 | 266 |
| 859 | 3300048925 | Ga0496122_0115739 | Ga0496122_0115739_308_1108 | 266 |
| 860 | 3300048926 | Ga0496123_0007938 | Ga0496123_0007938_7680_8480 | 266 |
| 861 | 3300048927 | Ga0496124_0015653 | Ga0496124_0015653_4934_5734 | 266 |
| 862 | 3300048928 | Ga0496125_0060012 | Ga0496125_0060012_1448_2248 | 266 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4r1h-assembly1.cif.gz_B | gntr family transcriptional regulator from listeria monocytogenes | 0.9496 | 29 | 97 |
| 4h0e-assembly1.cif.gz_A | crystal structure of mutant orr3 in complex with ntd of arar | 0.9476 | 29 | 97 |
| 2ek5-assembly4.cif.gz_C | crystal structure of the transcriptional factor from c.glutamicum at 2.2 angstrom resolution | 0.9461 | 31 | 98 |
| 2ek5-assembly4.cif.gz_C-3 | crystal structure of the transcriptional factor from c.glutamicum at 2.2 angstrom resolution | 0.9461 | 31 | 98 |
| 3cnv-assembly1.cif.gz_A | crystal structure of the ligand-binding domain of a putative gntr-family transcriptional regulator from bordetella bronchiseptica | 0.9407 | 104 | 264 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1P1_1_44_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9948 | 55 | 96 | 1.10.10.10 |
| af_P31475_2_79_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9829 | 33 | 98 | 1.10.10.10 |
| af_Q2FZ17_2_72_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9674 | 33 | 98 | 1.10.10.10 |
| af_P9WMG7_15_85_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9671 | 33 | 98 | 1.10.10.10 |
| af_P0A8W0_27_98_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9665 | 31 | 97 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R8XME7-F1-model_v4 | FadR family transcriptional regulator | 0.9891 | 29 | 98 |
GO:0003677
GO:0003700 |
| AF-U2DZG5-F1-model_v4 | Transcriptional regulator, GntR family | 0.9852 | 31 | 98 |
GO:0003677
GO:0003700 GO:0005737 |
| AF-A0A1V6FD53-F1-model_v4 | HTH-type transcriptional regulator GmuR | 0.9823 | 33 | 101 |
GO:0003677
GO:0003700 GO:0045892 |
| AF-A0A6I4P2X8-F1-model_v4 | FCD domain-containing protein | 0.9808 | 33 | 98 |
GO:0003677
GO:0003700 |
| AF-A0A1I5C458-F1-model_v4 | DNA-binding transcriptional regulator, FadR family | 0.9805 | 33 | 99 |
GO:0003677
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar