F483785

General Info

Members Datasets Scaffolds Average Seq Length
859 414 797 345

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0044844|Ga0395905_0044844_250_1374
Length 374
Sequence MHMARNWRVSWNKRAAAKLINQHFYQEHPMSITPQEALSRCIEHREIFHDEMLSLFRQIMRGEMSPVMIAALTMGLRVKKETIGEIAAAAQVMREFATKVDVANPDKLLDIVGTGGDGAHTFNISTTALFAVAAAGGHVAKHGGRSVSSSSGSADAMEALGVHINLKPELVARSIEQTGIGFMFAPNHHAAMKHAAPVRKELGVRTIFNILGPLTNPAGAANILMGVFHPDLVGIQVRVLQRLGAKRAVVVWGRDNLDEVTLGAGTLVGELIDGEIREYEIHPEDFGLPMAATRNLKVASAAESKVKMLEALDNKPGAVRDIVALNAGTALYAAGVASSIADGLAKAQEALASGAARAKMEEFVKVTQELGRLA

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
4 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
5 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
6 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
7 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
8 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
9 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
10 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
11 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
12 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
13 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
14 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
15 2643221638 Duganella sp. Root336D2 Isolate Unclassified
16 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
17 2643221645 Massilia sp. Root351 Isolate Unclassified
18 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
19 2643221664 Massilia sp. Root418 Isolate Unclassified
20 2738541280 Massilia sp. GV090 Isolate Unclassified
21 2738541297 Duganella sp. GV083 Isolate Unclassified
22 2738541300 Massilia sp. GV016 Isolate Unclassified
23 2738541357 Duganella sp. GV053 Isolate Unclassified
24 2738543003 Duganella sp. GV066 Isolate Unclassified
25 2738543018 Massilia sp. GV045 Isolate Unclassified
26 2738543026 Duganella sp. GV089 Isolate Unclassified
27 2738543029 Duganella sp. GV039 Isolate Unclassified
28 2738543030 Massilia sp. GV097 Isolate Unclassified
29 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
30 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
31 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
32 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
33 2818991436 Collimonas arenae 515 Isolate Unclassified
34 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
35 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
36 2821131069 Duganella sp. 1224 Isolate Unclassified
37 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
38 2842711865 Duganella sp. R-73148 Isolate Unclassified
39 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
40 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
41 2857553236 Duganella sp. R-74557 Isolate Unclassified
42 2857558681 Duganella sp. R-74565 Isolate Unclassified
43 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
44 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
45 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
46 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
47 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
48 2904424332 Duganella sp. 1411 Isolate Rhizosphere
49 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
50 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
51 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
52 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
53 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
54 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
55 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
56 2919476304 Duganella sp. 3397 Isolate Unclassified
57 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
58 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
59 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
60 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
61 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
62 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
63 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
64 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
65 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
66 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
67 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
68 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
69 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
70 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
71 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
72 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
73 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
74 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
75 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
76 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
77 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
78 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
79 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
80 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
81 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
82 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
83 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
84 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
85 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
86 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
87 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
88 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
89 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
90 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
91 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
92 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
93 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
94 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
95 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
96 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
97 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
98 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
99 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
100 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
101 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
102 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
103 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
104 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
105 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
106 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
107 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
108 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
109 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
110 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
111 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
112 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
113 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
114 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
115 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
116 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
117 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
118 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
119 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
120 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
121 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
122 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
123 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
124 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
125 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
126 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
127 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
128 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
129 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
130 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
131 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
132 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
133 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
134 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
139 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
140 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
141 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
142 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
143 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
147 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
148 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
149 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
150 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
151 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
152 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
153 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
154 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
161 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
163 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
164 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
165 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
167 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
168 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
172 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
177 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
180 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
211 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
212 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
217 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
218 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
219 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
220 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
221 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
222 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
223 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
224 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
225 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
226 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
227 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
228 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
229 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
230 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
231 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
232 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
233 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
234 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
235 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
236 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
237 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
244 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
245 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
246 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
247 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
248 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
249 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
250 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
251 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
252 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
253 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
254 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
255 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
256 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
257 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
258 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
259 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
260 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
261 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
262 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
263 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
264 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
265 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
266 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
267 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
268 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
269 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
270 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
271 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
272 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
273 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
274 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
275 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
276 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
277 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
278 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
279 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
280 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
281 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
282 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
283 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
284 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
285 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
286 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
287 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
288 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
289 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
290 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
291 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
292 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
293 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
294 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
295 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
296 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
297 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
298 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
299 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
300 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
301 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
302 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
303 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
304 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
305 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
306 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
307 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
308 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
309 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
310 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
311 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
312 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
313 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
314 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
315 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
316 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
317 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
318 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
319 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
320 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
321 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
322 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
323 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
324 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
325 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
326 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
327 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
328 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
329 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
330 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
331 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
332 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
333 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
334 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
335 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
336 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
337 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
338 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
339 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
340 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
341 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
342 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
343 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
344 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
345 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
346 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
347 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
348 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
349 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
350 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
351 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
352 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
353 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
354 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
355 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
356 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
357 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
358 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
359 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
360 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
361 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
362 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
363 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
364 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
365 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
366 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
367 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
368 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
369 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
370 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
381 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
382 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
383 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
384 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
385 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
386 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
387 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
388 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
389 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
390 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
391 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
392 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
393 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
394 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
395 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
396 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
397 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
398 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
399 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
400 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
401 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
402 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
403 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
404 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
