F483785
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 859 | 414 | 797 | 345 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0044844|Ga0395905_0044844_250_1374 |
| Length | 374 |
| Sequence | MHMARNWRVSWNKRAAAKLINQHFYQEHPMSITPQEALSRCIEHREIFHDEMLSLFRQIMRGEMSPVMIAALTMGLRVKKETIGEIAAAAQVMREFATKVDVANPDKLLDIVGTGGDGAHTFNISTTALFAVAAAGGHVAKHGGRSVSSSSGSADAMEALGVHINLKPELVARSIEQTGIGFMFAPNHHAAMKHAAPVRKELGVRTIFNILGPLTNPAGAANILMGVFHPDLVGIQVRVLQRLGAKRAVVVWGRDNLDEVTLGAGTLVGELIDGEIREYEIHPEDFGLPMAATRNLKVASAAESKVKMLEALDNKPGAVRDIVALNAGTALYAAGVASSIADGLAKAQEALASGAARAKMEEFVKVTQELGRLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 3 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 4 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 5 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 6 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 7 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 8 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 9 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 10 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 11 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 12 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 13 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 14 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 15 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 16 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 17 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 18 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 19 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 20 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 21 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 22 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 23 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 24 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 25 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 26 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 27 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 28 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 29 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 30 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 31 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 32 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 33 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 34 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 35 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 36 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 37 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 38 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 39 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 40 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 41 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 42 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 43 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 44 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 45 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 46 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 47 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 48 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 49 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 50 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 51 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 52 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 53 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 54 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 55 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 56 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 57 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 58 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 59 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 60 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 61 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 62 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 63 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 64 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 65 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 66 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 67 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 68 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 69 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 70 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 71 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 72 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 73 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 74 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 75 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 76 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 77 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 78 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 79 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 80 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 81 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 82 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 83 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 84 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 85 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 86 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 87 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 88 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 89 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 90 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 91 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 94 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 101 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 107 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 112 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 114 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 115 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 116 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 117 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 118 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 119 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 120 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 121 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 122 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 123 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 124 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 125 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 126 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 127 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 128 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 129 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 130 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 131 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 132 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 133 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 147 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 148 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 149 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 150 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 152 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 165 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 212 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 218 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 219 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 221 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 222 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 225 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 226 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 228 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 229 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 230 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 231 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 233 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 234 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 235 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 236 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 237 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 244 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 245 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 246 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 247 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 248 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 249 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 250 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 251 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 252 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 253 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 254 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 255 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 256 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 257 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 258 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 259 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 260 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 261 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 262 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 263 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 264 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 265 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 266 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 267 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 268 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 269 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 270 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 271 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 352 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 353 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 354 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 355 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 358 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 359 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 360 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 361 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 362 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 363 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 364 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 365 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 366 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 367 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 368 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 389 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 390 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 394 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 396 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 397 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 404 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 405 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 407 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 408 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 409 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 410 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 413 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 414 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.78 |
| Metatranscriptomes | 0 |
| Isolates | 7.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.83 |
| Nodule | 1.51 |
| Rhizoplane | 3.03 |
| Rhizosphere | 68.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000336 | 3300002704 | Bacteria | 15086 |
| 2 | JGI25155J39150_1000485 | 3300002704 | Bacteria | 9807 |
| 3 | JGI25156J39149_1000063 | 3300002705 | Bacteria | 84312 |
| 4 | JGI25156J39149_1000267 | 3300002705 | Bacteria | 35297 |
| 5 | JGI25154J39366_1000412 | 3300002738 | Bacteria | 23116 |
| 6 | JGI25154J39366_1000739 | 3300002738 | Bacteria | 14651 |
| 7 | JGI25154J39366_1000845 | 3300002738 | Bacteria | 13292 |
| 8 | JGI25154J39366_1001209 | 3300002738 | Bacteria | 9784 |
| 9 | JGI25154J39366_1002200 | 3300002738 | Bacteria | 5398 |
| 10 | JGI25158J39367_1003079 | 3300002739 | Bacteria | 2624 |
| 11 | JGI25157J39369_1000082 | 3300002741 | Bacteria | 84303 |
| 12 | JGI25157J39369_1000372 | 3300002741 | Bacteria | 30863 |
| 13 | JGI25157J39369_1000495 | 3300002741 | Bacteria | 24307 |
| 14 | JGI25152J39213_1000953 | 3300002773 | Bacteria | 14121 |
| 15 | JGI25150J39212_1000910 | 3300002774 | Bacteria | 9622 |
| 16 | JGI25150J39212_1003626 | 3300002774 | Bacteria | 3583 |
| 17 | JGI25159J45721_1002200 | 3300002987 | Bacteria | 7576 |
| 18 | JGI25151J46595_10001452 | 3300003187 | Bacteria | 16075 |
| 19 | JGI25153J46596_10018531 | 3300003215 | Bacteria | 2700 |
| 20 | JGI25160J50197_1003453 | 3300003354 | Bacteria | 7072 |
| 21 | Ga0055538_1000062 | 3300003751 | Bacteria | 105260 |
| 22 | Ga0055539_1000093 | 3300003752 | Bacteria | 105260 |
| 23 | Ga0055539_1000303 | 3300003752 | Bacteria | 26405 |
| 24 | Ga0055539_1000782 | 3300003752 | Bacteria | 7614 |
| 25 | Ga0055533_1000043 | 3300003756 | Bacteria | 229262 |
| 26 | Ga0055533_1000105 | 3300003756 | Bacteria | 105260 |
| 27 | Ga0055532_1000034 | 3300003758 | Bacteria | 210984 |
| 28 | Ga0055525_1000018 | 3300003759 | Bacteria | 393974 |
| 29 | Ga0055525_1000137 | 3300003759 | Bacteria | 105260 |
| 30 | Ga0055525_1001495 | 3300003759 | Bacteria | 4035 |
| 31 | Ga0055535_1000859 | 3300003761 | Bacteria | 21484 |
| 32 | Ga0055529_1000152 | 3300003763 | Bacteria | 98133 |
| 33 | Ga0055529_1000725 | 3300003763 | Bacteria | 21544 |
| 34 | Ga0055526_1000079 | 3300003771 | Bacteria | 89698 |
| 35 | Ga0055526_1000690 | 3300003771 | Bacteria | 25815 |
| 36 | Ga0055526_1001033 | 3300003771 | Bacteria | 20365 |
| 37 | Ga0055526_1003493 | 3300003771 | Bacteria | 9959 |
| 38 | Ga0055537_1000580 | 3300003773 | Bacteria | 20336 |
| 39 | Ga0055537_1002871 | 3300003773 | Bacteria | 5518 |
| 40 | Ga0055524_1000237 | 3300003775 | Bacteria | 57951 |
| 41 | Ga0055524_1000899 | 3300003775 | Bacteria | 19266 |
| 42 | Ga0055524_1001534 | 3300003775 | Bacteria | 13059 |
| 43 | Ga0055524_1003281 | 3300003775 | Bacteria | 7917 |
| 44 | Ga0055524_1008782 | 3300003775 | Bacteria | 4168 |
| 45 | Ga0055524_1015153 | 3300003775 | Bacteria | 2822 |
| 46 | Ga0055536_1000249 | 3300003781 | Bacteria | 42682 |
| 47 | Ga0055534_1000283 | 3300003784 | Bacteria | 34520 |
| 48 | Ga0055534_1003569 | 3300003784 | Bacteria | 4836 |
| 49 | Ga0055534_1005272 | 3300003784 | Bacteria | 3500 |
| 50 | Ga0055528_1000495 | 3300003790 | Bacteria | 31111 |
| 51 | Ga0055528_1002751 | 3300003790 | Bacteria | 9215 |
| 52 | Ga0055530_10005914 | 3300003791 | Bacteria | 5645 |
| 53 | Ga0055530_10006075 | 3300003791 | Bacteria | 5515 |
| 54 | Ga0055530_10006432 | 3300003791 | Bacteria | 5252 |
| 55 | Ga0055530_10023984 | 3300003791 | Bacteria | 1741 |
| 56 | Ga0055531_10020369 | 3300003794 | Bacteria | 2625 |
| 57 | Ga0055531_10034762 | 3300003794 | Bacteria | 1592 |
| 58 | Ga0055541_1000063 | 3300003841 | Bacteria | 105260 |
| 59 | Ga0055543_1001129 | 3300004625 | Bacteria | 11441 |
| 60 | Ga0055543_1003826 | 3300004625 | Bacteria | 4273 |
| 61 | Ga0065165_1002857 | 3300005262 | Bacteria | 13394 |
| 62 | Ga0065165_1003337 | 3300005262 | Bacteria | 11441 |
| 63 | Ga0065165_1004075 | 3300005262 | Bacteria | 9468 |
| 64 | Ga0070658_10124620 | 3300005327 | Bacteria | 2143 |
| 65 | Ga0070676_10128521 | 3300005328 | Bacteria | 1599 |
| 66 | Ga0070690_100037236 | 3300005330 | Bacteria | 3065 |
| 67 | Ga0070670_100086718 | 3300005331 | Bacteria | 2690 |
| 68 | Ga0070680_100167915 | 3300005336 | Bacteria | 1846 |
| 69 | Ga0070660_100016657 | 3300005339 | Bacteria | 5341 |
| 70 | Ga0070660_100044451 | 3300005339 | Bacteria | 3398 |
| 71 | Ga0070687_100031300 | 3300005343 | Bacteria | 2609 |
| 72 | Ga0070671_100026430 | 3300005355 | Bacteria | 4769 |
| 73 | Ga0070673_100032700 | 3300005364 | Bacteria | 3921 |
| 74 | Ga0070688_100052640 | 3300005365 | Bacteria | 2544 |
| 75 | Ga0070659_100001752 | 3300005366 | Bacteria | 15587 |
| 76 | Ga0070714_100135023 | 3300005435 | Bacteria | 2208 |
| 77 | Ga0070705_100041313 | 3300005440 | Bacteria | 2628 |
| 78 | Ga0070694_100004413 | 3300005444 | Bacteria | 8458 |
| 79 | Ga0070662_100057197 | 3300005457 | Bacteria | 2833 |
| 80 | Ga0070681_10014878 | 3300005458 | Bacteria | 7736 |
| 81 | Ga0070699_100021479 | 3300005518 | Bacteria | 5566 |
| 82 | Ga0070697_100149328 | 3300005536 | Bacteria | 1969 |
| 83 | Ga0070695_100020091 | 3300005545 | Bacteria | 4074 |
| 84 | Ga0070695_100051921 | 3300005545 | Bacteria | 2632 |
| 85 | Ga0070704_100033986 | 3300005549 | Bacteria | 3453 |
| 86 | Ga0070704_100129543 | 3300005549 | Bacteria | 1953 |
| 87 | Ga0068855_100009264 | 3300005563 | Bacteria | 11894 |
| 88 | Ga0068855_100035272 | 3300005563 | Bacteria | 5958 |
| 89 | Ga0068855_100062362 | 3300005563 | Bacteria | 4352 |
| 90 | Ga0068855_100120182 | 3300005563 | Bacteria | 3007 |
| 91 | Ga0068855_100249658 | 3300005563 | Bacteria | 1979 |
| 92 | Ga0068855_100317591 | 3300005563 | Bacteria | 1722 |
| 93 | Ga0070664_100003553 | 3300005564 | Bacteria | 12597 |
| 94 | Ga0068857_100004849 | 3300005577 | Bacteria | 11404 |
| 95 | Ga0068857_100367839 | 3300005577 | Bacteria | 1334 |
| 96 | Ga0068854_100017165 | 3300005578 | Bacteria | 4840 |
| 97 | Ga0068854_100119599 | 3300005578 | Bacteria | 1998 |
| 98 | Ga0068856_100002505 | 3300005614 | Bacteria | 18902 |
| 99 | Ga0068856_100317250 | 3300005614 | Bacteria | 1576 |
| 100 | Ga0068852_100004430 | 3300005616 | Bacteria | 9925 |
| 101 | Ga0068864_100032966 | 3300005618 | Bacteria | 4402 |
| 102 | Ga0068861_100036671 | 3300005719 | Bacteria | 3641 |
| 103 | Ga0068863_100067354 | 3300005841 | Bacteria | 3386 |
| 104 | Ga0068862_100019436 | 3300005844 | Bacteria | 5670 |
| 105 | Ga0081539_10000365 | 3300005985 | Bacteria | 99063 |
| 106 | Ga0075367_10043698 | 3300006178 | Bacteria | 2624 |
| 107 | Ga0075366_10019447 | 3300006195 | Bacteria | 3929 |
| 108 | Ga0075366_10066646 | 3300006195 | Bacteria | 2142 |
| 109 | Ga0075370_10011458 | 3300006353 | Bacteria | 4660 |
| 110 | Ga0075428_100301946 | 3300006844 | Bacteria | 1721 |
| 111 | Ga0075430_100008118 | 3300006846 | Bacteria | 8872 |
| 112 | Ga0075430_100011586 | 3300006846 | Bacteria | 7498 |
| 113 | Ga0075430_100179064 | 3300006846 | Bacteria | 1763 |
| 114 | Ga0075431_100039309 | 3300006847 | Bacteria | 4874 |
| 115 | Ga0075431_100226597 | 3300006847 | Bacteria | 1905 |
| 116 | Ga0068865_100001729 | 3300006881 | Bacteria | 12820 |
| 117 | Ga0075436_100119909 | 3300006914 | Bacteria | 1840 |
| 118 | Ga0079104_1000012 | 3300006946 | Bacteria | 355143 |
| 119 | Ga0079104_1005592 | 3300006946 | Bacteria | 4978 |
| 120 | Ga0099826_10000010 | 3300006948 | Bacteria | 314346 |
| 121 | Ga0099826_10000024 | 3300006948 | Bacteria | 148974 |
| 122 | Ga0099794_10016101 | 3300007265 | Bacteria | 3310 |
| 123 | Ga0105251_10007888 | 3300009011 | Bacteria | 6472 |
| 124 | Ga0105244_10003441 | 3300009036 | Bacteria | 11284 |
| 125 | Ga0105244_10035827 | 3300009036 | Bacteria | 2604 |
| 126 | Ga0105240_10001608 | 3300009093 | Bacteria | 38292 |
| 127 | Ga0105240_10016336 | 3300009093 | Bacteria | 10052 |
| 128 | Ga0105240_10158169 | 3300009093 | Bacteria | 2693 |
| 129 | Ga0105240_10161523 | 3300009093 | Bacteria | 2661 |
| 130 | Ga0105240_10190542 | 3300009093 | Bacteria | 2412 |
| 131 | Ga0111539_10335889 | 3300009094 | Bacteria | 1759 |
| 132 | Ga0114129_10589096 | 3300009147 | Bacteria | 1442 |
| 133 | Ga0105248_10004608 | 3300009177 | Bacteria | 15258 |
| 134 | Ga0105237_10010944 | 3300009545 | Bacteria | 9627 |
| 135 | Ga0105237_10359562 | 3300009545 | Bacteria | 1460 |
| 136 | Ga0105238_10000763 | 3300009551 | Bacteria | 33477 |
| 137 | Ga0105239_10010387 | 3300010375 | Bacteria | 10421 |
| 138 | Ga0105246_10023704 | 3300011119 | Bacteria | 3975 |
| 139 | Ga0157371_10000018 | 3300013102 | Bacteria | 310522 |
| 140 | Ga0157369_10019171 | 3300013105 | Bacteria | 7655 |
| 141 | Ga0157378_10007501 | 3300013297 | Bacteria | 9526 |
| 142 | Ga0182008_10056599 | 3300014497 | Bacteria | 1937 |
| 143 | Ga0182006_1000033 | 3300015261 | Bacteria | 238180 |
| 144 | Ga0182006_1000080 | 3300015261 | Bacteria | 122163 |
| 145 | Ga0182006_1025436 | 3300015261 | Bacteria | 2431 |
| 146 | Ga0182007_10000042 | 3300015262 | Bacteria | 111840 |
| 147 | Ga0182007_10005353 | 3300015262 | Bacteria | 5653 |
| 148 | Ga0182007_10021481 | 3300015262 | Bacteria | 2292 |
| 149 | Ga0182005_1000016 | 3300015265 | Bacteria | 346889 |
| 150 | Ga0182005_1000024 | 3300015265 | Bacteria | 238256 |
| 151 | Ga0163161_10012023 | 3300017792 | Bacteria | 6004 |
| 152 | Ga0163161_10012229 | 3300017792 | Bacteria | 5953 |
| 153 | Ga0213872_10047661 | 3300021361 | Bacteria | 1948 |
| 154 | Ga0213872_10049654 | 3300021361 | Bacteria | 1905 |
| 155 | Ga0209435_100007 | 3300025206 | Bacteria | 516857 |
| 156 | Ga0209435_100176 | 3300025206 | Bacteria | 19214 |
| 157 | Ga0209436_100769 | 3300025208 | Bacteria | 13300 |
| 158 | Ga0209436_104031 | 3300025208 | Bacteria | 3712 |
| 159 | Ga0209784_100021 | 3300025224 | Bacteria | 408534 |
| 160 | Ga0209566_100119 | 3300025225 | Bacteria | 105312 |
| 161 | Ga0209674_100036 | 3300025226 | Bacteria | 408534 |
| 162 | Ga0209674_100067 | 3300025226 | Bacteria | 253824 |
| 163 | Ga0209147_100017 | 3300025229 | Bacteria | 516857 |
| 164 | Ga0209563_100011 | 3300025230 | Bacteria | 1187808 |
| 165 | Ga0209563_100040 | 3300025230 | Bacteria | 408534 |
| 166 | Ga0209563_100068 | 3300025230 | Bacteria | 254802 |
| 167 | Ga0207427_101402 | 3300025231 | Bacteria | 8811 |
| 168 | Ga0209437_100332 | 3300025233 | Bacteria | 58796 |
| 169 | Ga0209258_100129 | 3300025242 | Bacteria | 176515 |
| 170 | Ga0209258_101277 | 3300025242 | Bacteria | 9457 |
| 171 | Ga0209258_101777 | 3300025242 | Bacteria | 6621 |
| 172 | Ga0207425_1000021 | 3300025245 | Bacteria | 367537 |
| 173 | Ga0207425_1000050 | 3300025245 | Bacteria | 177008 |
| 174 | Ga0207425_1000829 | 3300025245 | Bacteria | 15420 |
| 175 | Ga0209646_1000044 | 3300025246 | Bacteria | 334596 |
| 176 | Ga0209646_1000107 | 3300025246 | Bacteria | 163112 |
| 177 | Ga0209646_1000190 | 3300025246 | Bacteria | 75772 |
| 178 | Ga0209646_1000244 | 3300025246 | Bacteria | 55661 |
| 179 | Ga0209026_1000004 | 3300025250 | Bacteria | 949012 |
| 180 | Ga0209026_1000063 | 3300025250 | Bacteria | 211324 |
| 181 | Ga0209677_100023 | 3300025253 | Bacteria | 408534 |
| 182 | Ga0209677_100049 | 3300025253 | Bacteria | 180721 |
| 183 | Ga0209677_100413 | 3300025253 | Bacteria | 25541 |
| 184 | Ga0209759_1000003 | 3300025256 | Bacteria | 792130 |
| 185 | Ga0209759_1000048 | 3300025256 | Bacteria | 224817 |
| 186 | Ga0209759_1000198 | 3300025256 | Bacteria | 95052 |
| 187 | Ga0209759_1003928 | 3300025256 | Bacteria | 5727 |
| 188 | Ga0209759_1004764 | 3300025256 | Bacteria | 4958 |
| 189 | Ga0209759_1020166 | 3300025256 | Bacteria | 1556 |
| 190 | Ga0209129_1000020 | 3300025258 | Bacteria | 457053 |
| 191 | Ga0209565_1000055 | 3300025263 | Bacteria | 201184 |
| 192 | Ga0209565_1000677 | 3300025263 | Bacteria | 21295 |
| 193 | Ga0209565_1009659 | 3300025263 | Bacteria | 2432 |
| 194 | Ga0209565_1011047 | 3300025263 | Bacteria | 2215 |
| 195 | Ga0209455_1000070 | 3300025272 | Bacteria | 307867 |
| 196 | Ga0209455_1000083 | 3300025272 | Bacteria | 255660 |
| 197 | Ga0209673_1000040 | 3300025273 | Bacteria | 312633 |
| 198 | Ga0209673_1003338 | 3300025273 | Bacteria | 9600 |
| 199 | Ga0209673_1004762 | 3300025273 | Bacteria | 7131 |
| 200 | Ga0209130_1000169 | 3300025284 | Bacteria | 95167 |
| 201 | Ga0209130_1002260 | 3300025284 | Bacteria | 9942 |
| 202 | Ga0209130_1006585 | 3300025284 | Bacteria | 3748 |
| 203 | Ga0209675_1000052 | 3300025291 | Bacteria | 201332 |
| 204 | Ga0209675_1000156 | 3300025291 | Bacteria | 88813 |
| 205 | Ga0209675_1000753 | 3300025291 | Bacteria | 21816 |
| 206 | Ga0209675_1001299 | 3300025291 | Bacteria | 14837 |
| 207 | Ga0209675_1003114 | 3300025291 | Bacteria | 8083 |
| 208 | Ga0209676_1000364 | 3300025292 | Bacteria | 85375 |
| 209 | Ga0209025_1000417 | 3300025294 | Bacteria | 85342 |
| 210 | Ga0209025_1000473 | 3300025294 | Bacteria | 78078 |
| 211 | Ga0209025_1000516 | 3300025294 | Bacteria | 73496 |
| 212 | Ga0209025_1001876 | 3300025294 | Bacteria | 24626 |
| 213 | Ga0209025_1002453 | 3300025294 | Bacteria | 19596 |
| 214 | Ga0209564_1000027 | 3300025295 | Bacteria | 518458 |
| 215 | Ga0209564_1000047 | 3300025295 | Bacteria | 368031 |
| 216 | Ga0209564_1000063 | 3300025295 | Bacteria | 318515 |
| 217 | Ga0209564_1000271 | 3300025295 | Bacteria | 108422 |
| 218 | Ga0209564_1000658 | 3300025295 | Bacteria | 51441 |
| 219 | Ga0209564_1000709 | 3300025295 | Bacteria | 48568 |
| 220 | Ga0209564_1001666 | 3300025295 | Bacteria | 21297 |
| 221 | Ga0209758_1000288 | 3300025297 | Bacteria | 99096 |
| 222 | Ga0209758_1000436 | 3300025297 | Bacteria | 70342 |
| 223 | Ga0209050_1000050 | 3300025298 | Bacteria | 362578 |
| 224 | Ga0209050_1000335 | 3300025298 | Bacteria | 93521 |
| 225 | Ga0209050_1001698 | 3300025298 | Bacteria | 22016 |
| 226 | Ga0209256_1000045 | 3300025299 | Bacteria | 325506 |
| 227 | Ga0209256_1000054 | 3300025299 | Bacteria | 298431 |
| 228 | Ga0209256_1000079 | 3300025299 | Bacteria | 225382 |
| 229 | Ga0209256_1000100 | 3300025299 | Bacteria | 201246 |
| 230 | Ga0209256_1000754 | 3300025299 | Bacteria | 42096 |
| 231 | Ga0209256_1001531 | 3300025299 | Bacteria | 23281 |
| 232 | Ga0209256_1003694 | 3300025299 | Bacteria | 10398 |
| 233 | Ga0209256_1035264 | 3300025299 | Bacteria | 1323 |
| 234 | Ga0207426_1003112 | 3300025302 | Bacteria | 9466 |
| 235 | Ga0209051_1006479 | 3300025303 | Bacteria | 6592 |
| 236 | Ga0209051_1017263 | 3300025303 | Bacteria | 3230 |
| 237 | Ga0209051_1028245 | 3300025303 | Bacteria | 2219 |
| 238 | Ga0209257_1001336 | 3300025304 | Bacteria | 29943 |
| 239 | Ga0207696_1053792 | 3300025711 | Bacteria | 1145 |
| 240 | Ga0207655_1001651 | 3300025728 | Bacteria | 19767 |
| 241 | Ga0207713_1064026 | 3300025735 | Bacteria | 1386 |
| 242 | Ga0207699_10201555 | 3300025906 | Bacteria | 1349 |
| 243 | Ga0207645_10053286 | 3300025907 | Bacteria | 2585 |
| 244 | Ga0207695_10008939 | 3300025913 | Bacteria | 12470 |
| 245 | Ga0207695_10012318 | 3300025913 | Bacteria | 10275 |
| 246 | Ga0207695_10025241 | 3300025913 | Bacteria | 6658 |
| 247 | Ga0207695_10070196 | 3300025913 | Bacteria | 3582 |
| 248 | Ga0207695_10136114 | 3300025913 | Bacteria | 2409 |
| 249 | Ga0207671_10004652 | 3300025914 | Bacteria | 12996 |
| 250 | Ga0207671_10092910 | 3300025914 | Bacteria | 2275 |
| 251 | Ga0207660_10078923 | 3300025917 | Bacteria | 2414 |
| 252 | Ga0207662_10041525 | 3300025918 | Bacteria | 2708 |
| 253 | Ga0207662_10109316 | 3300025918 | Bacteria | 1722 |
| 254 | Ga0207657_10008924 | 3300025919 | Bacteria | 10132 |
| 255 | Ga0207657_10012688 | 3300025919 | Bacteria | 8304 |
| 256 | Ga0207649_10024118 | 3300025920 | Bacteria | 3532 |
| 257 | Ga0207694_10000343 | 3300025924 | Bacteria | 44142 |
| 258 | Ga0207650_10063319 | 3300025925 | Bacteria | 2765 |
| 259 | Ga0207690_10000951 | 3300025932 | Bacteria | 18563 |
| 260 | Ga0207706_10051130 | 3300025933 | Bacteria | 3650 |
| 261 | Ga0207709_10039485 | 3300025935 | Bacteria | 2819 |
| 262 | Ga0207704_10018780 | 3300025938 | Bacteria | 3617 |
| 263 | Ga0207711_10036832 | 3300025941 | Bacteria | 4152 |
| 264 | Ga0207689_10018288 | 3300025942 | Bacteria | 5915 |
| 265 | Ga0207689_10050545 | 3300025942 | Bacteria | 3427 |
| 266 | Ga0207679_10004406 | 3300025945 | Bacteria | 8766 |
| 267 | Ga0207667_10000912 | 3300025949 | Bacteria | 37632 |
| 268 | Ga0207667_10007366 | 3300025949 | Bacteria | 13242 |
| 269 | Ga0207667_10041134 | 3300025949 | Bacteria | 4917 |
| 270 | Ga0207667_10067556 | 3300025949 | Bacteria | 3723 |
| 271 | Ga0207667_10098677 | 3300025949 | Bacteria | 3014 |
| 272 | Ga0207667_10228908 | 3300025949 | Bacteria | 1904 |
| 273 | Ga0207651_10014547 | 3300025960 | Bacteria | 4548 |
| 274 | Ga0207640_10041316 | 3300025981 | Bacteria | 2932 |
| 275 | Ga0207640_10074203 | 3300025981 | Bacteria | 2302 |
| 276 | Ga0207703_10187047 | 3300026035 | Bacteria | 1831 |
| 277 | Ga0207702_10001231 | 3300026078 | Bacteria | 25873 |
| 278 | Ga0207648_10210122 | 3300026089 | Bacteria | 1727 |
| 279 | Ga0207674_10090346 | 3300026116 | Bacteria | 3054 |
| 280 | Ga0207698_10284985 | 3300026142 | Bacteria | 1530 |
| 281 | Ga0209281_1000039 | 3300027111 | Bacteria | 355150 |
| 282 | Ga0209282_1000009 | 3300027666 | Bacteria | 233366 |
| 283 | Ga0209282_1000032 | 3300027666 | Bacteria | 149218 |
| 284 | Ga0209971_1014001 | 3300027682 | Bacteria | 1901 |
| 285 | Ga0209974_10048755 | 3300027876 | Bacteria | 1420 |
| 286 | Ga0209974_10051497 | 3300027876 | Bacteria | 1385 |
| 287 | Ga0268265_10009579 | 3300028380 | Bacteria | 6541 |
| 288 | Ga0268264_10084747 | 3300028381 | Bacteria | 2718 |
| 289 | Ga0265336_10000371 | 3300028666 | Bacteria | 28840 |
| 290 | Ga0307517_10163511 | 3300028786 | Bacteria | 1486 |
| 291 | Ga0307515_10001889 | 3300028794 | Bacteria | 46606 |
| 292 | Ga0307515_10062795 | 3300028794 | Bacteria | 5236 |
| 293 | Ga0307515_10137784 | 3300028794 | Bacteria | 2639 |
| 294 | Ga0307515_10209697 | 3300028794 | Bacteria | 1796 |
| 295 | Ga0265324_10004594 | 3300029957 | Bacteria | 6172 |
| 296 | Ga0265324_10026135 | 3300029957 | Bacteria | 2067 |
| 297 | Ga0316181_1137224 | 3300030744 | Bacteria | 4539 |
| 298 | Ga0316182_1156105 | 3300030745 | Bacteria | 2669 |
| 299 | Ga0265330_10009515 | 3300031235 | Bacteria | 4615 |
| 300 | Ga0265332_10000253 | 3300031238 | Bacteria | 42715 |
| 301 | Ga0265325_10006633 | 3300031241 | Bacteria | 7004 |
| 302 | Ga0265329_10001506 | 3300031242 | Bacteria | 11154 |
| 303 | Ga0265331_10004185 | 3300031250 | Bacteria | 9045 |
| 304 | Ga0265327_10015618 | 3300031251 | Bacteria | 4886 |
| 305 | Ga0265327_10020732 | 3300031251 | Bacteria | 3993 |
| 306 | Ga0265316_10004517 | 3300031344 | Bacteria | 13828 |
| 307 | Ga0265316_10114733 | 3300031344 | Bacteria | 2037 |
| 308 | Ga0307408_100000432 | 3300031548 | Bacteria | 37289 |
| 309 | Ga0307408_100002407 | 3300031548 | Bacteria | 13173 |
| 310 | Ga0307408_100010617 | 3300031548 | Bacteria | 6076 |
| 311 | Ga0307408_100227442 | 3300031548 | Bacteria | 1525 |
| 312 | Ga0307408_100253356 | 3300031548 | Bacteria | 1453 |
| 313 | Ga0307408_100275698 | 3300031548 | Bacteria | 1398 |
| 314 | Ga0307508_10018336 | 3300031616 | Bacteria | 6361 |
| 315 | Ga0265314_10008929 | 3300031711 | Bacteria | 8538 |
| 316 | Ga0265314_10017740 | 3300031711 | Bacteria | 5577 |
| 317 | Ga0307516_10000048 | 3300031730 | Bacteria | 130378 |
| 318 | Ga0307516_10002257 | 3300031730 | Bacteria | 26000 |
| 319 | Ga0307516_10030751 | 3300031730 | Bacteria | 5415 |
| 320 | Ga0307412_10282814 | 3300031911 | Bacteria | 1303 |
| 321 | Ga0307416_100000975 | 3300032002 | Bacteria | 15137 |
| 322 | Ga0373926_0010863 | 3300035083 | Bacteria | 3057 |
| 323 | Ga0373928_0015985 | 3300035084 | Bacteria | 1532 |
| 324 | Ga0373943_0180795 | 3300035170 | Bacteria | 1159 |
| 325 | Ga0373955_0080618 | 3300035172 | Bacteria | 1838 |
| 326 | Ga0373924_0006584 | 3300035410 | Bacteria | 4165 |
| 327 | Ga0373931_0015826 | 3300035691 | Bacteria | 3703 |
| 328 | Ga0373933_0039388 | 3300035724 | Bacteria | 2780 |
| 329 | Ga0373937_0001073 | 3300036401 | Bacteria | 23083 |
| 330 | Ga0395899_0002806 | 3300037312 | Bacteria | 14038 |
| 331 | Ga0395899_0003830 | 3300037312 | Bacteria | 11871 |
| 332 | Ga0395899_0018674 | 3300037312 | Bacteria | 5269 |
| 333 | Ga0395899_0030258 | 3300037312 | Bacteria | 4072 |
| 334 | Ga0395899_0179380 | 3300037312 | Bacteria | 1488 |
| 335 | Ga0395900_0000904 | 3300037418 | Bacteria | 39054 |
| 336 | Ga0395900_0006506 | 3300037418 | Bacteria | 12173 |
| 337 | Ga0395900_0031672 | 3300037418 | Bacteria | 5435 |
| 338 | Ga0395900_0035466 | 3300037418 | Bacteria | 5137 |
| 339 | Ga0395900_0285887 | 3300037418 | Bacteria | 1639 |
| 340 | Ga0395900_0334820 | 3300037418 | Bacteria | 1490 |
| 341 | Ga0395898_0001196 | 3300037466 | Bacteria | 39243 |
| 342 | Ga0395898_0144923 | 3300037466 | Bacteria | 2273 |
| 343 | Ga0395905_0000161 | 3300037471 | Bacteria | 111197 |
| 344 | Ga0395905_0010442 | 3300037471 | Bacteria | 9034 |
| 345 | Ga0395905_0021728 | 3300037471 | Bacteria | 6070 |
| 346 | Ga0395905_0027336 | 3300037471 | Bacteria | 5379 |
| 347 | Ga0395905_0036632 | 3300037471 | Bacteria | 4608 |
| 348 | Ga0395905_0044844 | 3300037471 | Bacteria | 4148 |
| 349 | Ga0395905_0055914 | 3300037471 | Bacteria | 3693 |
| 350 | Ga0395905_0068537 | 3300037471 | Bacteria | 3322 |
| 351 | Ga0395901_0002710 | 3300038443 | Bacteria | 17843 |
| 352 | Ga0395901_0002897 | 3300038443 | Bacteria | 17321 |
| 353 | Ga0395901_0005821 | 3300038443 | Bacteria | 12479 |
| 354 | Ga0395901_0066242 | 3300038443 | Bacteria | 3762 |
| 355 | Ga0395901_0403054 | 3300038443 | Bacteria | 1405 |
| 356 | Ga0395901_0410996 | 3300038443 | Bacteria | 1389 |
| 357 | Ga0400490_04196 | 3300038726 | Bacteria | 8292 |
| 358 | Ga0436361_0013073 | 3300039447 | Bacteria | 17617 |
| 359 | Ga0436361_0303014 | 3300039447 | Bacteria | 21994 |
| 360 | Ga0436361_0314274 | 3300039447 | Bacteria | 1808 |
| 361 | Ga0436361_0319505 | 3300039447 | Bacteria | 9115 |
| 362 | Ga0436361_0511425 | 3300039447 | Bacteria | 1344 |
| 363 | Ga0436361_0865310 | 3300039447 | Bacteria | 2352 |
| 364 | Ga0436361_0930389 | 3300039447 | Bacteria | 10390 |
| 365 | Ga0436361_1142583 | 3300039447 | Bacteria | 2713 |
| 366 | Ga0436361_1189474 | 3300039447 | Bacteria | 2881 |
| 367 | Ga0451789_1013970 | 3300041443 | Bacteria | 2229 |
| 368 | Ga0439441_009995 | 3300042001 | Bacteria | 1582 |
| 369 | Ga0439451_028011 | 3300042009 | Bacteria | 1136 |
| 370 | Ga0450898_004347 | 3300042134 | Bacteria | 2090 |
| 371 | Ga0439446_0016659 | 3300042156 | Bacteria | 2048 |
| 372 | Ga0439435_0028631 | 3300042436 | Bacteria | 1498 |
| 373 | Ga0439460_0011810 | 3300042461 | Bacteria | 2257 |
| 374 | Ga0451577_0070287 | 3300042876 | Bacteria | 3122 |
| 375 | Ga0451577_0084653 | 3300042876 | Bacteria | 2829 |
| 376 | Ga0466969_0002316 | 3300044656 | Bacteria | 10167 |
| 377 | Ga0466969_0007117 | 3300044656 | Bacteria | 5954 |
| 378 | Ga0466972_0000420 | 3300044658 | Bacteria | 22023 |
| 379 | Ga0466972_0003973 | 3300044658 | Bacteria | 7370 |
| 380 | Ga0466972_0011040 | 3300044658 | Bacteria | 4535 |
| 381 | Ga0466972_0065816 | 3300044658 | Bacteria | 1733 |
| 382 | Ga0466965_0002121 | 3300044683 | Bacteria | 8329 |
| 383 | Ga0466965_0019993 | 3300044683 | Bacteria | 3216 |
| 384 | Ga0466965_0020012 | 3300044683 | Bacteria | 3215 |
| 385 | Ga0466965_0029552 | 3300044683 | Bacteria | 2667 |
| 386 | Ga0466965_0036795 | 3300044683 | Bacteria | 2402 |
| 387 | Ga0466966_0001854 | 3300044684 | Bacteria | 13710 |
| 388 | Ga0466966_0029228 | 3300044684 | Bacteria | 3587 |
| 389 | Ga0466966_0029262 | 3300044684 | Bacteria | 3584 |
| 390 | Ga0466961_0007476 | 3300044693 | Bacteria | 6948 |
| 391 | Ga0466961_0027488 | 3300044693 | Bacteria | 3658 |
| 392 | Ga0466964_0004187 | 3300044706 | Bacteria | 5308 |
| 393 | Ga0466964_0045872 | 3300044706 | Bacteria | 1780 |
| 394 | Ga0466971_0008161 | 3300044719 | Bacteria | 4563 |
| 395 | Ga0466971_0018165 | 3300044719 | Bacteria | 3113 |
| 396 | Ga0466968_0003902 | 3300044735 | Bacteria | 5531 |
| 397 | Ga0466970_0002134 | 3300044765 | Bacteria | 9544 |
| 398 | Ga0466957_0001920 | 3300044842 | Bacteria | 11037 |
| 399 | Ga0466957_0015104 | 3300044842 | Bacteria | 4506 |
| 400 | Ga0466957_0076144 | 3300044842 | Bacteria | 2083 |
| 401 | Ga0466957_0133066 | 3300044842 | Bacteria | 1595 |
| 402 | Ga0466959_0001954 | 3300045049 | Bacteria | 12989 |
| 403 | Ga0466959_0025858 | 3300045049 | Bacteria | 4353 |
| 404 | Ga0466959_0068023 | 3300045049 | Bacteria | 2581 |
| 405 | Ga0466959_0093076 | 3300045049 | Bacteria | 2163 |
| 406 | Ga0451576_0001583 | 3300045051 | Bacteria | 38253 |
| 407 | Ga0451576_0082220 | 3300045051 | Bacteria | 3349 |
| 408 | Ga0451576_0291462 | 3300045051 | Bacteria | 1706 |
| 409 | Ga0466958_0070166 | 3300045836 | Bacteria | 2143 |
| 410 | Ga0495617_000022 | 3300046452 | Bacteria | 185975 |
| 411 | Ga0495617_000075 | 3300046452 | Bacteria | 78250 |
| 412 | Ga0495617_001209 | 3300046452 | Bacteria | 11631 |
| 413 | Ga0495617_018396 | 3300046452 | Bacteria | 2362 |
| 414 | Ga0495627_000011 | 3300046453 | Bacteria | 354522 |
| 415 | Ga0495627_000398 | 3300046453 | Bacteria | 38966 |
| 416 | Ga0495592_0002825 | 3300046454 | Bacteria | 12317 |
| 417 | Ga0495603_0044746 | 3300046455 | Bacteria | 2641 |
| 418 | Ga0495603_0046856 | 3300046455 | Bacteria | 2575 |
| 419 | Ga0495590_0000057 | 3300046457 | Bacteria | 93720 |
| 420 | Ga0495590_0000143 | 3300046457 | Bacteria | 43197 |
| 421 | Ga0495590_0005737 | 3300046457 | Bacteria | 4877 |
| 422 | Ga0495591_000799 | 3300046458 | Bacteria | 22321 |
| 423 | Ga0495629_0020396 | 3300046459 | Bacteria | 4733 |
| 424 | Ga0495629_0041378 | 3300046459 | Bacteria | 3242 |
| 425 | Ga0495638_0001680 | 3300046460 | Bacteria | 19581 |
| 426 | Ga0495651_0002596 | 3300046462 | Bacteria | 13971 |
| 427 | Ga0495653_0000044 | 3300046463 | Bacteria | 115591 |
| 428 | Ga0495653_0028893 | 3300046463 | Bacteria | 4432 |
| 429 | Ga0495653_0062600 | 3300046463 | Bacteria | 2810 |
| 430 | Ga0495650_0000082 | 3300046471 | Bacteria | 239477 |
| 431 | Ga0495650_0000100 | 3300046471 | Bacteria | 213752 |
| 432 | Ga0495650_0001173 | 3300046471 | Bacteria | 27987 |
| 433 | Ga0495650_0001749 | 3300046471 | Bacteria | 19780 |
| 434 | Ga0495650_0002119 | 3300046471 | Bacteria | 16976 |
| 435 | Ga0495650_0008196 | 3300046471 | Bacteria | 6141 |
| 436 | Ga0495650_0012103 | 3300046471 | Bacteria | 4666 |
| 437 | Ga0495582_0027191 | 3300046473 | Bacteria | 3134 |
| 438 | Ga0495582_0038957 | 3300046473 | Bacteria | 2616 |
| 439 | Ga0495605_0000098 | 3300046474 | Bacteria | 109816 |
| 440 | Ga0495605_0000153 | 3300046474 | Bacteria | 88955 |
| 441 | Ga0495605_0002046 | 3300046474 | Bacteria | 12721 |
| 442 | Ga0495605_0020353 | 3300046474 | Bacteria | 3526 |
| 443 | Ga0495605_0037236 | 3300046474 | Bacteria | 2448 |
| 444 | Ga0495584_0000232 | 3300046491 | Bacteria | 40218 |
| 445 | Ga0495584_0000729 | 3300046491 | Bacteria | 21708 |
| 446 | Ga0495584_0002317 | 3300046491 | Bacteria | 10849 |
| 447 | Ga0495584_0009911 | 3300046491 | Bacteria | 4896 |
| 448 | Ga0495584_0067745 | 3300046491 | Bacteria | 1793 |
| 449 | Ga0495584_0094799 | 3300046491 | Bacteria | 1506 |
| 450 | Ga0495584_0147235 | 3300046491 | Bacteria | 1196 |
| 451 | Ga0495585_0000023 | 3300046492 | Bacteria | 149218 |
| 452 | Ga0495585_0000152 | 3300046492 | Bacteria | 74325 |
| 453 | Ga0495585_0000444 | 3300046492 | Bacteria | 39574 |
| 454 | Ga0495585_0022247 | 3300046492 | Bacteria | 3639 |
| 455 | Ga0495585_0036679 | 3300046492 | Bacteria | 2763 |
| 456 | Ga0495585_0063062 | 3300046492 | Bacteria | 2034 |
| 457 | Ga0495585_0065031 | 3300046492 | Bacteria | 1998 |
| 458 | Ga0495585_0142084 | 3300046492 | Bacteria | 1256 |
| 459 | Ga0495594_0068128 | 3300046499 | Bacteria | 1976 |
| 460 | Ga0495596_0000032 | 3300046500 | Bacteria | 102282 |
| 461 | Ga0495596_0000683 | 3300046500 | Bacteria | 21108 |
| 462 | Ga0495596_0001270 | 3300046500 | Bacteria | 14619 |
| 463 | Ga0495596_0004904 | 3300046500 | Bacteria | 6418 |
| 464 | Ga0495596_0019014 | 3300046500 | Bacteria | 2826 |
| 465 | Ga0495596_0039062 | 3300046500 | Bacteria | 1875 |
| 466 | Ga0495596_0047804 | 3300046500 | Bacteria | 1678 |
| 467 | Ga0495607_0009757 | 3300046501 | Bacteria | 6480 |
| 468 | Ga0495607_0013841 | 3300046501 | Bacteria | 5271 |
| 469 | Ga0495607_0034462 | 3300046501 | Bacteria | 3071 |
| 470 | Ga0495607_0053231 | 3300046501 | Bacteria | 2340 |
| 471 | Ga0495607_0060494 | 3300046501 | Bacteria | 2155 |
| 472 | Ga0495583_0000106 | 3300046506 | Bacteria | 140932 |
| 473 | Ga0495583_0000150 | 3300046506 | Bacteria | 117772 |
| 474 | Ga0495583_0000517 | 3300046506 | Bacteria | 55159 |
| 475 | Ga0495583_0000597 | 3300046506 | Bacteria | 49120 |
| 476 | Ga0495583_0001383 | 3300046506 | Bacteria | 24824 |
| 477 | Ga0495583_0001918 | 3300046506 | Bacteria | 19228 |
| 478 | Ga0495606_0000080 | 3300046507 | Bacteria | 161866 |
| 479 | Ga0495606_0000090 | 3300046507 | Bacteria | 154737 |
| 480 | Ga0495606_0000099 | 3300046507 | Bacteria | 150950 |
| 481 | Ga0495606_0000524 | 3300046507 | Bacteria | 62049 |
| 482 | Ga0495606_0000600 | 3300046507 | Bacteria | 57013 |
| 483 | Ga0495606_0001629 | 3300046507 | Bacteria | 29255 |
| 484 | Ga0495606_0002603 | 3300046507 | Bacteria | 20634 |
| 485 | Ga0495606_0086803 | 3300046507 | Bacteria | 1932 |
| 486 | Ga0495608_0026406 | 3300046511 | Bacteria | 3959 |
| 487 | Ga0495608_0026533 | 3300046511 | Bacteria | 3948 |
| 488 | Ga0495608_0127594 | 3300046511 | Bacteria | 1629 |
| 489 | Ga0495610_0000017 | 3300046512 | Bacteria | 365675 |
| 490 | Ga0495610_0000668 | 3300046512 | Bacteria | 33359 |
| 491 | Ga0495610_0002272 | 3300046512 | Bacteria | 16239 |
| 492 | Ga0495610_0013362 | 3300046512 | Bacteria | 4884 |
| 493 | Ga0495610_0043732 | 3300046512 | Bacteria | 2228 |
| 494 | Ga0495616_0000490 | 3300046513 | Bacteria | 30167 |
| 495 | Ga0495616_0002388 | 3300046513 | Bacteria | 12495 |
| 496 | Ga0495616_0004647 | 3300046513 | Bacteria | 8621 |
| 497 | Ga0495616_0006823 | 3300046513 | Bacteria | 6878 |
| 498 | Ga0495616_0016924 | 3300046513 | Bacteria | 4026 |
| 499 | Ga0495616_0018885 | 3300046513 | Bacteria | 3769 |
| 500 | Ga0495616_0029168 | 3300046513 | Bacteria | 2915 |
| 501 | Ga0495616_0034548 | 3300046513 | Bacteria | 2625 |
| 502 | Ga0495616_0073217 | 3300046513 | Bacteria | 1653 |
| 503 | Ga0495618_0063746 | 3300046514 | Bacteria | 2341 |
| 504 | Ga0495628_0000382 | 3300046516 | Bacteria | 40502 |
| 505 | Ga0495628_0002078 | 3300046516 | Bacteria | 18185 |
| 506 | Ga0495630_0246662 | 3300046517 | Bacteria | 1364 |
| 507 | Ga0495631_0001332 | 3300046518 | Bacteria | 15128 |
| 508 | Ga0495631_0001436 | 3300046518 | Bacteria | 14479 |
| 509 | Ga0495631_0023308 | 3300046518 | Bacteria | 2870 |
| 510 | Ga0495631_0065120 | 3300046518 | Bacteria | 1577 |
| 511 | Ga0495632_0000052 | 3300046519 | Bacteria | 132992 |
| 512 | Ga0495632_0000396 | 3300046519 | Bacteria | 40964 |
| 513 | Ga0495632_0001555 | 3300046519 | Bacteria | 18930 |
| 514 | Ga0495632_0003734 | 3300046519 | Bacteria | 10656 |
| 515 | Ga0495632_0012494 | 3300046519 | Bacteria | 4897 |
| 516 | Ga0495632_0013833 | 3300046519 | Bacteria | 4588 |
| 517 | Ga0495637_0000018 | 3300046520 | Bacteria | 186671 |
| 518 | Ga0495637_0000195 | 3300046520 | Bacteria | 47191 |
| 519 | Ga0495643_0000109 | 3300046522 | Bacteria | 135859 |
| 520 | Ga0495643_0000250 | 3300046522 | Bacteria | 78905 |
| 521 | Ga0495643_0001163 | 3300046522 | Bacteria | 25714 |
| 522 | Ga0495643_0003256 | 3300046522 | Bacteria | 12009 |
| 523 | Ga0495643_0021689 | 3300046522 | Bacteria | 3679 |
| 524 | Ga0495643_0025569 | 3300046522 | Bacteria | 3339 |
| 525 | Ga0495643_0039737 | 3300046522 | Bacteria | 2572 |
| 526 | Ga0495644_0001124 | 3300046523 | Bacteria | 10982 |
| 527 | Ga0495644_0003935 | 3300046523 | Bacteria | 5846 |
| 528 | Ga0495648_0001108 | 3300046524 | Bacteria | 27307 |
| 529 | Ga0495648_0001296 | 3300046524 | Bacteria | 24870 |
| 530 | Ga0495648_0001297 | 3300046524 | Bacteria | 24870 |
| 531 | Ga0495648_0001425 | 3300046524 | Bacteria | 23386 |
| 532 | Ga0495648_0003753 | 3300046524 | Bacteria | 13223 |
| 533 | Ga0495648_0012427 | 3300046524 | Bacteria | 6353 |
| 534 | Ga0495648_0012934 | 3300046524 | Bacteria | 6198 |
| 535 | Ga0495648_0015868 | 3300046524 | Bacteria | 5445 |
| 536 | Ga0495648_0030615 | 3300046524 | Bacteria | 3555 |
| 537 | Ga0495666_0006871 | 3300046526 | Bacteria | 5714 |
| 538 | Ga0495666_0007557 | 3300046526 | Bacteria | 5437 |
| 539 | Ga0495642_0000529 | 3300046528 | Bacteria | 19421 |
| 540 | Ga0495642_0002545 | 3300046528 | Bacteria | 7372 |
| 541 | Ga0495642_0003891 | 3300046528 | Bacteria | 5852 |
| 542 | Ga0495642_0004563 | 3300046528 | Bacteria | 5366 |
| 543 | Ga0495642_0011219 | 3300046528 | Bacteria | 3437 |
| 544 | Ga0495642_0014230 | 3300046528 | Bacteria | 3082 |
| 545 | Ga0495642_0042536 | 3300046528 | Bacteria | 1851 |
| 546 | Ga0495642_0068412 | 3300046528 | Bacteria | 1482 |
| 547 | Ga0495654_0000030 | 3300046530 | Bacteria | 216715 |
| 548 | Ga0495654_0018430 | 3300046530 | Bacteria | 3658 |
| 549 | Ga0495654_0021405 | 3300046530 | Bacteria | 3363 |
| 550 | Ga0495654_0031775 | 3300046530 | Bacteria | 2679 |
| 551 | Ga0495665_0001301 | 3300046531 | Bacteria | 13308 |
| 552 | Ga0495665_0024697 | 3300046531 | Bacteria | 3228 |
| 553 | Ga0495665_0034596 | 3300046531 | Bacteria | 2701 |
| 554 | Ga0495586_0115342 | 3300046535 | Bacteria | 1497 |
| 555 | Ga0495587_0051879 | 3300046536 | Bacteria | 2422 |
| 556 | Ga0495598_0015527 | 3300046537 | Bacteria | 1925 |
| 557 | Ga0495609_0002820 | 3300046538 | Bacteria | 10412 |
| 558 | Ga0495609_0005405 | 3300046538 | Bacteria | 6723 |
| 559 | Ga0495609_0007869 | 3300046538 | Bacteria | 5269 |
| 560 | Ga0495609_0008324 | 3300046538 | Bacteria | 5084 |
| 561 | Ga0495621_0013856 | 3300046539 | Bacteria | 2542 |
| 562 | Ga0495597_0001115 | 3300046542 | Bacteria | 20308 |
| 563 | Ga0495597_0001285 | 3300046542 | Bacteria | 18457 |
| 564 | Ga0495597_0001411 | 3300046542 | Bacteria | 17326 |
| 565 | Ga0495597_0002378 | 3300046542 | Bacteria | 12035 |
| 566 | Ga0495597_0018630 | 3300046542 | Bacteria | 3255 |
| 567 | Ga0495597_0022362 | 3300046542 | Bacteria | 2933 |
| 568 | Ga0495597_0073848 | 3300046542 | Bacteria | 1465 |
| 569 | Ga0495645_0068890 | 3300046543 | Bacteria | 2554 |
| 570 | Ga0495622_0000044 | 3300046557 | Bacteria | 115528 |
| 571 | Ga0495622_0004973 | 3300046557 | Bacteria | 6157 |
| 572 | Ga0495633_0000917 | 3300046558 | Bacteria | 24985 |
| 573 | Ga0495633_0003343 | 3300046558 | Bacteria | 10770 |
| 574 | Ga0495633_0006937 | 3300046558 | Bacteria | 6622 |
| 575 | Ga0495633_0059388 | 3300046558 | Bacteria | 1793 |
| 576 | Ga0495668_0000035 | 3300046616 | Bacteria | 240241 |
| 577 | Ga0495668_0000211 | 3300046616 | Bacteria | 84615 |
| 578 | Ga0495668_0000286 | 3300046616 | Bacteria | 69771 |
| 579 | Ga0495668_0000939 | 3300046616 | Bacteria | 32535 |
| 580 | Ga0495668_0001545 | 3300046616 | Bacteria | 21835 |
| 581 | Ga0495668_0004452 | 3300046616 | Bacteria | 9939 |
| 582 | Ga0495668_0004605 | 3300046616 | Bacteria | 9699 |
| 583 | Ga0495668_0012596 | 3300046616 | Bacteria | 5014 |
| 584 | Ga0495668_0097325 | 3300046616 | Bacteria | 1610 |