405 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
406 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
407 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
408 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
409 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
410 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
411 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
412 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
413 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
414 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.78
Metatranscriptomes 0
Isolates 7.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.83
Nodule 1.51
Rhizoplane 3.03
Rhizosphere 68.34
Stem 0
Stem Tuber 0
Unclassified 11.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000336 3300002704 Bacteria 15086
2 JGI25155J39150_1000485 3300002704 Bacteria 9807
3 JGI25156J39149_1000063 3300002705 Bacteria 84312
4 JGI25156J39149_1000267 3300002705 Bacteria 35297
5 JGI25154J39366_1000412 3300002738 Bacteria 23116
6 JGI25154J39366_1000739 3300002738 Bacteria 14651
7 JGI25154J39366_1000845 3300002738 Bacteria 13292
8 JGI25154J39366_1001209 3300002738 Bacteria 9784
9 JGI25154J39366_1002200 3300002738 Bacteria 5398
10 JGI25158J39367_1003079 3300002739 Bacteria 2624
11 JGI25157J39369_1000082 3300002741 Bacteria 84303
12 JGI25157J39369_1000372 3300002741 Bacteria 30863
13 JGI25157J39369_1000495 3300002741 Bacteria 24307
14 JGI25152J39213_1000953 3300002773 Bacteria 14121
15 JGI25150J39212_1000910 3300002774 Bacteria 9622
16 JGI25150J39212_1003626 3300002774 Bacteria 3583
17 JGI25159J45721_1002200 3300002987 Bacteria 7576
18 JGI25151J46595_10001452 3300003187 Bacteria 16075
19 JGI25153J46596_10018531 3300003215 Bacteria 2700
20 JGI25160J50197_1003453 3300003354 Bacteria 7072
21 Ga0055538_1000062 3300003751 Bacteria 105260
22 Ga0055539_1000093 3300003752 Bacteria 105260
23 Ga0055539_1000303 3300003752 Bacteria 26405
24 Ga0055539_1000782 3300003752 Bacteria 7614
25 Ga0055533_1000043 3300003756 Bacteria 229262
26 Ga0055533_1000105 3300003756 Bacteria 105260
27 Ga0055532_1000034 3300003758 Bacteria 210984
28 Ga0055525_1000018 3300003759 Bacteria 393974
29 Ga0055525_1000137 3300003759 Bacteria 105260
30 Ga0055525_1001495 3300003759 Bacteria 4035
31 Ga0055535_1000859 3300003761 Bacteria 21484
32 Ga0055529_1000152 3300003763 Bacteria 98133
33 Ga0055529_1000725 3300003763 Bacteria 21544
34 Ga0055526_1000079 3300003771 Bacteria 89698
35 Ga0055526_1000690 3300003771 Bacteria 25815
36 Ga0055526_1001033 3300003771 Bacteria 20365
37 Ga0055526_1003493 3300003771 Bacteria 9959
38 Ga0055537_1000580 3300003773 Bacteria 20336
39 Ga0055537_1002871 3300003773 Bacteria 5518
40 Ga0055524_1000237 3300003775 Bacteria 57951
41 Ga0055524_1000899 3300003775 Bacteria 19266
42 Ga0055524_1001534 3300003775 Bacteria 13059
43 Ga0055524_1003281 3300003775 Bacteria 7917
44 Ga0055524_1008782 3300003775 Bacteria 4168
45 Ga0055524_1015153 3300003775 Bacteria 2822
46 Ga0055536_1000249 3300003781 Bacteria 42682
47 Ga0055534_1000283 3300003784 Bacteria 34520
48 Ga0055534_1003569 3300003784 Bacteria 4836
49 Ga0055534_1005272 3300003784 Bacteria 3500
50 Ga0055528_1000495 3300003790 Bacteria 31111
51 Ga0055528_1002751 3300003790 Bacteria 9215
52 Ga0055530_10005914 3300003791 Bacteria 5645
53 Ga0055530_10006075 3300003791 Bacteria 5515
54 Ga0055530_10006432 3300003791 Bacteria 5252
55 Ga0055530_10023984 3300003791 Bacteria 1741
56 Ga0055531_10020369 3300003794 Bacteria 2625
57 Ga0055531_10034762 3300003794 Bacteria 1592
58 Ga0055541_1000063 3300003841 Bacteria 105260
59 Ga0055543_1001129 3300004625 Bacteria 11441
60 Ga0055543_1003826 3300004625 Bacteria 4273
61 Ga0065165_1002857 3300005262 Bacteria 13394
62 Ga0065165_1003337 3300005262 Bacteria 11441
63 Ga0065165_1004075 3300005262 Bacteria 9468
64 Ga0070658_10124620 3300005327 Bacteria 2143
65 Ga0070676_10128521 3300005328 Bacteria 1599
66 Ga0070690_100037236 3300005330 Bacteria 3065
67 Ga0070670_100086718 3300005331 Bacteria 2690
68 Ga0070680_100167915 3300005336 Bacteria 1846
69 Ga0070660_100016657 3300005339 Bacteria 5341
70 Ga0070660_100044451 3300005339 Bacteria 3398
71 Ga0070687_100031300 3300005343 Bacteria 2609
72 Ga0070671_100026430 3300005355 Bacteria 4769
73 Ga0070673_100032700 3300005364 Bacteria 3921
74 Ga0070688_100052640 3300005365 Bacteria 2544
75 Ga0070659_100001752 3300005366 Bacteria 15587
76 Ga0070714_100135023 3300005435 Bacteria 2208
77 Ga0070705_100041313 3300005440 Bacteria 2628
78 Ga0070694_100004413 3300005444 Bacteria 8458
79 Ga0070662_100057197 3300005457 Bacteria 2833
80 Ga0070681_10014878 3300005458 Bacteria 7736
81 Ga0070699_100021479 3300005518 Bacteria 5566
82 Ga0070697_100149328 3300005536 Bacteria 1969
83 Ga0070695_100020091 3300005545 Bacteria 4074
84 Ga0070695_100051921 3300005545 Bacteria 2632
85 Ga0070704_100033986 3300005549 Bacteria 3453
86 Ga0070704_100129543 3300005549 Bacteria 1953
87 Ga0068855_100009264 3300005563 Bacteria 11894
88 Ga0068855_100035272 3300005563 Bacteria 5958
89 Ga0068855_100062362 3300005563 Bacteria 4352
90 Ga0068855_100120182 3300005563 Bacteria 3007
91 Ga0068855_100249658 3300005563 Bacteria 1979
92 Ga0068855_100317591 3300005563 Bacteria 1722
93 Ga0070664_100003553 3300005564 Bacteria 12597
94 Ga0068857_100004849 3300005577 Bacteria 11404
95 Ga0068857_100367839 3300005577 Bacteria 1334
96 Ga0068854_100017165 3300005578 Bacteria 4840
97 Ga0068854_100119599 3300005578 Bacteria 1998
98 Ga0068856_100002505 3300005614 Bacteria 18902
99 Ga0068856_100317250 3300005614 Bacteria 1576
100 Ga0068852_100004430 3300005616 Bacteria 9925
101 Ga0068864_100032966 3300005618 Bacteria 4402
102 Ga0068861_100036671 3300005719 Bacteria 3641
103 Ga0068863_100067354 3300005841 Bacteria 3386
104 Ga0068862_100019436 3300005844 Bacteria 5670
105 Ga0081539_10000365 3300005985 Bacteria 99063
106 Ga0075367_10043698 3300006178 Bacteria 2624
107 Ga0075366_10019447 3300006195 Bacteria 3929
108 Ga0075366_10066646 3300006195 Bacteria 2142
109 Ga0075370_10011458 3300006353 Bacteria 4660
110 Ga0075428_100301946 3300006844 Bacteria 1721
111 Ga0075430_100008118 3300006846 Bacteria 8872
112 Ga0075430_100011586 3300006846 Bacteria 7498
113 Ga0075430_100179064 3300006846 Bacteria 1763
114 Ga0075431_100039309 3300006847 Bacteria 4874
115 Ga0075431_100226597 3300006847 Bacteria 1905
116 Ga0068865_100001729 3300006881 Bacteria 12820
117 Ga0075436_100119909 3300006914 Bacteria 1840
118 Ga0079104_1000012 3300006946 Bacteria 355143
119 Ga0079104_1005592 3300006946 Bacteria 4978
120 Ga0099826_10000010 3300006948 Bacteria 314346
121 Ga0099826_10000024 3300006948 Bacteria 148974
122 Ga0099794_10016101 3300007265 Bacteria 3310
123 Ga0105251_10007888 3300009011 Bacteria 6472
124 Ga0105244_10003441 3300009036 Bacteria 11284
125 Ga0105244_10035827 3300009036 Bacteria 2604
126 Ga0105240_10001608 3300009093 Bacteria 38292
127 Ga0105240_10016336 3300009093 Bacteria 10052
128 Ga0105240_10158169 3300009093 Bacteria 2693
129 Ga0105240_10161523 3300009093 Bacteria 2661
130 Ga0105240_10190542 3300009093 Bacteria 2412
131 Ga0111539_10335889 3300009094 Bacteria 1759
132 Ga0114129_10589096 3300009147 Bacteria 1442
133 Ga0105248_10004608 3300009177 Bacteria 15258
134 Ga0105237_10010944 3300009545 Bacteria 9627
135 Ga0105237_10359562 3300009545 Bacteria 1460
136 Ga0105238_10000763 3300009551 Bacteria 33477
137 Ga0105239_10010387 3300010375 Bacteria 10421
138 Ga0105246_10023704 3300011119 Bacteria 3975
139 Ga0157371_10000018 3300013102 Bacteria 310522
140 Ga0157369_10019171 3300013105 Bacteria 7655
141 Ga0157378_10007501 3300013297 Bacteria 9526
142 Ga0182008_10056599 3300014497 Bacteria 1937
143 Ga0182006_1000033 3300015261 Bacteria 238180
144 Ga0182006_1000080 3300015261 Bacteria 122163
145 Ga0182006_1025436 3300015261 Bacteria 2431
146 Ga0182007_10000042 3300015262 Bacteria 111840
147 Ga0182007_10005353 3300015262 Bacteria 5653
148 Ga0182007_10021481 3300015262 Bacteria 2292
149 Ga0182005_1000016 3300015265 Bacteria 346889
150 Ga0182005_1000024 3300015265 Bacteria 238256
151 Ga0163161_10012023 3300017792 Bacteria 6004
152 Ga0163161_10012229 3300017792 Bacteria 5953
153 Ga0213872_10047661 3300021361 Bacteria 1948
154 Ga0213872_10049654 3300021361 Bacteria 1905
155 Ga0209435_100007 3300025206 Bacteria 516857
156 Ga0209435_100176 3300025206 Bacteria 19214
157 Ga0209436_100769 3300025208 Bacteria 13300
158 Ga0209436_104031 3300025208 Bacteria 3712
159 Ga0209784_100021 3300025224 Bacteria 408534
160 Ga0209566_100119 3300025225 Bacteria 105312
161 Ga0209674_100036 3300025226 Bacteria 408534
162 Ga0209674_100067 3300025226 Bacteria 253824
163 Ga0209147_100017 3300025229 Bacteria 516857
164 Ga0209563_100011 3300025230 Bacteria 1187808
165 Ga0209563_100040 3300025230 Bacteria 408534
166 Ga0209563_100068 3300025230 Bacteria 254802
167 Ga0207427_101402 3300025231 Bacteria 8811
168 Ga0209437_100332 3300025233 Bacteria 58796
169 Ga0209258_100129 3300025242 Bacteria 176515
170 Ga0209258_101277 3300025242 Bacteria 9457
171 Ga0209258_101777 3300025242 Bacteria 6621
172 Ga0207425_1000021 3300025245 Bacteria 367537
173 Ga0207425_1000050 3300025245 Bacteria 177008
174 Ga0207425_1000829 3300025245 Bacteria 15420
175 Ga0209646_1000044 3300025246 Bacteria 334596
176 Ga0209646_1000107 3300025246 Bacteria 163112
177 Ga0209646_1000190 3300025246 Bacteria 75772
178 Ga0209646_1000244 3300025246 Bacteria 55661
179 Ga0209026_1000004 3300025250 Bacteria 949012
180 Ga0209026_1000063 3300025250 Bacteria 211324
181 Ga0209677_100023 3300025253 Bacteria 408534
182 Ga0209677_100049 3300025253 Bacteria 180721
183 Ga0209677_100413 3300025253 Bacteria 25541
184 Ga0209759_1000003 3300025256 Bacteria 792130
185 Ga0209759_1000048 3300025256 Bacteria 224817
186 Ga0209759_1000198 3300025256 Bacteria 95052
187 Ga0209759_1003928 3300025256 Bacteria 5727
188 Ga0209759_1004764 3300025256 Bacteria 4958
189 Ga0209759_1020166 3300025256 Bacteria 1556
190 Ga0209129_1000020 3300025258 Bacteria 457053
191 Ga0209565_1000055 3300025263 Bacteria 201184
192 Ga0209565_1000677 3300025263 Bacteria 21295
193 Ga0209565_1009659 3300025263 Bacteria 2432
194 Ga0209565_1011047 3300025263 Bacteria 2215
195 Ga0209455_1000070 3300025272 Bacteria 307867
196 Ga0209455_1000083 3300025272 Bacteria 255660
197 Ga0209673_1000040 3300025273 Bacteria 312633
198 Ga0209673_1003338 3300025273 Bacteria 9600
199 Ga0209673_1004762 3300025273 Bacteria 7131
200 Ga0209130_1000169 3300025284 Bacteria 95167
201 Ga0209130_1002260 3300025284 Bacteria 9942
202 Ga0209130_1006585 3300025284 Bacteria 3748
203 Ga0209675_1000052 3300025291 Bacteria 201332
204 Ga0209675_1000156 3300025291 Bacteria 88813
205 Ga0209675_1000753 3300025291 Bacteria 21816
206 Ga0209675_1001299 3300025291 Bacteria 14837
207 Ga0209675_1003114 3300025291 Bacteria 8083
208 Ga0209676_1000364 3300025292 Bacteria 85375
209 Ga0209025_1000417 3300025294 Bacteria 85342
210 Ga0209025_1000473 3300025294 Bacteria 78078
211 Ga0209025_1000516 3300025294 Bacteria 73496
212 Ga0209025_1001876 3300025294 Bacteria 24626
213 Ga0209025_1002453 3300025294 Bacteria 19596
214 Ga0209564_1000027 3300025295 Bacteria 518458
215 Ga0209564_1000047 3300025295 Bacteria 368031
216 Ga0209564_1000063 3300025295 Bacteria 318515
217 Ga0209564_1000271 3300025295 Bacteria 108422
218 Ga0209564_1000658 3300025295 Bacteria 51441
219 Ga0209564_1000709 3300025295 Bacteria 48568
220 Ga0209564_1001666 3300025295 Bacteria 21297
221 Ga0209758_1000288 3300025297 Bacteria 99096
222 Ga0209758_1000436 3300025297 Bacteria 70342
223 Ga0209050_1000050 3300025298 Bacteria 362578
224 Ga0209050_1000335 3300025298 Bacteria 93521
225 Ga0209050_1001698 3300025298 Bacteria 22016
226 Ga0209256_1000045 3300025299 Bacteria 325506
227 Ga0209256_1000054 3300025299 Bacteria 298431
228 Ga0209256_1000079 3300025299 Bacteria 225382
229 Ga0209256_1000100 3300025299 Bacteria 201246
230 Ga0209256_1000754 3300025299 Bacteria 42096
231 Ga0209256_1001531 3300025299 Bacteria 23281
232 Ga0209256_1003694 3300025299 Bacteria 10398
233 Ga0209256_1035264 3300025299 Bacteria 1323
234 Ga0207426_1003112 3300025302 Bacteria 9466
235 Ga0209051_1006479 3300025303 Bacteria 6592
236 Ga0209051_1017263 3300025303 Bacteria 3230
237 Ga0209051_1028245 3300025303 Bacteria 2219
238 Ga0209257_1001336 3300025304 Bacteria 29943
239 Ga0207696_1053792 3300025711 Bacteria 1145
240 Ga0207655_1001651 3300025728 Bacteria 19767
241 Ga0207713_1064026 3300025735 Bacteria 1386
242 Ga0207699_10201555 3300025906 Bacteria 1349
243 Ga0207645_10053286 3300025907 Bacteria 2585
244 Ga0207695_10008939 3300025913 Bacteria 12470
245 Ga0207695_10012318 3300025913 Bacteria 10275
246 Ga0207695_10025241 3300025913 Bacteria 6658
247 Ga0207695_10070196 3300025913 Bacteria 3582
248 Ga0207695_10136114 3300025913 Bacteria 2409
249 Ga0207671_10004652 3300025914 Bacteria 12996
250 Ga0207671_10092910 3300025914 Bacteria 2275
251 Ga0207660_10078923 3300025917 Bacteria 2414
252 Ga0207662_10041525 3300025918 Bacteria 2708
253 Ga0207662_10109316 3300025918 Bacteria 1722
254 Ga0207657_10008924 3300025919 Bacteria 10132
255 Ga0207657_10012688 3300025919 Bacteria 8304
256 Ga0207649_10024118 3300025920 Bacteria 3532
257 Ga0207694_10000343 3300025924 Bacteria 44142
258 Ga0207650_10063319 3300025925 Bacteria 2765
259 Ga0207690_10000951 3300025932 Bacteria 18563
260 Ga0207706_10051130 3300025933 Bacteria 3650
261 Ga0207709_10039485 3300025935 Bacteria 2819
262 Ga0207704_10018780 3300025938 Bacteria 3617
263 Ga0207711_10036832 3300025941 Bacteria 4152
264 Ga0207689_10018288 3300025942 Bacteria 5915
265 Ga0207689_10050545 3300025942 Bacteria 3427
266 Ga0207679_10004406 3300025945 Bacteria 8766
267 Ga0207667_10000912 3300025949 Bacteria 37632
268 Ga0207667_10007366 3300025949 Bacteria 13242
269 Ga0207667_10041134 3300025949 Bacteria 4917
270 Ga0207667_10067556 3300025949 Bacteria 3723
271 Ga0207667_10098677 3300025949 Bacteria 3014
272 Ga0207667_10228908 3300025949 Bacteria 1904
273 Ga0207651_10014547 3300025960 Bacteria 4548
274 Ga0207640_10041316 3300025981 Bacteria 2932
275 Ga0207640_10074203 3300025981 Bacteria 2302
276 Ga0207703_10187047 3300026035 Bacteria 1831
277 Ga0207702_10001231 3300026078 Bacteria 25873
278 Ga0207648_10210122 3300026089 Bacteria 1727
279 Ga0207674_10090346 3300026116 Bacteria 3054
280 Ga0207698_10284985 3300026142 Bacteria 1530
281 Ga0209281_1000039 3300027111 Bacteria 355150
282 Ga0209282_1000009 3300027666 Bacteria 233366
283 Ga0209282_1000032 3300027666 Bacteria 149218
284 Ga0209971_1014001 3300027682 Bacteria 1901
285 Ga0209974_10048755 3300027876 Bacteria 1420
286 Ga0209974_10051497 3300027876 Bacteria 1385
287 Ga0268265_10009579 3300028380 Bacteria 6541
288 Ga0268264_10084747 3300028381 Bacteria 2718
289 Ga0265336_10000371 3300028666 Bacteria 28840
290 Ga0307517_10163511 3300028786 Bacteria 1486
291 Ga0307515_10001889 3300028794 Bacteria 46606
292 Ga0307515_10062795 3300028794 Bacteria 5236
293 Ga0307515_10137784 3300028794 Bacteria 2639
294 Ga0307515_10209697 3300028794 Bacteria 1796
295 Ga0265324_10004594 3300029957 Bacteria 6172
296 Ga0265324_10026135 3300029957 Bacteria 2067
297 Ga0316181_1137224 3300030744 Bacteria 4539
298 Ga0316182_1156105 3300030745 Bacteria 2669
299 Ga0265330_10009515 3300031235 Bacteria 4615
300 Ga0265332_10000253 3300031238 Bacteria 42715
301 Ga0265325_10006633 3300031241 Bacteria 7004
302 Ga0265329_10001506 3300031242 Bacteria 11154
303 Ga0265331_10004185 3300031250 Bacteria 9045
304 Ga0265327_10015618 3300031251 Bacteria 4886
305 Ga0265327_10020732 3300031251 Bacteria 3993
306 Ga0265316_10004517 3300031344 Bacteria 13828
307 Ga0265316_10114733 3300031344 Bacteria 2037
308 Ga0307408_100000432 3300031548 Bacteria 37289
309 Ga0307408_100002407 3300031548 Bacteria 13173
310 Ga0307408_100010617 3300031548 Bacteria 6076
311 Ga0307408_100227442 3300031548 Bacteria 1525
312 Ga0307408_100253356 3300031548 Bacteria 1453
313 Ga0307408_100275698 3300031548 Bacteria 1398
314 Ga0307508_10018336 3300031616 Bacteria 6361
315 Ga0265314_10008929 3300031711 Bacteria 8538
316 Ga0265314_10017740 3300031711 Bacteria 5577
317 Ga0307516_10000048 3300031730 Bacteria 130378
318 Ga0307516_10002257 3300031730 Bacteria 26000
319 Ga0307516_10030751 3300031730 Bacteria 5415
320 Ga0307412_10282814 3300031911 Bacteria 1303
321 Ga0307416_100000975 3300032002 Bacteria 15137
322 Ga0373926_0010863 3300035083 Bacteria 3057
323 Ga0373928_0015985 3300035084 Bacteria 1532
324 Ga0373943_0180795 3300035170 Bacteria 1159
325 Ga0373955_0080618 3300035172 Bacteria 1838
326 Ga0373924_0006584 3300035410 Bacteria 4165
327 Ga0373931_0015826 3300035691 Bacteria 3703
328 Ga0373933_0039388 3300035724 Bacteria 2780
329 Ga0373937_0001073 3300036401 Bacteria 23083
330 Ga0395899_0002806 3300037312 Bacteria 14038
331 Ga0395899_0003830 3300037312 Bacteria 11871
332 Ga0395899_0018674 3300037312 Bacteria 5269
333 Ga0395899_0030258 3300037312 Bacteria 4072
334 Ga0395899_0179380 3300037312 Bacteria 1488
335 Ga0395900_0000904 3300037418 Bacteria 39054
336 Ga0395900_0006506 3300037418 Bacteria 12173
337 Ga0395900_0031672 3300037418 Bacteria 5435
338 Ga0395900_0035466 3300037418 Bacteria 5137
339 Ga0395900_0285887 3300037418 Bacteria 1639
340 Ga0395900_0334820 3300037418 Bacteria 1490
341 Ga0395898_0001196 3300037466 Bacteria 39243
342 Ga0395898_0144923 3300037466 Bacteria 2273
343 Ga0395905_0000161 3300037471 Bacteria 111197
344 Ga0395905_0010442 3300037471 Bacteria 9034
345 Ga0395905_0021728 3300037471 Bacteria 6070
346 Ga0395905_0027336 3300037471 Bacteria 5379
347 Ga0395905_0036632 3300037471 Bacteria 4608
348 Ga0395905_0044844 3300037471 Bacteria 4148
349 Ga0395905_0055914 3300037471 Bacteria 3693
350 Ga0395905_0068537 3300037471 Bacteria 3322
351 Ga0395901_0002710 3300038443 Bacteria 17843
352 Ga0395901_0002897 3300038443 Bacteria 17321
353 Ga0395901_0005821 3300038443 Bacteria 12479
354 Ga0395901_0066242 3300038443 Bacteria 3762
355 Ga0395901_0403054 3300038443 Bacteria 1405
356 Ga0395901_0410996 3300038443 Bacteria 1389
357 Ga0400490_04196 3300038726 Bacteria 8292
358 Ga0436361_0013073 3300039447 Bacteria 17617
359 Ga0436361_0303014 3300039447 Bacteria 21994
360 Ga0436361_0314274 3300039447 Bacteria 1808
361 Ga0436361_0319505 3300039447 Bacteria 9115
362 Ga0436361_0511425 3300039447 Bacteria 1344
363 Ga0436361_0865310 3300039447 Bacteria 2352
364 Ga0436361_0930389 3300039447 Bacteria 10390
365 Ga0436361_1142583 3300039447 Bacteria 2713
366 Ga0436361_1189474 3300039447 Bacteria 2881
367 Ga0451789_1013970 3300041443 Bacteria 2229
368 Ga0439441_009995 3300042001 Bacteria 1582
369 Ga0439451_028011 3300042009 Bacteria 1136
370 Ga0450898_004347 3300042134 Bacteria 2090
371 Ga0439446_0016659 3300042156 Bacteria 2048
372 Ga0439435_0028631 3300042436 Bacteria 1498
373 Ga0439460_0011810 3300042461 Bacteria 2257
374 Ga0451577_0070287 3300042876 Bacteria 3122
375 Ga0451577_0084653 3300042876 Bacteria 2829
376 Ga0466969_0002316 3300044656 Bacteria 10167
377 Ga0466969_0007117 3300044656 Bacteria 5954
378 Ga0466972_0000420 3300044658 Bacteria 22023
379 Ga0466972_0003973 3300044658 Bacteria 7370
380 Ga0466972_0011040 3300044658 Bacteria 4535
381 Ga0466972_0065816 3300044658 Bacteria 1733
382 Ga0466965_0002121 3300044683 Bacteria 8329
383 Ga0466965_0019993 3300044683 Bacteria 3216
384 Ga0466965_0020012 3300044683 Bacteria 3215
385 Ga0466965_0029552 3300044683 Bacteria 2667
386 Ga0466965_0036795 3300044683 Bacteria 2402
387 Ga0466966_0001854 3300044684 Bacteria 13710
388 Ga0466966_0029228 3300044684 Bacteria 3587
389 Ga0466966_0029262 3300044684 Bacteria 3584
390 Ga0466961_0007476 3300044693 Bacteria 6948
391 Ga0466961_0027488 3300044693 Bacteria 3658
392 Ga0466964_0004187 3300044706 Bacteria 5308
393 Ga0466964_0045872 3300044706 Bacteria 1780
394 Ga0466971_0008161 3300044719 Bacteria 4563
395 Ga0466971_0018165 3300044719 Bacteria 3113
396 Ga0466968_0003902 3300044735 Bacteria 5531
397 Ga0466970_0002134 3300044765 Bacteria 9544
398 Ga0466957_0001920 3300044842 Bacteria 11037
399 Ga0466957_0015104 3300044842 Bacteria 4506
400 Ga0466957_0076144 3300044842 Bacteria 2083
401 Ga0466957_0133066 3300044842 Bacteria 1595
402 Ga0466959_0001954 3300045049 Bacteria 12989
403 Ga0466959_0025858 3300045049 Bacteria 4353
404 Ga0466959_0068023 3300045049 Bacteria 2581
405 Ga0466959_0093076 3300045049 Bacteria 2163
406 Ga0451576_0001583 3300045051 Bacteria 38253
407 Ga0451576_0082220 3300045051 Bacteria 3349
408 Ga0451576_0291462 3300045051 Bacteria 1706
409 Ga0466958_0070166 3300045836 Bacteria 2143
410 Ga0495617_000022 3300046452 Bacteria 185975
411 Ga0495617_000075 3300046452 Bacteria 78250
412 Ga0495617_001209 3300046452 Bacteria 11631
413 Ga0495617_018396 3300046452 Bacteria 2362
414 Ga0495627_000011 3300046453 Bacteria 354522
415 Ga0495627_000398 3300046453 Bacteria 38966
416 Ga0495592_0002825 3300046454 Bacteria 12317
417 Ga0495603_0044746 3300046455 Bacteria 2641
418 Ga0495603_0046856 3300046455 Bacteria 2575
419 Ga0495590_0000057 3300046457 Bacteria 93720
420 Ga0495590_0000143 3300046457 Bacteria 43197
421 Ga0495590_0005737 3300046457 Bacteria 4877
422 Ga0495591_000799 3300046458 Bacteria 22321
423 Ga0495629_0020396 3300046459 Bacteria 4733
424 Ga0495629_0041378 3300046459 Bacteria 3242
425 Ga0495638_0001680 3300046460 Bacteria 19581
426 Ga0495651_0002596 3300046462 Bacteria 13971
427 Ga0495653_0000044 3300046463 Bacteria 115591
428 Ga0495653_0028893 3300046463 Bacteria 4432
429 Ga0495653_0062600 3300046463 Bacteria 2810
430 Ga0495650_0000082 3300046471 Bacteria 239477
431 Ga0495650_0000100 3300046471 Bacteria 213752
432 Ga0495650_0001173 3300046471 Bacteria 27987
433 Ga0495650_0001749 3300046471 Bacteria 19780
434 Ga0495650_0002119 3300046471 Bacteria 16976
435 Ga0495650_0008196 3300046471 Bacteria 6141
436 Ga0495650_0012103 3300046471 Bacteria 4666
437 Ga0495582_0027191 3300046473 Bacteria 3134
438 Ga0495582_0038957 3300046473 Bacteria 2616
439 Ga0495605_0000098 3300046474 Bacteria 109816
440 Ga0495605_0000153 3300046474 Bacteria 88955
441 Ga0495605_0002046 3300046474 Bacteria 12721
442 Ga0495605_0020353 3300046474 Bacteria 3526
443 Ga0495605_0037236 3300046474 Bacteria 2448
444 Ga0495584_0000232 3300046491 Bacteria 40218
445 Ga0495584_0000729 3300046491 Bacteria 21708
446 Ga0495584_0002317 3300046491 Bacteria 10849
447 Ga0495584_0009911 3300046491 Bacteria 4896
448 Ga0495584_0067745 3300046491 Bacteria 1793
449 Ga0495584_0094799 3300046491 Bacteria 1506
450 Ga0495584_0147235 3300046491 Bacteria 1196
451 Ga0495585_0000023 3300046492 Bacteria 149218
452 Ga0495585_0000152 3300046492 Bacteria 74325
453 Ga0495585_0000444 3300046492 Bacteria 39574
454 Ga0495585_0022247 3300046492 Bacteria 3639
455 Ga0495585_0036679 3300046492 Bacteria 2763
456 Ga0495585_0063062 3300046492 Bacteria 2034
457 Ga0495585_0065031 3300046492 Bacteria 1998
458 Ga0495585_0142084 3300046492 Bacteria 1256
459 Ga0495594_0068128 3300046499 Bacteria 1976
460 Ga0495596_0000032 3300046500 Bacteria 102282
461 Ga0495596_0000683 3300046500 Bacteria 21108
462 Ga0495596_0001270 3300046500 Bacteria 14619
463 Ga0495596_0004904 3300046500 Bacteria 6418
464 Ga0495596_0019014 3300046500 Bacteria 2826
465 Ga0495596_0039062 3300046500 Bacteria 1875
466 Ga0495596_0047804 3300046500 Bacteria 1678
467 Ga0495607_0009757 3300046501 Bacteria 6480
468 Ga0495607_0013841 3300046501 Bacteria 5271
469 Ga0495607_0034462 3300046501 Bacteria 3071
470 Ga0495607_0053231 3300046501 Bacteria 2340
471 Ga0495607_0060494 3300046501 Bacteria 2155
472 Ga0495583_0000106 3300046506 Bacteria 140932
473 Ga0495583_0000150 3300046506 Bacteria 117772
474 Ga0495583_0000517 3300046506 Bacteria 55159
475 Ga0495583_0000597 3300046506 Bacteria 49120
476 Ga0495583_0001383 3300046506 Bacteria 24824
477 Ga0495583_0001918 3300046506 Bacteria 19228
478 Ga0495606_0000080 3300046507 Bacteria 161866
479 Ga0495606_0000090 3300046507 Bacteria 154737
480 Ga0495606_0000099 3300046507 Bacteria 150950
481 Ga0495606_0000524 3300046507 Bacteria 62049
482 Ga0495606_0000600 3300046507 Bacteria 57013
483 Ga0495606_0001629 3300046507 Bacteria 29255
484 Ga0495606_0002603 3300046507 Bacteria 20634
485 Ga0495606_0086803 3300046507 Bacteria 1932
486 Ga0495608_0026406 3300046511 Bacteria 3959
487 Ga0495608_0026533 3300046511 Bacteria 3948
488 Ga0495608_0127594 3300046511 Bacteria 1629
489 Ga0495610_0000017 3300046512 Bacteria 365675
490 Ga0495610_0000668 3300046512 Bacteria 33359
491 Ga0495610_0002272 3300046512 Bacteria 16239
492 Ga0495610_0013362 3300046512 Bacteria 4884
493 Ga0495610_0043732 3300046512 Bacteria 2228
494 Ga0495616_0000490 3300046513 Bacteria 30167
495 Ga0495616_0002388 3300046513 Bacteria 12495
496 Ga0495616_0004647 3300046513 Bacteria 8621
497 Ga0495616_0006823 3300046513 Bacteria 6878
498 Ga0495616_0016924 3300046513 Bacteria 4026
499 Ga0495616_0018885 3300046513 Bacteria 3769
500 Ga0495616_0029168 3300046513 Bacteria 2915
501 Ga0495616_0034548 3300046513 Bacteria 2625
502 Ga0495616_0073217 3300046513 Bacteria 1653
503 Ga0495618_0063746 3300046514 Bacteria 2341
504 Ga0495628_0000382 3300046516 Bacteria 40502
505 Ga0495628_0002078 3300046516 Bacteria 18185
506 Ga0495630_0246662 3300046517 Bacteria 1364
507 Ga0495631_0001332 3300046518 Bacteria 15128
508 Ga0495631_0001436 3300046518 Bacteria 14479
509 Ga0495631_0023308 3300046518 Bacteria 2870
510 Ga0495631_0065120 3300046518 Bacteria 1577
511 Ga0495632_0000052 3300046519 Bacteria 132992
512 Ga0495632_0000396 3300046519 Bacteria 40964
513 Ga0495632_0001555 3300046519 Bacteria 18930
514 Ga0495632_0003734 3300046519 Bacteria 10656
515 Ga0495632_0012494 3300046519 Bacteria 4897
516 Ga0495632_0013833 3300046519 Bacteria 4588
517 Ga0495637_0000018 3300046520 Bacteria 186671
518 Ga0495637_0000195 3300046520 Bacteria 47191
519 Ga0495643_0000109 3300046522 Bacteria 135859
520 Ga0495643_0000250 3300046522 Bacteria 78905
521 Ga0495643_0001163 3300046522 Bacteria 25714
522 Ga0495643_0003256 3300046522 Bacteria 12009
523 Ga0495643_0021689 3300046522 Bacteria 3679
524 Ga0495643_0025569 3300046522 Bacteria 3339
525 Ga0495643_0039737 3300046522 Bacteria 2572
526 Ga0495644_0001124 3300046523 Bacteria 10982
527 Ga0495644_0003935 3300046523 Bacteria 5846
528 Ga0495648_0001108 3300046524 Bacteria 27307
529 Ga0495648_0001296 3300046524 Bacteria 24870
530 Ga0495648_0001297 3300046524 Bacteria 24870
531 Ga0495648_0001425 3300046524 Bacteria 23386
532 Ga0495648_0003753 3300046524 Bacteria 13223
533 Ga0495648_0012427 3300046524 Bacteria 6353
534 Ga0495648_0012934 3300046524 Bacteria 6198
535 Ga0495648_0015868 3300046524 Bacteria 5445
536 Ga0495648_0030615 3300046524 Bacteria 3555
537 Ga0495666_0006871 3300046526 Bacteria 5714
538 Ga0495666_0007557 3300046526 Bacteria 5437
539 Ga0495642_0000529 3300046528 Bacteria 19421
540 Ga0495642_0002545 3300046528 Bacteria 7372
541 Ga0495642_0003891 3300046528 Bacteria 5852
542 Ga0495642_0004563 3300046528 Bacteria 5366
543 Ga0495642_0011219 3300046528 Bacteria 3437
544 Ga0495642_0014230 3300046528 Bacteria 3082
545 Ga0495642_0042536 3300046528 Bacteria 1851
546 Ga0495642_0068412 3300046528 Bacteria 1482
547 Ga0495654_0000030 3300046530 Bacteria 216715
548 Ga0495654_0018430 3300046530 Bacteria 3658
549 Ga0495654_0021405 3300046530 Bacteria 3363
550 Ga0495654_0031775 3300046530 Bacteria 2679
551 Ga0495665_0001301 3300046531 Bacteria 13308
552 Ga0495665_0024697 3300046531 Bacteria 3228
553 Ga0495665_0034596 3300046531 Bacteria 2701
554 Ga0495586_0115342 3300046535 Bacteria 1497
555 Ga0495587_0051879 3300046536 Bacteria 2422
556 Ga0495598_0015527 3300046537 Bacteria 1925
557 Ga0495609_0002820 3300046538 Bacteria 10412
558 Ga0495609_0005405 3300046538 Bacteria 6723
559 Ga0495609_0007869 3300046538 Bacteria 5269
560 Ga0495609_0008324 3300046538 Bacteria 5084
561 Ga0495621_0013856 3300046539 Bacteria 2542
562 Ga0495597_0001115 3300046542 Bacteria 20308
563 Ga0495597_0001285 3300046542 Bacteria 18457
564 Ga0495597_0001411 3300046542 Bacteria 17326
565 Ga0495597_0002378 3300046542 Bacteria 12035
566 Ga0495597_0018630 3300046542 Bacteria 3255
567 Ga0495597_0022362 3300046542 Bacteria 2933
568 Ga0495597_0073848 3300046542 Bacteria 1465
569 Ga0495645_0068890 3300046543 Bacteria 2554
570 Ga0495622_0000044 3300046557 Bacteria 115528
571 Ga0495622_0004973 3300046557 Bacteria 6157
572 Ga0495633_0000917 3300046558 Bacteria 24985
573 Ga0495633_0003343 3300046558 Bacteria 10770
574 Ga0495633_0006937 3300046558 Bacteria 6622
575 Ga0495633_0059388 3300046558 Bacteria 1793
576 Ga0495668_0000035 3300046616 Bacteria 240241
577 Ga0495668_0000211 3300046616 Bacteria 84615
578 Ga0495668_0000286 3300046616 Bacteria 69771
579 Ga0495668_0000939 3300046616 Bacteria 32535
580 Ga0495668_0001545 3300046616 Bacteria 21835
581 Ga0495668_0004452 3300046616 Bacteria 9939
582 Ga0495668_0004605 3300046616 Bacteria 9699
583 Ga0495668_0012596 3300046616 Bacteria 5014
584 Ga0495668_0097325 3300046616 Bacteria 1610
585 Ga0495611_0001030 3300046648 Bacteria 14761
586 Ga0495611_0003988 3300046648 Bacteria 6425
587 Ga0495611_0006487 3300046648 Bacteria 4986
588 Ga0495611_0012387 3300046648 Bacteria 3626
589 Ga0495611_0024927 3300046648 Bacteria 2603
590 Ga0495611_0050001 3300046648 Bacteria 1882
591 Ga0495625_0000338 3300046660 Bacteria 71524
592 Ga0495625_0001765 3300046660 Bacteria 25007
593 Ga0495625_0002807 3300046660 Bacteria 18358
594 Ga0495625_0016076 3300046660 Bacteria 5897
595 Ga0495625_0032153 3300046660 Bacteria 3895
596 Ga0495625_0032657 3300046660 Bacteria 3857
597 Ga0495659_0000139 3300046664 Bacteria 32158
598 Ga0495659_0006513 3300046664 Bacteria 3687
599 Ga0495659_0012720 3300046664 Bacteria 2731
600 Ga0495659_0021812 3300046664 Bacteria 2161
601 Ga0495661_0004739 3300046665 Bacteria 9770
602 Ga0495661_0014026 3300046665 Bacteria 5371
603 Ga0495661_0028811 3300046665 Bacteria 3550
604 Ga0495661_0064889 3300046665 Bacteria 2152
605 Ga0495661_0146768 3300046665 Bacteria 1277
606 Ga0495588_0056552 3300046674 Bacteria 2025
607 Ga0495599_0009879 3300046678 Bacteria 5840
608 Ga0495623_0019111 3300046679 Bacteria 4426
609 Ga0495647_0004533 3300046681 Bacteria 4519
610 Ga0495647_0034374 3300046681 Bacteria 1898
611 Ga0495658_0216304 3300046683 Bacteria 1198
612 Ga0495669_0000101 3300046684 Bacteria 53876
613 Ga0495669_0000495 3300046684 Bacteria 18130
614 Ga0495669_0001145 3300046684 Bacteria 10993
615 Ga0495613_0026824 3300046689 Bacteria 4290
616 Ga0495613_0111034 3300046689 Bacteria 1975
617 Ga0495624_0004359 3300046690 Bacteria 10375
618 Ga0495624_0020490 3300046690 Bacteria 4400
619 Ga0495624_0083235 3300046690 Bacteria 1979
620 Ga0495670_0000859 3300046691 Bacteria 14714
621 Ga0495670_0045941 3300046691 Bacteria 2180
622 Ga0495671_0000087 3300046692 Bacteria 87327
623 Ga0495671_0000605 3300046692 Bacteria 26398
624 Ga0495671_0003108 3300046692 Bacteria 10317
625 Ga0495671_0003330 3300046692 Bacteria 9927
626 Ga0495671_0003550 3300046692 Bacteria 9532
627 Ga0495671_0038095 3300046692 Bacteria 2431
628 Ga0495649_0000194 3300046694 Bacteria 53689
629 Ga0495649_0000702 3300046694 Bacteria 27319
630 Ga0495649_0016852 3300046694 Bacteria 4136
631 Ga0495649_0027581 3300046694 Bacteria 3150
632 Ga0495589_0001516 3300046794 Bacteria 13354
633 Ga0495589_0018768 3300046794 Bacteria 3545
634 Ga0495660_0004751 3300046810 Bacteria 8199
635 Ga0495660_0028271 3300046810 Bacteria 3169
636 Ga0495581_0001539 3300047315 Bacteria 12859
637 Ga0495604_0053804 3300047317 Bacteria 3109
638 Ga0495604_0071554 3300047317 Bacteria 2623
639 Ga0495636_0003424 3300047318 Bacteria 6152
640 Ga0495636_0004254 3300047318 Bacteria 5617
641 Ga0495636_0011954 3300047318 Bacteria 3439
642 Ga0495636_0120545 3300047318 Bacteria 1160
643 Ga0495672_0000013 3300047320 Bacteria 511827
644 Ga0495672_0000064 3300047320 Bacteria 195158
645 Ga0495672_0000512 3300047320 Bacteria 44570
646 Ga0495672_0001189 3300047320 Bacteria 26357
647 Ga0495672_0004405 3300047320 Bacteria 11546
648 Ga0495672_0033064 3300047320 Bacteria 3208
649 Ga0495672_0084898 3300047320 Bacteria 1755
650 Ga0495676_0000015 3300047321 Bacteria 199492
651 Ga0495680_0058066 3300047322 Bacteria 2991
652 Ga0495683_0000036 3300047323 Bacteria 144974
653 Ga0495683_0005881 3300047323 Bacteria 6742
654 Ga0495683_0006168 3300047323 Bacteria 6571
655 Ga0495683_0035949 3300047323 Bacteria 2516
656 Ga0495687_000057 3300047443 Bacteria 186224
657 Ga0495687_001055 3300047443 Bacteria 27247
658 Ga0495687_001122 3300047443 Bacteria 26027
659 Ga0495687_007401 3300047443 Bacteria 6469
660 Ga0495677_0000948 3300047445 Bacteria 11680
661 Ga0495677_0005204 3300047445 Bacteria 4948
662 Ga0495677_0005995 3300047445 Bacteria 4600
663 Ga0495679_001332 3300047446 Bacteria 14284
664 Ga0495679_019405 3300047446 Bacteria 2389
665 Ga0495685_000299 3300047447 Bacteria 16305
666 Ga0495685_032368 3300047447 Bacteria 1796
667 Ga0495673_0000069 3300047469 Bacteria 218170
668 Ga0495673_0000203 3300047469 Bacteria 89918
669 Ga0495673_0000236 3300047469 Bacteria 79618
670 Ga0495681_0001009 3300047470 Bacteria 21583
671 Ga0495686_0000620 3300047472 Bacteria 48981
672 Ga0495686_0001028 3300047472 Bacteria 33622
673 Ga0495686_0006069 3300047472 Bacteria 9368
674 Ga0495686_0065437 3300047472 Bacteria 2247
675 Ga0495686_0066701 3300047472 Bacteria 2223
676 Ga0495615_0004412 3300048090 Bacteria 2456
677 Ga0495626_0000998 3300048091 Bacteria 24336
678 Ga0495626_0001757 3300048091 Bacteria 16497
679 Ga0495626_0002805 3300048091 Bacteria 11678
680 Ga0495626_0005031 3300048091 Bacteria 7893
681 Ga0495626_0021084 3300048091 Bacteria 3239
682 Ga0495626_0023637 3300048091 Bacteria 3022
683 Ga0495626_0052127 3300048091 Bacteria 1886
684 Ga0495626_0094330 3300048091 Bacteria 1312
685 Ga0496101_0088835 3300048904 Bacteria 2296
686 Ga0496102_0000068 3300048905 Bacteria 156306
687 Ga0496102_0000478 3300048905 Bacteria 44372
688 Ga0496102_0003174 3300048905 Bacteria 13940
689 Ga0496102_0008640 3300048905 Bacteria 8741
690 Ga0496102_0017344 3300048905 Bacteria 6306
691 Ga0496102_0060082 3300048905 Bacteria 3477
692 Ga0496102_0292601 3300048905 Bacteria 1535
693 Ga0496103_0039346 3300048906 Bacteria 2905
694 Ga0496104_0072060 3300048907 Bacteria 3285
695 Ga0496104_0247654 3300048907 Bacteria 1695
696 Ga0496107_0131596 3300048910 Bacteria 1847
697 Ga0496108_0232857 3300048911 Bacteria 1602
698 Ga0496108_0248307 3300048911 Bacteria 1548
699 Ga0496109_0010698 3300048912 Bacteria 7850
700 Ga0496110_0000092 3300048913 Bacteria 48035
701 Ga0496110_0067148 3300048913 Bacteria 3173
702 Ga0496110_0313389 3300048913 Bacteria 1429
703 Ga0496111_0085754 3300048914 Bacteria 2303
704 Ga0496111_0104260 3300048914 Bacteria 2086
705 Ga0496112_0012572 3300048915 Bacteria 7778
706 Ga0496113_0009523 3300048916 Bacteria 6371
707 Ga0496114_0039685 3300048917 Bacteria 3896
708 Ga0496114_0079489 3300048917 Bacteria 2768
709 Ga0496116_0010336 3300048919 Bacteria 7838
710 Ga0496116_0044055 3300048919 Bacteria 3034
711 Ga0496116_0050153 3300048919 Bacteria 2783
712 Ga0496121_0018725 3300048924 Bacteria 6964
713 Ga0496121_0043951 3300048924 Bacteria 3862
714 Ga0496121_0057712 3300048924 Bacteria 3215
715 Ga0496121_0057725 3300048924 Bacteria 3215
716 Ga0496121_0106030 3300048924 Bacteria 2155
717 Ga0496121_0282190 3300048924 Bacteria 1135
718 Ga0496122_0003525 3300048925 Bacteria 20479
719 Ga0496122_0004616 3300048925 Bacteria 16951
720 Ga0496122_0020064 3300048925 Bacteria 6067
721 Ga0496122_0114896 3300048925 Bacteria 1755
722 Ga0496123_0000084 3300048926 Bacteria 187479
723 Ga0496123_0001425 3300048926 Bacteria 33435
724 Ga0496123_0003683 3300048926 Bacteria 16896
725 Ga0496123_0004216 3300048926 Bacteria 15340
726 Ga0496125_0000368 3300048928 Bacteria 84924
727 Ga0496125_0002558 3300048928 Bacteria 23425
728 Ga0496125_0089020 3300048928 Bacteria 2323
729 Ga0496125_0090062 3300048928 Bacteria 2304
730 Ga0496126_0114487 3300048929 Bacteria 2346
731 Ga0495678_000010 3300049459 Bacteria 357896
732 Ga0495678_000034 3300049459 Bacteria 207827
733 Ga0495678_000095 3300049459 Bacteria 109532
734 Ga0495678_000383 3300049459 Bacteria 44894
735 Ga0495678_001376 3300049459 Bacteria 19384
736 Ga0495678_009739 3300049459 Bacteria 4722
737 Ga0495678_013065 3300049459 Bacteria 3913
738 Ga0495678_013343 3300049459 Bacteria 3861
739 Ga0495682_0000089 3300049460 Bacteria 80020
740 Ga0495682_0000432 3300049460 Bacteria 29176
741 Ga0501031_0164943 3300049568 Bacteria 1448
742 Ga0501034_0015538 3300049571 Bacteria 7819
743 Ga0501036_0005297 3300049572 Bacteria 10438
744 Ga0501038_0138702 3300049574 Bacteria 1991
745 Ga0501038_0242228 3300049574 Bacteria 1431
746 Ga0501040_0004246 3300049576 Bacteria 9326
747 Ga0501040_0034002 3300049576 Bacteria 3455
748 Ga0501041_0000171 3300049577 Bacteria 29019
749 Ga0501041_0015653 3300049577 Bacteria 4505
750 Ga0501041_0187064 3300049577 Bacteria 1297
751 Ga0501042_0148935 3300049578 Bacteria 1687
752 Ga0501042_0243691 3300049578 Bacteria 1297
753 Ga0501043_0070467 3300049579 Bacteria 2746
754 Ga0501046_0283386 3300049580 Bacteria 1213
755 Ga0501048_0002988 3300049582 Bacteria 12906
756 Ga0501048_0192145 3300049582 Bacteria 1447
757 Ga0501069_0053281 3300049585 Bacteria 2253
758 Ga0501070_0002373 3300049586 Bacteria 16519
759 Ga0501071_0075261 3300049587 Bacteria 2464
760 Ga0501072_0001613 3300049588 Bacteria 16851
761 Ga0501072_0002668 3300049588 Bacteria 13378
762 Ga0501073_0235668 3300049589 Bacteria 1264
763 Ga0501075_0006883 3300049591 Bacteria 7852
764 Ga0501076_0000429 3300049592 Bacteria 26487
765 Ga0501076_0003325 3300049592 Bacteria 11276
766 Ga0501077_0201709 3300049593 Bacteria 1264
767 Ga0501227_004729 3300049665 Bacteria 2921
768 Ga0501238_001560 3300049671 Bacteria 2659
769 Ga0501079_0046536 3300049741 Bacteria 3347
770 Ga0501080_0016392 3300049742 Bacteria 6844
771 Ga0501081_0000857 3300049743 Bacteria 17972
772 Ga0501279_002860 3300049775 Bacteria 2250
773 Ga0501035_0006010 3300049822 Bacteria 11433
774 Ga0501035_0290214 3300049822 Bacteria 1381
775 nmdc:mga0k408_40413_c1 3300050493 Bacteria 2684
776 nmdc:mga0k408_49769_c1 3300050493 Bacteria 2426
777 nmdc:mga07m45_666_c1 3300050496 Bacteria 14578
778 nmdc:mga07m45_68728_c1 3300050496 Bacteria 2014
779 nmdc:mga0qj67_10786_c1 3300050509 Bacteria 6834
780 nmdc:mga08y16_311260_c1 3300050511 Bacteria 1622
781 nmdc:mga08x19_17547_c1 3300050514 Bacteria 4381
782 nmdc:mga08x19_49650_c1 3300050514 Bacteria 2691
783 Ga0495601_0011317 3300053077 Bacteria 5332
784 Ga0495595_0131424 3300053084 Bacteria 1224
785 Ga0495619_0037112 3300053085 Bacteria 3174
786 Ga0500578_0000067 3300053086 Bacteria 115659
787 Ga0500593_004818 3300053117 Bacteria 5258
788 Ga0500618_000653 3300053125 Bacteria 20633
789 Ga0500574_000047 3300053141 Bacteria 14143
790 Ga0500586_000912 3300053145 Bacteria 6084
791 Ga0500619_000149 3300053154 Bacteria 17198
792 Ga0500570_079924 3300053724 Bacteria 1479
793 Ga0501084_0013441 3300054114 Bacteria 6774
794 Ga0501082_0002703 3300060353 Bacteria 15476
795 Ga0466962_0015221 3300061719 Bacteria 3709
796 Ga0530510_0001659 3300061734 Bacteria 15060
797 Ga0530510_0008175 3300061734 Bacteria 7296