| 585 | Ga0495611_0001030 | 3300046648 | Bacteria | 14761 |
| 586 | Ga0495611_0003988 | 3300046648 | Bacteria | 6425 |
| 587 | Ga0495611_0006487 | 3300046648 | Bacteria | 4986 |
| 588 | Ga0495611_0012387 | 3300046648 | Bacteria | 3626 |
| 589 | Ga0495611_0024927 | 3300046648 | Bacteria | 2603 |
| 590 | Ga0495611_0050001 | 3300046648 | Bacteria | 1882 |
| 591 | Ga0495625_0000338 | 3300046660 | Bacteria | 71524 |
| 592 | Ga0495625_0001765 | 3300046660 | Bacteria | 25007 |
| 593 | Ga0495625_0002807 | 3300046660 | Bacteria | 18358 |
| 594 | Ga0495625_0016076 | 3300046660 | Bacteria | 5897 |
| 595 | Ga0495625_0032153 | 3300046660 | Bacteria | 3895 |
| 596 | Ga0495625_0032657 | 3300046660 | Bacteria | 3857 |
| 597 | Ga0495659_0000139 | 3300046664 | Bacteria | 32158 |
| 598 | Ga0495659_0006513 | 3300046664 | Bacteria | 3687 |
| 599 | Ga0495659_0012720 | 3300046664 | Bacteria | 2731 |
| 600 | Ga0495659_0021812 | 3300046664 | Bacteria | 2161 |
| 601 | Ga0495661_0004739 | 3300046665 | Bacteria | 9770 |
| 602 | Ga0495661_0014026 | 3300046665 | Bacteria | 5371 |
| 603 | Ga0495661_0028811 | 3300046665 | Bacteria | 3550 |
| 604 | Ga0495661_0064889 | 3300046665 | Bacteria | 2152 |
| 605 | Ga0495661_0146768 | 3300046665 | Bacteria | 1277 |
| 606 | Ga0495588_0056552 | 3300046674 | Bacteria | 2025 |
| 607 | Ga0495599_0009879 | 3300046678 | Bacteria | 5840 |
| 608 | Ga0495623_0019111 | 3300046679 | Bacteria | 4426 |
| 609 | Ga0495647_0004533 | 3300046681 | Bacteria | 4519 |
| 610 | Ga0495647_0034374 | 3300046681 | Bacteria | 1898 |
| 611 | Ga0495658_0216304 | 3300046683 | Bacteria | 1198 |
| 612 | Ga0495669_0000101 | 3300046684 | Bacteria | 53876 |
| 613 | Ga0495669_0000495 | 3300046684 | Bacteria | 18130 |
| 614 | Ga0495669_0001145 | 3300046684 | Bacteria | 10993 |
| 615 | Ga0495613_0026824 | 3300046689 | Bacteria | 4290 |
| 616 | Ga0495613_0111034 | 3300046689 | Bacteria | 1975 |
| 617 | Ga0495624_0004359 | 3300046690 | Bacteria | 10375 |
| 618 | Ga0495624_0020490 | 3300046690 | Bacteria | 4400 |
| 619 | Ga0495624_0083235 | 3300046690 | Bacteria | 1979 |
| 620 | Ga0495670_0000859 | 3300046691 | Bacteria | 14714 |
| 621 | Ga0495670_0045941 | 3300046691 | Bacteria | 2180 |
| 622 | Ga0495671_0000087 | 3300046692 | Bacteria | 87327 |
| 623 | Ga0495671_0000605 | 3300046692 | Bacteria | 26398 |
| 624 | Ga0495671_0003108 | 3300046692 | Bacteria | 10317 |
| 625 | Ga0495671_0003330 | 3300046692 | Bacteria | 9927 |
| 626 | Ga0495671_0003550 | 3300046692 | Bacteria | 9532 |
| 627 | Ga0495671_0038095 | 3300046692 | Bacteria | 2431 |
| 628 | Ga0495649_0000194 | 3300046694 | Bacteria | 53689 |
| 629 | Ga0495649_0000702 | 3300046694 | Bacteria | 27319 |
| 630 | Ga0495649_0016852 | 3300046694 | Bacteria | 4136 |
| 631 | Ga0495649_0027581 | 3300046694 | Bacteria | 3150 |
| 632 | Ga0495589_0001516 | 3300046794 | Bacteria | 13354 |
| 633 | Ga0495589_0018768 | 3300046794 | Bacteria | 3545 |
| 634 | Ga0495660_0004751 | 3300046810 | Bacteria | 8199 |
| 635 | Ga0495660_0028271 | 3300046810 | Bacteria | 3169 |
| 636 | Ga0495581_0001539 | 3300047315 | Bacteria | 12859 |
| 637 | Ga0495604_0053804 | 3300047317 | Bacteria | 3109 |
| 638 | Ga0495604_0071554 | 3300047317 | Bacteria | 2623 |
| 639 | Ga0495636_0003424 | 3300047318 | Bacteria | 6152 |
| 640 | Ga0495636_0004254 | 3300047318 | Bacteria | 5617 |
| 641 | Ga0495636_0011954 | 3300047318 | Bacteria | 3439 |
| 642 | Ga0495636_0120545 | 3300047318 | Bacteria | 1160 |
| 643 | Ga0495672_0000013 | 3300047320 | Bacteria | 511827 |
| 644 | Ga0495672_0000064 | 3300047320 | Bacteria | 195158 |
| 645 | Ga0495672_0000512 | 3300047320 | Bacteria | 44570 |
| 646 | Ga0495672_0001189 | 3300047320 | Bacteria | 26357 |
| 647 | Ga0495672_0004405 | 3300047320 | Bacteria | 11546 |
| 648 | Ga0495672_0033064 | 3300047320 | Bacteria | 3208 |
| 649 | Ga0495672_0084898 | 3300047320 | Bacteria | 1755 |
| 650 | Ga0495676_0000015 | 3300047321 | Bacteria | 199492 |
| 651 | Ga0495680_0058066 | 3300047322 | Bacteria | 2991 |
| 652 | Ga0495683_0000036 | 3300047323 | Bacteria | 144974 |
| 653 | Ga0495683_0005881 | 3300047323 | Bacteria | 6742 |
| 654 | Ga0495683_0006168 | 3300047323 | Bacteria | 6571 |
| 655 | Ga0495683_0035949 | 3300047323 | Bacteria | 2516 |
| 656 | Ga0495687_000057 | 3300047443 | Bacteria | 186224 |
| 657 | Ga0495687_001055 | 3300047443 | Bacteria | 27247 |
| 658 | Ga0495687_001122 | 3300047443 | Bacteria | 26027 |
| 659 | Ga0495687_007401 | 3300047443 | Bacteria | 6469 |
| 660 | Ga0495677_0000948 | 3300047445 | Bacteria | 11680 |
| 661 | Ga0495677_0005204 | 3300047445 | Bacteria | 4948 |
| 662 | Ga0495677_0005995 | 3300047445 | Bacteria | 4600 |
| 663 | Ga0495679_001332 | 3300047446 | Bacteria | 14284 |
| 664 | Ga0495679_019405 | 3300047446 | Bacteria | 2389 |
| 665 | Ga0495685_000299 | 3300047447 | Bacteria | 16305 |
| 666 | Ga0495685_032368 | 3300047447 | Bacteria | 1796 |
| 667 | Ga0495673_0000069 | 3300047469 | Bacteria | 218170 |
| 668 | Ga0495673_0000203 | 3300047469 | Bacteria | 89918 |
| 669 | Ga0495673_0000236 | 3300047469 | Bacteria | 79618 |
| 670 | Ga0495681_0001009 | 3300047470 | Bacteria | 21583 |
| 671 | Ga0495686_0000620 | 3300047472 | Bacteria | 48981 |
| 672 | Ga0495686_0001028 | 3300047472 | Bacteria | 33622 |
| 673 | Ga0495686_0006069 | 3300047472 | Bacteria | 9368 |
| 674 | Ga0495686_0065437 | 3300047472 | Bacteria | 2247 |
| 675 | Ga0495686_0066701 | 3300047472 | Bacteria | 2223 |
| 676 | Ga0495615_0004412 | 3300048090 | Bacteria | 2456 |
| 677 | Ga0495626_0000998 | 3300048091 | Bacteria | 24336 |
| 678 | Ga0495626_0001757 | 3300048091 | Bacteria | 16497 |
| 679 | Ga0495626_0002805 | 3300048091 | Bacteria | 11678 |
| 680 | Ga0495626_0005031 | 3300048091 | Bacteria | 7893 |
| 681 | Ga0495626_0021084 | 3300048091 | Bacteria | 3239 |
| 682 | Ga0495626_0023637 | 3300048091 | Bacteria | 3022 |
| 683 | Ga0495626_0052127 | 3300048091 | Bacteria | 1886 |
| 684 | Ga0495626_0094330 | 3300048091 | Bacteria | 1312 |
| 685 | Ga0496101_0088835 | 3300048904 | Bacteria | 2296 |
| 686 | Ga0496102_0000068 | 3300048905 | Bacteria | 156306 |
| 687 | Ga0496102_0000478 | 3300048905 | Bacteria | 44372 |
| 688 | Ga0496102_0003174 | 3300048905 | Bacteria | 13940 |
| 689 | Ga0496102_0008640 | 3300048905 | Bacteria | 8741 |
| 690 | Ga0496102_0017344 | 3300048905 | Bacteria | 6306 |
| 691 | Ga0496102_0060082 | 3300048905 | Bacteria | 3477 |
| 692 | Ga0496102_0292601 | 3300048905 | Bacteria | 1535 |
| 693 | Ga0496103_0039346 | 3300048906 | Bacteria | 2905 |
| 694 | Ga0496104_0072060 | 3300048907 | Bacteria | 3285 |
| 695 | Ga0496104_0247654 | 3300048907 | Bacteria | 1695 |
| 696 | Ga0496107_0131596 | 3300048910 | Bacteria | 1847 |
| 697 | Ga0496108_0232857 | 3300048911 | Bacteria | 1602 |
| 698 | Ga0496108_0248307 | 3300048911 | Bacteria | 1548 |
| 699 | Ga0496109_0010698 | 3300048912 | Bacteria | 7850 |
| 700 | Ga0496110_0000092 | 3300048913 | Bacteria | 48035 |
| 701 | Ga0496110_0067148 | 3300048913 | Bacteria | 3173 |
| 702 | Ga0496110_0313389 | 3300048913 | Bacteria | 1429 |
| 703 | Ga0496111_0085754 | 3300048914 | Bacteria | 2303 |
| 704 | Ga0496111_0104260 | 3300048914 | Bacteria | 2086 |
| 705 | Ga0496112_0012572 | 3300048915 | Bacteria | 7778 |
| 706 | Ga0496113_0009523 | 3300048916 | Bacteria | 6371 |
| 707 | Ga0496114_0039685 | 3300048917 | Bacteria | 3896 |
| 708 | Ga0496114_0079489 | 3300048917 | Bacteria | 2768 |
| 709 | Ga0496116_0010336 | 3300048919 | Bacteria | 7838 |
| 710 | Ga0496116_0044055 | 3300048919 | Bacteria | 3034 |
| 711 | Ga0496116_0050153 | 3300048919 | Bacteria | 2783 |
| 712 | Ga0496121_0018725 | 3300048924 | Bacteria | 6964 |
| 713 | Ga0496121_0043951 | 3300048924 | Bacteria | 3862 |
| 714 | Ga0496121_0057712 | 3300048924 | Bacteria | 3215 |
| 715 | Ga0496121_0057725 | 3300048924 | Bacteria | 3215 |
| 716 | Ga0496121_0106030 | 3300048924 | Bacteria | 2155 |
| 717 | Ga0496121_0282190 | 3300048924 | Bacteria | 1135 |
| 718 | Ga0496122_0003525 | 3300048925 | Bacteria | 20479 |
| 719 | Ga0496122_0004616 | 3300048925 | Bacteria | 16951 |
| 720 | Ga0496122_0020064 | 3300048925 | Bacteria | 6067 |
| 721 | Ga0496122_0114896 | 3300048925 | Bacteria | 1755 |
| 722 | Ga0496123_0000084 | 3300048926 | Bacteria | 187479 |
| 723 | Ga0496123_0001425 | 3300048926 | Bacteria | 33435 |
| 724 | Ga0496123_0003683 | 3300048926 | Bacteria | 16896 |
| 725 | Ga0496123_0004216 | 3300048926 | Bacteria | 15340 |
| 726 | Ga0496125_0000368 | 3300048928 | Bacteria | 84924 |
| 727 | Ga0496125_0002558 | 3300048928 | Bacteria | 23425 |
| 728 | Ga0496125_0089020 | 3300048928 | Bacteria | 2323 |
| 729 | Ga0496125_0090062 | 3300048928 | Bacteria | 2304 |
| 730 | Ga0496126_0114487 | 3300048929 | Bacteria | 2346 |
| 731 | Ga0495678_000010 | 3300049459 | Bacteria | 357896 |
| 732 | Ga0495678_000034 | 3300049459 | Bacteria | 207827 |
| 733 | Ga0495678_000095 | 3300049459 | Bacteria | 109532 |
| 734 | Ga0495678_000383 | 3300049459 | Bacteria | 44894 |
| 735 | Ga0495678_001376 | 3300049459 | Bacteria | 19384 |
| 736 | Ga0495678_009739 | 3300049459 | Bacteria | 4722 |
| 737 | Ga0495678_013065 | 3300049459 | Bacteria | 3913 |
| 738 | Ga0495678_013343 | 3300049459 | Bacteria | 3861 |
| 739 | Ga0495682_0000089 | 3300049460 | Bacteria | 80020 |
| 740 | Ga0495682_0000432 | 3300049460 | Bacteria | 29176 |
| 741 | Ga0501031_0164943 | 3300049568 | Bacteria | 1448 |
| 742 | Ga0501034_0015538 | 3300049571 | Bacteria | 7819 |
| 743 | Ga0501036_0005297 | 3300049572 | Bacteria | 10438 |
| 744 | Ga0501038_0138702 | 3300049574 | Bacteria | 1991 |
| 745 | Ga0501038_0242228 | 3300049574 | Bacteria | 1431 |
| 746 | Ga0501040_0004246 | 3300049576 | Bacteria | 9326 |
| 747 | Ga0501040_0034002 | 3300049576 | Bacteria | 3455 |
| 748 | Ga0501041_0000171 | 3300049577 | Bacteria | 29019 |
| 749 | Ga0501041_0015653 | 3300049577 | Bacteria | 4505 |
| 750 | Ga0501041_0187064 | 3300049577 | Bacteria | 1297 |
| 751 | Ga0501042_0148935 | 3300049578 | Bacteria | 1687 |
| 752 | Ga0501042_0243691 | 3300049578 | Bacteria | 1297 |
| 753 | Ga0501043_0070467 | 3300049579 | Bacteria | 2746 |
| 754 | Ga0501046_0283386 | 3300049580 | Bacteria | 1213 |
| 755 | Ga0501048_0002988 | 3300049582 | Bacteria | 12906 |
| 756 | Ga0501048_0192145 | 3300049582 | Bacteria | 1447 |
| 757 | Ga0501069_0053281 | 3300049585 | Bacteria | 2253 |
| 758 | Ga0501070_0002373 | 3300049586 | Bacteria | 16519 |
| 759 | Ga0501071_0075261 | 3300049587 | Bacteria | 2464 |
| 760 | Ga0501072_0001613 | 3300049588 | Bacteria | 16851 |
| 761 | Ga0501072_0002668 | 3300049588 | Bacteria | 13378 |
| 762 | Ga0501073_0235668 | 3300049589 | Bacteria | 1264 |
| 763 | Ga0501075_0006883 | 3300049591 | Bacteria | 7852 |
| 764 | Ga0501076_0000429 | 3300049592 | Bacteria | 26487 |
| 765 | Ga0501076_0003325 | 3300049592 | Bacteria | 11276 |
| 766 | Ga0501077_0201709 | 3300049593 | Bacteria | 1264 |
| 767 | Ga0501227_004729 | 3300049665 | Bacteria | 2921 |
| 768 | Ga0501238_001560 | 3300049671 | Bacteria | 2659 |
| 769 | Ga0501079_0046536 | 3300049741 | Bacteria | 3347 |
| 770 | Ga0501080_0016392 | 3300049742 | Bacteria | 6844 |
| 771 | Ga0501081_0000857 | 3300049743 | Bacteria | 17972 |
| 772 | Ga0501279_002860 | 3300049775 | Bacteria | 2250 |
| 773 | Ga0501035_0006010 | 3300049822 | Bacteria | 11433 |
| 774 | Ga0501035_0290214 | 3300049822 | Bacteria | 1381 |
| 775 | nmdc:mga0k408_40413_c1 | 3300050493 | Bacteria | 2684 |
| 776 | nmdc:mga0k408_49769_c1 | 3300050493 | Bacteria | 2426 |
| 777 | nmdc:mga07m45_666_c1 | 3300050496 | Bacteria | 14578 |
| 778 | nmdc:mga07m45_68728_c1 | 3300050496 | Bacteria | 2014 |
| 779 | nmdc:mga0qj67_10786_c1 | 3300050509 | Bacteria | 6834 |
| 780 | nmdc:mga08y16_311260_c1 | 3300050511 | Bacteria | 1622 |
| 781 | nmdc:mga08x19_17547_c1 | 3300050514 | Bacteria | 4381 |
| 782 | nmdc:mga08x19_49650_c1 | 3300050514 | Bacteria | 2691 |
| 783 | Ga0495601_0011317 | 3300053077 | Bacteria | 5332 |
| 784 | Ga0495595_0131424 | 3300053084 | Bacteria | 1224 |
| 785 | Ga0495619_0037112 | 3300053085 | Bacteria | 3174 |
| 786 | Ga0500578_0000067 | 3300053086 | Bacteria | 115659 |
| 787 | Ga0500593_004818 | 3300053117 | Bacteria | 5258 |
| 788 | Ga0500618_000653 | 3300053125 | Bacteria | 20633 |
| 789 | Ga0500574_000047 | 3300053141 | Bacteria | 14143 |
| 790 | Ga0500586_000912 | 3300053145 | Bacteria | 6084 |
| 791 | Ga0500619_000149 | 3300053154 | Bacteria | 17198 |
| 792 | Ga0500570_079924 | 3300053724 | Bacteria | 1479 |
| 793 | Ga0501084_0013441 | 3300054114 | Bacteria | 6774 |
| 794 | Ga0501082_0002703 | 3300060353 | Bacteria | 15476 |
| 795 | Ga0466962_0015221 | 3300061719 | Bacteria | 3709 |
| 796 | Ga0530510_0001659 | 3300061734 | Bacteria | 15060 |
| 797 | Ga0530510_0008175 | 3300061734 | Bacteria | 7296 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039447 | Ga0436361_0319505 | Ga0436361_0319505_10_915 | 301 |
| 2 | 3300046500 | Ga0495596_0047804 | Ga0495596_0047804_11_916 | 301 |
| 3 | 3300042876 | Ga0451577_0084653 | Ga0451577_0084653_321_1340 | 305 |
| 4 | 3300046501 | Ga0495607_0009757 | Ga0495607_0009757_22_945 | 307 |
| 5 | 3300035170 | Ga0373943_0180795 | Ga0373943_0180795_106_1128 | 311 |
| 6 | 3300050511 | nmdc:mga08y16_311260_c1 | nmdc:mga08y16_311260_c1_12_953 | 313 |
| 7 | 3300045049 | Ga0466959_0093076 | Ga0466959_0093076_1197_2141 | 314 |
| 8 | 3300046507 | Ga0495606_0000524 | Ga0495606_0000524_52269_53306 | 315 |
| 9 | 3300027876 | Ga0209974_10048755 | Ga0209974_100487552 | 317 |
| 10 | 3300005343 | Ga0070687_100031300 | Ga0070687_1000313002 | 319 |
| 11 | 3300025918 | Ga0207662_10041525 | Ga0207662_100415252 | 319 |
| 12 | 3300046517 | Ga0495630_0246662 | Ga0495630_0246662_22_984 | 319 |
| 13 | 3300038443 | Ga0395901_0410996 | Ga0395901_0410996_407_1375 | 322 |
| 14 | 3300042009 | Ga0439451_028011 | Ga0439451_028011_155_1123 | 322 |
| 15 | 3300039447 | Ga0436361_0511425 | Ga0436361_0511425_360_1331 | 323 |
| 16 | 3300046459 | Ga0495629_0020396 | Ga0495629_0020396_807_1844 | 324 |
| 17 | 3300006846 | Ga0075430_100011586 | Ga0075430_1000115867 | 330 |
| 18 | 3300050509 | nmdc:mga0qj67_10786_c1 | nmdc:mga0qj67_10786_c1_776_1816 | 330 |
| 19 | 3300049580 | Ga0501046_0283386 | Ga0501046_0283386_11_1006 | 331 |
| 20 | 3300049582 | Ga0501048_0192145 | Ga0501048_0192145_202_1242 | 331 |
| 21 | 3300038726 | Ga0400490_04196 | Ga0400490_04196_3355_4359 | 334 |
| 22 | 3300050493 | nmdc:mga0k408_40413_c1 | nmdc:mga0k408_40413_c1_32_1036 | 334 |
| 23 | 3300046452 | Ga0495617_018396 | Ga0495617_018396_717_1775 | 337 |
| 24 | 3300046455 | Ga0495603_0044746 | Ga0495603_0044746_98_1135 | 337 |
| 25 | 3300046528 | Ga0495642_0014230 | Ga0495642_0014230_1343_2380 | 337 |
| 26 | 3300048905 | Ga0496102_0292601 | Ga0496102_0292601_150_1163 | 337 |
| 27 | 3300049460 | Ga0495682_0000089 | Ga0495682_0000089_3277_4335 | 337 |
| 28 | iso_pu_bacteria | 2526164512 | 2526212642 | 337 |
| 29 | iso_pu_bacteria | 2998344455 | 2998347185 | 337 |
| 30 | 3300046513 | Ga0495616_0016924 | Ga0495616_0016924_668_1684 | 338 |
| 31 | 3300049585 | Ga0501069_0053281 | Ga0501069_0053281_625_1641 | 338 |
| 32 | 3300049586 | Ga0501070_0002373 | Ga0501070_0002373_12002_13018 | 338 |
| 33 | 3300046664 | Ga0495659_0021812 | Ga0495659_0021812_256_1290 | 339 |
| 34 | iso_pu_bacteria | 2585428062 | 2587758017 | 339 |
| 35 | iso_pu_bacteria | 2821131069 | 2821136475 | 339 |
| 36 | 3300005545 | Ga0070695_100051921 | Ga0070695_1000519213 | 340 |
| 37 | 3300025906 | Ga0207699_10201555 | Ga0207699_102015552 | 340 |
| 38 | 3300031616 | Ga0307508_10018336 | Ga0307508_100183365 | 340 |
| 39 | 3300035084 | Ga0373928_0015985 | Ga0373928_0015985_341_1363 | 340 |
| 40 | 3300045051 | Ga0451576_0291462 | Ga0451576_0291462_34_1056 | 340 |
| 41 | iso_pu_bacteria | 2643221592 | 2643968460 | 340 |
| 42 | iso_pu_bacteria | 2643221625 | 2644140748 | 340 |
| 43 | iso_pu_bacteria | 2643221648 | 2644272732 | 340 |
| 44 | 3300048913 | Ga0496110_0313389 | Ga0496110_0313389_369_1394 | 341 |
| 45 | 3300048917 | Ga0496114_0039685 | Ga0496114_0039685_2322_3347 | 341 |
| 46 | iso_pu_bacteria | 2511231003 | 2511250315 | 341 |
| 47 | iso_pu_bacteria | 2511231026 | 2511387579 | 341 |
| 48 | iso_pu_bacteria | 2521172590 | 2521559829 | 341 |
| 49 | iso_pu_bacteria | 2548876994 | 2550693194 | 341 |
| 50 | iso_pu_bacteria | 2551306416 | 2553007037 | 341 |
| 51 | iso_pu_bacteria | 2600255292 | 2601672276 | 341 |
| 52 | iso_pu_bacteria | 2643221554 | 2643791755 | 341 |
| 53 | iso_pu_bacteria | 2643221603 | 2644027058 | 341 |
| 54 | iso_pu_bacteria | 2643221638 | 2644216766 | 341 |
| 55 | iso_pu_bacteria | 2643221644 | 2644245283 | 341 |
| 56 | iso_pu_bacteria | 2738541297 | 2738827055 | 341 |
| 57 | iso_pu_bacteria | 2738541357 | 2739150852 | 341 |
| 58 | iso_pu_bacteria | 2738543003 | 2739192771 | 341 |
| 59 | iso_pu_bacteria | 2738543026 | 2739319248 | 341 |
| 60 | iso_pu_bacteria | 2738543029 | 2739337489 | 341 |
| 61 | iso_pu_bacteria | 2765235838 | 2765571085 | 341 |
| 62 | iso_pu_bacteria | 2808606386 | 2808984993 | 341 |
| 63 | iso_pu_bacteria | 2808606415 | 2809130125 | 341 |
| 64 | iso_pu_bacteria | 2808606419 | 2809150398 | 341 |
| 65 | iso_pu_bacteria | 2818991436 | 2819544568 | 341 |
| 66 | iso_pu_bacteria | 2818991449 | 2819618262 | 341 |
| 67 | iso_pu_bacteria | 2839094727 | 2839096681 | 341 |
| 68 | iso_pu_bacteria | 2842711865 | 2842713692 | 341 |
| 69 | iso_pu_bacteria | 2852618963 | 2852621378 | 341 |
| 70 | iso_pu_bacteria | 2857547612 | 2857549307 | 341 |
| 71 | iso_pu_bacteria | 2857553236 | 2857558524 | 341 |
| 72 | iso_pu_bacteria | 2857558681 | 2857562339 | 341 |
| 73 | iso_pu_bacteria | 2884811622 | 2884815181 | 341 |
| 74 | iso_pu_bacteria | 2884836552 | 2884839895 | 341 |
| 75 | iso_pu_bacteria | 2884852848 | 2884856294 | 341 |
| 76 | iso_pu_bacteria | 2885080285 | 2885081347 | 341 |
| 77 | iso_pu_bacteria | 2896154374 | 2896158659 | 341 |
| 78 | iso_pu_bacteria | 2904424332 | 2904428567 | 341 |
| 79 | iso_pu_bacteria | 2904439833 | 2904444395 | 341 |
| 80 | iso_pu_bacteria | 2904530477 | 2904535548 | 341 |
| 81 | iso_pu_bacteria | 2904584206 | 2904588120 | 341 |
| 82 | iso_pu_bacteria | 2904589729 | 2904595156 | 341 |
| 83 | iso_pu_bacteria | 2904601388 | 2904606069 | 341 |
| 84 | iso_pu_bacteria | 2919046199 | 2919051305 | 341 |
| 85 | iso_pu_bacteria | 2919079590 | 2919084267 | 341 |
| 86 | iso_pu_bacteria | 2919476304 | 2919477224 | 341 |
| 87 | iso_pu_bacteria | 2923510766 | 2923513596 | 341 |
| 88 | iso_pu_bacteria | 2928130867 | 2928135287 | 341 |
| 89 | iso_pu_bacteria | 2932410948 | 2932416361 | 341 |
| 90 | iso_pu_bacteria | 2932416698 | 2932422246 | 341 |
| 91 | 3300003771 | Ga0055526_1003493 | Ga0055526_10034938 | 342 |
| 92 | 3300031251 | Ga0265327_10015618 | Ga0265327_100156183 | 342 |
| 93 | 3300042134 | Ga0450898_004347 | Ga0450898_004347_133_1161 | 342 |
| 94 | 3300048904 | Ga0496101_0088835 | Ga0496101_0088835_193_1221 | 342 |
| 95 | 3300048905 | Ga0496102_0003174 | Ga0496102_0003174_2003_3031 | 342 |
| 96 | 3300048912 | Ga0496109_0010698 | Ga0496109_0010698_3285_4313 | 342 |
| 97 | 3300053117 | Ga0500593_004818 | Ga0500593_004818_2174_3202 | 342 |
| 98 | 3300003759 | Ga0055525_1000018 | Ga0055525_100001810 | 343 |
| 99 | 3300003771 | Ga0055526_1001033 | Ga0055526_100103310 | 343 |
| 100 | 3300003773 | Ga0055537_1000580 | Ga0055537_100058010 | 343 |
| 101 | 3300003775 | Ga0055524_1015153 | Ga0055524_10151533 | 343 |
| 102 | 3300003784 | Ga0055534_1000283 | Ga0055534_100028310 | 343 |
| 103 | 3300003790 | Ga0055528_1000495 | Ga0055528_100049523 | 343 |
| 104 | 3300005339 | Ga0070660_100016657 | Ga0070660_1000166575 | 343 |
| 105 | 3300006178 | Ga0075367_10043698 | Ga0075367_100436982 | 343 |
| 106 | 3300025230 | Ga0209563_100011 | Ga0209563_1000111085 | 343 |
| 107 | 3300025263 | Ga0209565_1000055 | Ga0209565_100005511 | 343 |
| 108 | 3300025273 | Ga0209673_1000040 | Ga0209673_100004011 | 343 |
| 109 | 3300025291 | Ga0209675_1000052 | Ga0209675_1000052178 | 343 |
| 110 | 3300025295 | Ga0209564_1000271 | Ga0209564_100027112 | 343 |
| 111 | 3300025299 | Ga0209256_1000100 | Ga0209256_1000100178 | 343 |
| 112 | 3300025711 | Ga0207696_1053792 | Ga0207696_10537921 | 343 |
| 113 | 3300025919 | Ga0207657_10008924 | Ga0207657_1000892410 | 343 |
| 114 | 3300027876 | Ga0209974_10051497 | Ga0209974_100514971 | 343 |
| 115 | 3300028786 | Ga0307517_10163511 | Ga0307517_101635112 | 343 |
| 116 | 3300028794 | Ga0307515_10001889 | Ga0307515_1000188916 | 343 |
| 117 | 3300028794 | Ga0307515_10137784 | Ga0307515_101377843 | 343 |
| 118 | 3300031730 | Ga0307516_10000048 | Ga0307516_1000004856 | 343 |
| 119 | 3300031730 | Ga0307516_10002257 | Ga0307516_100022578 | 343 |
| 120 | 3300035691 | Ga0373931_0015826 | Ga0373931_0015826_1224_2255 | 343 |
| 121 | 3300037312 | Ga0395899_0030258 | Ga0395899_0030258_48_1079 | 343 |
| 122 | 3300037471 | Ga0395905_0068537 | Ga0395905_0068537_705_1736 | 343 |
| 123 | 3300039447 | Ga0436361_0865310 | Ga0436361_0865310_549_1580 | 343 |
| 124 | 3300039447 | Ga0436361_1189474 | Ga0436361_1189474_1740_2771 | 343 |
| 125 | 3300041443 | Ga0451789_1013970 | Ga0451789_1013970_894_1925 | 343 |
| 126 | 3300044683 | Ga0466965_0029552 | Ga0466965_0029552_1223_2254 | 343 |
| 127 | 3300044684 | Ga0466966_0029262 | Ga0466966_0029262_2074_3105 | 343 |
| 128 | 3300044842 | Ga0466957_0001920 | Ga0466957_0001920_4350_5381 | 343 |
| 129 | 3300045051 | Ga0451576_0001583 | Ga0451576_0001583_9396_10427 | 343 |
| 130 | 3300046512 | Ga0495610_0000017 | Ga0495610_0000017_8369_9400 | 343 |
| 131 | 3300046519 | Ga0495632_0013833 | Ga0495632_0013833_2224_3255 | 343 |
| 132 | 3300046522 | Ga0495643_0039737 | Ga0495643_0039737_1191_2222 | 343 |
| 133 | 3300046531 | Ga0495665_0034596 | Ga0495665_0034596_729_1760 | 343 |
| 134 | 3300046660 | Ga0495625_0002807 | Ga0495625_0002807_15458_16489 | 343 |
| 135 | 3300047472 | Ga0495686_0065437 | Ga0495686_0065437_337_1368 | 343 |
| 136 | 3300048905 | Ga0496102_0060082 | Ga0496102_0060082_1299_2330 | 343 |
| 137 | 3300048916 | Ga0496113_0009523 | Ga0496113_0009523_5083_6114 | 343 |
| 138 | 3300048925 | Ga0496122_0004616 | Ga0496122_0004616_15270_16301 | 343 |
| 139 | 3300048928 | Ga0496125_0090062 | Ga0496125_0090062_837_1868 | 343 |
| 140 | iso_pu_bacteria | 2643221645 | 2644254524 | 343 |
| 141 | iso_pu_bacteria | 2643221664 | 2644360071 | 343 |
| 142 | iso_pu_bacteria | 2738541280 | 2738742904 | 343 |
| 143 | iso_pu_bacteria | 2738541300 | 2738845992 | 343 |
| 144 | iso_pu_bacteria | 2738543018 | 2739276900 | 343 |
| 145 | iso_pu_bacteria | 2738543030 | 2739345944 | 343 |
| 146 | 3300003773 | Ga0055537_1002871 | Ga0055537_10028715 | 344 |
| 147 | 3300003791 | Ga0055530_10006432 | Ga0055530_100064327 | 344 |
| 148 | 3300005262 | Ga0065165_1004075 | Ga0065165_10040752 | 344 |
| 149 | 3300005328 | Ga0070676_10128521 | Ga0070676_101285212 | 344 |
| 150 | 3300005336 | Ga0070680_100167915 | Ga0070680_1001679151 | 344 |
| 151 | 3300005339 | Ga0070660_100044451 | Ga0070660_1000444511 | 344 |
| 152 | 3300005355 | Ga0070671_100026430 | Ga0070671_1000264306 | 344 |
| 153 | 3300005365 | Ga0070688_100052640 | Ga0070688_1000526403 | 344 |
| 154 | 3300005366 | Ga0070659_100001752 | Ga0070659_10000175210 | 344 |
| 155 | 3300005435 | Ga0070714_100135023 | Ga0070714_1001350232 | 344 |
| 156 | 3300005440 | Ga0070705_100041313 | Ga0070705_1000413132 | 344 |
| 157 | 3300005457 | Ga0070662_100057197 | Ga0070662_1000571973 | 344 |
| 158 | 3300005458 | Ga0070681_10014878 | Ga0070681_100148782 | 344 |
| 159 | 3300005518 | Ga0070699_100021479 | Ga0070699_1000214796 | 344 |
| 160 | 3300005536 | Ga0070697_100149328 | Ga0070697_1001493282 | 344 |
| 161 | 3300005549 | Ga0070704_100129543 | Ga0070704_1001295432 | 344 |
| 162 | 3300005563 | Ga0068855_100249658 | Ga0068855_1002496583 | 344 |
| 163 | 3300005564 | Ga0070664_100003553 | Ga0070664_10000355313 | 344 |
| 164 | 3300005614 | Ga0068856_100317250 | Ga0068856_1003172502 | 344 |
| 165 | 3300005618 | Ga0068864_100032966 | Ga0068864_1000329663 | 344 |
| 166 | 3300005841 | Ga0068863_100067354 | Ga0068863_1000673542 | 344 |
| 167 | 3300005985 | Ga0081539_10000365 | Ga0081539_1000036587 | 344 |
| 168 | 3300006195 | Ga0075366_10066646 | Ga0075366_100666463 | 344 |
| 169 | 3300006914 | Ga0075436_100119909 | Ga0075436_1001199092 | 344 |
| 170 | 3300009094 | Ga0111539_10335889 | Ga0111539_103358892 | 344 |
| 171 | 3300009177 | Ga0105248_10004608 | Ga0105248_1000460813 | 344 |
| 172 | 3300025273 | Ga0209673_1004762 | Ga0209673_100476210 | 344 |
| 173 | 3300025298 | Ga0209050_1000335 | Ga0209050_100033520 | 344 |
| 174 | 3300025299 | Ga0209256_1035264 | Ga0209256_10352642 | 344 |
| 175 | 3300025907 | Ga0207645_10053286 | Ga0207645_100532862 | 344 |
| 176 | 3300025918 | Ga0207662_10109316 | Ga0207662_101093162 | 344 |
| 177 | 3300025919 | Ga0207657_10012688 | Ga0207657_1001268810 | 344 |
| 178 | 3300025920 | Ga0207649_10024118 | Ga0207649_100241182 | 344 |
| 179 | 3300025932 | Ga0207690_10000951 | Ga0207690_1000095113 | 344 |
| 180 | 3300025933 | Ga0207706_10051130 | Ga0207706_100511304 | 344 |
| 181 | 3300025941 | Ga0207711_10036832 | Ga0207711_100368322 | 344 |
| 182 | 3300025942 | Ga0207689_10050545 | Ga0207689_100505453 | 344 |
| 183 | 3300025945 | Ga0207679_10004406 | Ga0207679_100044064 | 344 |
| 184 | 3300026035 | Ga0207703_10187047 | Ga0207703_101870471 | 344 |
| 185 | 3300026089 | Ga0207648_10210122 | Ga0207648_102101222 | 344 |
| 186 | 3300026142 | Ga0207698_10284985 | Ga0207698_102849851 | 344 |
| 187 | 3300030745 | Ga0316182_1156105 | Ga0316182_11561052 | 344 |
| 188 | 3300031548 | Ga0307408_100275698 | Ga0307408_1002756982 | 344 |
| 189 | 3300031911 | Ga0307412_10282814 | Ga0307412_102828142 | 344 |
| 190 | 3300037312 | Ga0395899_0002806 | Ga0395899_0002806_5762_6796 | 344 |
| 191 | 3300037312 | Ga0395899_0018674 | Ga0395899_0018674_1652_2686 | 344 |
| 192 | 3300037418 | Ga0395900_0006506 | Ga0395900_0006506_9085_10119 | 344 |
| 193 | 3300037418 | Ga0395900_0031672 | Ga0395900_0031672_126_1160 | 344 |
| 194 | 3300037418 | Ga0395900_0035466 | Ga0395900_0035466_2623_3657 | 344 |
| 195 | 3300037418 | Ga0395900_0285887 | Ga0395900_0285887_453_1487 | 344 |
| 196 | 3300037418 | Ga0395900_0334820 | Ga0395900_0334820_368_1402 | 344 |
| 197 | 3300037471 | Ga0395905_0027336 | Ga0395905_0027336_4118_5152 | 344 |
| 198 | 3300037471 | Ga0395905_0055914 | Ga0395905_0055914_1919_2953 | 344 |
| 199 | 3300038443 | Ga0395901_0002710 | Ga0395901_0002710_10296_11330 | 344 |
| 200 | 3300038443 | Ga0395901_0002897 | Ga0395901_0002897_9579_10613 | 344 |
| 201 | 3300038443 | Ga0395901_0066242 | Ga0395901_0066242_1806_2840 | 344 |
| 202 | 3300038443 | Ga0395901_0403054 | Ga0395901_0403054_244_1278 | 344 |
| 203 | 3300039447 | Ga0436361_0013073 | Ga0436361_0013073_9447_10481 | 344 |
| 204 | 3300044656 | Ga0466969_0002316 | Ga0466969_0002316_6742_7776 | 344 |
| 205 | 3300044658 | Ga0466972_0003973 | Ga0466972_0003973_2046_3080 | 344 |
| 206 | 3300044658 | Ga0466972_0065816 | Ga0466972_0065816_514_1548 | 344 |
| 207 | 3300044683 | Ga0466965_0036795 | Ga0466965_0036795_1153_2187 | 344 |
| 208 | 3300044684 | Ga0466966_0001854 | Ga0466966_0001854_2220_3254 | 344 |
| 209 | 3300044693 | Ga0466961_0007476 | Ga0466961_0007476_5449_6483 | 344 |
| 210 | 3300044719 | Ga0466971_0008161 | Ga0466971_0008161_1428_2462 | 344 |
| 211 | 3300044735 | Ga0466968_0003902 | Ga0466968_0003902_4195_5229 | 344 |
| 212 | 3300044842 | Ga0466957_0076144 | Ga0466957_0076144_637_1677 | 344 |
| 213 | 3300045049 | Ga0466959_0025858 | Ga0466959_0025858_712_1746 | 344 |
| 214 | 3300045049 | Ga0466959_0068023 | Ga0466959_0068023_698_1732 | 344 |
| 215 | 3300045051 | Ga0451576_0082220 | Ga0451576_0082220_1632_2666 | 344 |
| 216 | 3300046452 | Ga0495617_000022 | Ga0495617_000022_10610_11650 | 344 |
| 217 | 3300046453 | Ga0495627_000398 | Ga0495627_000398_27620_28660 | 344 |
| 218 | 3300046455 | Ga0495603_0046856 | Ga0495603_0046856_21_1055 | 344 |
| 219 | 3300046457 | Ga0495590_0000057 | Ga0495590_0000057_83228_84271 | 344 |
| 220 | 3300046457 | Ga0495590_0005737 | Ga0495590_0005737_801_1835 | 344 |
| 221 | 3300046458 | Ga0495591_000799 | Ga0495591_000799_216_1259 | 344 |
| 222 | 3300046459 | Ga0495629_0041378 | Ga0495629_0041378_329_1363 | 344 |
| 223 | 3300046463 | Ga0495653_0028893 | Ga0495653_0028893_2633_3667 | 344 |
| 224 | 3300046463 | Ga0495653_0062600 | Ga0495653_0062600_829_1863 | 344 |
| 225 | 3300046471 | Ga0495650_0002119 | Ga0495650_0002119_13835_14869 | 344 |
| 226 | 3300046473 | Ga0495582_0027191 | Ga0495582_0027191_573_1607 | 344 |
| 227 | 3300046474 | Ga0495605_0000153 | Ga0495605_0000153_77306_78346 | 344 |
| 228 | 3300046474 | Ga0495605_0037236 | Ga0495605_0037236_737_1771 | 344 |
| 229 | 3300046491 | Ga0495584_0000729 | Ga0495584_0000729_9195_10238 | 344 |
| 230 | 3300046491 | Ga0495584_0009911 | Ga0495584_0009911_961_1995 | 344 |
| 231 | 3300046492 | Ga0495585_0022247 | Ga0495585_0022247_339_1382 | 344 |
| 232 | 3300046492 | Ga0495585_0065031 | Ga0495585_0065031_915_1955 | 344 |
| 233 | 3300046492 | Ga0495585_0142084 | Ga0495585_0142084_93_1127 | 344 |
| 234 | 3300046499 | Ga0495594_0068128 | Ga0495594_0068128_624_1658 | 344 |
| 235 | 3300046500 | Ga0495596_0001270 | Ga0495596_0001270_871_1905 | 344 |
| 236 | 3300046500 | Ga0495596_0019014 | Ga0495596_0019014_536_1579 | 344 |
| 237 | 3300046500 | Ga0495596_0039062 | Ga0495596_0039062_776_1810 | 344 |
| 238 | 3300046506 | Ga0495583_0000106 | Ga0495583_0000106_8244_9278 | 344 |
| 239 | 3300046506 | Ga0495583_0000597 | Ga0495583_0000597_33419_34453 | 344 |
| 240 | 3300046507 | Ga0495606_0086803 | Ga0495606_0086803_115_1149 | 344 |
| 241 | 3300046512 | Ga0495610_0043732 | Ga0495610_0043732_466_1509 | 344 |
| 242 | 3300046513 | Ga0495616_0002388 | Ga0495616_0002388_2255_3289 | 344 |
| 243 | 3300046513 | Ga0495616_0018885 | Ga0495616_0018885_626_1660 | 344 |
| 244 | 3300046513 | Ga0495616_0029168 | Ga0495616_0029168_300_1334 | 344 |
| 245 | 3300046513 | Ga0495616_0034548 | Ga0495616_0034548_299_1333 | 344 |
| 246 | 3300046518 | Ga0495631_0001332 | Ga0495631_0001332_7801_8841 | 344 |
| 247 | 3300046518 | Ga0495631_0001436 | Ga0495631_0001436_5323_6357 | 344 |
| 248 | 3300046518 | Ga0495631_0023308 | Ga0495631_0023308_155_1189 | 344 |
| 249 | 3300046518 | Ga0495631_0065120 | Ga0495631_0065120_441_1475 | 344 |
| 250 | 3300046519 | Ga0495632_0000052 | Ga0495632_0000052_123429_124463 | 344 |
| 251 | 3300046519 | Ga0495632_0000396 | Ga0495632_0000396_38675_39709 | 344 |
| 252 | 3300046519 | Ga0495632_0001555 | Ga0495632_0001555_9085_10119 | 344 |
| 253 | 3300046519 | Ga0495632_0003734 | Ga0495632_0003734_6334_7368 | 344 |
| 254 | 3300046519 | Ga0495632_0012494 | Ga0495632_0012494_49_1092 | 344 |
| 255 | 3300046520 | Ga0495637_0000018 | Ga0495637_0000018_9274_10317 | 344 |
| 256 | 3300046522 | Ga0495643_0025569 | Ga0495643_0025569_265_1308 | 344 |
| 257 | 3300046523 | Ga0495644_0003935 | Ga0495644_0003935_4170_5210 | 344 |
| 258 | 3300046524 | Ga0495648_0015868 | Ga0495648_0015868_3668_4708 | 344 |
| 259 | 3300046526 | Ga0495666_0007557 | Ga0495666_0007557_3617_4651 | 344 |
| 260 | 3300046528 | Ga0495642_0000529 | Ga0495642_0000529_10597_11637 | 344 |
| 261 | 3300046528 | Ga0495642_0002545 | Ga0495642_0002545_4073_5107 | 344 |
| 262 | 3300046528 | Ga0495642_0042536 | Ga0495642_0042536_327_1361 | 344 |
| 263 | 3300046530 | Ga0495654_0021405 | Ga0495654_0021405_597_1631 | 344 |
| 264 | 3300046530 | Ga0495654_0031775 | Ga0495654_0031775_1187_2227 | 344 |
| 265 | 3300046536 | Ga0495587_0051879 | Ga0495587_0051879_1203_2237 | 344 |
| 266 | 3300046537 | Ga0495598_0015527 | Ga0495598_0015527_235_1269 | 344 |
| 267 | 3300046542 | Ga0495597_0001411 | Ga0495597_0001411_8215_9249 | 344 |
| 268 | 3300046542 | Ga0495597_0002378 | Ga0495597_0002378_7621_8655 | 344 |
| 269 | 3300046542 | Ga0495597_0022362 | Ga0495597_0022362_516_1550 | 344 |
| 270 | 3300046558 | Ga0495633_0003343 | Ga0495633_0003343_9274_10317 | 344 |
| 271 | 3300046558 | Ga0495633_0059388 | Ga0495633_0059388_700_1734 | 344 |
| 272 | 3300046616 | Ga0495668_0000211 | Ga0495668_0000211_4845_5879 | 344 |
| 273 | 3300046616 | Ga0495668_0097325 | Ga0495668_0097325_472_1506 | 344 |
| 274 | 3300046648 | Ga0495611_0001030 | Ga0495611_0001030_8428_9471 | 344 |
| 275 | 3300046648 | Ga0495611_0006487 | Ga0495611_0006487_1863_2897 | 344 |
| 276 | 3300046648 | Ga0495611_0024927 | Ga0495611_0024927_639_1673 | 344 |
| 277 | 3300046665 | Ga0495661_0014026 | Ga0495661_0014026_2854_3888 | 344 |
| 278 | 3300046665 | Ga0495661_0146768 | Ga0495661_0146768_66_1106 | 344 |
| 279 | 3300046674 | Ga0495588_0056552 | Ga0495588_0056552_141_1175 | 344 |
| 280 | 3300046684 | Ga0495669_0000101 | Ga0495669_0000101_43205_44239 | 344 |
| 281 | 3300046684 | Ga0495669_0001145 | Ga0495669_0001145_598_1632 | 344 |
| 282 | 3300046689 | Ga0495613_0026824 | Ga0495613_0026824_2436_3470 | 344 |
| 283 | 3300046691 | Ga0495670_0045941 | Ga0495670_0045941_867_1901 | 344 |
| 284 | 3300046692 | Ga0495671_0003330 | Ga0495671_0003330_8706_9740 | 344 |
| 285 | 3300046692 | Ga0495671_0038095 | Ga0495671_0038095_914_1954 | 344 |
| 286 | 3300046694 | Ga0495649_0000194 | Ga0495649_0000194_43205_44239 | 344 |
| 287 | 3300046794 | Ga0495589_0001516 | Ga0495589_0001516_456_1496 | 344 |
| 288 | 3300047317 | Ga0495604_0053804 | Ga0495604_0053804_666_1700 | 344 |
| 289 | 3300047318 | Ga0495636_0004254 | Ga0495636_0004254_3182_4216 | 344 |
| 290 | 3300047318 | Ga0495636_0011954 | Ga0495636_0011954_2257_3291 | 344 |
| 291 | 3300047320 | Ga0495672_0000013 | Ga0495672_0000013_500549_501583 | 344 |
| 292 | 3300047320 | Ga0495672_0000064 | Ga0495672_0000064_193650_194693 | 344 |
| 293 | 3300047320 | Ga0495672_0000512 | Ga0495672_0000512_2393_3427 | 344 |
| 294 | 3300047321 | Ga0495676_0000015 | Ga0495676_0000015_9608_10642 | 344 |
| 295 | 3300047322 | Ga0495680_0058066 | Ga0495680_0058066_1374_2408 | 344 |
| 296 | 3300047323 | Ga0495683_0035949 | Ga0495683_0035949_1008_2051 | 344 |
| 297 | 3300047443 | Ga0495687_001055 | Ga0495687_001055_7969_9003 | 344 |
| 298 | 3300047443 | Ga0495687_001122 | Ga0495687_001122_9562_10602 | 344 |
| 299 | 3300047445 | Ga0495677_0000948 | Ga0495677_0000948_9461_10504 | 344 |
| 300 | 3300047445 | Ga0495677_0005995 | Ga0495677_0005995_3289_4323 | 344 |
| 301 | 3300047446 | Ga0495679_001332 | Ga0495679_001332_5603_6637 | 344 |
| 302 | 3300047472 | Ga0495686_0000620 | Ga0495686_0000620_2324_3358 | 344 |
| 303 | 3300048090 | Ga0495615_0004412 | Ga0495615_0004412_1022_2056 | 344 |
| 304 | 3300048091 | Ga0495626_0001757 | Ga0495626_0001757_8898_9941 | 344 |
| 305 | 3300048091 | Ga0495626_0021084 | Ga0495626_0021084_2081_3115 | 344 |
| 306 | 3300048091 | Ga0495626_0023637 | Ga0495626_0023637_10_1044 | 344 |
| 307 | 3300048091 | Ga0495626_0052127 | Ga0495626_0052127_770_1804 | 344 |
| 308 | 3300048905 | Ga0496102_0000068 | Ga0496102_0000068_154749_155789 | 344 |
| 309 | 3300048905 | Ga0496102_0000478 | Ga0496102_0000478_34827_35861 | 344 |
| 310 | 3300048905 | Ga0496102_0008640 | Ga0496102_0008640_7118_8152 | 344 |
| 311 | 3300048905 | Ga0496102_0017344 | Ga0496102_0017344_540_1574 | 344 |
| 312 | 3300048906 | Ga0496103_0039346 | Ga0496103_0039346_1431_2465 | 344 |
| 313 | 3300048907 | Ga0496104_0247654 | Ga0496104_0247654_263_1297 | 344 |
| 314 | 3300048910 | Ga0496107_0131596 | Ga0496107_0131596_61_1095 | 344 |
| 315 | 3300048911 | Ga0496108_0232857 | Ga0496108_0232857_240_1280 | 344 |
| 316 | 3300048911 | Ga0496108_0248307 | Ga0496108_0248307_345_1385 | 344 |
| 317 | 3300048913 | Ga0496110_0000092 | Ga0496110_0000092_37167_38201 | 344 |
| 318 | 3300048914 | Ga0496111_0085754 | Ga0496111_0085754_394_1428 | 344 |
| 319 | 3300048914 | Ga0496111_0104260 | Ga0496111_0104260_727_1767 | 344 |
| 320 | 3300048915 | Ga0496112_0012572 | Ga0496112_0012572_2314_3348 | 344 |
| 321 | 3300048924 | Ga0496121_0282190 | Ga0496121_0282190_82_1116 | 344 |
| 322 | 3300048926 | Ga0496123_0000084 | Ga0496123_0000084_176940_177974 | 344 |
| 323 | 3300048928 | Ga0496125_0002558 | Ga0496125_0002558_209_1243 | 344 |
| 324 | 3300049459 | Ga0495678_000034 | Ga0495678_000034_9249_10292 | 344 |
| 325 | 3300049459 | Ga0495678_000383 | Ga0495678_000383_8178_9212 | 344 |
| 326 | 3300049459 | Ga0495678_001376 | Ga0495678_001376_9534_10568 | 344 |
| 327 | 3300049568 | Ga0501031_0164943 | Ga0501031_0164943_263_1297 | 344 |
| 328 | 3300049571 | Ga0501034_0015538 | Ga0501034_0015538_1547_2584 | 344 |
| 329 | 3300049572 | Ga0501036_0005297 | Ga0501036_0005297_8728_9762 | 344 |
| 330 | 3300049574 | Ga0501038_0242228 | Ga0501038_0242228_281_1315 | 344 |
| 331 | 3300049576 | Ga0501040_0004246 | Ga0501040_0004246_7744_8778 | 344 |
| 332 | 3300049577 | Ga0501041_0000171 | Ga0501041_0000171_16391_17425 | 344 |
| 333 | 3300049577 | Ga0501041_0187064 | Ga0501041_0187064_253_1287 | 344 |
| 334 | 3300049579 | Ga0501043_0070467 | Ga0501043_0070467_664_1698 | 344 |
| 335 | 3300049582 | Ga0501048_0002988 | Ga0501048_0002988_10971_12005 | 344 |
| 336 | 3300049587 | Ga0501071_0075261 | Ga0501071_0075261_839_1873 | 344 |
| 337 | 3300049588 | Ga0501072_0002668 | Ga0501072_0002668_11749_12783 | 344 |
| 338 | 3300049589 | Ga0501073_0235668 | Ga0501073_0235668_81_1115 | 344 |
| 339 | 3300049591 | Ga0501075_0006883 | Ga0501075_0006883_2029_3063 | 344 |
| 340 | 3300049592 | Ga0501076_0003325 | Ga0501076_0003325_3719_4753 | 344 |
| 341 | 3300049741 | Ga0501079_0046536 | Ga0501079_0046536_2202_3236 | 344 |
| 342 | 3300049743 | Ga0501081_0000857 | Ga0501081_0000857_15098_16132 | 344 |
| 343 | 3300049822 | Ga0501035_0006010 | Ga0501035_0006010_6704_7738 | 344 |
| 344 | 3300050493 | nmdc:mga0k408_49769_c1 | nmdc:mga0k408_49769_c1_138_1172 | 344 |
| 345 | 3300050514 | nmdc:mga08x19_17547_c1 | nmdc:mga08x19_17547_c1_2404_3438 | 344 |
| 346 | 3300050514 | nmdc:mga08x19_49650_c1 | nmdc:mga08x19_49650_c1_453_1487 | 344 |
| 347 | 3300053086 | Ga0500578_0000067 | Ga0500578_0000067_111672_112706 | 344 |
| 348 | 3300053724 | Ga0500570_079924 | Ga0500570_079924_402_1436 | 344 |
| 349 | 3300054114 | Ga0501084_0013441 | Ga0501084_0013441_795_1829 | 344 |
| 350 | 3300060353 | Ga0501082_0002703 | Ga0501082_0002703_400_1434 | 344 |
| 351 | 3300061719 | Ga0466962_0015221 | Ga0466962_0015221_2124_3158 | 344 |
| 352 | 3300061734 | Ga0530510_0001659 | Ga0530510_0001659_11797_12831 | 344 |
| 353 | 3300002704 | JGI25155J39150_1000485 | JGI25155J39150_10004852 | 345 |
| 354 | 3300002705 | JGI25156J39149_1000063 | JGI25156J39149_10000637 | 345 |
| 355 | 3300002738 | JGI25154J39366_1000412 | JGI25154J39366_10004127 | 345 |
| 356 | 3300002738 | JGI25154J39366_1000845 | JGI25154J39366_10008457 | 345 |
| 357 | 3300002738 | JGI25154J39366_1001209 | JGI25154J39366_10012099 | 345 |
| 358 | 3300002738 | JGI25154J39366_1002200 | JGI25154J39366_10022002 | 345 |
| 359 | 3300002739 | JGI25158J39367_1003079 | JGI25158J39367_10030792 | 345 |
| 360 | 3300002741 | JGI25157J39369_1000082 | JGI25157J39369_100008266 | 345 |
| 361 | 3300002773 | JGI25152J39213_1000953 | JGI25152J39213_100095313 | 345 |
| 362 | 3300002774 | JGI25150J39212_1000910 | JGI25150J39212_10009105 | 345 |
| 363 | 3300002774 | JGI25150J39212_1003626 | JGI25150J39212_10036262 | 345 |
| 364 | 3300002987 | JGI25159J45721_1002200 | JGI25159J45721_10022004 | 345 |
| 365 | 3300003215 | JGI25153J46596_10018531 | JGI25153J46596_100185312 | 345 |
| 366 | 3300003354 | JGI25160J50197_1003453 | JGI25160J50197_10034531 | 345 |
| 367 | 3300003751 | Ga0055538_1000062 | Ga0055538_100006283 | 345 |
| 368 | 3300003752 | Ga0055539_1000093 | Ga0055539_100009383 | 345 |
| 369 | 3300003752 | Ga0055539_1000303 | Ga0055539_100030321 | 345 |
| 370 | 3300003752 | Ga0055539_1000782 | Ga0055539_10007823 | 345 |
| 371 | 3300003756 | Ga0055533_1000043 | Ga0055533_1000043153 | 345 |
| 372 | 3300003756 | Ga0055533_1000105 | Ga0055533_100010583 | 345 |
| 373 | 3300003759 | Ga0055525_1000137 | Ga0055525_100013783 | 345 |
| 374 | 3300003759 | Ga0055525_1001495 | Ga0055525_10014957 | 345 |
| 375 | 3300003761 | Ga0055535_1000859 | Ga0055535_10008597 | 345 |
| 376 | 3300003763 | Ga0055529_1000152 | Ga0055529_100015211 | 345 |
| 377 | 3300003763 | Ga0055529_1000725 | Ga0055529_10007257 | 345 |
| 378 | 3300003771 | Ga0055526_1000079 | Ga0055526_100007972 | 345 |
| 379 | 3300003771 | Ga0055526_1000690 | Ga0055526_100069022 | 345 |
| 380 | 3300003775 | Ga0055524_1000237 | Ga0055524_10002378 | 345 |
| 381 | 3300003775 | Ga0055524_1000899 | Ga0055524_100089910 | 345 |
| 382 | 3300003775 | Ga0055524_1001534 | Ga0055524_100153412 | 345 |
| 383 | 3300003775 | Ga0055524_1003281 | Ga0055524_10032811 | 345 |
| 384 | 3300003790 | Ga0055528_1002751 | Ga0055528_10027514 | 345 |
| 385 | 3300003791 | Ga0055530_10005914 | Ga0055530_100059146 | 345 |
| 386 | 3300003791 | Ga0055530_10006075 | Ga0055530_100060755 | 345 |
| 387 | 3300003791 | Ga0055530_10023984 | Ga0055530_100239842 | 345 |
| 388 | 3300003794 | Ga0055531_10020369 | Ga0055531_100203692 | 345 |
| 389 | 3300003794 | Ga0055531_10034762 | Ga0055531_100347622 | 345 |
| 390 | 3300003841 | Ga0055541_1000063 | Ga0055541_100006383 | 345 |
| 391 | 3300004625 | Ga0055543_1001129 | Ga0055543_10011291 | 345 |
| 392 | 3300004625 | Ga0055543_1003826 | Ga0055543_10038263 | 345 |
| 393 | 3300005262 | Ga0065165_1002857 | Ga0065165_10028575 | 345 |
| 394 | 3300005262 | Ga0065165_1003337 | Ga0065165_10033371 | 345 |
| 395 | 3300005327 | Ga0070658_10124620 | Ga0070658_101246202 | 345 |
| 396 | 3300005330 | Ga0070690_100037236 | Ga0070690_1000372363 | 345 |
| 397 | 3300005331 | Ga0070670_100086718 | Ga0070670_1000867183 | 345 |
| 398 | 3300005364 | Ga0070673_100032700 | Ga0070673_1000327003 | 345 |
| 399 | 3300005563 | Ga0068855_100009264 | Ga0068855_1000092642 | 345 |
| 400 | 3300005563 | Ga0068855_100035272 | Ga0068855_1000352727 | 345 |
| 401 | 3300005563 | Ga0068855_100062362 | Ga0068855_1000623624 | 345 |
| 402 | 3300005563 | Ga0068855_100120182 | Ga0068855_1001201822 | 345 |
| 403 | 3300005563 | Ga0068855_100317591 | Ga0068855_1003175912 | 345 |
| 404 | 3300005577 | Ga0068857_100004849 | Ga0068857_1000048497 | 345 |
| 405 | 3300005577 | Ga0068857_100367839 | Ga0068857_1003678392 | 345 |
| 406 | 3300005578 | Ga0068854_100017165 | Ga0068854_1000171653 | 345 |
| 407 | 3300005578 | Ga0068854_100119599 | Ga0068854_1001195992 | 345 |
| 408 | 3300005614 | Ga0068856_100002505 | Ga0068856_10000250514 | 345 |
| 409 | 3300005616 | Ga0068852_100004430 | Ga0068852_1000044305 | 345 |
| 410 | 3300005719 | Ga0068861_100036671 | Ga0068861_1000366717 | 345 |
| 411 | 3300005844 | Ga0068862_100019436 | Ga0068862_1000194364 | 345 |
| 412 | 3300006195 | Ga0075366_10019447 | Ga0075366_100194472 | 345 |
| 413 | 3300006353 | Ga0075370_10011458 | Ga0075370_100114587 | 345 |
| 414 | 3300006844 | Ga0075428_100301946 | Ga0075428_1003019462 | 345 |
| 415 | 3300006846 | Ga0075430_100179064 | Ga0075430_1001790642 | 345 |
| 416 | 3300006847 | Ga0075431_100226597 | Ga0075431_1002265972 | 345 |
| 417 | 3300006881 | Ga0068865_100001729 | Ga0068865_1000017295 | 345 |
| 418 | 3300006946 | Ga0079104_1000012 | Ga0079104_1000012319 | 345 |
| 419 | 3300006946 | Ga0079104_1005592 | Ga0079104_10055924 | 345 |
| 420 | 3300006948 | Ga0099826_10000010 | Ga0099826_1000001011 | 345 |
| 421 | 3300007265 | Ga0099794_10016101 | Ga0099794_100161013 | 345 |
| 422 | 3300009036 | Ga0105244_10003441 | Ga0105244_1000344110 | 345 |
| 423 | 3300009036 | Ga0105244_10035827 | Ga0105244_100358273 | 345 |
| 424 | 3300009093 | Ga0105240_10016336 | Ga0105240_100163363 | 345 |
| 425 | 3300009093 | Ga0105240_10158169 | Ga0105240_101581692 | 345 |
| 426 | 3300009093 | Ga0105240_10161523 | Ga0105240_101615232 | 345 |
| 427 | 3300009093 | Ga0105240_10190542 | Ga0105240_101905422 | 345 |
| 428 | 3300009147 | Ga0114129_10589096 | Ga0114129_105890962 | 345 |
| 429 | 3300009545 | Ga0105237_10010944 | Ga0105237_100109443 | 345 |
| 430 | 3300009545 | Ga0105237_10359562 | Ga0105237_103595621 | 345 |
| 431 | 3300009551 | Ga0105238_10000763 | Ga0105238_1000076310 | 345 |
| 432 | 3300010375 | Ga0105239_10010387 | Ga0105239_1001038710 | 345 |
| 433 | 3300011119 | Ga0105246_10023704 | Ga0105246_100237042 | 345 |
| 434 | 3300013102 | Ga0157371_10000018 | Ga0157371_1000001812 | 345 |
| 435 | 3300013105 | Ga0157369_10019171 | Ga0157369_100191715 | 345 |
| 436 | 3300013297 | Ga0157378_10007501 | Ga0157378_1000750111 | 345 |
| 437 | 3300015261 | Ga0182006_1000080 | Ga0182006_100008018 | 345 |
| 438 | 3300015262 | Ga0182007_10005353 | Ga0182007_100053534 | 345 |
| 439 | 3300015262 | Ga0182007_10021481 | Ga0182007_100214812 | 345 |
| 440 | 3300015265 | Ga0182005_1000016 | Ga0182005_100001617 | 345 |
| 441 | 3300017792 | Ga0163161_10012023 | Ga0163161_100120232 | 345 |
| 442 | 3300017792 | Ga0163161_10012229 | Ga0163161_100122293 | 345 |
| 443 | 3300021361 | Ga0213872_10047661 | Ga0213872_100476612 | 345 |
| 444 | 3300021361 | Ga0213872_10049654 | Ga0213872_100496542 | 345 |
| 445 | 3300025206 | Ga0209435_100176 | Ga0209435_1001762 | 345 |
| 446 | 3300025208 | Ga0209436_100769 | Ga0209436_10076913 | 345 |
| 447 | 3300025208 | Ga0209436_104031 | Ga0209436_1040314 | 345 |
| 448 | 3300025224 | Ga0209784_100021 | Ga0209784_100021373 | 345 |
| 449 | 3300025225 | Ga0209566_100119 | Ga0209566_1001199 | 345 |
| 450 | 3300025226 | Ga0209674_100036 | Ga0209674_100036373 | 345 |
| 451 | 3300025226 | Ga0209674_100067 | Ga0209674_100067154 | 345 |
| 452 | 3300025230 | Ga0209563_100040 | Ga0209563_100040373 | 345 |
| 453 | 3300025230 | Ga0209563_100068 | Ga0209563_100068154 | 345 |
| 454 | 3300025231 | Ga0207427_101402 | Ga0207427_1014022 | 345 |
| 455 | 3300025233 | Ga0209437_100332 | Ga0209437_10033210 | 345 |
| 456 | 3300025242 | Ga0209258_100129 | Ga0209258_1001297 | 345 |
| 457 | 3300025242 | Ga0209258_101777 | Ga0209258_1017775 | 345 |
| 458 | 3300025245 | Ga0207425_1000021 | Ga0207425_1000021347 | 345 |
| 459 | 3300025245 | Ga0207425_1000050 | Ga0207425_1000050165 | 345 |
| 460 | 3300025245 | Ga0207425_1000829 | Ga0207425_10008297 | 345 |
| 461 | 3300025246 | Ga0209646_1000107 | Ga0209646_1000107138 | 345 |
| 462 | 3300025246 | Ga0209646_1000190 | Ga0209646_100019052 | 345 |
| 463 | 3300025246 | Ga0209646_1000244 | Ga0209646_10002447 | 345 |
| 464 | 3300025250 | Ga0209026_1000004 | Ga0209026_1000004718 | 345 |
| 465 | 3300025253 | Ga0209677_100023 | Ga0209677_100023373 | 345 |
| 466 | 3300025253 | Ga0209677_100049 | Ga0209677_1000497 | 345 |
| 467 | 3300025253 | Ga0209677_100413 | Ga0209677_1004134 | 345 |
| 468 | 3300025256 | Ga0209759_1000003 | Ga0209759_10000037 | 345 |
| 469 | 3300025256 | Ga0209759_1000198 | Ga0209759_100019882 | 345 |
| 470 | 3300025256 | Ga0209759_1003928 | Ga0209759_10039283 | 345 |
| 471 | 3300025256 | Ga0209759_1004764 | Ga0209759_10047644 | 345 |
| 472 | 3300025256 | Ga0209759_1020166 | Ga0209759_10201662 | 345 |
| 473 | 3300025258 | Ga0209129_1000020 | Ga0209129_1000020418 | 345 |
| 474 | 3300025263 | Ga0209565_1000677 | Ga0209565_100067713 | 345 |