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_0319505 Ga0436361_0319505_10_915 301
2 3300046500 Ga0495596_0047804 Ga0495596_0047804_11_916 301
3 3300042876 Ga0451577_0084653 Ga0451577_0084653_321_1340 305
4 3300046501 Ga0495607_0009757 Ga0495607_0009757_22_945 307
5 3300035170 Ga0373943_0180795 Ga0373943_0180795_106_1128 311
6 3300050511 nmdc:mga08y16_311260_c1 nmdc:mga08y16_311260_c1_12_953 313
7 3300045049 Ga0466959_0093076 Ga0466959_0093076_1197_2141 314
8 3300046507 Ga0495606_0000524 Ga0495606_0000524_52269_53306 315
9 3300027876 Ga0209974_10048755 Ga0209974_100487552 317
10 3300005343 Ga0070687_100031300 Ga0070687_1000313002 319
11 3300025918 Ga0207662_10041525 Ga0207662_100415252 319
12 3300046517 Ga0495630_0246662 Ga0495630_0246662_22_984 319
13 3300038443 Ga0395901_0410996 Ga0395901_0410996_407_1375 322
14 3300042009 Ga0439451_028011 Ga0439451_028011_155_1123 322
15 3300039447 Ga0436361_0511425 Ga0436361_0511425_360_1331 323
16 3300046459 Ga0495629_0020396 Ga0495629_0020396_807_1844 324
17 3300006846 Ga0075430_100011586 Ga0075430_1000115867 330
18 3300050509 nmdc:mga0qj67_10786_c1 nmdc:mga0qj67_10786_c1_776_1816 330
19 3300049580 Ga0501046_0283386 Ga0501046_0283386_11_1006 331
20 3300049582 Ga0501048_0192145 Ga0501048_0192145_202_1242 331
21 3300038726 Ga0400490_04196 Ga0400490_04196_3355_4359 334
22 3300050493 nmdc:mga0k408_40413_c1 nmdc:mga0k408_40413_c1_32_1036 334
23 3300046452 Ga0495617_018396 Ga0495617_018396_717_1775 337
24 3300046455 Ga0495603_0044746 Ga0495603_0044746_98_1135 337
25 3300046528 Ga0495642_0014230 Ga0495642_0014230_1343_2380 337
26 3300048905 Ga0496102_0292601 Ga0496102_0292601_150_1163 337
27 3300049460 Ga0495682_0000089 Ga0495682_0000089_3277_4335 337
28 iso_pu_bacteria 2526164512 2526212642 337
29 iso_pu_bacteria 2998344455 2998347185 337
30 3300046513 Ga0495616_0016924 Ga0495616_0016924_668_1684 338
31 3300049585 Ga0501069_0053281 Ga0501069_0053281_625_1641 338
32 3300049586 Ga0501070_0002373 Ga0501070_0002373_12002_13018 338
33 3300046664 Ga0495659_0021812 Ga0495659_0021812_256_1290 339
34 iso_pu_bacteria 2585428062 2587758017 339
35 iso_pu_bacteria 2821131069 2821136475 339
36 3300005545 Ga0070695_100051921 Ga0070695_1000519213 340
37 3300025906 Ga0207699_10201555 Ga0207699_102015552 340
38 3300031616 Ga0307508_10018336 Ga0307508_100183365 340
39 3300035084 Ga0373928_0015985 Ga0373928_0015985_341_1363 340
40 3300045051 Ga0451576_0291462 Ga0451576_0291462_34_1056 340
41 iso_pu_bacteria 2643221592 2643968460 340
42 iso_pu_bacteria 2643221625 2644140748 340
43 iso_pu_bacteria 2643221648 2644272732 340
44 3300048913 Ga0496110_0313389 Ga0496110_0313389_369_1394 341
45 3300048917 Ga0496114_0039685 Ga0496114_0039685_2322_3347 341
46 iso_pu_bacteria 2511231003 2511250315 341
47 iso_pu_bacteria 2511231026 2511387579 341
48 iso_pu_bacteria 2521172590 2521559829 341
49 iso_pu_bacteria 2548876994 2550693194 341
50 iso_pu_bacteria 2551306416 2553007037 341
51 iso_pu_bacteria 2600255292 2601672276 341
52 iso_pu_bacteria 2643221554 2643791755 341
53 iso_pu_bacteria 2643221603 2644027058 341
54 iso_pu_bacteria 2643221638 2644216766 341
55 iso_pu_bacteria 2643221644 2644245283 341
56 iso_pu_bacteria 2738541297 2738827055 341
57 iso_pu_bacteria 2738541357 2739150852 341
58 iso_pu_bacteria 2738543003 2739192771 341
59 iso_pu_bacteria 2738543026 2739319248 341
60 iso_pu_bacteria 2738543029 2739337489 341
61 iso_pu_bacteria 2765235838 2765571085 341
62 iso_pu_bacteria 2808606386 2808984993 341
63 iso_pu_bacteria 2808606415 2809130125 341
64 iso_pu_bacteria 2808606419 2809150398 341
65 iso_pu_bacteria 2818991436 2819544568 341
66 iso_pu_bacteria 2818991449 2819618262 341
67 iso_pu_bacteria 2839094727 2839096681 341
68 iso_pu_bacteria 2842711865 2842713692 341
69 iso_pu_bacteria 2852618963 2852621378 341
70 iso_pu_bacteria 2857547612 2857549307 341
71 iso_pu_bacteria 2857553236 2857558524 341
72 iso_pu_bacteria 2857558681 2857562339 341
73 iso_pu_bacteria 2884811622 2884815181 341
74 iso_pu_bacteria 2884836552 2884839895 341
75 iso_pu_bacteria 2884852848 2884856294 341
76 iso_pu_bacteria 2885080285 2885081347 341
77 iso_pu_bacteria 2896154374 2896158659 341
78 iso_pu_bacteria 2904424332 2904428567 341
79 iso_pu_bacteria 2904439833 2904444395 341
80 iso_pu_bacteria 2904530477 2904535548 341
81 iso_pu_bacteria 2904584206 2904588120 341
82 iso_pu_bacteria 2904589729 2904595156 341
83 iso_pu_bacteria 2904601388 2904606069 341
84 iso_pu_bacteria 2919046199 2919051305 341
85 iso_pu_bacteria 2919079590 2919084267 341
86 iso_pu_bacteria 2919476304 2919477224 341
87 iso_pu_bacteria 2923510766 2923513596 341
88 iso_pu_bacteria 2928130867 2928135287 341
89 iso_pu_bacteria 2932410948 2932416361 341
90 iso_pu_bacteria 2932416698 2932422246 341
91 3300003771 Ga0055526_1003493 Ga0055526_10034938 342
92 3300031251 Ga0265327_10015618 Ga0265327_100156183 342
93 3300042134 Ga0450898_004347 Ga0450898_004347_133_1161 342
94 3300048904 Ga0496101_0088835 Ga0496101_0088835_193_1221 342
95 3300048905 Ga0496102_0003174 Ga0496102_0003174_2003_3031 342
96 3300048912 Ga0496109_0010698 Ga0496109_0010698_3285_4313 342
97 3300053117 Ga0500593_004818 Ga0500593_004818_2174_3202 342
98 3300003759 Ga0055525_1000018 Ga0055525_100001810 343
99 3300003771 Ga0055526_1001033 Ga0055526_100103310 343
100 3300003773 Ga0055537_1000580 Ga0055537_100058010 343
101 3300003775 Ga0055524_1015153 Ga0055524_10151533 343
102 3300003784 Ga0055534_1000283 Ga0055534_100028310 343
103 3300003790 Ga0055528_1000495 Ga0055528_100049523 343
104 3300005339 Ga0070660_100016657 Ga0070660_1000166575 343
105 3300006178 Ga0075367_10043698 Ga0075367_100436982 343
106 3300025230 Ga0209563_100011 Ga0209563_1000111085 343
107 3300025263 Ga0209565_1000055 Ga0209565_100005511 343
108 3300025273 Ga0209673_1000040 Ga0209673_100004011 343
109 3300025291 Ga0209675_1000052 Ga0209675_1000052178 343
110 3300025295 Ga0209564_1000271 Ga0209564_100027112 343
111 3300025299 Ga0209256_1000100 Ga0209256_1000100178 343
112 3300025711 Ga0207696_1053792 Ga0207696_10537921 343
113 3300025919 Ga0207657_10008924 Ga0207657_1000892410 343
114 3300027876 Ga0209974_10051497 Ga0209974_100514971 343
115 3300028786 Ga0307517_10163511 Ga0307517_101635112 343
116 3300028794 Ga0307515_10001889 Ga0307515_1000188916 343
117 3300028794 Ga0307515_10137784 Ga0307515_101377843 343
118 3300031730 Ga0307516_10000048 Ga0307516_1000004856 343
119 3300031730 Ga0307516_10002257 Ga0307516_100022578 343
120 3300035691 Ga0373931_0015826 Ga0373931_0015826_1224_2255 343
121 3300037312 Ga0395899_0030258 Ga0395899_0030258_48_1079 343
122 3300037471 Ga0395905_0068537 Ga0395905_0068537_705_1736 343
123 3300039447 Ga0436361_0865310 Ga0436361_0865310_549_1580 343
124 3300039447 Ga0436361_1189474 Ga0436361_1189474_1740_2771 343
125 3300041443 Ga0451789_1013970 Ga0451789_1013970_894_1925 343
126 3300044683 Ga0466965_0029552 Ga0466965_0029552_1223_2254 343
127 3300044684 Ga0466966_0029262 Ga0466966_0029262_2074_3105 343
128 3300044842 Ga0466957_0001920 Ga0466957_0001920_4350_5381 343
129 3300045051 Ga0451576_0001583 Ga0451576_0001583_9396_10427 343
130 3300046512 Ga0495610_0000017 Ga0495610_0000017_8369_9400 343
131 3300046519 Ga0495632_0013833 Ga0495632_0013833_2224_3255 343
132 3300046522 Ga0495643_0039737 Ga0495643_0039737_1191_2222 343
133 3300046531 Ga0495665_0034596 Ga0495665_0034596_729_1760 343
134 3300046660 Ga0495625_0002807 Ga0495625_0002807_15458_16489 343
135 3300047472 Ga0495686_0065437 Ga0495686_0065437_337_1368 343
136 3300048905 Ga0496102_0060082 Ga0496102_0060082_1299_2330 343
137 3300048916 Ga0496113_0009523 Ga0496113_0009523_5083_6114 343
138 3300048925 Ga0496122_0004616 Ga0496122_0004616_15270_16301 343
139 3300048928 Ga0496125_0090062 Ga0496125_0090062_837_1868 343
140 iso_pu_bacteria 2643221645 2644254524 343
141 iso_pu_bacteria 2643221664 2644360071 343
142 iso_pu_bacteria 2738541280 2738742904 343
143 iso_pu_bacteria 2738541300 2738845992 343
144 iso_pu_bacteria 2738543018 2739276900 343
145 iso_pu_bacteria 2738543030 2739345944 343
146 3300003773 Ga0055537_1002871 Ga0055537_10028715 344
147 3300003791 Ga0055530_10006432 Ga0055530_100064327 344
148 3300005262 Ga0065165_1004075 Ga0065165_10040752 344
149 3300005328 Ga0070676_10128521 Ga0070676_101285212 344
150 3300005336 Ga0070680_100167915 Ga0070680_1001679151 344
151 3300005339 Ga0070660_100044451 Ga0070660_1000444511 344
152 3300005355 Ga0070671_100026430 Ga0070671_1000264306 344
153 3300005365 Ga0070688_100052640 Ga0070688_1000526403 344
154 3300005366 Ga0070659_100001752 Ga0070659_10000175210 344
155 3300005435 Ga0070714_100135023 Ga0070714_1001350232 344
156 3300005440 Ga0070705_100041313 Ga0070705_1000413132 344
157 3300005457 Ga0070662_100057197 Ga0070662_1000571973 344
158 3300005458 Ga0070681_10014878 Ga0070681_100148782 344
159 3300005518 Ga0070699_100021479 Ga0070699_1000214796 344
160 3300005536 Ga0070697_100149328 Ga0070697_1001493282 344
161 3300005549 Ga0070704_100129543 Ga0070704_1001295432 344
162 3300005563 Ga0068855_100249658 Ga0068855_1002496583 344
163 3300005564 Ga0070664_100003553 Ga0070664_10000355313 344
164 3300005614 Ga0068856_100317250 Ga0068856_1003172502 344
165 3300005618 Ga0068864_100032966 Ga0068864_1000329663 344
166 3300005841 Ga0068863_100067354 Ga0068863_1000673542 344
167 3300005985 Ga0081539_10000365 Ga0081539_1000036587 344
168 3300006195 Ga0075366_10066646 Ga0075366_100666463 344
169 3300006914 Ga0075436_100119909 Ga0075436_1001199092 344
170 3300009094 Ga0111539_10335889 Ga0111539_103358892 344
171 3300009177 Ga0105248_10004608 Ga0105248_1000460813 344
172 3300025273 Ga0209673_1004762 Ga0209673_100476210 344
173 3300025298 Ga0209050_1000335 Ga0209050_100033520 344
174 3300025299 Ga0209256_1035264 Ga0209256_10352642 344
175 3300025907 Ga0207645_10053286 Ga0207645_100532862 344
176 3300025918 Ga0207662_10109316 Ga0207662_101093162 344
177 3300025919 Ga0207657_10012688 Ga0207657_1001268810 344
178 3300025920 Ga0207649_10024118 Ga0207649_100241182 344
179 3300025932 Ga0207690_10000951 Ga0207690_1000095113 344
180 3300025933 Ga0207706_10051130 Ga0207706_100511304 344
181 3300025941 Ga0207711_10036832 Ga0207711_100368322 344
182 3300025942 Ga0207689_10050545 Ga0207689_100505453 344
183 3300025945 Ga0207679_10004406 Ga0207679_100044064 344
184 3300026035 Ga0207703_10187047 Ga0207703_101870471 344
185 3300026089 Ga0207648_10210122 Ga0207648_102101222 344
186 3300026142 Ga0207698_10284985 Ga0207698_102849851 344
187 3300030745 Ga0316182_1156105 Ga0316182_11561052 344
188 3300031548 Ga0307408_100275698 Ga0307408_1002756982 344
189 3300031911 Ga0307412_10282814 Ga0307412_102828142 344
190 3300037312 Ga0395899_0002806 Ga0395899_0002806_5762_6796 344
191 3300037312 Ga0395899_0018674 Ga0395899_0018674_1652_2686 344
192 3300037418 Ga0395900_0006506 Ga0395900_0006506_9085_10119 344
193 3300037418 Ga0395900_0031672 Ga0395900_0031672_126_1160 344
194 3300037418 Ga0395900_0035466 Ga0395900_0035466_2623_3657 344
195 3300037418 Ga0395900_0285887 Ga0395900_0285887_453_1487 344
196 3300037418 Ga0395900_0334820 Ga0395900_0334820_368_1402 344
197 3300037471 Ga0395905_0027336 Ga0395905_0027336_4118_5152 344
198 3300037471 Ga0395905_0055914 Ga0395905_0055914_1919_2953 344
199 3300038443 Ga0395901_0002710 Ga0395901_0002710_10296_11330 344
200 3300038443 Ga0395901_0002897 Ga0395901_0002897_9579_10613 344
201 3300038443 Ga0395901_0066242 Ga0395901_0066242_1806_2840 344
202 3300038443 Ga0395901_0403054 Ga0395901_0403054_244_1278 344
203 3300039447 Ga0436361_0013073 Ga0436361_0013073_9447_10481 344
204 3300044656 Ga0466969_0002316 Ga0466969_0002316_6742_7776 344
205 3300044658 Ga0466972_0003973 Ga0466972_0003973_2046_3080 344
206 3300044658 Ga0466972_0065816 Ga0466972_0065816_514_1548 344
207 3300044683 Ga0466965_0036795 Ga0466965_0036795_1153_2187 344
208 3300044684 Ga0466966_0001854 Ga0466966_0001854_2220_3254 344
209 3300044693 Ga0466961_0007476 Ga0466961_0007476_5449_6483 344
210 3300044719 Ga0466971_0008161 Ga0466971_0008161_1428_2462 344
211 3300044735 Ga0466968_0003902 Ga0466968_0003902_4195_5229 344
212 3300044842 Ga0466957_0076144 Ga0466957_0076144_637_1677 344
213 3300045049 Ga0466959_0025858 Ga0466959_0025858_712_1746 344
214 3300045049 Ga0466959_0068023 Ga0466959_0068023_698_1732 344
215 3300045051 Ga0451576_0082220 Ga0451576_0082220_1632_2666 344
216 3300046452 Ga0495617_000022 Ga0495617_000022_10610_11650 344
217 3300046453 Ga0495627_000398 Ga0495627_000398_27620_28660 344
218 3300046455 Ga0495603_0046856 Ga0495603_0046856_21_1055 344
219 3300046457 Ga0495590_0000057 Ga0495590_0000057_83228_84271 344
220 3300046457 Ga0495590_0005737 Ga0495590_0005737_801_1835 344
221 3300046458 Ga0495591_000799 Ga0495591_000799_216_1259 344
222 3300046459 Ga0495629_0041378 Ga0495629_0041378_329_1363 344
223 3300046463 Ga0495653_0028893 Ga0495653_0028893_2633_3667 344
224 3300046463 Ga0495653_0062600 Ga0495653_0062600_829_1863 344
225 3300046471 Ga0495650_0002119 Ga0495650_0002119_13835_14869 344
226 3300046473 Ga0495582_0027191 Ga0495582_0027191_573_1607 344
227 3300046474 Ga0495605_0000153 Ga0495605_0000153_77306_78346 344
228 3300046474 Ga0495605_0037236 Ga0495605_0037236_737_1771 344
229 3300046491 Ga0495584_0000729 Ga0495584_0000729_9195_10238 344
230 3300046491 Ga0495584_0009911 Ga0495584_0009911_961_1995 344
231 3300046492 Ga0495585_0022247 Ga0495585_0022247_339_1382 344
232 3300046492 Ga0495585_0065031 Ga0495585_0065031_915_1955 344
233 3300046492 Ga0495585_0142084 Ga0495585_0142084_93_1127 344
234 3300046499 Ga0495594_0068128 Ga0495594_0068128_624_1658 344
235 3300046500 Ga0495596_0001270 Ga0495596_0001270_871_1905 344
236 3300046500 Ga0495596_0019014 Ga0495596_0019014_536_1579 344
237 3300046500 Ga0495596_0039062 Ga0495596_0039062_776_1810 344
238 3300046506 Ga0495583_0000106 Ga0495583_0000106_8244_9278 344
239 3300046506 Ga0495583_0000597 Ga0495583_0000597_33419_34453 344
240 3300046507 Ga0495606_0086803 Ga0495606_0086803_115_1149 344
241 3300046512 Ga0495610_0043732 Ga0495610_0043732_466_1509 344
242 3300046513 Ga0495616_0002388 Ga0495616_0002388_2255_3289 344
243 3300046513 Ga0495616_0018885 Ga0495616_0018885_626_1660 344
244 3300046513 Ga0495616_0029168 Ga0495616_0029168_300_1334 344
245 3300046513 Ga0495616_0034548 Ga0495616_0034548_299_1333 344
246 3300046518 Ga0495631_0001332 Ga0495631_0001332_7801_8841 344
247 3300046518 Ga0495631_0001436 Ga0495631_0001436_5323_6357 344
248 3300046518 Ga0495631_0023308 Ga0495631_0023308_155_1189 344
249 3300046518 Ga0495631_0065120 Ga0495631_0065120_441_1475 344
250 3300046519 Ga0495632_0000052 Ga0495632_0000052_123429_124463 344
251 3300046519 Ga0495632_0000396 Ga0495632_0000396_38675_39709 344
252 3300046519 Ga0495632_0001555 Ga0495632_0001555_9085_10119 344
253 3300046519 Ga0495632_0003734 Ga0495632_0003734_6334_7368 344
254 3300046519 Ga0495632_0012494 Ga0495632_0012494_49_1092 344
255 3300046520 Ga0495637_0000018 Ga0495637_0000018_9274_10317 344
256 3300046522 Ga0495643_0025569 Ga0495643_0025569_265_1308 344
257 3300046523 Ga0495644_0003935 Ga0495644_0003935_4170_5210 344
258 3300046524 Ga0495648_0015868 Ga0495648_0015868_3668_4708 344
259 3300046526 Ga0495666_0007557 Ga0495666_0007557_3617_4651 344
260 3300046528 Ga0495642_0000529 Ga0495642_0000529_10597_11637 344
261 3300046528 Ga0495642_0002545 Ga0495642_0002545_4073_5107 344
262 3300046528 Ga0495642_0042536 Ga0495642_0042536_327_1361 344
263 3300046530 Ga0495654_0021405 Ga0495654_0021405_597_1631 344
264 3300046530 Ga0495654_0031775 Ga0495654_0031775_1187_2227 344
265 3300046536 Ga0495587_0051879 Ga0495587_0051879_1203_2237 344
266 3300046537 Ga0495598_0015527 Ga0495598_0015527_235_1269 344
267 3300046542 Ga0495597_0001411 Ga0495597_0001411_8215_9249 344
268 3300046542 Ga0495597_0002378 Ga0495597_0002378_7621_8655 344
269 3300046542 Ga0495597_0022362 Ga0495597_0022362_516_1550 344
270 3300046558 Ga0495633_0003343 Ga0495633_0003343_9274_10317 344
271 3300046558 Ga0495633_0059388 Ga0495633_0059388_700_1734 344
272 3300046616 Ga0495668_0000211 Ga0495668_0000211_4845_5879 344
273 3300046616 Ga0495668_0097325 Ga0495668_0097325_472_1506 344
274 3300046648 Ga0495611_0001030 Ga0495611_0001030_8428_9471 344
275 3300046648 Ga0495611_0006487 Ga0495611_0006487_1863_2897 344
276 3300046648 Ga0495611_0024927 Ga0495611_0024927_639_1673 344
277 3300046665 Ga0495661_0014026 Ga0495661_0014026_2854_3888 344
278 3300046665 Ga0495661_0146768 Ga0495661_0146768_66_1106 344
279 3300046674 Ga0495588_0056552 Ga0495588_0056552_141_1175 344
280 3300046684 Ga0495669_0000101 Ga0495669_0000101_43205_44239 344
281 3300046684 Ga0495669_0001145 Ga0495669_0001145_598_1632 344
282 3300046689 Ga0495613_0026824 Ga0495613_0026824_2436_3470 344
283 3300046691 Ga0495670_0045941 Ga0495670_0045941_867_1901 344
284 3300046692 Ga0495671_0003330 Ga0495671_0003330_8706_9740 344
285 3300046692 Ga0495671_0038095 Ga0495671_0038095_914_1954 344
286 3300046694 Ga0495649_0000194 Ga0495649_0000194_43205_44239 344
287 3300046794 Ga0495589_0001516 Ga0495589_0001516_456_1496 344
288 3300047317 Ga0495604_0053804 Ga0495604_0053804_666_1700 344
289 3300047318 Ga0495636_0004254 Ga0495636_0004254_3182_4216 344
290 3300047318 Ga0495636_0011954 Ga0495636_0011954_2257_3291 344
291 3300047320 Ga0495672_0000013 Ga0495672_0000013_500549_501583 344
292 3300047320 Ga0495672_0000064 Ga0495672_0000064_193650_194693 344
293 3300047320 Ga0495672_0000512 Ga0495672_0000512_2393_3427 344
294 3300047321 Ga0495676_0000015 Ga0495676_0000015_9608_10642 344
295 3300047322 Ga0495680_0058066 Ga0495680_0058066_1374_2408 344
296 3300047323 Ga0495683_0035949 Ga0495683_0035949_1008_2051 344
297 3300047443 Ga0495687_001055 Ga0495687_001055_7969_9003 344
298 3300047443 Ga0495687_001122 Ga0495687_001122_9562_10602 344
299 3300047445 Ga0495677_0000948 Ga0495677_0000948_9461_10504 344
300 3300047445 Ga0495677_0005995 Ga0495677_0005995_3289_4323 344
301 3300047446 Ga0495679_001332 Ga0495679_001332_5603_6637 344
302 3300047472 Ga0495686_0000620 Ga0495686_0000620_2324_3358 344
303 3300048090 Ga0495615_0004412 Ga0495615_0004412_1022_2056 344
304 3300048091 Ga0495626_0001757 Ga0495626_0001757_8898_9941 344
305 3300048091 Ga0495626_0021084 Ga0495626_0021084_2081_3115 344
306 3300048091 Ga0495626_0023637 Ga0495626_0023637_10_1044 344
307 3300048091 Ga0495626_0052127 Ga0495626_0052127_770_1804 344
308 3300048905 Ga0496102_0000068 Ga0496102_0000068_154749_155789 344
309 3300048905 Ga0496102_0000478 Ga0496102_0000478_34827_35861 344
310 3300048905 Ga0496102_0008640 Ga0496102_0008640_7118_8152 344
311 3300048905 Ga0496102_0017344 Ga0496102_0017344_540_1574 344
312 3300048906 Ga0496103_0039346 Ga0496103_0039346_1431_2465 344
313 3300048907 Ga0496104_0247654 Ga0496104_0247654_263_1297 344
314 3300048910 Ga0496107_0131596 Ga0496107_0131596_61_1095 344
315 3300048911 Ga0496108_0232857 Ga0496108_0232857_240_1280 344
316 3300048911 Ga0496108_0248307 Ga0496108_0248307_345_1385 344
317 3300048913 Ga0496110_0000092 Ga0496110_0000092_37167_38201 344
318 3300048914 Ga0496111_0085754 Ga0496111_0085754_394_1428 344
319 3300048914 Ga0496111_0104260 Ga0496111_0104260_727_1767 344
320 3300048915 Ga0496112_0012572 Ga0496112_0012572_2314_3348 344
321 3300048924 Ga0496121_0282190 Ga0496121_0282190_82_1116 344
322 3300048926 Ga0496123_0000084 Ga0496123_0000084_176940_177974 344
323 3300048928 Ga0496125_0002558 Ga0496125_0002558_209_1243 344
324 3300049459 Ga0495678_000034 Ga0495678_000034_9249_10292 344
325 3300049459 Ga0495678_000383 Ga0495678_000383_8178_9212 344
326 3300049459 Ga0495678_001376 Ga0495678_001376_9534_10568 344
327 3300049568 Ga0501031_0164943 Ga0501031_0164943_263_1297 344
328 3300049571 Ga0501034_0015538 Ga0501034_0015538_1547_2584 344
329 3300049572 Ga0501036_0005297 Ga0501036_0005297_8728_9762 344
330 3300049574 Ga0501038_0242228 Ga0501038_0242228_281_1315 344
331 3300049576 Ga0501040_0004246 Ga0501040_0004246_7744_8778 344
332 3300049577 Ga0501041_0000171 Ga0501041_0000171_16391_17425 344
333 3300049577 Ga0501041_0187064 Ga0501041_0187064_253_1287 344
334 3300049579 Ga0501043_0070467 Ga0501043_0070467_664_1698 344
335 3300049582 Ga0501048_0002988 Ga0501048_0002988_10971_12005 344
336 3300049587 Ga0501071_0075261 Ga0501071_0075261_839_1873 344
337 3300049588 Ga0501072_0002668 Ga0501072_0002668_11749_12783 344
338 3300049589 Ga0501073_0235668 Ga0501073_0235668_81_1115 344
339 3300049591 Ga0501075_0006883 Ga0501075_0006883_2029_3063 344
340 3300049592 Ga0501076_0003325 Ga0501076_0003325_3719_4753 344
341 3300049741 Ga0501079_0046536 Ga0501079_0046536_2202_3236 344
342 3300049743 Ga0501081_0000857 Ga0501081_0000857_15098_16132 344
343 3300049822 Ga0501035_0006010 Ga0501035_0006010_6704_7738 344
344 3300050493 nmdc:mga0k408_49769_c1 nmdc:mga0k408_49769_c1_138_1172 344
345 3300050514 nmdc:mga08x19_17547_c1 nmdc:mga08x19_17547_c1_2404_3438 344
346 3300050514 nmdc:mga08x19_49650_c1 nmdc:mga08x19_49650_c1_453_1487 344
347 3300053086 Ga0500578_0000067 Ga0500578_0000067_111672_112706 344
348 3300053724 Ga0500570_079924 Ga0500570_079924_402_1436 344
349 3300054114 Ga0501084_0013441 Ga0501084_0013441_795_1829 344
350 3300060353 Ga0501082_0002703 Ga0501082_0002703_400_1434 344
351 3300061719 Ga0466962_0015221 Ga0466962_0015221_2124_3158 344
352 3300061734 Ga0530510_0001659 Ga0530510_0001659_11797_12831 344
353 3300002704 JGI25155J39150_1000485 JGI25155J39150_10004852 345
354 3300002705 JGI25156J39149_1000063 JGI25156J39149_10000637 345
355 3300002738 JGI25154J39366_1000412 JGI25154J39366_10004127 345
356 3300002738 JGI25154J39366_1000845 JGI25154J39366_10008457 345
357 3300002738 JGI25154J39366_1001209 JGI25154J39366_10012099 345
358 3300002738 JGI25154J39366_1002200 JGI25154J39366_10022002 345
359 3300002739 JGI25158J39367_1003079 JGI25158J39367_10030792 345
360 3300002741 JGI25157J39369_1000082 JGI25157J39369_100008266 345
361 3300002773 JGI25152J39213_1000953 JGI25152J39213_100095313 345
362 3300002774 JGI25150J39212_1000910 JGI25150J39212_10009105 345
363 3300002774 JGI25150J39212_1003626 JGI25150J39212_10036262 345
364 3300002987 JGI25159J45721_1002200 JGI25159J45721_10022004 345
365 3300003215 JGI25153J46596_10018531 JGI25153J46596_100185312 345
366 3300003354 JGI25160J50197_1003453 JGI25160J50197_10034531 345
367 3300003751 Ga0055538_1000062 Ga0055538_100006283 345
368 3300003752 Ga0055539_1000093 Ga0055539_100009383 345
369 3300003752 Ga0055539_1000303 Ga0055539_100030321 345
370 3300003752 Ga0055539_1000782 Ga0055539_10007823 345
371 3300003756 Ga0055533_1000043 Ga0055533_1000043153 345
372 3300003756 Ga0055533_1000105 Ga0055533_100010583 345
373 3300003759 Ga0055525_1000137 Ga0055525_100013783 345
374 3300003759 Ga0055525_1001495 Ga0055525_10014957 345
375 3300003761 Ga0055535_1000859 Ga0055535_10008597 345
376 3300003763 Ga0055529_1000152 Ga0055529_100015211 345
377 3300003763 Ga0055529_1000725 Ga0055529_10007257 345
378 3300003771 Ga0055526_1000079 Ga0055526_100007972 345
379 3300003771 Ga0055526_1000690 Ga0055526_100069022 345
380 3300003775 Ga0055524_1000237 Ga0055524_10002378 345
381 3300003775 Ga0055524_1000899 Ga0055524_100089910 345
382 3300003775 Ga0055524_1001534 Ga0055524_100153412 345
383 3300003775 Ga0055524_1003281 Ga0055524_10032811 345
384 3300003790 Ga0055528_1002751 Ga0055528_10027514 345
385 3300003791 Ga0055530_10005914 Ga0055530_100059146 345
386 3300003791 Ga0055530_10006075 Ga0055530_100060755 345
387 3300003791 Ga0055530_10023984 Ga0055530_100239842 345
388 3300003794 Ga0055531_10020369 Ga0055531_100203692 345
389 3300003794 Ga0055531_10034762 Ga0055531_100347622 345
390 3300003841 Ga0055541_1000063 Ga0055541_100006383 345
391 3300004625 Ga0055543_1001129 Ga0055543_10011291 345
392 3300004625 Ga0055543_1003826 Ga0055543_10038263 345
393 3300005262 Ga0065165_1002857 Ga0065165_10028575 345
394 3300005262 Ga0065165_1003337 Ga0065165_10033371 345
395 3300005327 Ga0070658_10124620 Ga0070658_101246202 345
396 3300005330 Ga0070690_100037236 Ga0070690_1000372363 345
397 3300005331 Ga0070670_100086718 Ga0070670_1000867183 345
398 3300005364 Ga0070673_100032700 Ga0070673_1000327003 345
399 3300005563 Ga0068855_100009264 Ga0068855_1000092642 345
400 3300005563 Ga0068855_100035272 Ga0068855_1000352727 345
401 3300005563 Ga0068855_100062362 Ga0068855_1000623624 345
402 3300005563 Ga0068855_100120182 Ga0068855_1001201822 345
403 3300005563 Ga0068855_100317591 Ga0068855_1003175912 345
404 3300005577 Ga0068857_100004849 Ga0068857_1000048497 345
405 3300005577 Ga0068857_100367839 Ga0068857_1003678392 345
406 3300005578 Ga0068854_100017165 Ga0068854_1000171653 345
407 3300005578 Ga0068854_100119599 Ga0068854_1001195992 345
408 3300005614 Ga0068856_100002505 Ga0068856_10000250514 345
409 3300005616 Ga0068852_100004430 Ga0068852_1000044305 345
410 3300005719 Ga0068861_100036671 Ga0068861_1000366717 345
411 3300005844 Ga0068862_100019436 Ga0068862_1000194364 345
412 3300006195 Ga0075366_10019447 Ga0075366_100194472 345
413 3300006353 Ga0075370_10011458 Ga0075370_100114587 345
414 3300006844 Ga0075428_100301946 Ga0075428_1003019462 345
415 3300006846 Ga0075430_100179064 Ga0075430_1001790642 345
416 3300006847 Ga0075431_100226597 Ga0075431_1002265972 345
417 3300006881 Ga0068865_100001729 Ga0068865_1000017295 345
418 3300006946 Ga0079104_1000012 Ga0079104_1000012319 345
419 3300006946 Ga0079104_1005592 Ga0079104_10055924 345
420 3300006948 Ga0099826_10000010 Ga0099826_1000001011 345
421 3300007265 Ga0099794_10016101 Ga0099794_100161013 345
422 3300009036 Ga0105244_10003441 Ga0105244_1000344110 345
423 3300009036 Ga0105244_10035827 Ga0105244_100358273 345
424 3300009093 Ga0105240_10016336 Ga0105240_100163363 345
425 3300009093 Ga0105240_10158169 Ga0105240_101581692 345
426 3300009093 Ga0105240_10161523 Ga0105240_101615232 345
427 3300009093 Ga0105240_10190542 Ga0105240_101905422 345
428 3300009147 Ga0114129_10589096 Ga0114129_105890962 345
429 3300009545 Ga0105237_10010944 Ga0105237_100109443 345
430 3300009545 Ga0105237_10359562 Ga0105237_103595621 345
431 3300009551 Ga0105238_10000763 Ga0105238_1000076310 345
432 3300010375 Ga0105239_10010387 Ga0105239_1001038710 345
433 3300011119 Ga0105246_10023704 Ga0105246_100237042 345
434 3300013102 Ga0157371_10000018 Ga0157371_1000001812 345
435 3300013105 Ga0157369_10019171 Ga0157369_100191715 345
436 3300013297 Ga0157378_10007501 Ga0157378_1000750111 345
437 3300015261 Ga0182006_1000080 Ga0182006_100008018 345
438 3300015262 Ga0182007_10005353 Ga0182007_100053534 345
439 3300015262 Ga0182007_10021481 Ga0182007_100214812 345
440 3300015265 Ga0182005_1000016 Ga0182005_100001617 345
441 3300017792 Ga0163161_10012023 Ga0163161_100120232 345
442 3300017792 Ga0163161_10012229 Ga0163161_100122293 345
443 3300021361 Ga0213872_10047661 Ga0213872_100476612 345
444 3300021361 Ga0213872_10049654 Ga0213872_100496542 345
445 3300025206 Ga0209435_100176 Ga0209435_1001762 345
446 3300025208 Ga0209436_100769 Ga0209436_10076913 345
447 3300025208 Ga0209436_104031 Ga0209436_1040314 345
448 3300025224 Ga0209784_100021 Ga0209784_100021373 345
449 3300025225 Ga0209566_100119 Ga0209566_1001199 345
450 3300025226 Ga0209674_100036 Ga0209674_100036373 345
451 3300025226 Ga0209674_100067 Ga0209674_100067154 345
452 3300025230 Ga0209563_100040 Ga0209563_100040373 345
453 3300025230 Ga0209563_100068 Ga0209563_100068154 345
454 3300025231 Ga0207427_101402 Ga0207427_1014022 345
455 3300025233 Ga0209437_100332 Ga0209437_10033210 345
456 3300025242 Ga0209258_100129 Ga0209258_1001297 345
457 3300025242 Ga0209258_101777 Ga0209258_1017775 345
458 3300025245 Ga0207425_1000021 Ga0207425_1000021347 345
459 3300025245 Ga0207425_1000050 Ga0207425_1000050165 345
460 3300025245 Ga0207425_1000829 Ga0207425_10008297 345
461 3300025246 Ga0209646_1000107 Ga0209646_1000107138 345
462 3300025246 Ga0209646_1000190 Ga0209646_100019052 345
463 3300025246 Ga0209646_1000244 Ga0209646_10002447 345
464 3300025250 Ga0209026_1000004 Ga0209026_1000004718 345
465 3300025253 Ga0209677_100023 Ga0209677_100023373 345
466 3300025253 Ga0209677_100049 Ga0209677_1000497 345
467 3300025253 Ga0209677_100413 Ga0209677_1004134 345
468 3300025256 Ga0209759_1000003 Ga0209759_10000037 345
469 3300025256 Ga0209759_1000198 Ga0209759_100019882 345
470 3300025256 Ga0209759_1003928 Ga0209759_10039283 345
471 3300025256 Ga0209759_1004764 Ga0209759_10047644 345
472 3300025256 Ga0209759_1020166 Ga0209759_10201662 345
473 3300025258 Ga0209129_1000020 Ga0209129_1000020418 345
474 3300025263 Ga0209565_1000677 Ga0209565_100067713 345
475 3300025263 Ga0209565_1011047 Ga0209565_10110471 345
476 3300025272 Ga0209455_1000070 Ga0209455_100007012 345
477 3300025272 Ga0209455_1000083 Ga0209455_1000083148 345
478 3300025273 Ga0209673_1003338 Ga0209673_10033386 345
479 3300025284 Ga0209130_1000169 Ga0209130_100016982 345
480 3300025284 Ga0209130_1002260 Ga0209130_100226013 345
481 3300025284 Ga0209130_1006585 Ga0209130_10065854 345
482 3300025291 Ga0209675_1001299 Ga0209675_10012993 345
483 3300025294 Ga0209025_1001876 Ga0209025_100187617 345
484 3300025295 Ga0209564_1000027 Ga0209564_100002713 345
485 3300025295 Ga0209564_1000047 Ga0209564_1000047316 345
486 3300025295 Ga0209564_1000063 Ga0209564_100006310 345
487 3300025295 Ga0209564_1001666 Ga0209564_100166613 345
488 3300025297 Ga0209758_1000288 Ga0209758_100028885 345
489 3300025297 Ga0209758_1000436 Ga0209758_100043610 345
490 3300025298 Ga0209050_1000050 Ga0209050_1000050348 345
491 3300025298 Ga0209050_1001698 Ga0209050_100169820 345
492 3300025299 Ga0209256_1000045 Ga0209256_1000045271 345
493 3300025299 Ga0209256_1000054 Ga0209256_100005412 345
494 3300025299 Ga0209256_1000079 Ga0209256_1000079207 345
495 3300025299 Ga0209256_1000754 Ga0209256_100075412 345
496 3300025299 Ga0209256_1001531 Ga0209256_10015312 345
497 3300025302 Ga0207426_1003112 Ga0207426_10031122 345
498 3300025303 Ga0209051_1028245 Ga0209051_10282453 345
499 3300025304 Ga0209257_1001336 Ga0209257_100133627 345
500 3300025728 Ga0207655_1001651 Ga0207655_100165112 345
501 3300025735 Ga0207713_1064026 Ga0207713_10640262 345
502 3300025913 Ga0207695_10008939 Ga0207695_100089399 345
503 3300025913 Ga0207695_10012318 Ga0207695_100123182 345
504 3300025913 Ga0207695_10025241 Ga0207695_100252412 345
505 3300025913 Ga0207695_10070196 Ga0207695_100701964 345
506 3300025913 Ga0207695_10136114 Ga0207695_101361142 345
507 3300025914 Ga0207671_10004652 Ga0207671_100046529 345
508 3300025914 Ga0207671_10092910 Ga0207671_100929102 345
509 3300025924 Ga0207694_10000343 Ga0207694_100003433 345
510 3300025925 Ga0207650_10063319 Ga0207650_100633193 345
511 3300025935 Ga0207709_10039485 Ga0207709_100394853 345
512 3300025938 Ga0207704_10018780 Ga0207704_100187803 345
513 3300025942 Ga0207689_10018288 Ga0207689_100182882 345
514 3300025949 Ga0207667_10000912 Ga0207667_1000091210 345
515 3300025949 Ga0207667_10007366 Ga0207667_100073662 345
516 3300025949 Ga0207667_10041134 Ga0207667_100411347 345
517 3300025949 Ga0207667_10067556 Ga0207667_100675564 345
518 3300025949 Ga0207667_10098677 Ga0207667_100986772 345
519 3300025949 Ga0207667_10228908 Ga0207667_102289082 345
520 3300025960 Ga0207651_10014547 Ga0207651_100145477 345
521 3300025981 Ga0207640_10041316 Ga0207640_100413163 345
522 3300025981 Ga0207640_10074203 Ga0207640_100742033 345
523 3300026078 Ga0207702_10001231 Ga0207702_1000123116 345
524 3300026116 Ga0207674_10090346 Ga0207674_100903462 345
525 3300027111 Ga0209281_1000039 Ga0209281_10000398 345
526 3300027666 Ga0209282_1000009 Ga0209282_100000911 345
527 3300027682 Ga0209971_1014001 Ga0209971_10140012 345
528 3300028380 Ga0268265_10009579 Ga0268265_1000957910 345
529 3300028381 Ga0268264_10084747 Ga0268264_100847473 345
530 3300028666 Ga0265336_10000371 Ga0265336_100003713 345
531 3300028794 Ga0307515_10062795 Ga0307515_100627957 345
532 3300028794 Ga0307515_10209697 Ga0307515_102096972 345
533 3300029957 Ga0265324_10004594 Ga0265324_100045948 345
534 3300029957 Ga0265324_10026135 Ga0265324_100261353 345
535 3300030744 Ga0316181_1137224 Ga0316181_11372243 345
536 3300031235 Ga0265330_10009515 Ga0265330_100095154 345
537 3300031238 Ga0265332_10000253 Ga0265332_1000025329 345
538 3300031241 Ga0265325_10006633 Ga0265325_100066335 345
539 3300031242 Ga0265329_10001506 Ga0265329_1000150612 345
540 3300031250 Ga0265331_10004185 Ga0265331_1000418510 345
541 3300031251 Ga0265327_10020732 Ga0265327_100207323 345
542 3300031344 Ga0265316_10114733 Ga0265316_101147332 345
543 3300031548 Ga0307408_100000432 Ga0307408_10000043228 345
544 3300031548 Ga0307408_100002407 Ga0307408_1000024074 345
545 3300031548 Ga0307408_100010617 Ga0307408_1000106173 345
546 3300031548 Ga0307408_100227442 Ga0307408_1002274422 345
547 3300031548 Ga0307408_100253356 Ga0307408_1002533562 345
548 3300031711 Ga0265314_10008929 Ga0265314_100089298 345
549 3300031711 Ga0265314_10017740 Ga0265314_100177402 345
550 3300031730 Ga0307516_10030751 Ga0307516_100307513 345
551 3300032002 Ga0307416_100000975 Ga0307416_10000097510 345
552 3300035083 Ga0373926_0010863 Ga0373926_0010863_876_1916 345
553 3300037312 Ga0395899_0179380 Ga0395899_0179380_239_1276 345
554 3300037418 Ga0395900_0000904 Ga0395900_0000904_35677_36714 345
555 3300037466 Ga0395898_0001196 Ga0395898_0001196_2389_3426 345
556 3300037471 Ga0395905_0010442 Ga0395905_0010442_275_1312 345
557 3300037471 Ga0395905_0021728 Ga0395905_0021728_1120_2157 345
558 3300037471 Ga0395905_0036632 Ga0395905_0036632_2508_3557 345
559 3300038443 Ga0395901_0005821 Ga0395901_0005821_9286_10323 345
560 3300039447 Ga0436361_0303014 Ga0436361_0303014_3587_4624 345
561 3300039447 Ga0436361_0314274 Ga0436361_0314274_661_1698 345
562 3300039447 Ga0436361_0930389 Ga0436361_0930389_3768_4805 345
563 3300039447 Ga0436361_1142583 Ga0436361_1142583_1075_2112 345
564 3300042436 Ga0439435_0028631 Ga0439435_0028631_200_1237 345
565 3300042461 Ga0439460_0011810 Ga0439460_0011810_285_1322 345
566 3300042876 Ga0451577_0070287 Ga0451577_0070287_1674_2711 345
567 3300044656 Ga0466969_0007117 Ga0466969_0007117_857_1894 345
568 3300044658 Ga0466972_0000420 Ga0466972_0000420_7980_9017 345
569 3300044658 Ga0466972_0011040 Ga0466972_0011040_50_1087 345
570 3300044683 Ga0466965_0002121 Ga0466965_0002121_3367_4404 345
571 3300044683 Ga0466965_0019993 Ga0466965_0019993_337_1374 345
572 3300044683 Ga0466965_0020012 Ga0466965_0020012_268_1305 345
573 3300044684 Ga0466966_0029228 Ga0466966_0029228_1531_2568 345
574 3300044693 Ga0466961_0027488 Ga0466961_0027488_1318_2355 345
575 3300044706 Ga0466964_0004187 Ga0466964_0004187_2077_3114 345
576 3300044706 Ga0466964_0045872 Ga0466964_0045872_402_1439 345
577 3300044719 Ga0466971_0018165 Ga0466971_0018165_336_1373 345
578 3300044765 Ga0466970_0002134 Ga0466970_0002134_1319_2356 345
579 3300044842 Ga0466957_0015104 Ga0466957_0015104_1703_2740 345
580 3300044842 Ga0466957_0133066 Ga0466957_0133066_152_1189 345
581 3300045049 Ga0466959_0001954 Ga0466959_0001954_9748_10785 345
582 3300045836 Ga0466958_0070166 Ga0466958_0070166_233_1270 345
583 3300046452 Ga0495617_000075 Ga0495617_000075_3375_4412 345
584 3300046452 Ga0495617_001209 Ga0495617_001209_3895_4932 345
585 3300046453 Ga0495627_000011 Ga0495627_000011_14955_15998 345
586 3300046454 Ga0495592_0002825 Ga0495592_0002825_618_1655 345
587 3300046457 Ga0495590_0000143 Ga0495590_0000143_28405_29442 345
588 3300046460 Ga0495638_0001680 Ga0495638_0001680_15327_16364 345
589 3300046462 Ga0495651_0002596 Ga0495651_0002596_12669_13721 345
590 3300046463 Ga0495653_0000044 Ga0495653_0000044_8320_9357 345
591 3300046471 Ga0495650_0000100 Ga0495650_0000100_360_1397 345
592 3300046471 Ga0495650_0001173 Ga0495650_0001173_18632_19669 345
593 3300046471 Ga0495650_0001749 Ga0495650_0001749_10336_11373 345
594 3300046471 Ga0495650_0008196 Ga0495650_0008196_4638_5675 345
595 3300046471 Ga0495650_0012103 Ga0495650_0012103_726_1763 345
596 3300046473 Ga0495582_0038957 Ga0495582_0038957_1467_2507 345
597 3300046474 Ga0495605_0000098 Ga0495605_0000098_8385_9422 345
598 3300046474 Ga0495605_0002046 Ga0495605_0002046_2799_3857 345
599 3300046474 Ga0495605_0020353 Ga0495605_0020353_1582_2619 345
600 3300046491 Ga0495584_0000232 Ga0495584_0000232_35096_36154 345
601 3300046491 Ga0495584_0002317 Ga0495584_0002317_8900_9937 345
602 3300046491 Ga0495584_0067745 Ga0495584_0067745_169_1206 345
603 3300046491 Ga0495584_0094799 Ga0495584_0094799_35_1072 345
604 3300046491 Ga0495584_0147235 Ga0495584_0147235_25_1062 345
605 3300046492 Ga0495585_0000023 Ga0495585_0000023_135941_136978 345
606 3300046492 Ga0495585_0000152 Ga0495585_0000152_943_1998 345
607 3300046492 Ga0495585_0000444 Ga0495585_0000444_3536_4573 345
608 3300046492 Ga0495585_0036679 Ga0495585_0036679_1602_2639 345
609 3300046500 Ga0495596_0004904 Ga0495596_0004904_1802_2839 345
610 3300046501 Ga0495607_0013841 Ga0495607_0013841_217_1254 345
611 3300046501 Ga0495607_0034462 Ga0495607_0034462_1225_2262 345
612 3300046501 Ga0495607_0053231 Ga0495607_0053231_1208_2266 345
613 3300046501 Ga0495607_0060494 Ga0495607_0060494_510_1568 345
614 3300046506 Ga0495583_0000150 Ga0495583_0000150_109506_110564 345
615 3300046506 Ga0495583_0000517 Ga0495583_0000517_27726_28763 345
616 3300046506 Ga0495583_0001383 Ga0495583_0001383_15263_16300 345
617 3300046506 Ga0495583_0001918 Ga0495583_0001918_9796_10854 345
618 3300046507 Ga0495606_0000080 Ga0495606_0000080_716_1753 345
619 3300046507 Ga0495606_0000090 Ga0495606_0000090_146168_147214 345
620 3300046507 Ga0495606_0000099 Ga0495606_0000099_8378_9415 345
621 3300046507 Ga0495606_0000600 Ga0495606_0000600_10580_11617 345
622 3300046507 Ga0495606_0001629 Ga0495606_0001629_27546_28583 345
623 3300046507 Ga0495606_0002603 Ga0495606_0002603_11241_12278 345
624 3300046511 Ga0495608_0026406 Ga0495608_0026406_1666_2718 345
625 3300046511 Ga0495608_0026533 Ga0495608_0026533_949_1986 345
626 3300046512 Ga0495610_0000668 Ga0495610_0000668_23957_24994 345
627 3300046512 Ga0495610_0013362 Ga0495610_0013362_410_1447 345
628 3300046513 Ga0495616_0000490 Ga0495616_0000490_25645_26682 345
629 3300046513 Ga0495616_0006823 Ga0495616_0006823_4016_5074 345
630 3300046514 Ga0495618_0063746 Ga0495618_0063746_384_1421 345
631 3300046516 Ga0495628_0000382 Ga0495628_0000382_31001_32038 345
632 3300046516 Ga0495628_0002078 Ga0495628_0002078_2179_3231 345
633 3300046520 Ga0495637_0000195 Ga0495637_0000195_37802_38839 345
634 3300046522 Ga0495643_0000109 Ga0495643_0000109_8085_9122 345
635 3300046522 Ga0495643_0000250 Ga0495643_0000250_8526_9563 345
636 3300046522 Ga0495643_0001163 Ga0495643_0001163_15896_16933 345
637 3300046523 Ga0495644_0001124 Ga0495644_0001124_1060_2118 345
638 3300046524 Ga0495648_0001108 Ga0495648_0001108_23149_24207 345
639 3300046524 Ga0495648_0001296 Ga0495648_0001296_15295_16332 345
640 3300046524 Ga0495648_0001297 Ga0495648_0001297_8539_9576 345
641 3300046524 Ga0495648_0001425 Ga0495648_0001425_12120_13157 345
642 3300046524 Ga0495648_0003753 Ga0495648_0003753_8604_9641 345
643 3300046524 Ga0495648_0012427 Ga0495648_0012427_3163_4200 345
644 3300046524 Ga0495648_0012934 Ga0495648_0012934_365_1402 345
645 3300046524 Ga0495648_0030615 Ga0495648_0030615_1651_2688 345
646 3300046526 Ga0495666_0006871 Ga0495666_0006871_804_1841 345
647 3300046528 Ga0495642_0003891 Ga0495642_0003891_634_1671 345
648 3300046528 Ga0495642_0004563 Ga0495642_0004563_1464_2501 345
649 3300046528 Ga0495642_0011219 Ga0495642_0011219_1089_2126 345
650 3300046528 Ga0495642_0068412 Ga0495642_0068412_223_1260 345
651 3300046530 Ga0495654_0000030 Ga0495654_0000030_8353_9390 345
652 3300046530 Ga0495654_0018430 Ga0495654_0018430_791_1828 345
653 3300046531 Ga0495665_0001301 Ga0495665_0001301_698_1735 345
654 3300046531 Ga0495665_0024697 Ga0495665_0024697_255_1295 345
655 3300046535 Ga0495586_0115342 Ga0495586_0115342_190_1227 345
656 3300046538 Ga0495609_0002820 Ga0495609_0002820_5149_6186 345
657 3300046538 Ga0495609_0005405 Ga0495609_0005405_1048_2085 345
658 3300046538 Ga0495609_0007869 Ga0495609_0007869_532_1590 345
659 3300046539 Ga0495621_0013856 Ga0495621_0013856_1129_2166 345
660 3300046542 Ga0495597_0001115 Ga0495597_0001115_16075_17112 345
661 3300046542 Ga0495597_0001285 Ga0495597_0001285_8924_9961 345
662 3300046542 Ga0495597_0073848 Ga0495597_0073848_404_1441 345
663 3300046543 Ga0495645_0068890 Ga0495645_0068890_472_1509 345
664 3300046557 Ga0495622_0000044 Ga0495622_0000044_111088_112125 345
665 3300046557 Ga0495622_0004973 Ga0495622_0004973_4363_5400 345
666 3300046558 Ga0495633_0000917 Ga0495633_0000917_8622_9659 345
667 3300046616 Ga0495668_0000035 Ga0495668_0000035_230566_231603 345
668 3300046616 Ga0495668_0000286 Ga0495668_0000286_60430_61467 345
669 3300046616 Ga0495668_0000939 Ga0495668_0000939_17346_18383 345
670 3300046616 Ga0495668_0001545 Ga0495668_0001545_19764_20801 345
671 3300046616 Ga0495668_0004452 Ga0495668_0004452_4115_5152 345
672 3300046616 Ga0495668_0004605 Ga0495668_0004605_8575_9612 345
673 3300046616 Ga0495668_0012596 Ga0495668_0012596_3383_4420 345
674 3300046648 Ga0495611_0003988 Ga0495611_0003988_1849_2907 345
675 3300046648 Ga0495611_0012387 Ga0495611_0012387_1829_2866 345
676 3300046648 Ga0495611_0050001 Ga0495611_0050001_33_1070 345
677 3300046660 Ga0495625_0000338 Ga0495625_0000338_69321_70358 345
678 3300046660 Ga0495625_0001765 Ga0495625_0001765_8680_9717 345
679 3300046660 Ga0495625_0016076 Ga0495625_0016076_4016_5074 345
680 3300046660 Ga0495625_0032153 Ga0495625_0032153_2824_3861 345
681 3300046660 Ga0495625_0032657 Ga0495625_0032657_1592_2662 345
682 3300046664 Ga0495659_0000139 Ga0495659_0000139_2963_4033 345
683 3300046664 Ga0495659_0006513 Ga0495659_0006513_920_1978 345
684 3300046664 Ga0495659_0012720 Ga0495659_0012720_751_1788 345
685 3300046665 Ga0495661_0028811 Ga0495661_0028811_2272_3309 345
686 3300046665 Ga0495661_0064889 Ga0495661_0064889_633_1670 345
687 3300046678 Ga0495599_0009879 Ga0495599_0009879_737_1774 345
688 3300046679 Ga0495623_0019111 Ga0495623_0019111_650_1702 345
689 3300046681 Ga0495647_0004533 Ga0495647_0004533_2673_3713 345
690 3300046681 Ga0495647_0034374 Ga0495647_0034374_774_1811 345
691 3300046683 Ga0495658_0216304 Ga0495658_0216304_29_1069 345
692 3300046684 Ga0495669_0000495 Ga0495669_0000495_9725_10762 345
693 3300046689 Ga0495613_0111034 Ga0495613_0111034_585_1625 345
694 3300046690 Ga0495624_0004359 Ga0495624_0004359_2624_3661 345
695 3300046690 Ga0495624_0020490 Ga0495624_0020490_2837_3874 345
696 3300046690 Ga0495624_0083235 Ga0495624_0083235_881_1918 345
697 3300046691 Ga0495670_0000859 Ga0495670_0000859_6411_7469 345
698 3300046692 Ga0495671_0000087 Ga0495671_0000087_83313_84383 345
699 3300046692 Ga0495671_0000605 Ga0495671_0000605_16851_17888 345
700 3300046692 Ga0495671_0003550 Ga0495671_0003550_2565_3623 345
701 3300046694 Ga0495649_0000702 Ga0495649_0000702_2144_3181 345
702 3300046694 Ga0495649_0016852 Ga0495649_0016852_1187_2224 345
703 3300046694 Ga0495649_0027581 Ga0495649_0027581_1792_2829 345
704 3300046794 Ga0495589_0018768 Ga0495589_0018768_1616_2653 345
705 3300046810 Ga0495660_0004751 Ga0495660_0004751_118_1161 345
706 3300046810 Ga0495660_0028271 Ga0495660_0028271_740_1777 345
707 3300047315 Ga0495581_0001539 Ga0495581_0001539_9443_10483 345
708 3300047317 Ga0495604_0071554 Ga0495604_0071554_1085_2122 345
709 3300047318 Ga0495636_0003424 Ga0495636_0003424_912_1970 345
710 3300047318 Ga0495636_0120545 Ga0495636_0120545_21_1058 345
711 3300047320 Ga0495672_0001189 Ga0495672_0001189_13867_14937 345
712 3300047320 Ga0495672_0004405 Ga0495672_0004405_10246_11283 345
713 3300047320 Ga0495672_0033064 Ga0495672_0033064_856_1914 345
714 3300047320 Ga0495672_0084898 Ga0495672_0084898_443_1480 345
715 3300047323 Ga0495683_0000036 Ga0495683_0000036_9618_10655 345
716 3300047323 Ga0495683_0005881 Ga0495683_0005881_2126_3163 345
717 3300047323 Ga0495683_0006168 Ga0495683_0006168_3890_4948 345
718 3300047443 Ga0495687_000057 Ga0495687_000057_177958_179016 345
719 3300047443 Ga0495687_007401 Ga0495687_007401_5214_6251 345
720 3300047445 Ga0495677_0005204 Ga0495677_0005204_3303_4361 345
721 3300047446 Ga0495679_019405 Ga0495679_019405_900_1937 345
722 3300047447 Ga0495685_000299 Ga0495685_000299_8077_9135 345
723 3300047447 Ga0495685_032368 Ga0495685_032368_712_1749 345
724 3300047469 Ga0495673_0000069 Ga0495673_0000069_208782_209819 345
725 3300047469 Ga0495673_0000203 Ga0495673_0000203_8509_9546 345
726 3300047469 Ga0495673_0000236 Ga0495673_0000236_69888_70925 345
727 3300047472 Ga0495686_0001028 Ga0495686_0001028_1541_2578 345
728 3300047472 Ga0495686_0006069 Ga0495686_0006069_3295_4332 345
729 3300047472 Ga0495686_0066701 Ga0495686_0066701_142_1179 345
730 3300048091 Ga0495626_0000998 Ga0495626_0000998_15060_16097 345
731 3300048091 Ga0495626_0002805 Ga0495626_0002805_2955_3992 345
732 3300048091 Ga0495626_0005031 Ga0495626_0005031_5924_6961 345
733 3300048091 Ga0495626_0094330 Ga0495626_0094330_217_1254 345
734 3300048907 Ga0496104_0072060 Ga0496104_0072060_854_1891 345
735 3300048919 Ga0496116_0044055 Ga0496116_0044055_854_1891 345
736 3300048919 Ga0496116_0050153 Ga0496116_0050153_1317_2360 345
737 3300048924 Ga0496121_0043951 Ga0496121_0043951_1812_2849 345
738 3300048924 Ga0496121_0057712 Ga0496121_0057712_1272_2309 345
739 3300048924 Ga0496121_0057725 Ga0496121_0057725_2030_3067 345
740 3300048925 Ga0496122_0114896 Ga0496122_0114896_258_1295 345
741 3300048926 Ga0496123_0004216 Ga0496123_0004216_3407_4444 345
742 3300048929 Ga0496126_0114487 Ga0496126_0114487_780_1817 345
743 3300049459 Ga0495678_000010 Ga0495678_000010_15929_16972 345
744 3300049459 Ga0495678_000095 Ga0495678_000095_107812_108849 345
745 3300049459 Ga0495678_009739 Ga0495678_009739_1744_2802 345
746 3300049459 Ga0495678_013065 Ga0495678_013065_2755_3792 345
747 3300049459 Ga0495678_013343 Ga0495678_013343_249_1286 345
748 3300049460 Ga0495682_0000432 Ga0495682_0000432_1363_2421 345
749 3300049665 Ga0501227_004729 Ga0501227_004729_1783_2820 345
750 3300049671 Ga0501238_001560 Ga0501238_001560_604_1641 345
751 3300049775 Ga0501279_002860 Ga0501279_002860_225_1262 345
752 3300049822 Ga0501035_0290214 Ga0501035_0290214_123_1160 345
753 3300050496 nmdc:mga07m45_666_c1 nmdc:mga07m45_666_c1_2607_3644 345
754 3300050496 nmdc:mga07m45_68728_c1 nmdc:mga07m45_68728_c1_708_1745 345
755 3300053077 Ga0495601_0011317 Ga0495601_0011317_680_1717 345
756 3300053084 Ga0495595_0131424 Ga0495595_0131424_28_1068 345
757 3300053085 Ga0495619_0037112 Ga0495619_0037112_1283_2323 345
758 3300053125 Ga0500618_000653 Ga0500618_000653_8341_9378 345
759 3300053141 Ga0500574_000047 Ga0500574_000047_5682_6719 345
760 3300053145 Ga0500586_000912 Ga0500586_000912_3299_4336 345
761 3300005444 Ga0070694_100004413 Ga0070694_1000044132 346
762 3300005545 Ga0070695_100020091 Ga0070695_1000200912 346
763 3300005549 Ga0070704_100033986 Ga0070704_1000339863 346
764 3300006846 Ga0075430_100008118 Ga0075430_1000081184 346
765 3300006847 Ga0075431_100039309 Ga0075431_1000393094 346
766 3300025917 Ga0207660_10078923 Ga0207660_100789232 346
767 3300031344 Ga0265316_10004517 Ga0265316_1000451710 346
768 3300035172 Ga0373955_0080618 Ga0373955_0080618_375_1415 346
769 3300035410 Ga0373924_0006584 Ga0373924_0006584_3018_4058 346
770 3300035724 Ga0373933_0039388 Ga0373933_0039388_206_1246 346
771 3300036401 Ga0373937_0001073 Ga0373937_0001073_2567_3607 346
772 3300037471 Ga0395905_0000161 Ga0395905_0000161_80313_81356 346
773 3300042001 Ga0439441_009995 Ga0439441_009995_163_1203 346
774 3300042156 Ga0439446_0016659 Ga0439446_0016659_891_1934 346
775 3300046511 Ga0495608_0127594 Ga0495608_0127594_232_1272 346
776 3300048913 Ga0496110_0067148 Ga0496110_0067148_1508_2554 346
777 3300049574 Ga0501038_0138702 Ga0501038_0138702_569_1609 346
778 3300049576 Ga0501040_0034002 Ga0501040_0034002_1788_2828 346
779 3300049577 Ga0501041_0015653 Ga0501041_0015653_3036_4076 346
780 3300049578 Ga0501042_0148935 Ga0501042_0148935_18_1058 346
781 3300049578 Ga0501042_0243691 Ga0501042_0243691_26_1066 346
782 3300049588 Ga0501072_0001613 Ga0501072_0001613_6056_7096 346
783 3300049592 Ga0501076_0000429 Ga0501076_0000429_11605_12645 346
784 3300049593 Ga0501077_0201709 Ga0501077_0201709_91_1131 346
785 3300049742 Ga0501080_0016392 Ga0501080_0016392_5664_6704 346
786 3300061734 Ga0530510_0008175 Ga0530510_0008175_5795_6835 346
787 3300037312 Ga0395899_0003830 Ga0395899_0003830_3575_4621 347
788 3300037466 Ga0395898_0144923 Ga0395898_0144923_791_1837 347
789 3300046471 Ga0495650_0000082 Ga0495650_0000082_28218_29261 347
790 3300053154 Ga0500619_000149 Ga0500619_000149_14109_15155 347
791 3300046513 Ga0495616_0004647 Ga0495616_0004647_6925_7971 348
792 3300006948 Ga0099826_10000024 Ga0099826_10000024147 349
793 3300009011 Ga0105251_10007888 Ga0105251_100078885 349
794 3300025294 Ga0209025_1000473 Ga0209025_100047316 349
795 3300025303 Ga0209051_1017263 Ga0209051_10172633 349
796 3300027666 Ga0209282_1000032 Ga0209282_100003219 349
797 3300046500 Ga0495596_0000683 Ga0495596_0000683_16237_17325 349
798 3300046512 Ga0495610_0002272 Ga0495610_0002272_14997_16085 349
799 3300046513 Ga0495616_0073217 Ga0495616_0073217_451_1539 349
800 3300046522 Ga0495643_0003256 Ga0495643_0003256_6795_7865 349
801 3300046538 Ga0495609_0008324 Ga0495609_0008324_3878_4966 349
802 3300046665 Ga0495661_0004739 Ga0495661_0004739_5782_6852 349
803 3300046692 Ga0495671_0003108 Ga0495671_0003108_873_1961 349
804 3300003187 JGI25151J46595_10001452 JGI25151J46595_100014522 350
805 3300003775 Ga0055524_1008782 Ga0055524_10087823 350
806 3300003784 Ga0055534_1003569 Ga0055534_10035696 350
807 3300025263 Ga0209565_1009659 Ga0209565_10096593 350
808 3300025291 Ga0209675_1000753 Ga0209675_10007537 350
809 3300025291 Ga0209675_1003114 Ga0209675_10031146 350
810 3300025294 Ga0209025_1000516 Ga0209025_100051641 350
811 3300025294 Ga0209025_1002453 Ga0209025_10024539 350
812 3300025299 Ga0209256_1003694 Ga0209256_10036946 350
813 3300025303 Ga0209051_1006479 Ga0209051_10064797 350
814 iso_pu_bacteria 2513237150 2513956583 350
815 iso_pu_bacteria 644736347 644749093 350
816 3300003781 Ga0055536_1000249 Ga0055536_100024914 351
817 3300003784 Ga0055534_1005272 Ga0055534_10052722 351
818 3300025291 Ga0209675_1000156 Ga0209675_100015658 351
819 3300025292 Ga0209676_1000364 Ga0209676_100036452 351
820 3300025294 Ga0209025_1000417 Ga0209025_100041752 351
821 3300025295 Ga0209564_1000658 Ga0209564_100065845 351
822 3300025295 Ga0209564_1000709 Ga0209564_10007093 351
823 3300046522 Ga0495643_0021689 Ga0495643_0021689_263_1324 353
824 3300047470 Ga0495681_0001009 Ga0495681_0001009_17586_18647 353
825 iso_pu_bacteria 2513237165 2514044119 353
826 3300015261 Ga0182006_1000033 Ga0182006_100003312 354
827 3300015262 Ga0182007_10000042 Ga0182007_1000004212 354
828 3300015265 Ga0182005_1000024 Ga0182005_1000024210 354
829 3300046558 Ga0495633_0006937 Ga0495633_0006937_3590_4669 354
830 3300048919 Ga0496116_0010336 Ga0496116_0010336_3596_4675 354
831 3300048924 Ga0496121_0018725 Ga0496121_0018725_270_1349 354
832 3300048925 Ga0496122_0020064 Ga0496122_0020064_1653_2732 354
833 3300048926 Ga0496123_0001425 Ga0496123_0001425_3323_4402 354
834 3300048928 Ga0496125_0089020 Ga0496125_0089020_1154_2233 354
835 3300048917 Ga0496114_0079489 Ga0496114_0079489_396_1472 355
836 3300048928 Ga0496125_0000368 Ga0496125_0000368_76591_77667 355
837 3300015261 Ga0182006_1025436 Ga0182006_10254363 356
838 iso_pu_bacteria 2818991445 2819594068 356
839 3300009093 Ga0105240_10001608 Ga0105240_1000160830 358
840 3300014497 Ga0182008_10056599 Ga0182008_100565992 358
841 3300048924 Ga0496121_0106030 Ga0496121_0106030_996_2072 358
842 3300048925 Ga0496122_0003525 Ga0496122_0003525_10529_11605 358
843 3300048926 Ga0496123_0003683 Ga0496123_0003683_5375_6451 358
844 3300037471 Ga0395905_0044844 Ga0395905_0044844_250_1374 359
845 3300002704 JGI25155J39150_1000336 JGI25155J39150_10003362 360
846 3300002705 JGI25156J39149_1000267 JGI25156J39149_10002673 360
847 3300002738 JGI25154J39366_1000739 JGI25154J39366_100073913 360
848 3300002741 JGI25157J39369_1000372 JGI25157J39369_100037210 360
849 3300002741 JGI25157J39369_1000495 JGI25157J39369_100049522 360
850 3300003758 Ga0055532_1000034 Ga0055532_100003410 360
851 3300025206 Ga0209435_100007 Ga0209435_10000710 360
852 3300025229 Ga0209147_100017 Ga0209147_100017462 360
853 3300025242 Ga0209258_101277 Ga0209258_10127711 360
854 3300025246 Ga0209646_1000044 Ga0209646_1000044303 360
855 3300025250 Ga0209026_1000063 Ga0209026_100006310 360
856 3300025256 Ga0209759_1000048 Ga0209759_100004810 360
857 3300046492 Ga0495585_0063062 Ga0495585_0063062_820_1971 360
858 3300046500 Ga0495596_0000032 Ga0495596_0000032_100414_101511 360
859 3300046542 Ga0495597_0018630 Ga0495597_0018630_1129_2217 360

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00591

Glycos_transf_3

Glycosyl transferase family, a/b domain

105

357

0.99

PF02885

Glycos_trans_3N

Glycosyl transferase family, helical bundle domain

35

97

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hkm-assembly1.cif.gz_A crystal structure of an anthranilate phosphoribosyltransferase (target id nysgrc-016600) from xanthomonas campestris 0.9835 18 355
4hkm-assembly2.cif.gz_B crystal structure of an anthranilate phosphoribosyltransferase (target id nysgrc-016600) from xanthomonas campestris 0.9825 18 355
4hkm-assembly2.cif.gz_B crystal structure of an anthranilate phosphoribosyltransferase (target id nysgrc-016600) from xanthomonas campestris 0.9708 18 355
4hkm-assembly1.cif.gz_A crystal structure of an anthranilate phosphoribosyltransferase (target id nysgrc-016600) from xanthomonas campestris 0.9682 18 355
1zyk-assembly2.cif.gz_B anthranilate phosphoribosyltransferase in complex with prpp, anthranilate and magnesium 0.965 18 352
ID Description Score Start End Superfamily
4hkmA02 Alpha Beta;3-Layer(aba) Sandwich;Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2;Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 0.9856 88 355 3.40.1030.10
4yi7A01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9757 20 87 1.20.970.10
af_Q57686_71_335_3.40.1030.10 Alpha Beta;3-Layer(aba) Sandwich;Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2;Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 0.9747 94 354 3.40.1030.10
af_K7WHC8_126_393_3.40.1030.10 Alpha Beta;3-Layer(aba) Sandwich;Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2;Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 0.9746 90 353 3.40.1030.10
4gtnA01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9717 20 87 1.20.970.10
ID Description Score Start End GO Terms
AF-B2JHI7-F1-model_v4 Anthranilate phosphoribosyltransferase (EC 2.4.2.18) 0.9955 18 355 GO:0000162
GO:0000287
GO:0004048
GO:0005829
AF-A0A1N6L9L8-F1-model_v4 Anthranilate phosphoribosyltransferase (EC 2.4.2.18) 0.9954 16 355 GO:0000162
GO:0000287
GO:0004048
GO:0005829
AF-Q62DC9-F1-model_v4 Anthranilate phosphoribosyltransferase (EC 2.4.2.18) 0.9953 16 355 GO:0000162
GO:0000287
GO:0004048
GO:0005829
AF-A0A244DQT8-F1-model_v4 deleted 0.9948 18 355
AF-A0A6N6W577-F1-model_v4 Anthranilate phosphoribosyltransferase (EC 2.4.2.18) 0.9948 16 355 GO:0000162
GO:0000287
GO:0004048
GO:0005829

Feature Viewer

pLDDT pTM Quality
91.26 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map