| 475 | 3300025263 | Ga0209565_1011047 | Ga0209565_10110471 | 345 |
| 476 | 3300025272 | Ga0209455_1000070 | Ga0209455_100007012 | 345 |
| 477 | 3300025272 | Ga0209455_1000083 | Ga0209455_1000083148 | 345 |
| 478 | 3300025273 | Ga0209673_1003338 | Ga0209673_10033386 | 345 |
| 479 | 3300025284 | Ga0209130_1000169 | Ga0209130_100016982 | 345 |
| 480 | 3300025284 | Ga0209130_1002260 | Ga0209130_100226013 | 345 |
| 481 | 3300025284 | Ga0209130_1006585 | Ga0209130_10065854 | 345 |
| 482 | 3300025291 | Ga0209675_1001299 | Ga0209675_10012993 | 345 |
| 483 | 3300025294 | Ga0209025_1001876 | Ga0209025_100187617 | 345 |
| 484 | 3300025295 | Ga0209564_1000027 | Ga0209564_100002713 | 345 |
| 485 | 3300025295 | Ga0209564_1000047 | Ga0209564_1000047316 | 345 |
| 486 | 3300025295 | Ga0209564_1000063 | Ga0209564_100006310 | 345 |
| 487 | 3300025295 | Ga0209564_1001666 | Ga0209564_100166613 | 345 |
| 488 | 3300025297 | Ga0209758_1000288 | Ga0209758_100028885 | 345 |
| 489 | 3300025297 | Ga0209758_1000436 | Ga0209758_100043610 | 345 |
| 490 | 3300025298 | Ga0209050_1000050 | Ga0209050_1000050348 | 345 |
| 491 | 3300025298 | Ga0209050_1001698 | Ga0209050_100169820 | 345 |
| 492 | 3300025299 | Ga0209256_1000045 | Ga0209256_1000045271 | 345 |
| 493 | 3300025299 | Ga0209256_1000054 | Ga0209256_100005412 | 345 |
| 494 | 3300025299 | Ga0209256_1000079 | Ga0209256_1000079207 | 345 |
| 495 | 3300025299 | Ga0209256_1000754 | Ga0209256_100075412 | 345 |
| 496 | 3300025299 | Ga0209256_1001531 | Ga0209256_10015312 | 345 |
| 497 | 3300025302 | Ga0207426_1003112 | Ga0207426_10031122 | 345 |
| 498 | 3300025303 | Ga0209051_1028245 | Ga0209051_10282453 | 345 |
| 499 | 3300025304 | Ga0209257_1001336 | Ga0209257_100133627 | 345 |
| 500 | 3300025728 | Ga0207655_1001651 | Ga0207655_100165112 | 345 |
| 501 | 3300025735 | Ga0207713_1064026 | Ga0207713_10640262 | 345 |
| 502 | 3300025913 | Ga0207695_10008939 | Ga0207695_100089399 | 345 |
| 503 | 3300025913 | Ga0207695_10012318 | Ga0207695_100123182 | 345 |
| 504 | 3300025913 | Ga0207695_10025241 | Ga0207695_100252412 | 345 |
| 505 | 3300025913 | Ga0207695_10070196 | Ga0207695_100701964 | 345 |
| 506 | 3300025913 | Ga0207695_10136114 | Ga0207695_101361142 | 345 |
| 507 | 3300025914 | Ga0207671_10004652 | Ga0207671_100046529 | 345 |
| 508 | 3300025914 | Ga0207671_10092910 | Ga0207671_100929102 | 345 |
| 509 | 3300025924 | Ga0207694_10000343 | Ga0207694_100003433 | 345 |
| 510 | 3300025925 | Ga0207650_10063319 | Ga0207650_100633193 | 345 |
| 511 | 3300025935 | Ga0207709_10039485 | Ga0207709_100394853 | 345 |
| 512 | 3300025938 | Ga0207704_10018780 | Ga0207704_100187803 | 345 |
| 513 | 3300025942 | Ga0207689_10018288 | Ga0207689_100182882 | 345 |
| 514 | 3300025949 | Ga0207667_10000912 | Ga0207667_1000091210 | 345 |
| 515 | 3300025949 | Ga0207667_10007366 | Ga0207667_100073662 | 345 |
| 516 | 3300025949 | Ga0207667_10041134 | Ga0207667_100411347 | 345 |
| 517 | 3300025949 | Ga0207667_10067556 | Ga0207667_100675564 | 345 |
| 518 | 3300025949 | Ga0207667_10098677 | Ga0207667_100986772 | 345 |
| 519 | 3300025949 | Ga0207667_10228908 | Ga0207667_102289082 | 345 |
| 520 | 3300025960 | Ga0207651_10014547 | Ga0207651_100145477 | 345 |
| 521 | 3300025981 | Ga0207640_10041316 | Ga0207640_100413163 | 345 |
| 522 | 3300025981 | Ga0207640_10074203 | Ga0207640_100742033 | 345 |
| 523 | 3300026078 | Ga0207702_10001231 | Ga0207702_1000123116 | 345 |
| 524 | 3300026116 | Ga0207674_10090346 | Ga0207674_100903462 | 345 |
| 525 | 3300027111 | Ga0209281_1000039 | Ga0209281_10000398 | 345 |
| 526 | 3300027666 | Ga0209282_1000009 | Ga0209282_100000911 | 345 |
| 527 | 3300027682 | Ga0209971_1014001 | Ga0209971_10140012 | 345 |
| 528 | 3300028380 | Ga0268265_10009579 | Ga0268265_1000957910 | 345 |
| 529 | 3300028381 | Ga0268264_10084747 | Ga0268264_100847473 | 345 |
| 530 | 3300028666 | Ga0265336_10000371 | Ga0265336_100003713 | 345 |
| 531 | 3300028794 | Ga0307515_10062795 | Ga0307515_100627957 | 345 |
| 532 | 3300028794 | Ga0307515_10209697 | Ga0307515_102096972 | 345 |
| 533 | 3300029957 | Ga0265324_10004594 | Ga0265324_100045948 | 345 |
| 534 | 3300029957 | Ga0265324_10026135 | Ga0265324_100261353 | 345 |
| 535 | 3300030744 | Ga0316181_1137224 | Ga0316181_11372243 | 345 |
| 536 | 3300031235 | Ga0265330_10009515 | Ga0265330_100095154 | 345 |
| 537 | 3300031238 | Ga0265332_10000253 | Ga0265332_1000025329 | 345 |
| 538 | 3300031241 | Ga0265325_10006633 | Ga0265325_100066335 | 345 |
| 539 | 3300031242 | Ga0265329_10001506 | Ga0265329_1000150612 | 345 |
| 540 | 3300031250 | Ga0265331_10004185 | Ga0265331_1000418510 | 345 |
| 541 | 3300031251 | Ga0265327_10020732 | Ga0265327_100207323 | 345 |
| 542 | 3300031344 | Ga0265316_10114733 | Ga0265316_101147332 | 345 |
| 543 | 3300031548 | Ga0307408_100000432 | Ga0307408_10000043228 | 345 |
| 544 | 3300031548 | Ga0307408_100002407 | Ga0307408_1000024074 | 345 |
| 545 | 3300031548 | Ga0307408_100010617 | Ga0307408_1000106173 | 345 |
| 546 | 3300031548 | Ga0307408_100227442 | Ga0307408_1002274422 | 345 |
| 547 | 3300031548 | Ga0307408_100253356 | Ga0307408_1002533562 | 345 |
| 548 | 3300031711 | Ga0265314_10008929 | Ga0265314_100089298 | 345 |
| 549 | 3300031711 | Ga0265314_10017740 | Ga0265314_100177402 | 345 |
| 550 | 3300031730 | Ga0307516_10030751 | Ga0307516_100307513 | 345 |
| 551 | 3300032002 | Ga0307416_100000975 | Ga0307416_10000097510 | 345 |
| 552 | 3300035083 | Ga0373926_0010863 | Ga0373926_0010863_876_1916 | 345 |
| 553 | 3300037312 | Ga0395899_0179380 | Ga0395899_0179380_239_1276 | 345 |
| 554 | 3300037418 | Ga0395900_0000904 | Ga0395900_0000904_35677_36714 | 345 |
| 555 | 3300037466 | Ga0395898_0001196 | Ga0395898_0001196_2389_3426 | 345 |
| 556 | 3300037471 | Ga0395905_0010442 | Ga0395905_0010442_275_1312 | 345 |
| 557 | 3300037471 | Ga0395905_0021728 | Ga0395905_0021728_1120_2157 | 345 |
| 558 | 3300037471 | Ga0395905_0036632 | Ga0395905_0036632_2508_3557 | 345 |
| 559 | 3300038443 | Ga0395901_0005821 | Ga0395901_0005821_9286_10323 | 345 |
| 560 | 3300039447 | Ga0436361_0303014 | Ga0436361_0303014_3587_4624 | 345 |
| 561 | 3300039447 | Ga0436361_0314274 | Ga0436361_0314274_661_1698 | 345 |
| 562 | 3300039447 | Ga0436361_0930389 | Ga0436361_0930389_3768_4805 | 345 |
| 563 | 3300039447 | Ga0436361_1142583 | Ga0436361_1142583_1075_2112 | 345 |
| 564 | 3300042436 | Ga0439435_0028631 | Ga0439435_0028631_200_1237 | 345 |
| 565 | 3300042461 | Ga0439460_0011810 | Ga0439460_0011810_285_1322 | 345 |
| 566 | 3300042876 | Ga0451577_0070287 | Ga0451577_0070287_1674_2711 | 345 |
| 567 | 3300044656 | Ga0466969_0007117 | Ga0466969_0007117_857_1894 | 345 |
| 568 | 3300044658 | Ga0466972_0000420 | Ga0466972_0000420_7980_9017 | 345 |
| 569 | 3300044658 | Ga0466972_0011040 | Ga0466972_0011040_50_1087 | 345 |
| 570 | 3300044683 | Ga0466965_0002121 | Ga0466965_0002121_3367_4404 | 345 |
| 571 | 3300044683 | Ga0466965_0019993 | Ga0466965_0019993_337_1374 | 345 |
| 572 | 3300044683 | Ga0466965_0020012 | Ga0466965_0020012_268_1305 | 345 |
| 573 | 3300044684 | Ga0466966_0029228 | Ga0466966_0029228_1531_2568 | 345 |
| 574 | 3300044693 | Ga0466961_0027488 | Ga0466961_0027488_1318_2355 | 345 |
| 575 | 3300044706 | Ga0466964_0004187 | Ga0466964_0004187_2077_3114 | 345 |
| 576 | 3300044706 | Ga0466964_0045872 | Ga0466964_0045872_402_1439 | 345 |
| 577 | 3300044719 | Ga0466971_0018165 | Ga0466971_0018165_336_1373 | 345 |
| 578 | 3300044765 | Ga0466970_0002134 | Ga0466970_0002134_1319_2356 | 345 |
| 579 | 3300044842 | Ga0466957_0015104 | Ga0466957_0015104_1703_2740 | 345 |
| 580 | 3300044842 | Ga0466957_0133066 | Ga0466957_0133066_152_1189 | 345 |
| 581 | 3300045049 | Ga0466959_0001954 | Ga0466959_0001954_9748_10785 | 345 |
| 582 | 3300045836 | Ga0466958_0070166 | Ga0466958_0070166_233_1270 | 345 |
| 583 | 3300046452 | Ga0495617_000075 | Ga0495617_000075_3375_4412 | 345 |
| 584 | 3300046452 | Ga0495617_001209 | Ga0495617_001209_3895_4932 | 345 |
| 585 | 3300046453 | Ga0495627_000011 | Ga0495627_000011_14955_15998 | 345 |
| 586 | 3300046454 | Ga0495592_0002825 | Ga0495592_0002825_618_1655 | 345 |
| 587 | 3300046457 | Ga0495590_0000143 | Ga0495590_0000143_28405_29442 | 345 |
| 588 | 3300046460 | Ga0495638_0001680 | Ga0495638_0001680_15327_16364 | 345 |
| 589 | 3300046462 | Ga0495651_0002596 | Ga0495651_0002596_12669_13721 | 345 |
| 590 | 3300046463 | Ga0495653_0000044 | Ga0495653_0000044_8320_9357 | 345 |
| 591 | 3300046471 | Ga0495650_0000100 | Ga0495650_0000100_360_1397 | 345 |
| 592 | 3300046471 | Ga0495650_0001173 | Ga0495650_0001173_18632_19669 | 345 |
| 593 | 3300046471 | Ga0495650_0001749 | Ga0495650_0001749_10336_11373 | 345 |
| 594 | 3300046471 | Ga0495650_0008196 | Ga0495650_0008196_4638_5675 | 345 |
| 595 | 3300046471 | Ga0495650_0012103 | Ga0495650_0012103_726_1763 | 345 |
| 596 | 3300046473 | Ga0495582_0038957 | Ga0495582_0038957_1467_2507 | 345 |
| 597 | 3300046474 | Ga0495605_0000098 | Ga0495605_0000098_8385_9422 | 345 |
| 598 | 3300046474 | Ga0495605_0002046 | Ga0495605_0002046_2799_3857 | 345 |
| 599 | 3300046474 | Ga0495605_0020353 | Ga0495605_0020353_1582_2619 | 345 |
| 600 | 3300046491 | Ga0495584_0000232 | Ga0495584_0000232_35096_36154 | 345 |
| 601 | 3300046491 | Ga0495584_0002317 | Ga0495584_0002317_8900_9937 | 345 |
| 602 | 3300046491 | Ga0495584_0067745 | Ga0495584_0067745_169_1206 | 345 |
| 603 | 3300046491 | Ga0495584_0094799 | Ga0495584_0094799_35_1072 | 345 |
| 604 | 3300046491 | Ga0495584_0147235 | Ga0495584_0147235_25_1062 | 345 |
| 605 | 3300046492 | Ga0495585_0000023 | Ga0495585_0000023_135941_136978 | 345 |
| 606 | 3300046492 | Ga0495585_0000152 | Ga0495585_0000152_943_1998 | 345 |
| 607 | 3300046492 | Ga0495585_0000444 | Ga0495585_0000444_3536_4573 | 345 |
| 608 | 3300046492 | Ga0495585_0036679 | Ga0495585_0036679_1602_2639 | 345 |
| 609 | 3300046500 | Ga0495596_0004904 | Ga0495596_0004904_1802_2839 | 345 |
| 610 | 3300046501 | Ga0495607_0013841 | Ga0495607_0013841_217_1254 | 345 |
| 611 | 3300046501 | Ga0495607_0034462 | Ga0495607_0034462_1225_2262 | 345 |
| 612 | 3300046501 | Ga0495607_0053231 | Ga0495607_0053231_1208_2266 | 345 |
| 613 | 3300046501 | Ga0495607_0060494 | Ga0495607_0060494_510_1568 | 345 |
| 614 | 3300046506 | Ga0495583_0000150 | Ga0495583_0000150_109506_110564 | 345 |
| 615 | 3300046506 | Ga0495583_0000517 | Ga0495583_0000517_27726_28763 | 345 |
| 616 | 3300046506 | Ga0495583_0001383 | Ga0495583_0001383_15263_16300 | 345 |
| 617 | 3300046506 | Ga0495583_0001918 | Ga0495583_0001918_9796_10854 | 345 |
| 618 | 3300046507 | Ga0495606_0000080 | Ga0495606_0000080_716_1753 | 345 |
| 619 | 3300046507 | Ga0495606_0000090 | Ga0495606_0000090_146168_147214 | 345 |
| 620 | 3300046507 | Ga0495606_0000099 | Ga0495606_0000099_8378_9415 | 345 |
| 621 | 3300046507 | Ga0495606_0000600 | Ga0495606_0000600_10580_11617 | 345 |
| 622 | 3300046507 | Ga0495606_0001629 | Ga0495606_0001629_27546_28583 | 345 |
| 623 | 3300046507 | Ga0495606_0002603 | Ga0495606_0002603_11241_12278 | 345 |
| 624 | 3300046511 | Ga0495608_0026406 | Ga0495608_0026406_1666_2718 | 345 |
| 625 | 3300046511 | Ga0495608_0026533 | Ga0495608_0026533_949_1986 | 345 |
| 626 | 3300046512 | Ga0495610_0000668 | Ga0495610_0000668_23957_24994 | 345 |
| 627 | 3300046512 | Ga0495610_0013362 | Ga0495610_0013362_410_1447 | 345 |
| 628 | 3300046513 | Ga0495616_0000490 | Ga0495616_0000490_25645_26682 | 345 |
| 629 | 3300046513 | Ga0495616_0006823 | Ga0495616_0006823_4016_5074 | 345 |
| 630 | 3300046514 | Ga0495618_0063746 | Ga0495618_0063746_384_1421 | 345 |
| 631 | 3300046516 | Ga0495628_0000382 | Ga0495628_0000382_31001_32038 | 345 |
| 632 | 3300046516 | Ga0495628_0002078 | Ga0495628_0002078_2179_3231 | 345 |
| 633 | 3300046520 | Ga0495637_0000195 | Ga0495637_0000195_37802_38839 | 345 |
| 634 | 3300046522 | Ga0495643_0000109 | Ga0495643_0000109_8085_9122 | 345 |
| 635 | 3300046522 | Ga0495643_0000250 | Ga0495643_0000250_8526_9563 | 345 |
| 636 | 3300046522 | Ga0495643_0001163 | Ga0495643_0001163_15896_16933 | 345 |
| 637 | 3300046523 | Ga0495644_0001124 | Ga0495644_0001124_1060_2118 | 345 |
| 638 | 3300046524 | Ga0495648_0001108 | Ga0495648_0001108_23149_24207 | 345 |
| 639 | 3300046524 | Ga0495648_0001296 | Ga0495648_0001296_15295_16332 | 345 |
| 640 | 3300046524 | Ga0495648_0001297 | Ga0495648_0001297_8539_9576 | 345 |
| 641 | 3300046524 | Ga0495648_0001425 | Ga0495648_0001425_12120_13157 | 345 |
| 642 | 3300046524 | Ga0495648_0003753 | Ga0495648_0003753_8604_9641 | 345 |
| 643 | 3300046524 | Ga0495648_0012427 | Ga0495648_0012427_3163_4200 | 345 |
| 644 | 3300046524 | Ga0495648_0012934 | Ga0495648_0012934_365_1402 | 345 |
| 645 | 3300046524 | Ga0495648_0030615 | Ga0495648_0030615_1651_2688 | 345 |
| 646 | 3300046526 | Ga0495666_0006871 | Ga0495666_0006871_804_1841 | 345 |
| 647 | 3300046528 | Ga0495642_0003891 | Ga0495642_0003891_634_1671 | 345 |
| 648 | 3300046528 | Ga0495642_0004563 | Ga0495642_0004563_1464_2501 | 345 |
| 649 | 3300046528 | Ga0495642_0011219 | Ga0495642_0011219_1089_2126 | 345 |
| 650 | 3300046528 | Ga0495642_0068412 | Ga0495642_0068412_223_1260 | 345 |
| 651 | 3300046530 | Ga0495654_0000030 | Ga0495654_0000030_8353_9390 | 345 |
| 652 | 3300046530 | Ga0495654_0018430 | Ga0495654_0018430_791_1828 | 345 |
| 653 | 3300046531 | Ga0495665_0001301 | Ga0495665_0001301_698_1735 | 345 |
| 654 | 3300046531 | Ga0495665_0024697 | Ga0495665_0024697_255_1295 | 345 |
| 655 | 3300046535 | Ga0495586_0115342 | Ga0495586_0115342_190_1227 | 345 |
| 656 | 3300046538 | Ga0495609_0002820 | Ga0495609_0002820_5149_6186 | 345 |
| 657 | 3300046538 | Ga0495609_0005405 | Ga0495609_0005405_1048_2085 | 345 |
| 658 | 3300046538 | Ga0495609_0007869 | Ga0495609_0007869_532_1590 | 345 |
| 659 | 3300046539 | Ga0495621_0013856 | Ga0495621_0013856_1129_2166 | 345 |
| 660 | 3300046542 | Ga0495597_0001115 | Ga0495597_0001115_16075_17112 | 345 |
| 661 | 3300046542 | Ga0495597_0001285 | Ga0495597_0001285_8924_9961 | 345 |
| 662 | 3300046542 | Ga0495597_0073848 | Ga0495597_0073848_404_1441 | 345 |
| 663 | 3300046543 | Ga0495645_0068890 | Ga0495645_0068890_472_1509 | 345 |
| 664 | 3300046557 | Ga0495622_0000044 | Ga0495622_0000044_111088_112125 | 345 |
| 665 | 3300046557 | Ga0495622_0004973 | Ga0495622_0004973_4363_5400 | 345 |
| 666 | 3300046558 | Ga0495633_0000917 | Ga0495633_0000917_8622_9659 | 345 |
| 667 | 3300046616 | Ga0495668_0000035 | Ga0495668_0000035_230566_231603 | 345 |
| 668 | 3300046616 | Ga0495668_0000286 | Ga0495668_0000286_60430_61467 | 345 |
| 669 | 3300046616 | Ga0495668_0000939 | Ga0495668_0000939_17346_18383 | 345 |
| 670 | 3300046616 | Ga0495668_0001545 | Ga0495668_0001545_19764_20801 | 345 |
| 671 | 3300046616 | Ga0495668_0004452 | Ga0495668_0004452_4115_5152 | 345 |
| 672 | 3300046616 | Ga0495668_0004605 | Ga0495668_0004605_8575_9612 | 345 |
| 673 | 3300046616 | Ga0495668_0012596 | Ga0495668_0012596_3383_4420 | 345 |
| 674 | 3300046648 | Ga0495611_0003988 | Ga0495611_0003988_1849_2907 | 345 |
| 675 | 3300046648 | Ga0495611_0012387 | Ga0495611_0012387_1829_2866 | 345 |
| 676 | 3300046648 | Ga0495611_0050001 | Ga0495611_0050001_33_1070 | 345 |
| 677 | 3300046660 | Ga0495625_0000338 | Ga0495625_0000338_69321_70358 | 345 |
| 678 | 3300046660 | Ga0495625_0001765 | Ga0495625_0001765_8680_9717 | 345 |
| 679 | 3300046660 | Ga0495625_0016076 | Ga0495625_0016076_4016_5074 | 345 |
| 680 | 3300046660 | Ga0495625_0032153 | Ga0495625_0032153_2824_3861 | 345 |
| 681 | 3300046660 | Ga0495625_0032657 | Ga0495625_0032657_1592_2662 | 345 |
| 682 | 3300046664 | Ga0495659_0000139 | Ga0495659_0000139_2963_4033 | 345 |
| 683 | 3300046664 | Ga0495659_0006513 | Ga0495659_0006513_920_1978 | 345 |
| 684 | 3300046664 | Ga0495659_0012720 | Ga0495659_0012720_751_1788 | 345 |
| 685 | 3300046665 | Ga0495661_0028811 | Ga0495661_0028811_2272_3309 | 345 |
| 686 | 3300046665 | Ga0495661_0064889 | Ga0495661_0064889_633_1670 | 345 |
| 687 | 3300046678 | Ga0495599_0009879 | Ga0495599_0009879_737_1774 | 345 |
| 688 | 3300046679 | Ga0495623_0019111 | Ga0495623_0019111_650_1702 | 345 |
| 689 | 3300046681 | Ga0495647_0004533 | Ga0495647_0004533_2673_3713 | 345 |
| 690 | 3300046681 | Ga0495647_0034374 | Ga0495647_0034374_774_1811 | 345 |
| 691 | 3300046683 | Ga0495658_0216304 | Ga0495658_0216304_29_1069 | 345 |
| 692 | 3300046684 | Ga0495669_0000495 | Ga0495669_0000495_9725_10762 | 345 |
| 693 | 3300046689 | Ga0495613_0111034 | Ga0495613_0111034_585_1625 | 345 |
| 694 | 3300046690 | Ga0495624_0004359 | Ga0495624_0004359_2624_3661 | 345 |
| 695 | 3300046690 | Ga0495624_0020490 | Ga0495624_0020490_2837_3874 | 345 |
| 696 | 3300046690 | Ga0495624_0083235 | Ga0495624_0083235_881_1918 | 345 |
| 697 | 3300046691 | Ga0495670_0000859 | Ga0495670_0000859_6411_7469 | 345 |
| 698 | 3300046692 | Ga0495671_0000087 | Ga0495671_0000087_83313_84383 | 345 |
| 699 | 3300046692 | Ga0495671_0000605 | Ga0495671_0000605_16851_17888 | 345 |
| 700 | 3300046692 | Ga0495671_0003550 | Ga0495671_0003550_2565_3623 | 345 |
| 701 | 3300046694 | Ga0495649_0000702 | Ga0495649_0000702_2144_3181 | 345 |
| 702 | 3300046694 | Ga0495649_0016852 | Ga0495649_0016852_1187_2224 | 345 |
| 703 | 3300046694 | Ga0495649_0027581 | Ga0495649_0027581_1792_2829 | 345 |
| 704 | 3300046794 | Ga0495589_0018768 | Ga0495589_0018768_1616_2653 | 345 |
| 705 | 3300046810 | Ga0495660_0004751 | Ga0495660_0004751_118_1161 | 345 |
| 706 | 3300046810 | Ga0495660_0028271 | Ga0495660_0028271_740_1777 | 345 |
| 707 | 3300047315 | Ga0495581_0001539 | Ga0495581_0001539_9443_10483 | 345 |
| 708 | 3300047317 | Ga0495604_0071554 | Ga0495604_0071554_1085_2122 | 345 |
| 709 | 3300047318 | Ga0495636_0003424 | Ga0495636_0003424_912_1970 | 345 |
| 710 | 3300047318 | Ga0495636_0120545 | Ga0495636_0120545_21_1058 | 345 |
| 711 | 3300047320 | Ga0495672_0001189 | Ga0495672_0001189_13867_14937 | 345 |
| 712 | 3300047320 | Ga0495672_0004405 | Ga0495672_0004405_10246_11283 | 345 |
| 713 | 3300047320 | Ga0495672_0033064 | Ga0495672_0033064_856_1914 | 345 |
| 714 | 3300047320 | Ga0495672_0084898 | Ga0495672_0084898_443_1480 | 345 |
| 715 | 3300047323 | Ga0495683_0000036 | Ga0495683_0000036_9618_10655 | 345 |
| 716 | 3300047323 | Ga0495683_0005881 | Ga0495683_0005881_2126_3163 | 345 |
| 717 | 3300047323 | Ga0495683_0006168 | Ga0495683_0006168_3890_4948 | 345 |
| 718 | 3300047443 | Ga0495687_000057 | Ga0495687_000057_177958_179016 | 345 |
| 719 | 3300047443 | Ga0495687_007401 | Ga0495687_007401_5214_6251 | 345 |
| 720 | 3300047445 | Ga0495677_0005204 | Ga0495677_0005204_3303_4361 | 345 |
| 721 | 3300047446 | Ga0495679_019405 | Ga0495679_019405_900_1937 | 345 |
| 722 | 3300047447 | Ga0495685_000299 | Ga0495685_000299_8077_9135 | 345 |
| 723 | 3300047447 | Ga0495685_032368 | Ga0495685_032368_712_1749 | 345 |
| 724 | 3300047469 | Ga0495673_0000069 | Ga0495673_0000069_208782_209819 | 345 |
| 725 | 3300047469 | Ga0495673_0000203 | Ga0495673_0000203_8509_9546 | 345 |
| 726 | 3300047469 | Ga0495673_0000236 | Ga0495673_0000236_69888_70925 | 345 |
| 727 | 3300047472 | Ga0495686_0001028 | Ga0495686_0001028_1541_2578 | 345 |
| 728 | 3300047472 | Ga0495686_0006069 | Ga0495686_0006069_3295_4332 | 345 |
| 729 | 3300047472 | Ga0495686_0066701 | Ga0495686_0066701_142_1179 | 345 |
| 730 | 3300048091 | Ga0495626_0000998 | Ga0495626_0000998_15060_16097 | 345 |
| 731 | 3300048091 | Ga0495626_0002805 | Ga0495626_0002805_2955_3992 | 345 |
| 732 | 3300048091 | Ga0495626_0005031 | Ga0495626_0005031_5924_6961 | 345 |
| 733 | 3300048091 | Ga0495626_0094330 | Ga0495626_0094330_217_1254 | 345 |
| 734 | 3300048907 | Ga0496104_0072060 | Ga0496104_0072060_854_1891 | 345 |
| 735 | 3300048919 | Ga0496116_0044055 | Ga0496116_0044055_854_1891 | 345 |
| 736 | 3300048919 | Ga0496116_0050153 | Ga0496116_0050153_1317_2360 | 345 |
| 737 | 3300048924 | Ga0496121_0043951 | Ga0496121_0043951_1812_2849 | 345 |
| 738 | 3300048924 | Ga0496121_0057712 | Ga0496121_0057712_1272_2309 | 345 |
| 739 | 3300048924 | Ga0496121_0057725 | Ga0496121_0057725_2030_3067 | 345 |
| 740 | 3300048925 | Ga0496122_0114896 | Ga0496122_0114896_258_1295 | 345 |
| 741 | 3300048926 | Ga0496123_0004216 | Ga0496123_0004216_3407_4444 | 345 |
| 742 | 3300048929 | Ga0496126_0114487 | Ga0496126_0114487_780_1817 | 345 |
| 743 | 3300049459 | Ga0495678_000010 | Ga0495678_000010_15929_16972 | 345 |
| 744 | 3300049459 | Ga0495678_000095 | Ga0495678_000095_107812_108849 | 345 |
| 745 | 3300049459 | Ga0495678_009739 | Ga0495678_009739_1744_2802 | 345 |
| 746 | 3300049459 | Ga0495678_013065 | Ga0495678_013065_2755_3792 | 345 |
| 747 | 3300049459 | Ga0495678_013343 | Ga0495678_013343_249_1286 | 345 |
| 748 | 3300049460 | Ga0495682_0000432 | Ga0495682_0000432_1363_2421 | 345 |
| 749 | 3300049665 | Ga0501227_004729 | Ga0501227_004729_1783_2820 | 345 |
| 750 | 3300049671 | Ga0501238_001560 | Ga0501238_001560_604_1641 | 345 |
| 751 | 3300049775 | Ga0501279_002860 | Ga0501279_002860_225_1262 | 345 |
| 752 | 3300049822 | Ga0501035_0290214 | Ga0501035_0290214_123_1160 | 345 |
| 753 | 3300050496 | nmdc:mga07m45_666_c1 | nmdc:mga07m45_666_c1_2607_3644 | 345 |
| 754 | 3300050496 | nmdc:mga07m45_68728_c1 | nmdc:mga07m45_68728_c1_708_1745 | 345 |
| 755 | 3300053077 | Ga0495601_0011317 | Ga0495601_0011317_680_1717 | 345 |
| 756 | 3300053084 | Ga0495595_0131424 | Ga0495595_0131424_28_1068 | 345 |
| 757 | 3300053085 | Ga0495619_0037112 | Ga0495619_0037112_1283_2323 | 345 |
| 758 | 3300053125 | Ga0500618_000653 | Ga0500618_000653_8341_9378 | 345 |
| 759 | 3300053141 | Ga0500574_000047 | Ga0500574_000047_5682_6719 | 345 |
| 760 | 3300053145 | Ga0500586_000912 | Ga0500586_000912_3299_4336 | 345 |
| 761 | 3300005444 | Ga0070694_100004413 | Ga0070694_1000044132 | 346 |
| 762 | 3300005545 | Ga0070695_100020091 | Ga0070695_1000200912 | 346 |
| 763 | 3300005549 | Ga0070704_100033986 | Ga0070704_1000339863 | 346 |
| 764 | 3300006846 | Ga0075430_100008118 | Ga0075430_1000081184 | 346 |
| 765 | 3300006847 | Ga0075431_100039309 | Ga0075431_1000393094 | 346 |
| 766 | 3300025917 | Ga0207660_10078923 | Ga0207660_100789232 | 346 |
| 767 | 3300031344 | Ga0265316_10004517 | Ga0265316_1000451710 | 346 |
| 768 | 3300035172 | Ga0373955_0080618 | Ga0373955_0080618_375_1415 | 346 |
| 769 | 3300035410 | Ga0373924_0006584 | Ga0373924_0006584_3018_4058 | 346 |
| 770 | 3300035724 | Ga0373933_0039388 | Ga0373933_0039388_206_1246 | 346 |
| 771 | 3300036401 | Ga0373937_0001073 | Ga0373937_0001073_2567_3607 | 346 |
| 772 | 3300037471 | Ga0395905_0000161 | Ga0395905_0000161_80313_81356 | 346 |
| 773 | 3300042001 | Ga0439441_009995 | Ga0439441_009995_163_1203 | 346 |
| 774 | 3300042156 | Ga0439446_0016659 | Ga0439446_0016659_891_1934 | 346 |
| 775 | 3300046511 | Ga0495608_0127594 | Ga0495608_0127594_232_1272 | 346 |
| 776 | 3300048913 | Ga0496110_0067148 | Ga0496110_0067148_1508_2554 | 346 |
| 777 | 3300049574 | Ga0501038_0138702 | Ga0501038_0138702_569_1609 | 346 |
| 778 | 3300049576 | Ga0501040_0034002 | Ga0501040_0034002_1788_2828 | 346 |
| 779 | 3300049577 | Ga0501041_0015653 | Ga0501041_0015653_3036_4076 | 346 |
| 780 | 3300049578 | Ga0501042_0148935 | Ga0501042_0148935_18_1058 | 346 |
| 781 | 3300049578 | Ga0501042_0243691 | Ga0501042_0243691_26_1066 | 346 |
| 782 | 3300049588 | Ga0501072_0001613 | Ga0501072_0001613_6056_7096 | 346 |
| 783 | 3300049592 | Ga0501076_0000429 | Ga0501076_0000429_11605_12645 | 346 |
| 784 | 3300049593 | Ga0501077_0201709 | Ga0501077_0201709_91_1131 | 346 |
| 785 | 3300049742 | Ga0501080_0016392 | Ga0501080_0016392_5664_6704 | 346 |
| 786 | 3300061734 | Ga0530510_0008175 | Ga0530510_0008175_5795_6835 | 346 |
| 787 | 3300037312 | Ga0395899_0003830 | Ga0395899_0003830_3575_4621 | 347 |
| 788 | 3300037466 | Ga0395898_0144923 | Ga0395898_0144923_791_1837 | 347 |
| 789 | 3300046471 | Ga0495650_0000082 | Ga0495650_0000082_28218_29261 | 347 |
| 790 | 3300053154 | Ga0500619_000149 | Ga0500619_000149_14109_15155 | 347 |
| 791 | 3300046513 | Ga0495616_0004647 | Ga0495616_0004647_6925_7971 | 348 |
| 792 | 3300006948 | Ga0099826_10000024 | Ga0099826_10000024147 | 349 |
| 793 | 3300009011 | Ga0105251_10007888 | Ga0105251_100078885 | 349 |
| 794 | 3300025294 | Ga0209025_1000473 | Ga0209025_100047316 | 349 |
| 795 | 3300025303 | Ga0209051_1017263 | Ga0209051_10172633 | 349 |
| 796 | 3300027666 | Ga0209282_1000032 | Ga0209282_100003219 | 349 |
| 797 | 3300046500 | Ga0495596_0000683 | Ga0495596_0000683_16237_17325 | 349 |
| 798 | 3300046512 | Ga0495610_0002272 | Ga0495610_0002272_14997_16085 | 349 |
| 799 | 3300046513 | Ga0495616_0073217 | Ga0495616_0073217_451_1539 | 349 |
| 800 | 3300046522 | Ga0495643_0003256 | Ga0495643_0003256_6795_7865 | 349 |
| 801 | 3300046538 | Ga0495609_0008324 | Ga0495609_0008324_3878_4966 | 349 |
| 802 | 3300046665 | Ga0495661_0004739 | Ga0495661_0004739_5782_6852 | 349 |
| 803 | 3300046692 | Ga0495671_0003108 | Ga0495671_0003108_873_1961 | 349 |
| 804 | 3300003187 | JGI25151J46595_10001452 | JGI25151J46595_100014522 | 350 |
| 805 | 3300003775 | Ga0055524_1008782 | Ga0055524_10087823 | 350 |
| 806 | 3300003784 | Ga0055534_1003569 | Ga0055534_10035696 | 350 |
| 807 | 3300025263 | Ga0209565_1009659 | Ga0209565_10096593 | 350 |
| 808 | 3300025291 | Ga0209675_1000753 | Ga0209675_10007537 | 350 |
| 809 | 3300025291 | Ga0209675_1003114 | Ga0209675_10031146 | 350 |
| 810 | 3300025294 | Ga0209025_1000516 | Ga0209025_100051641 | 350 |
| 811 | 3300025294 | Ga0209025_1002453 | Ga0209025_10024539 | 350 |
| 812 | 3300025299 | Ga0209256_1003694 | Ga0209256_10036946 | 350 |
| 813 | 3300025303 | Ga0209051_1006479 | Ga0209051_10064797 | 350 |
| 814 | iso_pu_bacteria | 2513237150 | 2513956583 | 350 |
| 815 | iso_pu_bacteria | 644736347 | 644749093 | 350 |
| 816 | 3300003781 | Ga0055536_1000249 | Ga0055536_100024914 | 351 |
| 817 | 3300003784 | Ga0055534_1005272 | Ga0055534_10052722 | 351 |
| 818 | 3300025291 | Ga0209675_1000156 | Ga0209675_100015658 | 351 |
| 819 | 3300025292 | Ga0209676_1000364 | Ga0209676_100036452 | 351 |
| 820 | 3300025294 | Ga0209025_1000417 | Ga0209025_100041752 | 351 |
| 821 | 3300025295 | Ga0209564_1000658 | Ga0209564_100065845 | 351 |
| 822 | 3300025295 | Ga0209564_1000709 | Ga0209564_10007093 | 351 |
| 823 | 3300046522 | Ga0495643_0021689 | Ga0495643_0021689_263_1324 | 353 |
| 824 | 3300047470 | Ga0495681_0001009 | Ga0495681_0001009_17586_18647 | 353 |
| 825 | iso_pu_bacteria | 2513237165 | 2514044119 | 353 |
| 826 | 3300015261 | Ga0182006_1000033 | Ga0182006_100003312 | 354 |
| 827 | 3300015262 | Ga0182007_10000042 | Ga0182007_1000004212 | 354 |
| 828 | 3300015265 | Ga0182005_1000024 | Ga0182005_1000024210 | 354 |
| 829 | 3300046558 | Ga0495633_0006937 | Ga0495633_0006937_3590_4669 | 354 |
| 830 | 3300048919 | Ga0496116_0010336 | Ga0496116_0010336_3596_4675 | 354 |
| 831 | 3300048924 | Ga0496121_0018725 | Ga0496121_0018725_270_1349 | 354 |
| 832 | 3300048925 | Ga0496122_0020064 | Ga0496122_0020064_1653_2732 | 354 |
| 833 | 3300048926 | Ga0496123_0001425 | Ga0496123_0001425_3323_4402 | 354 |
| 834 | 3300048928 | Ga0496125_0089020 | Ga0496125_0089020_1154_2233 | 354 |
| 835 | 3300048917 | Ga0496114_0079489 | Ga0496114_0079489_396_1472 | 355 |
| 836 | 3300048928 | Ga0496125_0000368 | Ga0496125_0000368_76591_77667 | 355 |
| 837 | 3300015261 | Ga0182006_1025436 | Ga0182006_10254363 | 356 |
| 838 | iso_pu_bacteria | 2818991445 | 2819594068 | 356 |
| 839 | 3300009093 | Ga0105240_10001608 | Ga0105240_1000160830 | 358 |
| 840 | 3300014497 | Ga0182008_10056599 | Ga0182008_100565992 | 358 |
| 841 | 3300048924 | Ga0496121_0106030 | Ga0496121_0106030_996_2072 | 358 |
| 842 | 3300048925 | Ga0496122_0003525 | Ga0496122_0003525_10529_11605 | 358 |
| 843 | 3300048926 | Ga0496123_0003683 | Ga0496123_0003683_5375_6451 | 358 |
| 844 | 3300037471 | Ga0395905_0044844 | Ga0395905_0044844_250_1374 | 359 |
| 845 | 3300002704 | JGI25155J39150_1000336 | JGI25155J39150_10003362 | 360 |
| 846 | 3300002705 | JGI25156J39149_1000267 | JGI25156J39149_10002673 | 360 |
| 847 | 3300002738 | JGI25154J39366_1000739 | JGI25154J39366_100073913 | 360 |
| 848 | 3300002741 | JGI25157J39369_1000372 | JGI25157J39369_100037210 | 360 |
| 849 | 3300002741 | JGI25157J39369_1000495 | JGI25157J39369_100049522 | 360 |
| 850 | 3300003758 | Ga0055532_1000034 | Ga0055532_100003410 | 360 |
| 851 | 3300025206 | Ga0209435_100007 | Ga0209435_10000710 | 360 |
| 852 | 3300025229 | Ga0209147_100017 | Ga0209147_100017462 | 360 |
| 853 | 3300025242 | Ga0209258_101277 | Ga0209258_10127711 | 360 |
| 854 | 3300025246 | Ga0209646_1000044 | Ga0209646_1000044303 | 360 |
| 855 | 3300025250 | Ga0209026_1000063 | Ga0209026_100006310 | 360 |
| 856 | 3300025256 | Ga0209759_1000048 | Ga0209759_100004810 | 360 |
| 857 | 3300046492 | Ga0495585_0063062 | Ga0495585_0063062_820_1971 | 360 |
| 858 | 3300046500 | Ga0495596_0000032 | Ga0495596_0000032_100414_101511 | 360 |
| 859 | 3300046542 | Ga0495597_0018630 | Ga0495597_0018630_1129_2217 | 360 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hkm-assembly1.cif.gz_A | crystal structure of an anthranilate phosphoribosyltransferase (target id nysgrc-016600) from xanthomonas campestris | 0.9835 | 18 | 355 |
| 4hkm-assembly2.cif.gz_B | crystal structure of an anthranilate phosphoribosyltransferase (target id nysgrc-016600) from xanthomonas campestris | 0.9825 | 18 | 355 |
| 4hkm-assembly2.cif.gz_B | crystal structure of an anthranilate phosphoribosyltransferase (target id nysgrc-016600) from xanthomonas campestris | 0.9708 | 18 | 355 |
| 4hkm-assembly1.cif.gz_A | crystal structure of an anthranilate phosphoribosyltransferase (target id nysgrc-016600) from xanthomonas campestris | 0.9682 | 18 | 355 |
| 1zyk-assembly2.cif.gz_B | anthranilate phosphoribosyltransferase in complex with prpp, anthranilate and magnesium | 0.965 | 18 | 352 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hkmA02 | Alpha Beta;3-Layer(aba) Sandwich;Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2;Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain | 0.9856 | 88 | 355 | 3.40.1030.10 |
| 4yi7A01 | Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C | 0.9757 | 20 | 87 | 1.20.970.10 |
| af_Q57686_71_335_3.40.1030.10 | Alpha Beta;3-Layer(aba) Sandwich;Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2;Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain | 0.9747 | 94 | 354 | 3.40.1030.10 |
| af_K7WHC8_126_393_3.40.1030.10 | Alpha Beta;3-Layer(aba) Sandwich;Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2;Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain | 0.9746 | 90 | 353 | 3.40.1030.10 |
| 4gtnA01 | Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C | 0.9717 | 20 | 87 | 1.20.970.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-B2JHI7-F1-model_v4 | Anthranilate phosphoribosyltransferase (EC 2.4.2.18) | 0.9955 | 18 | 355 |
GO:0000162
GO:0000287 GO:0004048 GO:0005829 |
| AF-A0A1N6L9L8-F1-model_v4 | Anthranilate phosphoribosyltransferase (EC 2.4.2.18) | 0.9954 | 16 | 355 |
GO:0000162
GO:0000287 GO:0004048 GO:0005829 |
| AF-Q62DC9-F1-model_v4 | Anthranilate phosphoribosyltransferase (EC 2.4.2.18) | 0.9953 | 16 | 355 |
GO:0000162
GO:0000287 GO:0004048 GO:0005829 |
| AF-A0A244DQT8-F1-model_v4 | deleted | 0.9948 | 18 | 355 |
|
| AF-A0A6N6W577-F1-model_v4 | Anthranilate phosphoribosyltransferase (EC 2.4.2.18) | 0.9948 | 16 | 355 |
GO:0000162
GO:0000287 GO:0004048 GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar