F483783
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 859 | 456 | 771 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300035695|Ga0373927_0026775|Ga0373927_0026775_919_1860 |
| Length | 313 |
| Sequence | VAPVPGNPSSHAFIKNEAYMRPESLPTSDVIGLTKTAPLSRRGFMTASAAVAAGYTLAAGPVRADVIKTNTNGLTAGDARIKVADGEMPGYFARPANAANPPVVLVAMEIFGLHEYIRDVARRLAKLGAFAVAPDYYFRKGDLTRITDIPQLLPLVNAKPDAELLSDLDSTVAWAKSQGADTSRLGIIGFCRGGRTVWEYAAHSPALKAGAAFYGPPVDPPNPLWPKSPMQLAPEMKAAVIGLYGEADSGIPVAQVEAFKAALAANNKTAEFKIYPGAPHGFHADYRASYRKDAAEDAWNQMQAWFRKYGVLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 3 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 4 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 5 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 6 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 7 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 8 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 9 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 10 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 11 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 12 | 2791355199 | |||
| 13 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 14 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 15 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 16 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 17 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 18 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 19 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 20 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 21 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 22 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 23 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 24 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 25 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 26 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 27 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 28 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 29 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 30 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 31 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 32 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 33 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 34 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 35 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 36 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 37 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 38 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 39 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 40 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 41 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 42 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 43 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 44 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 45 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 46 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 47 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 48 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 49 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 50 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 51 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 52 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 53 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 54 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 55 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 56 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 57 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 58 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 59 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 60 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 61 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 62 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 63 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 64 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 65 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 66 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 67 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 68 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 69 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 70 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 71 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 72 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 73 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 74 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 75 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 76 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 77 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 78 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 79 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 81 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 82 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 83 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 86 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 89 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 91 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 104 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 105 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 107 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 112 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 113 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 114 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 115 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 116 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 117 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 118 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 119 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 120 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 121 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 122 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 123 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 124 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 125 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 126 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 127 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 129 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 130 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 131 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 132 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 133 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 134 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 135 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 136 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 137 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 139 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 140 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 141 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 142 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 143 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 144 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 146 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 147 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 157 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 169 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 228 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 230 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 232 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 234 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 235 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 236 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 239 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 240 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 241 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 243 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 244 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 245 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 246 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 247 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 251 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 252 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 254 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 255 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 257 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 258 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 262 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 263 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 264 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 265 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 266 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 267 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 268 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 271 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 272 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 273 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 274 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 275 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 276 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 277 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 278 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 279 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 280 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 281 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 282 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 350 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 351 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 352 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 353 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 354 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 355 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 358 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 359 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 360 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 361 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 362 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 363 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 364 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 365 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 366 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 367 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 368 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 369 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 370 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 371 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 372 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 397 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 398 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 399 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 400 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 401 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 402 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 403 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 409 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 412 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 415 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 416 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 417 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 418 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 419 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 420 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 421 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 422 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 423 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 424 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 425 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 426 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 427 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 428 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 429 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 430 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 431 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 432 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 433 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 434 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 435 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 436 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 437 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 438 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 439 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 440 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 441 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 442 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 444 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 446 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 447 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 448 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 449 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 450 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 451 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 452 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 453 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 454 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 455 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 456 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.74 |
| Metatranscriptomes | 0.12 |
| Isolates | 10.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.13 |
| Nodule | 8.73 |
| Rhizoplane | 5.7 |
| Rhizosphere | 67.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1014668 | 3300000549 | Bacteria | 919 |
| 2 | JGI24739J22299_10016256 | 3300001989 | Bacteria | 2695 |
| 3 | JGI25406J46586_10000165 | 3300003203 | Bacteria | 29331 |
| 4 | JGI25165J46597_1006630 | 3300003214 | Bacteria | 2029 |
| 5 | JGI25153J46596_10000575 | 3300003215 | Bacteria | 22652 |
| 6 | Ga0055525_1004330 | 3300003759 | Bacteria | 1224 |
| 7 | Ga0070658_10099672 | 3300005327 | Bacteria | 2400 |
| 8 | Ga0070683_100043524 | 3300005329 | Bacteria | 4138 |
| 9 | Ga0068869_100057695 | 3300005334 | Bacteria | 2835 |
| 10 | Ga0068869_100074094 | 3300005334 | Bacteria | 2526 |
| 11 | Ga0070680_100015252 | 3300005336 | Bacteria | 6020 |
| 12 | Ga0070680_100187112 | 3300005336 | Bacteria | 1744 |
| 13 | Ga0070682_100342676 | 3300005337 | Bacteria | 1111 |
| 14 | Ga0068868_100062156 | 3300005338 | Bacteria | 2959 |
| 15 | Ga0070660_100045327 | 3300005339 | Bacteria | 3365 |
| 16 | Ga0070660_100081978 | 3300005339 | Bacteria | 2532 |
| 17 | Ga0070660_100195360 | 3300005339 | Bacteria | 1640 |
| 18 | Ga0070689_100098548 | 3300005340 | Bacteria | 2312 |
| 19 | Ga0070691_10025379 | 3300005341 | Bacteria | 2759 |
| 20 | Ga0070668_100012163 | 3300005347 | Bacteria | 6408 |
| 21 | Ga0070668_100164813 | 3300005347 | Bacteria | 1800 |
| 22 | Ga0070675_100085365 | 3300005354 | Bacteria | 2637 |
| 23 | Ga0070675_100181162 | 3300005354 | Bacteria | 1822 |
| 24 | Ga0070675_100374362 | 3300005354 | Bacteria | 1267 |
| 25 | Ga0070659_100009316 | 3300005366 | Bacteria | 7210 |
| 26 | Ga0070659_100042620 | 3300005366 | Bacteria | 3549 |
| 27 | Ga0070709_10000506 | 3300005434 | Bacteria | 23004 |
| 28 | Ga0070709_10006029 | 3300005434 | Bacteria | 6590 |
| 29 | Ga0070709_10008240 | 3300005434 | Bacteria | 5725 |
| 30 | Ga0070709_10018713 | 3300005434 | Bacteria | 3995 |
| 31 | Ga0070709_10139333 | 3300005434 | Bacteria | 1665 |
| 32 | Ga0070709_10174801 | 3300005434 | Bacteria | 1503 |
| 33 | Ga0070714_100001330 | 3300005435 | Bacteria | 17843 |
| 34 | Ga0070714_100016718 | 3300005435 | Bacteria | 5932 |
| 35 | Ga0070713_100005814 | 3300005436 | Bacteria | 8478 |
| 36 | Ga0070713_100023991 | 3300005436 | Bacteria | 4743 |
| 37 | Ga0070713_100031315 | 3300005436 | Bacteria | 4236 |
| 38 | Ga0070713_100158058 | 3300005436 | Bacteria | 2022 |
| 39 | Ga0070713_100358239 | 3300005436 | Bacteria | 1355 |
| 40 | Ga0070710_10000386 | 3300005437 | Bacteria | 20587 |
| 41 | Ga0070710_10002397 | 3300005437 | Bacteria | 8873 |
| 42 | Ga0070710_10012971 | 3300005437 | Bacteria | 4156 |
| 43 | Ga0070710_10062026 | 3300005437 | Bacteria | 2131 |
| 44 | Ga0070711_100001793 | 3300005439 | Bacteria | 11956 |
| 45 | Ga0070711_100011103 | 3300005439 | Bacteria | 5588 |
| 46 | Ga0070711_100172690 | 3300005439 | Bacteria | 1649 |
| 47 | Ga0070663_100014179 | 3300005455 | Bacteria | 5110 |
| 48 | Ga0070663_100171895 | 3300005455 | Bacteria | 1675 |
| 49 | Ga0070663_100280125 | 3300005455 | Bacteria | 1328 |
| 50 | Ga0070663_100409278 | 3300005455 | Bacteria | 1110 |
| 51 | Ga0070663_100412290 | 3300005455 | Bacteria | 1106 |
| 52 | Ga0070663_100511417 | 3300005455 | Bacteria | 999 |
| 53 | Ga0070678_100084575 | 3300005456 | Bacteria | 2415 |
| 54 | Ga0070662_100017516 | 3300005457 | Bacteria | 4832 |
| 55 | Ga0070681_10005340 | 3300005458 | Bacteria | 12402 |
| 56 | Ga0070679_100020251 | 3300005530 | Bacteria | 6483 |
| 57 | Ga0070679_100156183 | 3300005530 | Bacteria | 2256 |
| 58 | Ga0070684_100014216 | 3300005535 | Bacteria | 6440 |
| 59 | Ga0070684_100015972 | 3300005535 | Bacteria | 6131 |
| 60 | Ga0070684_100175465 | 3300005535 | Bacteria | 1948 |
| 61 | Ga0068853_100002345 | 3300005539 | Bacteria | 14158 |
| 62 | Ga0068853_100208048 | 3300005539 | Bacteria | 1782 |
| 63 | Ga0068853_100232611 | 3300005539 | Bacteria | 1686 |
| 64 | Ga0070695_100012117 | 3300005545 | Bacteria | 5168 |
| 65 | Ga0070695_100198632 | 3300005545 | Bacteria | 1432 |
| 66 | Ga0070696_100012886 | 3300005546 | Bacteria | 5612 |
| 67 | Ga0070693_100067557 | 3300005547 | Bacteria | 2096 |
| 68 | Ga0070693_100153420 | 3300005547 | Bacteria | 1461 |
| 69 | Ga0070693_100169874 | 3300005547 | Bacteria | 1396 |
| 70 | Ga0070665_100008978 | 3300005548 | Bacteria | 10129 |
| 71 | Ga0070665_100013701 | 3300005548 | Bacteria | 8159 |
| 72 | Ga0070665_100124385 | 3300005548 | Bacteria | 2581 |
| 73 | Ga0068855_100035619 | 3300005563 | Bacteria | 5928 |
| 74 | Ga0068855_100123641 | 3300005563 | Bacteria | 2960 |
| 75 | Ga0068855_100288104 | 3300005563 | Bacteria | 1821 |
| 76 | Ga0068855_100746804 | 3300005563 | Bacteria | 1044 |
| 77 | Ga0068857_100070074 | 3300005577 | Bacteria | 3123 |
| 78 | Ga0068856_100081355 | 3300005614 | Bacteria | 3213 |
| 79 | Ga0068856_100292181 | 3300005614 | Bacteria | 1647 |
| 80 | Ga0068852_100093823 | 3300005616 | Bacteria | 2691 |
| 81 | Ga0068852_100474740 | 3300005616 | Bacteria | 1242 |
| 82 | Ga0068859_100072274 | 3300005617 | Bacteria | 3486 |
| 83 | Ga0068859_100253602 | 3300005617 | Bacteria | 1850 |
| 84 | Ga0068859_100292654 | 3300005617 | Bacteria | 1721 |
| 85 | Ga0068859_100417629 | 3300005617 | Bacteria | 1438 |
| 86 | Ga0068864_100068900 | 3300005618 | Bacteria | 3075 |
| 87 | Ga0068864_100070379 | 3300005618 | Bacteria | 3044 |
| 88 | Ga0068864_100119978 | 3300005618 | Bacteria | 2350 |
| 89 | Ga0068866_10056185 | 3300005718 | Bacteria | 2024 |
| 90 | Ga0068866_10073276 | 3300005718 | Bacteria | 1817 |
| 91 | Ga0068861_100462217 | 3300005719 | Bacteria | 1139 |
| 92 | Ga0068851_10013247 | 3300005834 | Bacteria | 3901 |
| 93 | Ga0068851_10198901 | 3300005834 | Bacteria | 1118 |
| 94 | Ga0068863_100242522 | 3300005841 | Bacteria | 1739 |
| 95 | Ga0068863_100559712 | 3300005841 | Bacteria | 1129 |
| 96 | Ga0068858_100194812 | 3300005842 | Bacteria | 1915 |
| 97 | Ga0068858_100579361 | 3300005842 | Bacteria | 1087 |
| 98 | Ga0068860_100000113 | 3300005843 | Bacteria | 130939 |
| 99 | Ga0068860_100182768 | 3300005843 | Bacteria | 2027 |
| 100 | Ga0068862_100258680 | 3300005844 | Bacteria | 1588 |
| 101 | Ga0068862_100483497 | 3300005844 | Bacteria | 1172 |
| 102 | Ga0081455_10000073 | 3300005937 | Bacteria | 107386 |
| 103 | Ga0081455_10045667 | 3300005937 | Bacteria | 3809 |
| 104 | Ga0081455_10228340 | 3300005937 | Bacteria | 1375 |
| 105 | Ga0081540_1001713 | 3300005983 | Bacteria | 18555 |
| 106 | Ga0081540_1003381 | 3300005983 | Bacteria | 12649 |
| 107 | Ga0081540_1048857 | 3300005983 | Bacteria | 2115 |
| 108 | Ga0081540_1062999 | 3300005983 | Bacteria | 1757 |
| 109 | Ga0081539_10000255 | 3300005985 | Bacteria | 123054 |
| 110 | Ga0081539_10119056 | 3300005985 | Bacteria | 1315 |
| 111 | Ga0070717_10019185 | 3300006028 | Bacteria | 5359 |
| 112 | Ga0070717_10416774 | 3300006028 | Bacteria | 1208 |
| 113 | Ga0070717_10512402 | 3300006028 | Bacteria | 1085 |
| 114 | Ga0075365_10017869 | 3300006038 | Bacteria | 4350 |
| 115 | Ga0075365_10101915 | 3300006038 | Bacteria | 1966 |
| 116 | Ga0075365_10142235 | 3300006038 | Bacteria | 1665 |
| 117 | Ga0075365_10365871 | 3300006038 | Bacteria | 1017 |
| 118 | Ga0075368_10001310 | 3300006042 | Bacteria | 7875 |
| 119 | Ga0075368_10053169 | 3300006042 | Bacteria | 1612 |
| 120 | Ga0075364_10034559 | 3300006051 | Bacteria | 3262 |
| 121 | Ga0075364_10094518 | 3300006051 | Bacteria | 1986 |
| 122 | Ga0075364_10094907 | 3300006051 | Bacteria | 1982 |
| 123 | Ga0070715_10072552 | 3300006163 | Bacteria | 1541 |
| 124 | Ga0070716_100013305 | 3300006173 | Bacteria | 4192 |
| 125 | Ga0070716_100188851 | 3300006173 | Bacteria | 1359 |
| 126 | Ga0070716_100369146 | 3300006173 | Bacteria | 1022 |
| 127 | Ga0070712_100008029 | 3300006175 | Bacteria | 6620 |
| 128 | Ga0070712_100051745 | 3300006175 | Bacteria | 2862 |
| 129 | Ga0070712_100458632 | 3300006175 | Bacteria | 1062 |
| 130 | Ga0075362_10057914 | 3300006177 | Bacteria | 1747 |
| 131 | Ga0075362_10152772 | 3300006177 | Bacteria | 1108 |
| 132 | Ga0075367_10104468 | 3300006178 | Bacteria | 1734 |
| 133 | Ga0075366_10024997 | 3300006195 | Bacteria | 3485 |
| 134 | Ga0097621_100132585 | 3300006237 | Bacteria | 2122 |
| 135 | Ga0097621_100189042 | 3300006237 | Bacteria | 1782 |
| 136 | Ga0075370_10016014 | 3300006353 | Bacteria | 4027 |
| 137 | Ga0075370_10020457 | 3300006353 | Bacteria | 3618 |
| 138 | Ga0075370_10021827 | 3300006353 | Bacteria | 3509 |
| 139 | Ga0068871_100056998 | 3300006358 | Bacteria | 3177 |
| 140 | Ga0068871_100219258 | 3300006358 | Bacteria | 1647 |
| 141 | Ga0075428_100109095 | 3300006844 | Bacteria | 3016 |
| 142 | Ga0075431_100449789 | 3300006847 | Bacteria | 1284 |
| 143 | Ga0075433_10004563 | 3300006852 | Bacteria | 10805 |
| 144 | Ga0075433_10202065 | 3300006852 | Bacteria | 1767 |
| 145 | Ga0075434_100088516 | 3300006871 | Bacteria | 3097 |
| 146 | Ga0075434_100101368 | 3300006871 | Unclassified | 2886 |
| 147 | Ga0097620_100072273 | 3300006931 | Bacteria | 3486 |
| 148 | Ga0097620_100253598 | 3300006931 | Bacteria | 1850 |
| 149 | Ga0097620_100292652 | 3300006931 | Bacteria | 1721 |
| 150 | Ga0097620_100417601 | 3300006931 | Bacteria | 1438 |
| 151 | Ga0075435_100189830 | 3300007076 | Bacteria | 1739 |
| 152 | Ga0075435_100542071 | 3300007076 | Bacteria | 1007 |
| 153 | Ga0099795_10007573 | 3300007788 | Bacteria | 3039 |
| 154 | Ga0099795_10027421 | 3300007788 | Bacteria | 1927 |
| 155 | Ga0105240_10009596 | 3300009093 | Bacteria | 13695 |
| 156 | Ga0105240_10545065 | 3300009093 | Bacteria | 1284 |
| 157 | Ga0111539_10377139 | 3300009094 | Bacteria | 1651 |
| 158 | Ga0105245_10618114 | 3300009098 | Bacteria | 1111 |
| 159 | Ga0105247_10001533 | 3300009101 | Bacteria | 16497 |
| 160 | Ga0105247_10026061 | 3300009101 | Bacteria | 3529 |
| 161 | Ga0105247_10058271 | 3300009101 | Bacteria | 2389 |
| 162 | Ga0105247_10079986 | 3300009101 | Bacteria | 2058 |
| 163 | Ga0105247_10155475 | 3300009101 | Bacteria | 1510 |
| 164 | Ga0114129_10028043 | 3300009147 | Bacteria | 7976 |
| 165 | Ga0105241_10010784 | 3300009174 | Bacteria | 6704 |
| 166 | Ga0105241_10010832 | 3300009174 | Bacteria | 6689 |
| 167 | Ga0105241_10232469 | 3300009174 | Bacteria | 1555 |
| 168 | Ga0105248_10055495 | 3300009177 | Bacteria | 4444 |
| 169 | Ga0105248_10428425 | 3300009177 | Bacteria | 1490 |
| 170 | Ga0105248_10714848 | 3300009177 | Bacteria | 1130 |
| 171 | Ga0105237_10035699 | 3300009545 | Bacteria | 5029 |
| 172 | Ga0105237_10106355 | 3300009545 | Bacteria | 2798 |
| 173 | Ga0105237_10366550 | 3300009545 | Bacteria | 1445 |
| 174 | Ga0105237_10614960 | 3300009545 | Bacteria | 1093 |
| 175 | Ga0105238_10009724 | 3300009551 | Bacteria | 9628 |
| 176 | Ga0105238_10015814 | 3300009551 | Bacteria | 7638 |
| 177 | Ga0105238_10044871 | 3300009551 | Bacteria | 4467 |
| 178 | Ga0105238_10169211 | 3300009551 | Bacteria | 2161 |
| 179 | Ga0105238_10242621 | 3300009551 | Bacteria | 1779 |
| 180 | Ga0099796_10003294 | 3300010159 | Bacteria | 3722 |
| 181 | Ga0099796_10007064 | 3300010159 | Bacteria | 2915 |
| 182 | Ga0105239_10011556 | 3300010375 | Bacteria | 9849 |
| 183 | Ga0105239_10066307 | 3300010375 | Bacteria | 3966 |
| 184 | Ga0105239_10084806 | 3300010375 | Bacteria | 3490 |
| 185 | Ga0105239_10144508 | 3300010375 | Bacteria | 2652 |
| 186 | Ga0105246_10195447 | 3300011119 | Bacteria | 1569 |
| 187 | Ga0157371_10023272 | 3300013102 | Bacteria | 4530 |
| 188 | Ga0157370_10088570 | 3300013104 | Bacteria | 2907 |
| 189 | Ga0157369_10034285 | 3300013105 | Bacteria | 5572 |
| 190 | Ga0157374_10062976 | 3300013296 | Bacteria | 3478 |
| 191 | Ga0163162_10189496 | 3300013306 | Bacteria | 2184 |
| 192 | Ga0163162_10343215 | 3300013306 | Bacteria | 1626 |
| 193 | Ga0157372_10154390 | 3300013307 | Bacteria | 2651 |
| 194 | Ga0157372_10206070 | 3300013307 | Bacteria | 2279 |
| 195 | Ga0157375_10169282 | 3300013308 | Bacteria | 2331 |
| 196 | Ga0163163_10028321 | 3300014325 | Bacteria | 5377 |
| 197 | Ga0163163_10031629 | 3300014325 | Bacteria | 5108 |
| 198 | Ga0163163_10044799 | 3300014325 | Bacteria | 4341 |
| 199 | Ga0163163_10883568 | 3300014325 | Bacteria | 957 |
| 200 | Ga0157376_10389523 | 3300014969 | Bacteria | 1344 |
| 201 | Ga0228598_1028294 | 3300024227 | Bacteria | 1103 |
| 202 | Ga0209563_105637 | 3300025230 | Bacteria | 2240 |
| 203 | Ga0209677_101030 | 3300025253 | Bacteria | 13283 |
| 204 | Ga0209233_1001936 | 3300025261 | Bacteria | 7895 |
| 205 | Ga0209758_1004964 | 3300025297 | Bacteria | 10643 |
| 206 | Ga0209758_1011448 | 3300025297 | Bacteria | 5138 |
| 207 | Ga0207426_1017410 | 3300025302 | Bacteria | 2555 |
| 208 | Ga0209257_1025055 | 3300025304 | Bacteria | 2048 |
| 209 | Ga0207656_10009757 | 3300025321 | Bacteria | 3570 |
| 210 | Ga0207696_1056267 | 3300025711 | Bacteria | 1114 |
| 211 | Ga0207682_10066293 | 3300025893 | Bacteria | 1521 |
| 212 | Ga0207692_10002116 | 3300025898 | Bacteria | 7577 |
| 213 | Ga0207692_10020587 | 3300025898 | Bacteria | 3003 |
| 214 | Ga0207692_10045204 | 3300025898 | Bacteria | 2201 |
| 215 | Ga0207692_10064618 | 3300025898 | Bacteria | 1906 |
| 216 | Ga0207710_10013025 | 3300025900 | Bacteria | 3504 |
| 217 | Ga0207647_10003775 | 3300025904 | Bacteria | 11329 |
| 218 | Ga0207685_10001134 | 3300025905 | Bacteria | 5315 |
| 219 | Ga0207685_10133598 | 3300025905 | Bacteria | 1104 |
| 220 | Ga0207699_10000315 | 3300025906 | Bacteria | 25846 |
| 221 | Ga0207699_10166481 | 3300025906 | Bacteria | 1471 |
| 222 | Ga0207699_10204089 | 3300025906 | Bacteria | 1341 |
| 223 | Ga0207643_10051800 | 3300025908 | Bacteria | 2330 |
| 224 | Ga0207705_10070646 | 3300025909 | Bacteria | 2531 |
| 225 | Ga0207654_10061873 | 3300025911 | Bacteria | 2192 |
| 226 | Ga0207707_10000852 | 3300025912 | Bacteria | 29744 |
| 227 | Ga0207707_10020269 | 3300025912 | Bacteria | 5805 |
| 228 | Ga0207707_10021472 | 3300025912 | Bacteria | 5644 |
| 229 | Ga0207695_10089162 | 3300025913 | Bacteria | 3102 |
| 230 | Ga0207671_10021759 | 3300025914 | Bacteria | 4860 |
| 231 | Ga0207671_10033060 | 3300025914 | Bacteria | 3850 |
| 232 | Ga0207671_10048218 | 3300025914 | Bacteria | 3153 |
| 233 | Ga0207671_10151137 | 3300025914 | Bacteria | 1794 |
| 234 | Ga0207693_10001315 | 3300025915 | Bacteria | 22038 |
| 235 | Ga0207693_10003192 | 3300025915 | Bacteria | 14084 |
| 236 | Ga0207693_10044175 | 3300025915 | Bacteria | 3502 |
| 237 | Ga0207693_10068492 | 3300025915 | Bacteria | 2778 |
| 238 | Ga0207693_10074227 | 3300025915 | Bacteria | 2663 |
| 239 | Ga0207693_10220871 | 3300025915 | Bacteria | 1489 |
| 240 | Ga0207663_10004589 | 3300025916 | Bacteria | 6882 |
| 241 | Ga0207663_10035391 | 3300025916 | Bacteria | 2995 |
| 242 | Ga0207663_10189769 | 3300025916 | Bacteria | 1475 |
| 243 | Ga0207663_10222720 | 3300025916 | Bacteria | 1373 |
| 244 | Ga0207663_10242632 | 3300025916 | Bacteria | 1322 |
| 245 | Ga0207660_10035846 | 3300025917 | Bacteria | 3446 |
| 246 | Ga0207662_10248026 | 3300025918 | Bacteria | 1168 |
| 247 | Ga0207657_10001809 | 3300025919 | Bacteria | 23060 |
| 248 | Ga0207657_10069596 | 3300025919 | Bacteria | 2985 |
| 249 | Ga0207657_10117682 | 3300025919 | Bacteria | 2188 |
| 250 | Ga0207652_10024173 | 3300025921 | Bacteria | 5039 |
| 251 | Ga0207652_10054223 | 3300025921 | Bacteria | 3446 |
| 252 | Ga0207652_10278323 | 3300025921 | Bacteria | 1509 |
| 253 | Ga0207694_10109458 | 3300025924 | Bacteria | 2197 |
| 254 | Ga0207694_10309257 | 3300025924 | Bacteria | 1302 |
| 255 | Ga0207650_10035414 | 3300025925 | Bacteria | 3625 |
| 256 | Ga0207687_10420633 | 3300025927 | Bacteria | 1103 |
| 257 | Ga0207700_10012197 | 3300025928 | Bacteria | 5529 |
| 258 | Ga0207700_10028958 | 3300025928 | Bacteria | 3903 |
| 259 | Ga0207700_10042385 | 3300025928 | Bacteria | 3336 |
| 260 | Ga0207700_10096591 | 3300025928 | Bacteria | 2346 |
| 261 | Ga0207700_10153428 | 3300025928 | Bacteria | 1906 |
| 262 | Ga0207664_10009598 | 3300025929 | Bacteria | 6799 |
| 263 | Ga0207664_10031373 | 3300025929 | Bacteria | 4065 |
| 264 | Ga0207664_10155779 | 3300025929 | Bacteria | 1945 |
| 265 | Ga0207664_10163631 | 3300025929 | Bacteria | 1899 |
| 266 | Ga0207690_10017589 | 3300025932 | Bacteria | 4369 |
| 267 | Ga0207690_10198749 | 3300025932 | Bacteria | 1521 |
| 268 | Ga0207690_10213028 | 3300025932 | Bacteria | 1474 |
| 269 | Ga0207706_10153068 | 3300025933 | Bacteria | 2028 |
| 270 | Ga0207670_10075306 | 3300025936 | Bacteria | 2346 |
| 271 | Ga0207669_10008544 | 3300025937 | Bacteria | 4815 |
| 272 | Ga0207704_10262480 | 3300025938 | Bacteria | 1303 |
| 273 | Ga0207665_10001125 | 3300025939 | Bacteria | 17981 |
| 274 | Ga0207665_10002700 | 3300025939 | Bacteria | 11896 |
| 275 | Ga0207665_10113175 | 3300025939 | Bacteria | 1909 |
| 276 | Ga0207689_10020170 | 3300025942 | Bacteria | 5615 |
| 277 | Ga0207689_10145801 | 3300025942 | Bacteria | 1950 |
| 278 | Ga0207679_10084232 | 3300025945 | Bacteria | 2439 |
| 279 | Ga0207679_10617280 | 3300025945 | Bacteria | 978 |
| 280 | Ga0207667_10160532 | 3300025949 | Bacteria | 2312 |
| 281 | Ga0207667_10198924 | 3300025949 | Bacteria | 2056 |
| 282 | Ga0207668_10011404 | 3300025972 | Bacteria | 5398 |
| 283 | Ga0207668_10119743 | 3300025972 | Bacteria | 1991 |
| 284 | Ga0207668_10181033 | 3300025972 | Bacteria | 1662 |
| 285 | Ga0207668_10245383 | 3300025972 | Bacteria | 1451 |
| 286 | Ga0207640_10211011 | 3300025981 | Bacteria | 1479 |
| 287 | Ga0207658_10488385 | 3300025986 | Bacteria | 1095 |
| 288 | Ga0207703_10050169 | 3300026035 | Bacteria | 3376 |
| 289 | Ga0207703_10050909 | 3300026035 | Bacteria | 3354 |
| 290 | Ga0207703_10206321 | 3300026035 | Bacteria | 1749 |
| 291 | Ga0207703_10231537 | 3300026035 | Bacteria | 1656 |
| 292 | Ga0207703_10400047 | 3300026035 | Bacteria | 1274 |
| 293 | Ga0207639_10064297 | 3300026041 | Bacteria | 2844 |
| 294 | Ga0207639_10115154 | 3300026041 | Bacteria | 2198 |
| 295 | Ga0207639_10211061 | 3300026041 | Bacteria | 1671 |
| 296 | Ga0207639_10312384 | 3300026041 | Bacteria | 1393 |
| 297 | Ga0207678_10000337 | 3300026067 | Bacteria | 42242 |
| 298 | Ga0207678_10021070 | 3300026067 | Bacteria | 5715 |
| 299 | Ga0207678_10033154 | 3300026067 | Bacteria | 4500 |
| 300 | Ga0207678_10042251 | 3300026067 | Bacteria | 3950 |
| 301 | Ga0207678_10102649 | 3300026067 | Bacteria | 2441 |
| 302 | Ga0207708_10065447 | 3300026075 | Bacteria | 2778 |
| 303 | Ga0207708_10352876 | 3300026075 | Bacteria | 1207 |
| 304 | Ga0207702_10077004 | 3300026078 | Bacteria | 2883 |
| 305 | Ga0207648_10150898 | 3300026089 | Bacteria | 2050 |
| 306 | Ga0207648_10282059 | 3300026089 | Bacteria | 1486 |
| 307 | Ga0207674_10095816 | 3300026116 | Bacteria | 2953 |
| 308 | Ga0207674_10203567 | 3300026116 | Bacteria | 1929 |
| 309 | Ga0207674_10248758 | 3300026116 | Bacteria | 1725 |
| 310 | Ga0207683_10011948 | 3300026121 | Bacteria | 7411 |
| 311 | Ga0207683_10133197 | 3300026121 | Bacteria | 2236 |
| 312 | Ga0207683_10513344 | 3300026121 | Bacteria | 1107 |
| 313 | Ga0207698_10090822 | 3300026142 | Bacteria | 2498 |
| 314 | Ga0209179_1008511 | 3300027512 | Bacteria | 1731 |
| 315 | Ga0209588_1014704 | 3300027671 | Bacteria | 2399 |
| 316 | Ga0209588_1060221 | 3300027671 | Bacteria | 1227 |
| 317 | Ga0268266_10001147 | 3300028379 | Bacteria | 32898 |
| 318 | Ga0268266_10012847 | 3300028379 | Bacteria | 7230 |
| 319 | Ga0268266_10208799 | 3300028379 | Bacteria | 1790 |
| 320 | Ga0268265_10070496 | 3300028380 | Bacteria | 2718 |
| 321 | Ga0268265_10327782 | 3300028380 | Bacteria | 1389 |
| 322 | Ga0268265_10475331 | 3300028380 | Bacteria | 1172 |
| 323 | Ga0268264_10000035 | 3300028381 | Bacteria | 398196 |
| 324 | Ga0268264_10218617 | 3300028381 | Bacteria | 1753 |
| 325 | Ga0268264_10435685 | 3300028381 | Bacteria | 1267 |
| 326 | Ga0265336_10007256 | 3300028666 | Bacteria | 3947 |
| 327 | Ga0307517_10000062 | 3300028786 | Bacteria | 145054 |
| 328 | Ga0307517_10145509 | 3300028786 | Bacteria | 1646 |
| 329 | Ga0265338_10000090 | 3300028800 | Bacteria | 171540 |
| 330 | Ga0307511_10114045 | 3300030521 | Bacteria | 1705 |
| 331 | Ga0265760_10063895 | 3300031090 | Bacteria | 1122 |
| 332 | Ga0265330_10014093 | 3300031235 | Bacteria | 3712 |
| 333 | Ga0265330_10093526 | 3300031235 | Bacteria | 1289 |
| 334 | Ga0265332_10000227 | 3300031238 | Bacteria | 45207 |
| 335 | Ga0265332_10100524 | 3300031238 | Bacteria | 1220 |
| 336 | Ga0265328_10091540 | 3300031239 | Bacteria | 1124 |
| 337 | Ga0265325_10010500 | 3300031241 | Bacteria | 5358 |
| 338 | Ga0265340_10001031 | 3300031247 | Bacteria | 15902 |
| 339 | Ga0265340_10004003 | 3300031247 | Bacteria | 8284 |
| 340 | Ga0265340_10023744 | 3300031247 | Bacteria | 3124 |
| 341 | Ga0265340_10049838 | 3300031247 | Bacteria | 2033 |
| 342 | Ga0265339_10007527 | 3300031249 | Bacteria | 7022 |
| 343 | Ga0265331_10018997 | 3300031250 | Bacteria | 3553 |
| 344 | Ga0265331_10035353 | 3300031250 | Bacteria | 2458 |
| 345 | Ga0265316_10091936 | 3300031344 | Bacteria | 2314 |
| 346 | Ga0265316_10197153 | 3300031344 | Bacteria | 1494 |
| 347 | Ga0307513_10099663 | 3300031456 | Bacteria | 2933 |
| 348 | Ga0307508_10000403 | 3300031616 | Bacteria | 51779 |
| 349 | Ga0307508_10040142 | 3300031616 | Bacteria | 4203 |
| 350 | Ga0307508_10043361 | 3300031616 | Bacteria | 4031 |
| 351 | Ga0265314_10030411 | 3300031711 | Bacteria | 3997 |
| 352 | Ga0265342_10000178 | 3300031712 | Bacteria | 70648 |
| 353 | Ga0265342_10013292 | 3300031712 | Bacteria | 5533 |
| 354 | Ga0265342_10104007 | 3300031712 | Bacteria | 1614 |
| 355 | Ga0265342_10147747 | 3300031712 | Bacteria | 1307 |
| 356 | Ga0307516_10011695 | 3300031730 | Bacteria | 9525 |
| 357 | Ga0307516_10140049 | 3300031730 | Bacteria | 2190 |
| 358 | Ga0307416_100642267 | 3300032002 | Bacteria | 1145 |
| 359 | Ga0307507_10024960 | 3300033179 | Bacteria | 6497 |
| 360 | Ga0307510_10060001 | 3300033180 | Bacteria | 3920 |
| 361 | Ga0307510_10127065 | 3300033180 | Bacteria | 2236 |
| 362 | Ga0373958_0001999 | 3300034819 | Bacteria | 2811 |
| 363 | Ga0373934_0162150 | 3300035086 | Bacteria | 917 |
| 364 | Ga0373923_0000940 | 3300035111 | Bacteria | 7790 |
| 365 | Ga0373936_0000142 | 3300035113 | Bacteria | 24935 |
| 366 | Ga0373936_0009685 | 3300035113 | Bacteria | 3632 |
| 367 | Ga0373936_0029308 | 3300035113 | Bacteria | 2166 |
| 368 | Ga0373939_0002723 | 3300035114 | Bacteria | 4146 |
| 369 | Ga0373945_0005237 | 3300035116 | Bacteria | 4146 |
| 370 | Ga0373945_0005308 | 3300035116 | Bacteria | 4124 |
| 371 | Ga0373953_0001908 | 3300035117 | Bacteria | 6180 |
| 372 | Ga0373953_0057994 | 3300035117 | Bacteria | 1577 |
| 373 | Ga0373954_0002012 | 3300035118 | Bacteria | 8443 |
| 374 | Ga0373954_0260456 | 3300035118 | Bacteria | 854 |
| 375 | Ga0373956_0002575 | 3300035119 | Bacteria | 7368 |
| 376 | Ga0373956_0128359 | 3300035119 | Bacteria | 1186 |
| 377 | Ga0373957_0018780 | 3300035120 | Bacteria | 2425 |
| 378 | Ga0373957_0025648 | 3300035120 | Bacteria | 2126 |
| 379 | Ga0373943_0011979 | 3300035170 | Bacteria | 3904 |
| 380 | Ga0373946_0001354 | 3300035171 | Bacteria | 8488 |
| 381 | Ga0373955_0001050 | 3300035172 | Bacteria | 11751 |
| 382 | Ga0373955_0211473 | 3300035172 | Bacteria | 1156 |
| 383 | Ga0373955_0272770 | 3300035172 | Bacteria | 1017 |
| 384 | Ga0373961_0006644 | 3300035241 | Bacteria | 2780 |
| 385 | Ga0373962_0042001 | 3300035242 | Bacteria | 1291 |
| 386 | Ga0373924_0000143 | 3300035410 | Bacteria | 20948 |
| 387 | Ga0373924_0028005 | 3300035410 | Bacteria | 2243 |
| 388 | Ga0373924_0146509 | 3300035410 | Bacteria | 1032 |
| 389 | Ga0373931_0053603 | 3300035691 | Bacteria | 2152 |
| 390 | Ga0373935_0000495 | 3300035692 | Bacteria | 20438 |
| 391 | Ga0373935_0000528 | 3300035692 | Bacteria | 19905 |
| 392 | Ga0373935_0021340 | 3300035692 | Bacteria | 3965 |
| 393 | Ga0373935_0024822 | 3300035692 | Bacteria | 3692 |
| 394 | Ga0373927_0000308 | 3300035695 | Bacteria | 38418 |
| 395 | Ga0373927_0026775 | 3300035695 | Bacteria | 3768 |
| 396 | Ga0373927_0035573 | 3300035695 | Bacteria | 3238 |
| 397 | Ga0373927_0042844 | 3300035695 | Bacteria | 2933 |
| 398 | Ga0373927_0045863 | 3300035695 | Bacteria | 2828 |
| 399 | Ga0373927_0048990 | 3300035695 | Bacteria | 2732 |
| 400 | Ga0373927_0057422 | 3300035695 | Bacteria | 2517 |
| 401 | Ga0373933_0001902 | 3300035724 | Bacteria | 12050 |
| 402 | Ga0373933_0004103 | 3300035724 | Bacteria | 8027 |
| 403 | Ga0373933_0097509 | 3300035724 | Bacteria | 1821 |
| 404 | Ga0373933_0134495 | 3300035724 | Bacteria | 1557 |
| 405 | Ga0373947_0001975 | 3300035725 | Bacteria | 12557 |
| 406 | Ga0373947_0005725 | 3300035725 | Bacteria | 7249 |
| 407 | Ga0373947_0043816 | 3300035725 | Bacteria | 2673 |
| 408 | Ga0373947_0090878 | 3300035725 | Bacteria | 1904 |
| 409 | Ga0373947_0126853 | 3300035725 | Bacteria | 1626 |
| 410 | Ga0373947_0299119 | 3300035725 | Bacteria | 1073 |
| 411 | Ga0373937_0000063 | 3300036401 | Bacteria | 95762 |
| 412 | Ga0373937_0109634 | 3300036401 | Bacteria | 2567 |
| 413 | Ga0373937_0235958 | 3300036401 | Bacteria | 1722 |
| 414 | Ga0373925_0000185 | 3300037068 | Bacteria | 68604 |
| 415 | Ga0373925_0090147 | 3300037068 | Bacteria | 2343 |
| 416 | Ga0373925_0130183 | 3300037068 | Bacteria | 1961 |
| 417 | Ga0395900_0018958 | 3300037418 | Bacteria | 7018 |
| 418 | Ga0395900_0272977 | 3300037418 | Unclassified | 1685 |
| 419 | Ga0395898_0010921 | 3300037466 | Bacteria | 9474 |
| 420 | Ga0395905_0076714 | 3300037471 | Bacteria | 3132 |
| 421 | Ga0395901_0035674 | 3300038443 | Bacteria | 5139 |
| 422 | Ga0395901_0330154 | 3300038443 | Bacteria | 1577 |
| 423 | Ga0436365_0607069 | 3300039437 | Bacteria | 2171 |
| 424 | Ga0436365_1432862 | 3300039437 | Bacteria | 2817 |
| 425 | Ga0436360_0353512 | 3300039438 | Bacteria | 1134 |
| 426 | Ga0436361_0642483 | 3300039447 | Bacteria | 3545 |
| 427 | Ga0436363_1413720 | 3300039450 | Bacteria | 1087 |
| 428 | Ga0451833_1020682 | 3300041491 | Bacteria | 1523 |
| 429 | Ga0451841_0361863 | 3300041498 | Bacteria | 1387 |
| 430 | Ga0466970_0183282 | 3300044765 | Bacteria | 1162 |
| 431 | Ga0466967_0704612 | 3300045976 | Bacteria | 1000 |
| 432 | Ga0495592_0000162 | 3300046454 | Bacteria | 59289 |
| 433 | Ga0495592_0079852 | 3300046454 | Bacteria | 2367 |
| 434 | Ga0495592_0129753 | 3300046454 | Bacteria | 1764 |
| 435 | Ga0495603_0004869 | 3300046455 | Bacteria | 8028 |
| 436 | Ga0495603_0027231 | 3300046455 | Bacteria | 3450 |
| 437 | Ga0495603_0045833 | 3300046455 | Bacteria | 2606 |
| 438 | Ga0495603_0066954 | 3300046455 | Bacteria | 2115 |
| 439 | Ga0495603_0080797 | 3300046455 | Bacteria | 1905 |
| 440 | Ga0495590_0109560 | 3300046457 | Bacteria | 985 |
| 441 | Ga0495629_0000170 | 3300046459 | Bacteria | 57733 |
| 442 | Ga0495629_0207017 | 3300046459 | Bacteria | 1355 |
| 443 | Ga0495629_0306418 | 3300046459 | Bacteria | 1087 |
| 444 | Ga0495638_0200910 | 3300046460 | Bacteria | 1125 |
| 445 | Ga0495641_0002571 | 3300046461 | Bacteria | 14249 |
| 446 | Ga0495641_0089224 | 3300046461 | Bacteria | 1378 |
| 447 | Ga0495651_0000190 | 3300046462 | Bacteria | 46071 |
| 448 | Ga0495651_0032169 | 3300046462 | Bacteria | 4092 |
| 449 | Ga0495653_0011588 | 3300046463 | Bacteria | 7197 |
| 450 | Ga0495653_0104323 | 3300046463 | Bacteria | 2049 |
| 451 | Ga0495580_0017329 | 3300046472 | Bacteria | 5388 |
| 452 | Ga0495582_0000053 | 3300046473 | Bacteria | 58155 |
| 453 | Ga0495639_0142744 | 3300046475 | Bacteria | 1152 |
| 454 | Ga0495662_0000692 | 3300046476 | Bacteria | 15954 |
| 455 | Ga0495662_0001239 | 3300046476 | Bacteria | 12579 |
| 456 | Ga0495664_0000006 | 3300046477 | Bacteria | 407031 |
| 457 | Ga0495664_0032278 | 3300046477 | Bacteria | 3072 |
| 458 | Ga0495664_0033605 | 3300046477 | Bacteria | 3014 |
| 459 | Ga0495664_0044554 | 3300046477 | Bacteria | 2629 |
| 460 | Ga0495584_0108005 | 3300046491 | Bacteria | 1407 |
| 461 | Ga0495584_0222177 | 3300046491 | Bacteria | 960 |
| 462 | Ga0495594_0000267 | 3300046499 | Bacteria | 25600 |
| 463 | Ga0495606_0052387 | 3300046507 | Bacteria | 2654 |
| 464 | Ga0495608_0000002 | 3300046511 | Bacteria | 376403 |
| 465 | Ga0495608_0009669 | 3300046511 | Bacteria | 6727 |
| 466 | Ga0495610_0075023 | 3300046512 | Bacteria | 1567 |
| 467 | Ga0495616_0016545 | 3300046513 | Bacteria | 4080 |
| 468 | Ga0495618_0000001 | 3300046514 | Bacteria | 282202 |
| 469 | Ga0495618_0220549 | 3300046514 | Bacteria | 1196 |
| 470 | Ga0495628_0000004 | 3300046516 | Bacteria | 462184 |
| 471 | Ga0495628_0118293 | 3300046516 | Bacteria | 2034 |
| 472 | Ga0495630_0006844 | 3300046517 | Bacteria | 8127 |
| 473 | Ga0495631_0086109 | 3300046518 | Bacteria | 1353 |
| 474 | Ga0495632_0120662 | 3300046519 | Bacteria | 1225 |
| 475 | Ga0495648_0001690 | 3300046524 | Bacteria | 21355 |
| 476 | Ga0495648_0033620 | 3300046524 | Bacteria | 3346 |
| 477 | Ga0495648_0111587 | 3300046524 | Bacteria | 1487 |
| 478 | Ga0495642_0031105 | 3300046528 | Bacteria | 2139 |
| 479 | Ga0495652_0000007 | 3300046529 | Bacteria | 418163 |
| 480 | Ga0495652_0256485 | 3300046529 | Bacteria | 1293 |
| 481 | Ga0495665_0000132 | 3300046531 | Bacteria | 35776 |
| 482 | Ga0495640_0000004 | 3300046533 | Bacteria | 357515 |
| 483 | Ga0495640_0001291 | 3300046533 | Bacteria | 19684 |
| 484 | Ga0495640_0015413 | 3300046533 | Bacteria | 5753 |
| 485 | Ga0495640_0168809 | 3300046533 | Bacteria | 1398 |
| 486 | Ga0495587_0000002 | 3300046536 | Bacteria | 425485 |
| 487 | Ga0495587_0015115 | 3300046536 | Bacteria | 4824 |
| 488 | Ga0495621_0103384 | 3300046539 | Bacteria | 1086 |
| 489 | Ga0495597_0030349 | 3300046542 | Bacteria | 2464 |
| 490 | Ga0495597_0083184 | 3300046542 | Bacteria | 1367 |
| 491 | Ga0495597_0085406 | 3300046542 | Bacteria | 1345 |
| 492 | Ga0495645_0000008 | 3300046543 | Bacteria | 331530 |
| 493 | Ga0495645_0010809 | 3300046543 | Bacteria | 6412 |
| 494 | Ga0495622_0001348 | 3300046557 | Bacteria | 12543 |
| 495 | Ga0495622_0002929 | 3300046557 | Bacteria | 8141 |
| 496 | Ga0495622_0041556 | 3300046557 | Bacteria | 2138 |
| 497 | Ga0495622_0080095 | 3300046557 | Bacteria | 1503 |
| 498 | Ga0495667_0000006 | 3300046559 | Bacteria | 257523 |
| 499 | Ga0495667_0005418 | 3300046559 | Bacteria | 8627 |
| 500 | Ga0495667_0028437 | 3300046559 | Bacteria | 3764 |
| 501 | Ga0495656_0047694 | 3300046615 | Bacteria | 1817 |
| 502 | Ga0495656_0050859 | 3300046615 | Bacteria | 1771 |
| 503 | Ga0495656_0065503 | 3300046615 | Bacteria | 1598 |
| 504 | Ga0495656_0106833 | 3300046615 | Bacteria | 1303 |
| 505 | Ga0495668_0012998 | 3300046616 | Bacteria | 4927 |
| 506 | Ga0495634_0000001 | 3300046642 | Bacteria | 303746 |
| 507 | Ga0495634_0002240 | 3300046642 | Bacteria | 16205 |
| 508 | Ga0495634_0018593 | 3300046642 | Bacteria | 4944 |
| 509 | Ga0495611_0036090 | 3300046648 | Bacteria | 2192 |
| 510 | Ga0495625_0259145 | 3300046660 | Bacteria | 1126 |
| 511 | Ga0495635_0000004 | 3300046663 | Bacteria | 388068 |
| 512 | Ga0495635_0000488 | 3300046663 | Bacteria | 25029 |
| 513 | Ga0495635_0317353 | 3300046663 | Bacteria | 1043 |
| 514 | Ga0495588_0002203 | 3300046674 | Bacteria | 8346 |
| 515 | Ga0495588_0005592 | 3300046674 | Bacteria | 5603 |
| 516 | Ga0495657_0000104 | 3300046675 | Bacteria | 74754 |
| 517 | Ga0495657_0005629 | 3300046675 | Bacteria | 9887 |
| 518 | Ga0495599_0000003 | 3300046678 | Bacteria | 319085 |
| 519 | Ga0495599_0016569 | 3300046678 | Bacteria | 4576 |
| 520 | Ga0495623_0000033 | 3300046679 | Bacteria | 84372 |
| 521 | Ga0495623_0006603 | 3300046679 | Bacteria | 7553 |
| 522 | Ga0495623_0007892 | 3300046679 | Bacteria | 6923 |
| 523 | Ga0495623_0104473 | 3300046679 | Bacteria | 1723 |
| 524 | Ga0495646_0000001 | 3300046680 | Bacteria | 403396 |
| 525 | Ga0495646_0009689 | 3300046680 | Bacteria | 6115 |
| 526 | Ga0495646_0071730 | 3300046680 | Bacteria | 2037 |
| 527 | Ga0495646_0115748 | 3300046680 | Bacteria | 1522 |
| 528 | Ga0495647_0049145 | 3300046681 | Bacteria | 1633 |
| 529 | Ga0495658_0000326 | 3300046683 | Bacteria | 26625 |
| 530 | Ga0495658_0022246 | 3300046683 | Bacteria | 3350 |
| 531 | Ga0495624_0013743 | 3300046690 | Bacteria | 5514 |
| 532 | Ga0495624_0019391 | 3300046690 | Bacteria | 4541 |
| 533 | Ga0495649_0045033 | 3300046694 | Bacteria | 2407 |
| 534 | Ga0495600_0000098 | 3300046809 | Bacteria | 47938 |
| 535 | Ga0495600_0000650 | 3300046809 | Bacteria | 18011 |
| 536 | Ga0495660_0195389 | 3300046810 | Bacteria | 969 |
| 537 | Ga0495581_0001133 | 3300047315 | Bacteria | 14586 |
| 538 | Ga0495581_0011098 | 3300047315 | Bacteria | 5207 |
| 539 | Ga0495581_0090122 | 3300047315 | Bacteria | 1779 |
| 540 | Ga0495604_0000003 | 3300047317 | Bacteria | 464246 |
| 541 | Ga0495604_0000498 | 3300047317 | Bacteria | 34541 |
| 542 | Ga0495604_0052607 | 3300047317 | Bacteria | 3152 |
| 543 | Ga0495674_0000006 | 3300047319 | Bacteria | 341772 |
| 544 | Ga0495674_0001834 | 3300047319 | Bacteria | 20944 |
| 545 | Ga0495674_0016302 | 3300047319 | Bacteria | 6929 |
| 546 | Ga0495674_0028485 | 3300047319 | Bacteria | 5091 |
| 547 | Ga0495672_0007685 | 3300047320 | Bacteria | 8079 |
| 548 | Ga0495676_0008173 | 3300047321 | Bacteria | 9598 |
| 549 | Ga0495676_0038619 | 3300047321 | Bacteria | 3964 |
| 550 | Ga0495680_0000149 | 3300047322 | Bacteria | 70484 |
| 551 | Ga0495680_0013407 | 3300047322 | Bacteria | 7152 |
| 552 | Ga0495683_0110308 | 3300047323 | Bacteria | 1314 |
| 553 | Ga0495687_011999 | 3300047443 | Bacteria | 4613 |
| 554 | Ga0495675_0000535 | 3300047444 | Bacteria | 24616 |
| 555 | Ga0495675_0022696 | 3300047444 | Bacteria | 4001 |
| 556 | Ga0495677_0015523 | 3300047445 | Bacteria | 2767 |
| 557 | Ga0495684_0000003 | 3300047471 | Bacteria | 331335 |
| 558 | Ga0495684_0282575 | 3300047471 | Bacteria | 1197 |
| 559 | Ga0495593_0000177 | 3300047673 | Bacteria | 32957 |
| 560 | Ga0495602_0000012 | 3300048088 | Bacteria | 200520 |
| 561 | Ga0495602_0027291 | 3300048088 | Bacteria | 5489 |
| 562 | Ga0495602_0267054 | 3300048088 | Bacteria | 1266 |
| 563 | Ga0495614_0078924 | 3300048089 | Bacteria | 1425 |
| 564 | Ga0496101_0050198 | 3300048904 | Bacteria | 3002 |
| 565 | Ga0496101_0155233 | 3300048904 | Bacteria | 1753 |
| 566 | Ga0496101_0287391 | 3300048904 | Bacteria | 1286 |
| 567 | Ga0496102_0017501 | 3300048905 | Bacteria | 6277 |
| 568 | Ga0496102_0079063 | 3300048905 | Bacteria | 3028 |
| 569 | Ga0496102_0159880 | 3300048905 | Bacteria | 2119 |
| 570 | Ga0496102_0262241 | 3300048905 | Bacteria | 1629 |
| 571 | Ga0496102_0265083 | 3300048905 | Bacteria | 1619 |
| 572 | Ga0496102_0767133 | 3300048905 | Bacteria | 887 |
| 573 | Ga0496103_0025616 | 3300048906 | Bacteria | 3566 |
| 574 | Ga0496103_0142593 | 3300048906 | Bacteria | 1533 |
| 575 | Ga0496104_0036927 | 3300048907 | Bacteria | 4568 |
| 576 | Ga0496104_0080212 | 3300048907 | Bacteria | 3111 |
| 577 | Ga0496104_0604980 | 3300048907 | Bacteria | 1006 |
| 578 | Ga0496105_0014472 | 3300048908 | Bacteria | 6281 |
| 579 | Ga0496105_0015437 | 3300048908 | Bacteria | 6087 |
| 580 | Ga0496105_0081970 | 3300048908 | Bacteria | 2665 |
| 581 | Ga0496106_0010975 | 3300048909 | Bacteria | 6697 |
| 582 | Ga0496106_0186206 | 3300048909 | Bacteria | 1649 |
| 583 | Ga0496107_0013514 | 3300048910 | Bacteria | 5708 |
| 584 | Ga0496107_0093819 | 3300048910 | Bacteria | 2195 |
| 585 | Ga0496107_0146499 | 3300048910 | Bacteria | 1746 |
| 586 | Ga0496107_0153829 | 3300048910 | Bacteria | 1702 |
| 587 | Ga0496108_0094243 | 3300048911 | Bacteria | 2548 |
| 588 | Ga0496108_0116962 | 3300048911 | Bacteria | 2284 |
| 589 | Ga0496109_0159816 | 3300048912 | Bacteria | 2111 |
| 590 | Ga0496109_0475972 | 3300048912 | Bacteria | 1179 |
| 591 | Ga0496110_0068905 | 3300048913 | Bacteria | 3132 |
| 592 | Ga0496110_0074545 | 3300048913 | Bacteria | 3014 |
| 593 | Ga0496110_0362059 | 3300048913 | Bacteria | 1321 |
| 594 | Ga0496111_0113665 | 3300048914 | Bacteria | 1995 |
| 595 | Ga0496112_0008432 | 3300048915 | Bacteria | 9230 |
| 596 | Ga0496112_0049558 | 3300048915 | Bacteria | 4117 |
| 597 | Ga0496112_0169472 | 3300048915 | Bacteria | 2149 |
| 598 | Ga0496112_0199224 | 3300048915 | Bacteria | 1962 |
| 599 | Ga0496112_0225277 | 3300048915 | Bacteria | 1830 |
| 600 | Ga0496113_0023942 | 3300048916 | Bacteria | 4335 |
| 601 | Ga0496113_0041640 | 3300048916 | Bacteria | 3390 |
| 602 | Ga0496113_0072765 | 3300048916 | Bacteria | 2617 |
| 603 | Ga0496113_0216856 | 3300048916 | Bacteria | 1524 |
| 604 | Ga0496114_0049252 | 3300048917 | Bacteria | 3505 |
| 605 | Ga0496114_0057140 | 3300048917 | Bacteria | 3257 |
| 606 | Ga0496114_0069331 | 3300048917 | Bacteria | 2961 |
| 607 | Ga0496115_0054832 | 3300048918 | Bacteria | 3201 |
| 608 | Ga0496115_0097067 | 3300048918 | Bacteria | 2413 |
| 609 | Ga0496115_0196421 | 3300048918 | Bacteria | 1667 |
| 610 | Ga0496115_0211067 | 3300048918 | Bacteria | 1603 |
| 611 | Ga0496115_0388025 | 3300048918 | Bacteria | 1135 |
| 612 | Ga0496115_0491343 | 3300048918 | Bacteria | 987 |
| 613 | Ga0496116_0089361 | 3300048919 | Bacteria | 1879 |
| 614 | Ga0496117_0048980 | 3300048920 | Bacteria | 3011 |
| 615 | Ga0496118_0044451 | 3300048921 | Bacteria | 3478 |
| 616 | Ga0496118_0102522 | 3300048921 | Bacteria | 1928 |
| 617 | Ga0496118_0111484 | 3300048921 | Bacteria | 1814 |
| 618 | Ga0496118_0185012 | 3300048921 | Bacteria | 1253 |
| 619 | Ga0496119_0048413 | 3300048922 | Bacteria | 2636 |
| 620 | Ga0496121_0000221 | 3300048924 | Bacteria | 123829 |
| 621 | Ga0496121_0000330 | 3300048924 | Bacteria | 98687 |
| 622 | Ga0496121_0001291 | 3300048924 | Bacteria | 43108 |
| 623 | Ga0496121_0017083 | 3300048924 | Bacteria | 7439 |
| 624 | Ga0496121_0072344 | 3300048924 | Bacteria | 2768 |
| 625 | Ga0496121_0086670 | 3300048924 | Bacteria | 2460 |
| 626 | Ga0496121_0102906 | 3300048924 | Bacteria | 2198 |
| 627 | Ga0496121_0156564 | 3300048924 | Bacteria | 1671 |
| 628 | Ga0496121_0161880 | 3300048924 | Bacteria | 1635 |
| 629 | Ga0496121_0193624 | 3300048924 | Bacteria | 1455 |
| 630 | Ga0496121_0208529 | 3300048924 | Bacteria | 1386 |
| 631 | Ga0496122_0064272 | 3300048925 | Bacteria | 2671 |
| 632 | Ga0496122_0179906 | 3300048925 | Bacteria | 1263 |
| 633 | Ga0496124_0001238 | 3300048927 | Bacteria | 39220 |
| 634 | Ga0496124_0213720 | 3300048927 | Bacteria | 1457 |
| 635 | Ga0496124_0281733 | 3300048927 | Bacteria | 1211 |
| 636 | Ga0496125_0008068 | 3300048928 | Bacteria | 11106 |
| 637 | Ga0496125_0054723 | 3300048928 | Bacteria | 3258 |
| 638 | Ga0496125_0264241 | 3300048928 | Bacteria | 1076 |
| 639 | Ga0496126_0010346 | 3300048929 | Bacteria | 9790 |
| 640 | Ga0496126_0029216 | 3300048929 | Bacteria | 5239 |
| 641 | Ga0496126_0030038 | 3300048929 | Bacteria | 5157 |
| 642 | Ga0496126_0030901 | 3300048929 | Bacteria | 5068 |
| 643 | Ga0496126_0093824 | 3300048929 | Bacteria | 2635 |
| 644 | Ga0496126_0094406 | 3300048929 | Bacteria | 2625 |
| 645 | Ga0496126_0095251 | 3300048929 | Bacteria | 2611 |
| 646 | Ga0496126_0110749 | 3300048929 | Bacteria | 2391 |
| 647 | Ga0496126_0116159 | 3300048929 | Bacteria | 2326 |
| 648 | Ga0496126_0158617 | 3300048929 | Bacteria | 1934 |
| 649 | Ga0495678_027212 | 3300049459 | Bacteria | 2429 |
| 650 | Ga0501031_0000394 | 3300049568 | Bacteria | 25545 |
| 651 | Ga0501032_0000120 | 3300049569 | Bacteria | 64900 |
| 652 | Ga0501032_0029824 | 3300049569 | Bacteria | 3742 |
| 653 | Ga0501033_0001934 | 3300049570 | Bacteria | 18049 |
| 654 | Ga0501033_0083913 | 3300049570 | Bacteria | 2335 |
| 655 | Ga0501033_0165697 | 3300049570 | Bacteria | 1589 |
| 656 | Ga0501034_0000014 | 3300049571 | Bacteria | 297798 |
| 657 | Ga0501034_0000061 | 3300049571 | Bacteria | 195178 |
| 658 | Ga0501036_0000054 | 3300049572 | Bacteria | 74190 |
| 659 | Ga0501036_0026394 | 3300049572 | Bacteria | 4903 |
| 660 | Ga0501037_0000093 | 3300049573 | Bacteria | 83246 |
| 661 | Ga0501038_0000066 | 3300049574 | Bacteria | 86216 |
| 662 | Ga0501038_0032518 | 3300049574 | Bacteria | 4602 |
| 663 | Ga0501039_0000142 | 3300049575 | Bacteria | 48935 |
| 664 | Ga0501039_0000289 | 3300049575 | Bacteria | 35699 |
| 665 | Ga0501043_0001358 | 3300049579 | Bacteria | 21438 |
| 666 | Ga0501043_0374312 | 3300049579 | Bacteria | 1079 |
| 667 | Ga0501046_0002815 | 3300049580 | Bacteria | 16199 |
| 668 | Ga0501046_0009578 | 3300049580 | Bacteria | 8356 |
| 669 | Ga0501047_0000122 | 3300049581 | Bacteria | 95307 |
| 670 | Ga0501047_0000291 | 3300049581 | Bacteria | 57615 |
| 671 | Ga0501047_0038737 | 3300049581 | Bacteria | 4612 |
| 672 | Ga0501048_0000548 | 3300049582 | Bacteria | 26504 |
| 673 | Ga0501048_0000976 | 3300049582 | Bacteria | 21182 |
| 674 | Ga0501067_0000118 | 3300049583 | Bacteria | 44933 |
| 675 | Ga0501067_0005695 | 3300049583 | Bacteria | 6919 |
| 676 | Ga0501067_0108497 | 3300049583 | Bacteria | 1543 |
| 677 | Ga0501068_0015383 | 3300049584 | Bacteria | 4392 |
| 678 | Ga0501070_0022012 | 3300049586 | Bacteria | 5339 |
| 679 | Ga0501070_0042294 | 3300049586 | Bacteria | 3795 |
| 680 | Ga0501070_0082890 | 3300049586 | Bacteria | 2654 |
| 681 | Ga0501070_0485137 | 3300049586 | Bacteria | 994 |
| 682 | Ga0501071_0072261 | 3300049587 | Bacteria | 2516 |
| 683 | Ga0501072_0049721 | 3300049588 | Bacteria | 3300 |
| 684 | Ga0501073_0000146 | 3300049589 | Bacteria | 46947 |
| 685 | Ga0501074_0001004 | 3300049590 | Bacteria | 18312 |
| 686 | Ga0501079_0004827 | 3300049741 | Bacteria | 9985 |
| 687 | Ga0501080_0000010 | 3300049742 | Bacteria | 115062 |
| 688 | Ga0501080_0027156 | 3300049742 | Bacteria | 5323 |
| 689 | Ga0501035_0000034 | 3300049822 | Bacteria | 174589 |
| 690 | Ga0501035_0000099 | 3300049822 | Bacteria | 108224 |
| 691 | Ga0501035_0367960 | 3300049822 | Bacteria | 1200 |
| 692 | Ga0501044_0000039 | 3300049823 | Bacteria | 158218 |
| 693 | Ga0501044_0000367 | 3300049823 | Bacteria | 56521 |
| 694 | nmdc:mga03683_65994_c1 | 3300050489 | Bacteria | 1538 |
| 695 | nmdc:mga03n38_34268_c1 | 3300050490 | Bacteria | 2167 |
| 696 | nmdc:mga00v17_31841_c1 | 3300050491 | Bacteria | 3112 |
| 697 | nmdc:mga0yw44_130991_c1 | 3300050492 | Bacteria | 1624 |
| 698 | nmdc:mga0yw44_31257_c1 | 3300050492 | Bacteria | 3094 |
| 699 | nmdc:mga0yw44_4430_c1 | 3300050492 | Bacteria | 6439 |
| 700 | nmdc:mga0yw44_66574_c1 | 3300050492 | Bacteria | 2223 |
| 701 | nmdc:mga0yw44_7412_c1 | 3300050492 | Bacteria | 5395 |
| 702 | nmdc:mga06z11_67830_c1 | 3300050494 | Bacteria | 1879 |
| 703 | nmdc:mga06z11_98991_c1 | 3300050494 | Bacteria | 1597 |
| 704 | nmdc:mga04h51_83276_c1 | 3300050495 | Bacteria | 1139 |
| 705 | nmdc:mga07m45_114109_c1 | 3300050496 | Bacteria | 1558 |
| 706 | nmdc:mga07m45_19251_c1 | 3300050496 | Bacteria | 3697 |
| 707 | nmdc:mga09592_389107_c1 | 3300050508 | Bacteria | 1205 |
| 708 | nmdc:mga08y16_474409_c1 | 3300050511 | Bacteria | 1274 |
| 709 | nmdc:mga0n895_6786_c1 | 3300050512 | Bacteria | 9769 |
| 710 | nmdc:mga0n895_86178_c1 | 3300050512 | Unclassified | 3137 |
| 711 | nmdc:mga0n895_87559_c1 | 3300050512 | Bacteria | 3112 |
| 712 | nmdc:mga0rr50_73880_c1 | 3300050513 | Unclassified | 2608 |
| 713 | nmdc:mga0a205_66738_c1 | 3300050515 | Bacteria | 3476 |
| 714 | nmdc:mga0sz30_24843_c1 | 3300050516 | Bacteria | 2448 |
| 715 | Ga0495601_0000004 | 3300053077 | Bacteria | 449178 |
| 716 | Ga0495601_0049571 | 3300053077 | Bacteria | 2648 |
| 717 | Ga0495601_0053969 | 3300053077 | Bacteria | 2541 |
| 718 | Ga0495612_0000013 | 3300053078 | Bacteria | 198142 |
| 719 | Ga0495612_0012545 | 3300053078 | Bacteria | 3416 |
| 720 | Ga0500635_0007712 | 3300053080 | Bacteria | 2927 |
| 721 | Ga0500635_0021870 | 3300053080 | Bacteria | 1976 |
| 722 | Ga0495595_0000039 | 3300053084 | Bacteria | 68667 |
| 723 | Ga0495619_0000005 | 3300053085 | Bacteria | 418061 |
| 724 | Ga0495619_0061361 | 3300053085 | Bacteria | 2502 |
| 725 | Ga0500647_0018825 | 3300053091 | Bacteria | 3202 |
| 726 | Ga0500651_0004903 | 3300053093 | Bacteria | 7566 |
| 727 | Ga0500651_0292553 | 3300053093 | Bacteria | 936 |
| 728 | Ga0500566_0000020 | 3300053094 | Bacteria | 83462 |
| 729 | Ga0500566_0010191 | 3300053094 | Bacteria | 5544 |
| 730 | Ga0500566_0037138 | 3300053094 | Bacteria | 2823 |
| 731 | Ga0500640_000957 | 3300053095 | Bacteria | 8166 |
| 732 | Ga0500641_0001024 | 3300053096 | Bacteria | 9936 |
| 733 | Ga0500554_005163 | 3300053102 | Bacteria | 2823 |
| 734 | Ga0500554_009927 | 3300053102 | Bacteria | 2298 |
| 735 | Ga0500569_015557 | 3300053109 | Bacteria | 1908 |
| 736 | Ga0500572_000455 | 3300053111 | Bacteria | 14240 |
| 737 | Ga0500572_000882 | 3300053111 | Bacteria | 9311 |
| 738 | Ga0500594_0049090 | 3300053118 | Bacteria | 1182 |
| 739 | Ga0500595_000977 | 3300053119 | Bacteria | 16054 |
| 740 | Ga0500595_008725 | 3300053119 | Bacteria | 4125 |
| 741 | Ga0500595_008794 | 3300053119 | Bacteria | 4104 |
| 742 | Ga0500595_018339 | 3300053119 | Bacteria | 2561 |
| 743 | Ga0500595_026419 | 3300053119 | Bacteria | 2001 |
| 744 | Ga0500608_005725 | 3300053122 | Bacteria | 4972 |
| 745 | Ga0500614_000134 | 3300053123 | Bacteria | 18035 |
| 746 | Ga0500642_0042106 | 3300053130 | Bacteria | 1978 |
| 747 | Ga0500655_006594 | 3300053133 | Bacteria | 2089 |
| 748 | Ga0500559_0000930 | 3300053136 | Bacteria | 18495 |
| 749 | Ga0500559_0003043 | 3300053136 | Bacteria | 8381 |
| 750 | Ga0500568_0015205 | 3300053139 | Bacteria | 3450 |
| 751 | Ga0500603_000209 | 3300053150 | Bacteria | 15429 |
| 752 | Ga0500603_002632 | 3300053150 | Bacteria | 3908 |
| 753 | Ga0500603_073093 | 3300053150 | Bacteria | 980 |
| 754 | Ga0500622_0041194 | 3300053156 | Bacteria | 2404 |
| 755 | Ga0500627_0080499 | 3300053158 | Bacteria | 1452 |
| 756 | Ga0500630_001295 | 3300053159 | Bacteria | 11762 |
| 757 | Ga0500638_010552 | 3300053162 | Bacteria | 4052 |
| 758 | Ga0500638_086904 | 3300053162 | Bacteria | 1478 |
| 759 | Ga0500639_000111 | 3300053163 | Bacteria | 38862 |
| 760 | Ga0500636_0082938 | 3300053177 | Bacteria | 1845 |
| 761 | Ga0500636_0108588 | 3300053177 | Bacteria | 1570 |
| 762 | Ga0500637_0000941 | 3300053178 | Bacteria | 11795 |
| 763 | Ga0500637_0032604 | 3300053178 | Bacteria | 2905 |
| 764 | Ga0500637_0049480 | 3300053178 | Bacteria | 2392 |
| 765 | Ga0500570_118119 | 3300053724 | Bacteria | 1051 |
| 766 | Ga0500645_024807 | 3300053730 | Bacteria | 1831 |
| 767 | Ga0500596_000483 | 3300053735 | Bacteria | 7448 |
| 768 | Ga0500601_004478 | 3300053737 | Bacteria | 1523 |
| 769 | Ga0501084_0027731 | 3300054114 | Bacteria | 4732 |
| 770 | Ga0500661_000091 | 3300055283 | Bacteria | 14401 |
| 771 | Ga0501082_0118605 | 3300060353 | Bacteria | 2292 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050511 | nmdc:mga08y16_474409_c1 | nmdc:mga08y16_474409_c1_16_795 | 257 |
| 2 | 3300046519 | Ga0495632_0120662 | Ga0495632_0120662_163_957 | 264 |
| 3 | 3300049582 | Ga0501048_0000976 | Ga0501048_0000976_19282_20172 | 266 |
| 4 | 3300034819 | Ga0373958_0001999 | Ga0373958_0001999_1983_2798 | 269 |
| 5 | 3300035114 | Ga0373939_0002723 | Ga0373939_0002723_1858_2673 | 269 |
| 6 | 3300035241 | Ga0373961_0006644 | Ga0373961_0006644_73_888 | 269 |
| 7 | 3300035242 | Ga0373962_0042001 | Ga0373962_0042001_205_1020 | 269 |
| 8 | 3300035691 | Ga0373931_0053603 | Ga0373931_0053603_469_1284 | 269 |
| 9 | 3300045976 | Ga0466967_0704612 | Ga0466967_0704612_158_973 | 269 |
| 10 | 3300009551 | Ga0105238_10169211 | Ga0105238_101692111 | 270 |
| 11 | 3300026121 | Ga0207683_10133197 | Ga0207683_101331971 | 270 |
| 12 | 3300031711 | Ga0265314_10030411 | Ga0265314_100304111 | 270 |
| 13 | 3300031712 | Ga0265342_10147747 | Ga0265342_101477472 | 270 |
| 14 | 3300035118 | Ga0373954_0260456 | Ga0373954_0260456_22_834 | 270 |
| 15 | 3300035172 | Ga0373955_0211473 | Ga0373955_0211473_26_838 | 270 |
| 16 | 3300035725 | Ga0373947_0126853 | Ga0373947_0126853_744_1556 | 270 |
| 17 | 3300046455 | Ga0495603_0066954 | Ga0495603_0066954_29_841 | 270 |
| 18 | 3300046459 | Ga0495629_0306418 | Ga0495629_0306418_224_1042 | 270 |
| 19 | 3300046460 | Ga0495638_0200910 | Ga0495638_0200910_246_1058 | 270 |
| 20 | 3300046462 | Ga0495651_0032169 | Ga0495651_0032169_26_838 | 270 |
| 21 | 3300046463 | Ga0495653_0104323 | Ga0495653_0104323_1210_2022 | 270 |
| 22 | 3300046491 | Ga0495584_0222177 | Ga0495584_0222177_138_950 | 270 |
| 23 | 3300046511 | Ga0495608_0009669 | Ga0495608_0009669_5896_6708 | 270 |
| 24 | 3300046663 | Ga0495635_0317353 | Ga0495635_0317353_171_983 | 270 |
| 25 | 3300048924 | Ga0496121_0072344 | Ga0496121_0072344_1298_2110 | 270 |
| 26 | 3300053093 | Ga0500651_0292553 | Ga0500651_0292553_90_902 | 270 |
| 27 | 3300041498 | Ga0451841_0361863 | Ga0451841_0361863_32_859 | 273 |
| 28 | 3300035172 | Ga0373955_0272770 | Ga0373955_0272770_35_925 | 275 |
| 29 | 3300005439 | Ga0070711_100172690 | Ga0070711_1001726903 | 282 |
| 30 | 3300048905 | Ga0496102_0767133 | Ga0496102_0767133_10_867 | 285 |
| 31 | 3300005937 | Ga0081455_10045667 | Ga0081455_100456672 | 287 |
| 32 | 3300035111 | Ga0373923_0000940 | Ga0373923_0000940_5687_6565 | 287 |
| 33 | 3300035113 | Ga0373936_0000142 | Ga0373936_0000142_17038_17916 | 287 |
| 34 | 3300035116 | Ga0373945_0005308 | Ga0373945_0005308_436_1314 | 287 |
| 35 | 3300035117 | Ga0373953_0001908 | Ga0373953_0001908_4713_5591 | 287 |
| 36 | 3300035118 | Ga0373954_0002012 | Ga0373954_0002012_4550_5428 | 287 |
| 37 | 3300035120 | Ga0373957_0025648 | Ga0373957_0025648_493_1371 | 287 |
| 38 | 3300035170 | Ga0373943_0011979 | Ga0373943_0011979_2840_3718 | 287 |
| 39 | 3300035171 | Ga0373946_0001354 | Ga0373946_0001354_5418_6296 | 287 |
| 40 | 3300035172 | Ga0373955_0001050 | Ga0373955_0001050_1469_2347 | 287 |
| 41 | 3300035410 | Ga0373924_0000143 | Ga0373924_0000143_11426_12304 | 287 |
| 42 | 3300035692 | Ga0373935_0000528 | Ga0373935_0000528_3321_4199 | 287 |
| 43 | 3300035695 | Ga0373927_0045863 | Ga0373927_0045863_1315_2193 | 287 |
| 44 | 3300035724 | Ga0373933_0004103 | Ga0373933_0004103_5377_6255 | 287 |
| 45 | 3300035725 | Ga0373947_0001975 | Ga0373947_0001975_11281_12159 | 287 |
| 46 | 3300036401 | Ga0373937_0000063 | Ga0373937_0000063_76266_77144 | 287 |
| 47 | 3300037068 | Ga0373925_0000185 | Ga0373925_0000185_15133_16011 | 287 |
| 48 | 3300039437 | Ga0436365_0607069 | Ga0436365_0607069_1223_2086 | 287 |
| 49 | 3300046454 | Ga0495592_0000162 | Ga0495592_0000162_11982_12860 | 287 |
| 50 | 3300046459 | Ga0495629_0207017 | Ga0495629_0207017_423_1301 | 287 |
| 51 | 3300046462 | Ga0495651_0000190 | Ga0495651_0000190_11207_12085 | 287 |
| 52 | 3300046476 | Ga0495662_0000692 | Ga0495662_0000692_12811_13689 | 287 |
| 53 | 3300046477 | Ga0495664_0000006 | Ga0495664_0000006_187694_188572 | 287 |
| 54 | 3300046511 | Ga0495608_0000002 | Ga0495608_0000002_187642_188520 | 287 |
| 55 | 3300046514 | Ga0495618_0000001 | Ga0495618_0000001_44584_45462 | 287 |
| 56 | 3300046516 | Ga0495628_0000004 | Ga0495628_0000004_239839_240717 | 287 |
| 57 | 3300046517 | Ga0495630_0006844 | Ga0495630_0006844_2737_3615 | 287 |
| 58 | 3300046529 | Ga0495652_0000007 | Ga0495652_0000007_229421_230299 | 287 |
| 59 | 3300046533 | Ga0495640_0000004 | Ga0495640_0000004_209759_210637 | 287 |
| 60 | 3300046536 | Ga0495587_0000002 | Ga0495587_0000002_236775_237653 | 287 |
| 61 | 3300046543 | Ga0495645_0000008 | Ga0495645_0000008_142889_143767 | 287 |
| 62 | 3300046559 | Ga0495667_0000006 | Ga0495667_0000006_236762_237640 | 287 |
| 63 | 3300046642 | Ga0495634_0000001 | Ga0495634_0000001_214824_215702 | 287 |
| 64 | 3300046663 | Ga0495635_0000004 | Ga0495635_0000004_209715_210593 | 287 |
| 65 | 3300046675 | Ga0495657_0000104 | Ga0495657_0000104_46476_47354 | 287 |
| 66 | 3300046678 | Ga0495599_0000003 | Ga0495599_0000003_130500_131378 | 287 |
| 67 | 3300046679 | Ga0495623_0000033 | Ga0495623_0000033_47087_47965 | 287 |
| 68 | 3300046680 | Ga0495646_0000001 | Ga0495646_0000001_187751_188629 | 287 |
| 69 | 3300046690 | Ga0495624_0019391 | Ga0495624_0019391_1555_2433 | 287 |
| 70 | 3300046809 | Ga0495600_0000098 | Ga0495600_0000098_39892_40770 | 287 |
| 71 | 3300047315 | Ga0495581_0011098 | Ga0495581_0011098_1959_2837 | 287 |
| 72 | 3300047317 | Ga0495604_0000003 | Ga0495604_0000003_187616_188494 | 287 |
| 73 | 3300047319 | Ga0495674_0000006 | Ga0495674_0000006_279345_280223 | 287 |
| 74 | 3300047322 | Ga0495680_0000149 | Ga0495680_0000149_55876_56754 | 287 |
| 75 | 3300047444 | Ga0495675_0000535 | Ga0495675_0000535_11784_12662 | 287 |
| 76 | 3300047471 | Ga0495684_0000003 | Ga0495684_0000003_101070_101948 | 287 |
| 77 | 3300048088 | Ga0495602_0000012 | Ga0495602_0000012_12033_12911 | 287 |
| 78 | 3300049586 | Ga0501070_0485137 | Ga0501070_0485137_107_976 | 287 |
| 79 | 3300053077 | Ga0495601_0000004 | Ga0495601_0000004_260458_261336 | 287 |
| 80 | 3300053078 | Ga0495612_0000013 | Ga0495612_0000013_9513_10391 | 287 |
| 81 | 3300053084 | Ga0495595_0000039 | Ga0495595_0000039_54721_55599 | 287 |
| 82 | 3300053085 | Ga0495619_0000005 | Ga0495619_0000005_187757_188635 | 287 |
| 83 | 3300013102 | Ga0157371_10023272 | Ga0157371_100232725 | 289 |
| 84 | 3300013307 | Ga0157372_10154390 | Ga0157372_101543902 | 289 |
| 85 | 3300047321 | Ga0495676_0038619 | Ga0495676_0038619_882_1751 | 289 |
| 86 | 3300048907 | Ga0496104_0604980 | Ga0496104_0604980_14_883 | 289 |
| 87 | iso_pu_bacteria | 2513237098 | 2513672770 | 289 |
| 88 | iso_pu_bacteria | 2903768456 | 2903775412 | 289 |
| 89 | 3300006871 | Ga0075434_100088516 | Ga0075434_1000885162 | 290 |
| 90 | 3300007076 | Ga0075435_100189830 | Ga0075435_1001898302 | 290 |
| 91 | 3300035086 | Ga0373934_0162150 | Ga0373934_0162150_33_905 | 290 |
| 92 | 3300048921 | Ga0496118_0044451 | Ga0496118_0044451_94_966 | 290 |
| 93 | 3300048924 | Ga0496121_0001291 | Ga0496121_0001291_40_912 | 290 |
| 94 | 3300048927 | Ga0496124_0001238 | Ga0496124_0001238_38279_39151 | 290 |
| 95 | 3300048929 | Ga0496126_0030901 | Ga0496126_0030901_3115_3987 | 290 |
| 96 | 3300048929 | Ga0496126_0093824 | Ga0496126_0093824_1700_2572 | 290 |
| 97 | 3300050512 | nmdc:mga0n895_87559_c1 | nmdc:mga0n895_87559_c1_318_1205 | 290 |
| 98 | 3300053177 | Ga0500636_0108588 | Ga0500636_0108588_34_906 | 290 |
| 99 | 3300053178 | Ga0500637_0032604 | Ga0500637_0032604_730_1632 | 290 |
| 100 | 3300053724 | Ga0500570_118119 | Ga0500570_118119_10_882 | 290 |
| 101 | iso_pu_bacteria | 2524023210 | 2524470256 | 290 |
| 102 | iso_pu_bacteria | 2885383462 | 2885387188 | 290 |
| 103 | iso_pu_bacteria | 2904690495 | 2904691525 | 290 |
| 104 | iso_pu_bacteria | 2908756301 | 2908761663 | 290 |
| 105 | iso_pu_bacteria | 2922361189 | 2922362099 | 290 |
| 106 | iso_pu_bacteria | 8056689827 | 8056695967 | 290 |
| 107 | iso_pu_bacteria | 2507262055 | 2507511245 | 291 |
| 108 | iso_pu_bacteria | 2508501128 | 2509151372 | 291 |
| 109 | iso_pu_bacteria | 2513237092 | 2513623684 | 291 |
| 110 | iso_pu_bacteria | 2513237095 | 2513651934 | 291 |
| 111 | iso_pu_bacteria | 2513237139 | 2513874857 | 291 |
| 112 | iso_pu_bacteria | 2513237141 | 2513893397 | 291 |
| 113 | iso_pu_bacteria | 2528768022 | 2528849260 | 291 |
| 114 | iso_pu_bacteria | 2617270735 | 2617350519 | 291 |
| 115 | iso_pu_bacteria | 2791355199 | 2793082715 | 291 |
| 116 | iso_pu_bacteria | 2802429603 | 2805916860 | 291 |
| 117 | iso_pu_bacteria | 2816332527 | 2818238398 | 291 |
| 118 | iso_pu_bacteria | 2824661429 | 2824663394 | 291 |
| 119 | iso_pu_bacteria | 2824696289 | 2824701953 | 291 |
| 120 | iso_pu_bacteria | 2824732956 | 2824737905 | 291 |
| 121 | iso_pu_bacteria | 2824773399 | 2824773531 | 291 |
| 122 | iso_pu_bacteria | 2841957949 | 2841962140 | 291 |
| 123 | iso_pu_bacteria | 2847939898 | 2847944024 | 291 |
| 124 | iso_pu_bacteria | 2874612657 | 2874619784 | 291 |
| 125 | iso_pu_bacteria | 2876761206 | 2876768766 | 291 |
| 126 | iso_pu_bacteria | 2879099564 | 2879109088 | 291 |
| 127 | iso_pu_bacteria | 2879127579 | 2879134274 | 291 |
| 128 | iso_pu_bacteria | 2879142872 | 2879145913 | 291 |
| 129 | iso_pu_bacteria | 2885409591 | 2885410604 | 291 |
| 130 | iso_pu_bacteria | 2888378607 | 2888381274 | 291 |
| 131 | iso_pu_bacteria | 2888388044 | 2888389402 | 291 |
| 132 | iso_pu_bacteria | 2929615660 | 2929619302 | 291 |
| 133 | iso_pu_bacteria | 2929624759 | 2929628228 | 291 |
| 134 | iso_pu_bacteria | 2932784394 | 2932785601 | 291 |
| 135 | iso_pu_bacteria | 2932809354 | 2932813814 | 291 |
| 136 | iso_pu_bacteria | 2932818245 | 2932822217 | 291 |
| 137 | iso_pu_bacteria | 2932828146 | 2932830665 | 291 |
| 138 | iso_pu_bacteria | 2933577622 | 2933581223 | 291 |
| 139 | iso_pu_bacteria | 2935608549 | 2935612524 | 291 |
| 140 | iso_pu_bacteria | 2935616580 | 2935620706 | 291 |
| 141 | iso_pu_bacteria | 2935638405 | 2935639784 | 291 |
| 142 | iso_pu_bacteria | 2935665750 | 2935667378 | 291 |
| 143 | iso_pu_bacteria | 2935675223 | 2935677563 | 291 |
| 144 | iso_pu_bacteria | 2935684952 | 2935690495 | 291 |
| 145 | iso_pu_bacteria | 2935694250 | 2935697174 | 291 |
| 146 | iso_pu_bacteria | 2935703347 | 2935705118 | 291 |
| 147 | iso_pu_bacteria | 2935713505 | 2935717809 | 291 |
| 148 | iso_pu_bacteria | 2935722832 | 2935727041 | 291 |
| 149 | iso_pu_bacteria | 2935732158 | 2935735811 | 291 |
| 150 | iso_pu_bacteria | 2935741537 | 2935744918 | 291 |
| 151 | iso_pu_bacteria | 2935750917 | 2935755504 | 291 |
| 152 | iso_pu_bacteria | 2935760218 | 2935761982 | 291 |
| 153 | iso_pu_bacteria | 2935801545 | 2935803481 | 291 |
| 154 | iso_pu_bacteria | 2935810662 | 2935811407 | 291 |
| 155 | iso_pu_bacteria | 2935819856 | 2935824013 | 291 |
| 156 | iso_pu_bacteria | 2935827899 | 2935829267 | 291 |
| 157 | iso_pu_bacteria | 2935837841 | 2935842754 | 291 |
| 158 | iso_pu_bacteria | 2935847175 | 2935852840 | 291 |
| 159 | iso_pu_bacteria | 2935855204 | 2935858514 | 291 |
| 160 | iso_pu_bacteria | 2935864058 | 2935867065 | 291 |
| 161 | iso_pu_bacteria | 2935873716 | 2935877195 | 291 |
| 162 | iso_pu_bacteria | 2935975950 | 2935976909 | 291 |
| 163 | iso_pu_bacteria | 2935992306 | 2935995169 | 291 |
| 164 | iso_pu_bacteria | 2936002035 | 2936004056 | 291 |
| 165 | iso_pu_bacteria | 2936037263 | 2936037989 | 291 |
| 166 | iso_pu_bacteria | 2940556831 | 2940561215 | 291 |
| 167 | iso_pu_bacteria | 2941538514 | 2941544397 | 291 |
| 168 | iso_pu_bacteria | 3005587118 | 3005592849 | 291 |
| 169 | iso_pu_bacteria | 8006984368 | 8006991972 | 291 |
| 170 | iso_pu_bacteria | 8016511872 | 8016516748 | 291 |
| 171 | iso_pu_bacteria | 8017057580 | 8017059815 | 291 |
| 172 | iso_pu_bacteria | 8019576017 | 8019579294 | 291 |
| 173 | iso_pu_bacteria | 8019586578 | 8019597349 | 291 |
| 174 | iso_pu_bacteria | 8019597564 | 8019604338 | 291 |
| 175 | iso_pu_bacteria | 8019608314 | 8019614198 | 291 |
| 176 | iso_pu_bacteria | 8019619141 | 8019624876 | 291 |
| 177 | iso_pu_bacteria | 8019668869 | 8019674696 | 291 |
| 178 | iso_pu_bacteria | 8055742211 | 8055749440 | 291 |
| 179 | 3300005354 | Ga0070675_100085365 | Ga0070675_1000853653 | 292 |
| 180 | 3300005434 | Ga0070709_10174801 | Ga0070709_101748011 | 292 |
| 181 | 3300005937 | Ga0081455_10000073 | Ga0081455_100000734 | 292 |
| 182 | 3300006847 | Ga0075431_100449789 | Ga0075431_1004497892 | 292 |
| 183 | 3300006852 | Ga0075433_10004563 | Ga0075433_100045634 | 292 |
| 184 | 3300009094 | Ga0111539_10377139 | Ga0111539_103771392 | 292 |
| 185 | 3300010159 | Ga0099796_10007064 | Ga0099796_100070644 | 292 |
| 186 | 3300025906 | Ga0207699_10204089 | Ga0207699_102040891 | 292 |
| 187 | 3300025915 | Ga0207693_10220871 | Ga0207693_102208711 | 292 |
| 188 | 3300027671 | Ga0209588_1014704 | Ga0209588_10147042 | 292 |
| 189 | 3300028381 | Ga0268264_10435685 | Ga0268264_104356852 | 292 |
| 190 | 3300035695 | Ga0373927_0048990 | Ga0373927_0048990_1824_2717 | 292 |
| 191 | 3300035695 | Ga0373927_0057422 | Ga0373927_0057422_109_987 | 292 |
| 192 | 3300046683 | Ga0495658_0022246 | Ga0495658_0022246_2413_3306 | 292 |
| 193 | 3300050512 | nmdc:mga0n895_6786_c1 | nmdc:mga0n895_6786_c1_5459_6355 | 292 |
| 194 | 3300050515 | nmdc:mga0a205_66738_c1 | nmdc:mga0a205_66738_c1_2116_3006 | 292 |
| 195 | 3300005435 | Ga0070714_100001330 | Ga0070714_1000013305 | 293 |
| 196 | 3300006871 | Ga0075434_100101368 | Ga0075434_1001013682 | 293 |
| 197 | 3300007076 | Ga0075435_100542071 | Ga0075435_1005420711 | 293 |
| 198 | 3300007788 | Ga0099795_10007573 | Ga0099795_100075732 | 293 |
| 199 | 3300025893 | Ga0207682_10066293 | Ga0207682_100662932 | 293 |
| 200 | 3300025916 | Ga0207663_10242632 | Ga0207663_102426321 | 293 |
| 201 | 3300025929 | Ga0207664_10163631 | Ga0207664_101636312 | 293 |
| 202 | 3300031247 | Ga0265340_10049838 | Ga0265340_100498382 | 293 |
| 203 | 3300031344 | Ga0265316_10091936 | Ga0265316_100919363 | 293 |
| 204 | 3300035113 | Ga0373936_0029308 | Ga0373936_0029308_662_1543 | 293 |
| 205 | 3300035692 | Ga0373935_0021340 | Ga0373935_0021340_1708_2589 | 293 |
| 206 | 3300035695 | Ga0373927_0042844 | Ga0373927_0042844_1102_1983 | 293 |
| 207 | 3300035724 | Ga0373933_0134495 | Ga0373933_0134495_273_1154 | 293 |
| 208 | 3300035725 | Ga0373947_0043816 | Ga0373947_0043816_1378_2259 | 293 |
| 209 | 3300037068 | Ga0373925_0130183 | Ga0373925_0130183_564_1445 | 293 |
| 210 | 3300037471 | Ga0395905_0076714 | Ga0395905_0076714_510_1391 | 293 |
| 211 | 3300046533 | Ga0495640_0168809 | Ga0495640_0168809_267_1148 | 293 |
| 212 | 3300047471 | Ga0495684_0282575 | Ga0495684_0282575_178_1059 | 293 |
| 213 | 3300048905 | Ga0496102_0262241 | Ga0496102_0262241_34_933 | 293 |
| 214 | 3300048908 | Ga0496105_0081970 | Ga0496105_0081970_1575_2456 | 293 |
| 215 | 3300048910 | Ga0496107_0093819 | Ga0496107_0093819_104_985 | 293 |
| 216 | 3300048913 | Ga0496110_0362059 | Ga0496110_0362059_163_1044 | 293 |
| 217 | 3300048917 | Ga0496114_0049252 | Ga0496114_0049252_2254_3135 | 293 |
| 218 | 3300048918 | Ga0496115_0097067 | Ga0496115_0097067_1059_1940 | 293 |
| 219 | 3300050492 | nmdc:mga0yw44_31257_c1 | nmdc:mga0yw44_31257_c1_339_1274 | 293 |
| 220 | 3300050512 | nmdc:mga0n895_86178_c1 | nmdc:mga0n895_86178_c1_1992_2885 | 293 |
| 221 | 3300050513 | nmdc:mga0rr50_73880_c1 | nmdc:mga0rr50_73880_c1_1703_2596 | 293 |
| 222 | 3300053077 | Ga0495601_0049571 | Ga0495601_0049571_1279_2160 | 293 |
| 223 | 3300053085 | Ga0495619_0061361 | Ga0495619_0061361_1379_2275 | 293 |
| 224 | 3300005336 | Ga0070680_100015252 | Ga0070680_1000152523 | 294 |
| 225 | 3300005339 | Ga0070660_100081978 | Ga0070660_1000819782 | 294 |
| 226 | 3300005341 | Ga0070691_10025379 | Ga0070691_100253794 | 294 |
| 227 | 3300005366 | Ga0070659_100009316 | Ga0070659_1000093166 | 294 |
| 228 | 3300005434 | Ga0070709_10000506 | Ga0070709_1000050617 | 294 |
| 229 | 3300005434 | Ga0070709_10006029 | Ga0070709_100060299 | 294 |
| 230 | 3300005434 | Ga0070709_10008240 | Ga0070709_100082401 | 294 |
| 231 | 3300005434 | Ga0070709_10018713 | Ga0070709_100187132 | 294 |
| 232 | 3300005435 | Ga0070714_100016718 | Ga0070714_1000167188 | 294 |
| 233 | 3300005436 | Ga0070713_100005814 | Ga0070713_10000581412 | 294 |
| 234 | 3300005436 | Ga0070713_100023991 | Ga0070713_1000239913 | 294 |
| 235 | 3300005436 | Ga0070713_100031315 | Ga0070713_1000313154 | 294 |
| 236 | 3300005437 | Ga0070710_10000386 | Ga0070710_1000038610 | 294 |
| 237 | 3300005437 | Ga0070710_10002397 | Ga0070710_100023976 | 294 |
| 238 | 3300005437 | Ga0070710_10012971 | Ga0070710_100129712 | 294 |
| 239 | 3300005437 | Ga0070710_10062026 | Ga0070710_100620261 | 294 |
| 240 | 3300005439 | Ga0070711_100001793 | Ga0070711_10000179312 | 294 |
| 241 | 3300005439 | Ga0070711_100011103 | Ga0070711_1000111035 | 294 |
| 242 | 3300005539 | Ga0068853_100002345 | Ga0068853_10000234515 | 294 |
| 243 | 3300005545 | Ga0070695_100012117 | Ga0070695_1000121174 | 294 |
| 244 | 3300005546 | Ga0070696_100012886 | Ga0070696_1000128866 | 294 |
| 245 | 3300005616 | Ga0068852_100093823 | Ga0068852_1000938232 | 294 |
| 246 | 3300005618 | Ga0068864_100068900 | Ga0068864_1000689003 | 294 |
| 247 | 3300005842 | Ga0068858_100194812 | Ga0068858_1001948122 | 294 |
| 248 | 3300005843 | Ga0068860_100182768 | Ga0068860_1001827681 | 294 |
| 249 | 3300005983 | Ga0081540_1048857 | Ga0081540_10488572 | 294 |
| 250 | 3300005983 | Ga0081540_1062999 | Ga0081540_10629992 | 294 |
| 251 | 3300005985 | Ga0081539_10119056 | Ga0081539_101190561 | 294 |
| 252 | 3300006028 | Ga0070717_10019185 | Ga0070717_100191856 | 294 |
| 253 | 3300006038 | Ga0075365_10101915 | Ga0075365_101019154 | 294 |
| 254 | 3300006163 | Ga0070715_10072552 | Ga0070715_100725523 | 294 |
| 255 | 3300006173 | Ga0070716_100013305 | Ga0070716_1000133055 | 294 |
| 256 | 3300006173 | Ga0070716_100188851 | Ga0070716_1001888512 | 294 |
| 257 | 3300006175 | Ga0070712_100008029 | Ga0070712_1000080292 | 294 |
| 258 | 3300006175 | Ga0070712_100051745 | Ga0070712_1000517453 | 294 |
| 259 | 3300006175 | Ga0070712_100458632 | Ga0070712_1004586321 | 294 |
| 260 | 3300006237 | Ga0097621_100132585 | Ga0097621_1001325852 | 294 |
| 261 | 3300007788 | Ga0099795_10027421 | Ga0099795_100274212 | 294 |
| 262 | 3300009098 | Ga0105245_10618114 | Ga0105245_106181142 | 294 |
| 263 | 3300009174 | Ga0105241_10010832 | Ga0105241_100108325 | 294 |
| 264 | 3300009545 | Ga0105237_10035699 | Ga0105237_100356995 | 294 |
| 265 | 3300009545 | Ga0105237_10614960 | Ga0105237_106149601 | 294 |
| 266 | 3300009551 | Ga0105238_10015814 | Ga0105238_100158148 | 294 |
| 267 | 3300013104 | Ga0157370_10088570 | Ga0157370_100885701 | 294 |
| 268 | 3300013307 | Ga0157372_10206070 | Ga0157372_102060701 | 294 |
| 269 | 3300014969 | Ga0157376_10389523 | Ga0157376_103895231 | 294 |
| 270 | 3300025297 | Ga0209758_1004964 | Ga0209758_10049649 | 294 |
| 271 | 3300025898 | Ga0207692_10002116 | Ga0207692_100021163 | 294 |
| 272 | 3300025898 | Ga0207692_10020587 | Ga0207692_100205874 | 294 |
| 273 | 3300025898 | Ga0207692_10045204 | Ga0207692_100452041 | 294 |
| 274 | 3300025898 | Ga0207692_10064618 | Ga0207692_100646182 | 294 |
| 275 | 3300025905 | Ga0207685_10001134 | Ga0207685_100011346 | 294 |
| 276 | 3300025905 | Ga0207685_10133598 | Ga0207685_101335981 | 294 |
| 277 | 3300025906 | Ga0207699_10000315 | Ga0207699_1000031518 | 294 |
| 278 | 3300025906 | Ga0207699_10166481 | Ga0207699_101664812 | 294 |
| 279 | 3300025914 | Ga0207671_10151137 | Ga0207671_101511371 | 294 |
| 280 | 3300025915 | Ga0207693_10001315 | Ga0207693_100013155 | 294 |
| 281 | 3300025915 | Ga0207693_10003192 | Ga0207693_100031922 | 294 |
| 282 | 3300025915 | Ga0207693_10044175 | Ga0207693_100441752 | 294 |
| 283 | 3300025915 | Ga0207693_10068492 | Ga0207693_100684923 | 294 |
| 284 | 3300025915 | Ga0207693_10074227 | Ga0207693_100742273 | 294 |
| 285 | 3300025916 | Ga0207663_10004589 | Ga0207663_100045894 | 294 |
| 286 | 3300025916 | Ga0207663_10035391 | Ga0207663_100353912 | 294 |
| 287 | 3300025916 | Ga0207663_10222720 | Ga0207663_102227202 | 294 |
| 288 | 3300025919 | Ga0207657_10117682 | Ga0207657_101176821 | 294 |
| 289 | 3300025928 | Ga0207700_10012197 | Ga0207700_100121972 | 294 |
| 290 | 3300025928 | Ga0207700_10028958 | Ga0207700_100289584 | 294 |
| 291 | 3300025928 | Ga0207700_10042385 | Ga0207700_100423853 | 294 |
| 292 | 3300025929 | Ga0207664_10009598 | Ga0207664_100095988 | 294 |
| 293 | 3300025929 | Ga0207664_10155779 | Ga0207664_101557793 | 294 |
| 294 | 3300025932 | Ga0207690_10017589 | Ga0207690_100175891 | 294 |
| 295 | 3300025939 | Ga0207665_10001125 | Ga0207665_1000112515 | 294 |
| 296 | 3300025939 | Ga0207665_10002700 | Ga0207665_1000270012 | 294 |
| 297 | 3300025939 | Ga0207665_10113175 | Ga0207665_101131752 | 294 |
| 298 | 3300026035 | Ga0207703_10206321 | Ga0207703_102063212 | 294 |
| 299 | 3300026035 | Ga0207703_10400047 | Ga0207703_104000472 | 294 |
| 300 | 3300026041 | Ga0207639_10211061 | Ga0207639_102110611 | 294 |
| 301 | 3300026067 | Ga0207678_10000337 | Ga0207678_1000033713 | 294 |
| 302 | 3300026075 | Ga0207708_10065447 | Ga0207708_100654471 | 294 |
| 303 | 3300026142 | Ga0207698_10090822 | Ga0207698_100908222 | 294 |
| 304 | 3300027512 | Ga0209179_1008511 | Ga0209179_10085111 | 294 |
| 305 | 3300027671 | Ga0209588_1060221 | Ga0209588_10602211 | 294 |
| 306 | 3300028381 | Ga0268264_10218617 | Ga0268264_102186171 | 294 |
| 307 | 3300031238 | Ga0265332_10000227 | Ga0265332_100002274 | 294 |
| 308 | 3300031247 | Ga0265340_10004003 | Ga0265340_1000400311 | 294 |
| 309 | 3300031247 | Ga0265340_10023744 | Ga0265340_100237441 | 294 |
| 310 | 3300031249 | Ga0265339_10007527 | Ga0265339_100075274 | 294 |
| 311 | 3300031250 | Ga0265331_10035353 | Ga0265331_100353532 | 294 |
| 312 | 3300031616 | Ga0307508_10000403 | Ga0307508_1000040332 | 294 |
| 313 | 3300031616 | Ga0307508_10043361 | Ga0307508_100433611 | 294 |
| 314 | 3300031712 | Ga0265342_10000178 | Ga0265342_1000017820 | 294 |
| 315 | 3300033180 | Ga0307510_10127065 | Ga0307510_101270651 | 294 |
| 316 | 3300035695 | Ga0373927_0026775 | Ga0373927_0026775_919_1860 | 294 |
| 317 | 3300035724 | Ga0373933_0001902 | Ga0373933_0001902_2887_3771 | 294 |
| 318 | 3300036401 | Ga0373937_0109634 | Ga0373937_0109634_1340_2224 | 294 |
| 319 | 3300037418 | Ga0395900_0018958 | Ga0395900_0018958_4594_5487 | 294 |
| 320 | 3300037418 | Ga0395900_0272977 | Ga0395900_0272977_373_1266 | 294 |
| 321 | 3300037466 | Ga0395898_0010921 | Ga0395898_0010921_8210_9103 | 294 |
| 322 | 3300038443 | Ga0395901_0035674 | Ga0395901_0035674_466_1359 | 294 |
| 323 | 3300038443 | Ga0395901_0330154 | Ga0395901_0330154_235_1119 | 294 |
| 324 | 3300039437 | Ga0436365_1432862 | Ga0436365_1432862_72_962 | 294 |
| 325 | 3300039438 | Ga0436360_0353512 | Ga0436360_0353512_72_956 | 294 |
| 326 | 3300039447 | Ga0436361_0642483 | Ga0436361_0642483_163_1053 | 294 |
| 327 | 3300039450 | Ga0436363_1413720 | Ga0436363_1413720_77_961 | 294 |
| 328 | 3300046524 | Ga0495648_0001690 | Ga0495648_0001690_18747_19631 | 294 |
| 329 | 3300047320 | Ga0495672_0007685 | Ga0495672_0007685_5392_6276 | 294 |
| 330 | 3300048904 | Ga0496101_0287391 | Ga0496101_0287391_200_1084 | 294 |
| 331 | 3300048905 | Ga0496102_0265083 | Ga0496102_0265083_398_1282 | 294 |
| 332 | 3300048909 | Ga0496106_0010975 | Ga0496106_0010975_1301_2191 | 294 |
| 333 | 3300048918 | Ga0496115_0211067 | Ga0496115_0211067_605_1489 | 294 |
| 334 | 3300048918 | Ga0496115_0491343 | Ga0496115_0491343_81_965 | 294 |
| 335 | 3300048924 | Ga0496121_0000330 | Ga0496121_0000330_87453_88337 | 294 |
| 336 | 3300048924 | Ga0496121_0208529 | Ga0496121_0208529_226_1116 | 294 |
| 337 | 3300048925 | Ga0496122_0064272 | Ga0496122_0064272_1526_2410 | 294 |
| 338 | 3300048928 | Ga0496125_0264241 | Ga0496125_0264241_139_1023 | 294 |
| 339 | 3300048929 | Ga0496126_0010346 | Ga0496126_0010346_5673_6557 | 294 |
| 340 | 3300048929 | Ga0496126_0029216 | Ga0496126_0029216_2122_3006 | 294 |
| 341 | 3300048929 | Ga0496126_0030038 | Ga0496126_0030038_316_1206 | 294 |
| 342 | 3300049568 | Ga0501031_0000394 | Ga0501031_0000394_14408_15292 | 294 |
| 343 | 3300049569 | Ga0501032_0000120 | Ga0501032_0000120_42857_43741 | 294 |
| 344 | 3300049569 | Ga0501032_0029824 | Ga0501032_0029824_612_1502 | 294 |
| 345 | 3300049570 | Ga0501033_0001934 | Ga0501033_0001934_6827_7711 | 294 |
| 346 | 3300049570 | Ga0501033_0083913 | Ga0501033_0083913_986_1879 | 294 |
| 347 | 3300049570 | Ga0501033_0165697 | Ga0501033_0165697_591_1481 | 294 |
| 348 | 3300049571 | Ga0501034_0000014 | Ga0501034_0000014_93454_94344 | 294 |
| 349 | 3300049571 | Ga0501034_0000061 | Ga0501034_0000061_100387_101271 | 294 |
| 350 | 3300049572 | Ga0501036_0000054 | Ga0501036_0000054_43309_44193 | 294 |
| 351 | 3300049572 | Ga0501036_0026394 | Ga0501036_0026394_2287_3177 | 294 |
| 352 | 3300049573 | Ga0501037_0000093 | Ga0501037_0000093_42949_43833 | 294 |
| 353 | 3300049574 | Ga0501038_0000066 | Ga0501038_0000066_31828_32712 | 294 |
| 354 | 3300049574 | Ga0501038_0032518 | Ga0501038_0032518_1476_2366 | 294 |
| 355 | 3300049575 | Ga0501039_0000142 | Ga0501039_0000142_22620_23504 | 294 |
| 356 | 3300049575 | Ga0501039_0000289 | Ga0501039_0000289_10978_11868 | 294 |
| 357 | 3300049579 | Ga0501043_0001358 | Ga0501043_0001358_9943_10827 | 294 |
| 358 | 3300049579 | Ga0501043_0374312 | Ga0501043_0374312_112_1002 | 294 |
| 359 | 3300049580 | Ga0501046_0002815 | Ga0501046_0002815_2104_2994 | 294 |
| 360 | 3300049580 | Ga0501046_0009578 | Ga0501046_0009578_6633_7517 | 294 |
| 361 | 3300049581 | Ga0501047_0000122 | Ga0501047_0000122_94154_95038 | 294 |
| 362 | 3300049581 | Ga0501047_0000291 | Ga0501047_0000291_13162_14052 | 294 |
| 363 | 3300049581 | Ga0501047_0038737 | Ga0501047_0038737_3240_4130 | 294 |
| 364 | 3300049582 | Ga0501048_0000548 | Ga0501048_0000548_1053_1937 | 294 |
| 365 | 3300049583 | Ga0501067_0000118 | Ga0501067_0000118_3869_4753 | 294 |
| 366 | 3300049583 | Ga0501067_0005695 | Ga0501067_0005695_150_1040 | 294 |
| 367 | 3300049583 | Ga0501067_0108497 | Ga0501067_0108497_191_1093 | 294 |
| 368 | 3300049584 | Ga0501068_0015383 | Ga0501068_0015383_696_1580 | 294 |
| 369 | 3300049586 | Ga0501070_0022012 | Ga0501070_0022012_2402_3286 | 294 |
| 370 | 3300049586 | Ga0501070_0042294 | Ga0501070_0042294_467_1357 | 294 |
| 371 | 3300049586 | Ga0501070_0082890 | Ga0501070_0082890_1274_2164 | 294 |
| 372 | 3300049587 | Ga0501071_0072261 | Ga0501071_0072261_904_1788 | 294 |
| 373 | 3300049588 | Ga0501072_0049721 | Ga0501072_0049721_1344_2228 | 294 |
| 374 | 3300049589 | Ga0501073_0000146 | Ga0501073_0000146_37031_37915 | 294 |
| 375 | 3300049590 | Ga0501074_0001004 | Ga0501074_0001004_10468_11352 | 294 |
| 376 | 3300049741 | Ga0501079_0004827 | Ga0501079_0004827_3695_4579 | 294 |
| 377 | 3300049742 | Ga0501080_0000010 | Ga0501080_0000010_104614_105504 | 294 |
| 378 | 3300049742 | Ga0501080_0027156 | Ga0501080_0027156_2395_3279 | 294 |
| 379 | 3300049822 | Ga0501035_0000034 | Ga0501035_0000034_126553_127443 | 294 |
| 380 | 3300049822 | Ga0501035_0000099 | Ga0501035_0000099_78646_79530 | 294 |
| 381 | 3300049822 | Ga0501035_0367960 | Ga0501035_0367960_269_1159 | 294 |
| 382 | 3300049823 | Ga0501044_0000039 | Ga0501044_0000039_123490_124380 | 294 |
| 383 | 3300049823 | Ga0501044_0000367 | Ga0501044_0000367_2133_3017 | 294 |
| 384 | 3300053080 | Ga0500635_0021870 | Ga0500635_0021870_473_1357 | 294 |
| 385 | 3300053102 | Ga0500554_005163 | Ga0500554_005163_1491_2375 | 294 |
| 386 | 3300053119 | Ga0500595_008794 | Ga0500595_008794_2996_3880 | 294 |
| 387 | 3300053119 | Ga0500595_018339 | Ga0500595_018339_1571_2455 | 294 |
| 388 | 3300053139 | Ga0500568_0015205 | Ga0500568_0015205_2341_3225 | 294 |
| 389 | 3300053150 | Ga0500603_000209 | Ga0500603_000209_3373_4257 | 294 |
| 390 | 3300053178 | Ga0500637_0049480 | Ga0500637_0049480_254_1138 | 294 |
| 391 | 3300054114 | Ga0501084_0027731 | Ga0501084_0027731_197_1081 | 294 |
| 392 | 3300060353 | Ga0501082_0118605 | Ga0501082_0118605_1338_2222 | 294 |
| 393 | 3300000549 | LJQas_1014668 | LJQas_10146681 | 295 |
| 394 | 3300001989 | JGI24739J22299_10016256 | JGI24739J22299_100162564 | 295 |
| 395 | 3300003203 | JGI25406J46586_10000165 | JGI25406J46586_1000016519 | 295 |
| 396 | 3300003214 | JGI25165J46597_1006630 | JGI25165J46597_10066301 | 295 |
| 397 | 3300003215 | JGI25153J46596_10000575 | JGI25153J46596_1000057525 | 295 |
| 398 | 3300003759 | Ga0055525_1004330 | Ga0055525_10043302 | 295 |
| 399 | 3300005327 | Ga0070658_10099672 | Ga0070658_100996722 | 295 |
| 400 | 3300005329 | Ga0070683_100043524 | Ga0070683_1000435242 | 295 |
| 401 | 3300005334 | Ga0068869_100057695 | Ga0068869_1000576954 | 295 |
| 402 | 3300005334 | Ga0068869_100074094 | Ga0068869_1000740942 | 295 |
| 403 | 3300005336 | Ga0070680_100187112 | Ga0070680_1001871122 | 295 |
| 404 | 3300005337 | Ga0070682_100342676 | Ga0070682_1003426761 | 295 |
| 405 | 3300005338 | Ga0068868_100062156 | Ga0068868_1000621561 | 295 |
| 406 | 3300005339 | Ga0070660_100045327 | Ga0070660_1000453273 | 295 |
| 407 | 3300005339 | Ga0070660_100195360 | Ga0070660_1001953602 | 295 |
| 408 | 3300005340 | Ga0070689_100098548 | Ga0070689_1000985482 | 295 |
| 409 | 3300005347 | Ga0070668_100012163 | Ga0070668_1000121639 | 295 |
| 410 | 3300005347 | Ga0070668_100164813 | Ga0070668_1001648132 | 295 |
| 411 | 3300005354 | Ga0070675_100181162 | Ga0070675_1001811621 | 295 |
| 412 | 3300005354 | Ga0070675_100374362 | Ga0070675_1003743621 | 295 |
| 413 | 3300005366 | Ga0070659_100042620 | Ga0070659_1000426203 | 295 |
| 414 | 3300005434 | Ga0070709_10139333 | Ga0070709_101393331 | 295 |
| 415 | 3300005436 | Ga0070713_100158058 | Ga0070713_1001580583 | 295 |
| 416 | 3300005436 | Ga0070713_100358239 | Ga0070713_1003582391 | 295 |
| 417 | 3300005455 | Ga0070663_100014179 | Ga0070663_1000141797 | 295 |
| 418 | 3300005455 | Ga0070663_100171895 | Ga0070663_1001718951 | 295 |
| 419 | 3300005455 | Ga0070663_100280125 | Ga0070663_1002801251 | 295 |
| 420 | 3300005455 | Ga0070663_100409278 | Ga0070663_1004092781 | 295 |
| 421 | 3300005455 | Ga0070663_100412290 | Ga0070663_1004122901 | 295 |
| 422 | 3300005455 | Ga0070663_100511417 | Ga0070663_1005114171 | 295 |
| 423 | 3300005456 | Ga0070678_100084575 | Ga0070678_1000845753 | 295 |
| 424 | 3300005457 | Ga0070662_100017516 | Ga0070662_1000175163 | 295 |
| 425 | 3300005458 | Ga0070681_10005340 | Ga0070681_1000534011 | 295 |
| 426 | 3300005530 | Ga0070679_100020251 | Ga0070679_1000202513 | 295 |
| 427 | 3300005530 | Ga0070679_100156183 | Ga0070679_1001561832 | 295 |
| 428 | 3300005535 | Ga0070684_100014216 | Ga0070684_1000142166 | 295 |
| 429 | 3300005535 | Ga0070684_100015972 | Ga0070684_1000159727 | 295 |
| 430 | 3300005535 | Ga0070684_100175465 | Ga0070684_1001754652 | 295 |
| 431 | 3300005539 | Ga0068853_100208048 | Ga0068853_1002080482 | 295 |
| 432 | 3300005539 | Ga0068853_100232611 | Ga0068853_1002326113 | 295 |
| 433 | 3300005545 | Ga0070695_100198632 | Ga0070695_1001986321 | 295 |
| 434 | 3300005547 | Ga0070693_100067557 | Ga0070693_1000675574 | 295 |
| 435 | 3300005547 | Ga0070693_100153420 | Ga0070693_1001534202 | 295 |
| 436 | 3300005547 | Ga0070693_100169874 | Ga0070693_1001698741 | 295 |
| 437 | 3300005548 | Ga0070665_100008978 | Ga0070665_1000089787 | 295 |
| 438 | 3300005548 | Ga0070665_100013701 | Ga0070665_1000137015 | 295 |
| 439 | 3300005548 | Ga0070665_100124385 | Ga0070665_1001243852 | 295 |
| 440 | 3300005563 | Ga0068855_100035619 | Ga0068855_1000356193 | 295 |
| 441 | 3300005563 | Ga0068855_100123641 | Ga0068855_1001236413 | 295 |
| 442 | 3300005563 | Ga0068855_100288104 | Ga0068855_1002881043 | 295 |
| 443 | 3300005563 | Ga0068855_100746804 | Ga0068855_1007468041 | 295 |
| 444 | 3300005577 | Ga0068857_100070074 | Ga0068857_1000700744 | 295 |
| 445 | 3300005614 | Ga0068856_100081355 | Ga0068856_1000813552 | 295 |
| 446 | 3300005614 | Ga0068856_100292181 | Ga0068856_1002921812 | 295 |
| 447 | 3300005616 | Ga0068852_100474740 | Ga0068852_1004747402 | 295 |
| 448 | 3300005617 | Ga0068859_100072274 | Ga0068859_1000722742 | 295 |
| 449 | 3300005617 | Ga0068859_100253602 | Ga0068859_1002536021 | 295 |
| 450 | 3300005617 | Ga0068859_100292654 | Ga0068859_1002926542 | 295 |
| 451 | 3300005617 | Ga0068859_100417629 | Ga0068859_1004176291 | 295 |
| 452 | 3300005618 | Ga0068864_100070379 | Ga0068864_1000703795 | 295 |
| 453 | 3300005618 | Ga0068864_100119978 | Ga0068864_1001199784 | 295 |
| 454 | 3300005718 | Ga0068866_10056185 | Ga0068866_100561853 | 295 |
| 455 | 3300005718 | Ga0068866_10073276 | Ga0068866_100732761 | 295 |
| 456 | 3300005719 | Ga0068861_100462217 | Ga0068861_1004622171 | 295 |
| 457 | 3300005834 | Ga0068851_10013247 | Ga0068851_100132476 | 295 |
| 458 | 3300005834 | Ga0068851_10198901 | Ga0068851_101989011 | 295 |
| 459 | 3300005841 | Ga0068863_100242522 | Ga0068863_1002425222 | 295 |
| 460 | 3300005841 | Ga0068863_100559712 | Ga0068863_1005597121 | 295 |
| 461 | 3300005842 | Ga0068858_100579361 | Ga0068858_1005793611 | 295 |
| 462 | 3300005843 | Ga0068860_100000113 | Ga0068860_100000113114 | 295 |
| 463 | 3300005844 | Ga0068862_100258680 | Ga0068862_1002586803 | 295 |
| 464 | 3300005844 | Ga0068862_100483497 | Ga0068862_1004834971 | 295 |
| 465 | 3300005937 | Ga0081455_10228340 | Ga0081455_102283402 | 295 |
| 466 | 3300005983 | Ga0081540_1001713 | Ga0081540_10017138 | 295 |
| 467 | 3300005983 | Ga0081540_1003381 | Ga0081540_100338116 | 295 |
| 468 | 3300005985 | Ga0081539_10000255 | Ga0081539_1000025563 | 295 |
| 469 | 3300006028 | Ga0070717_10416774 | Ga0070717_104167741 | 295 |
| 470 | 3300006028 | Ga0070717_10512402 | Ga0070717_105124021 | 295 |
| 471 | 3300006038 | Ga0075365_10017869 | Ga0075365_100178695 | 295 |
| 472 | 3300006038 | Ga0075365_10142235 | Ga0075365_101422351 | 295 |
| 473 | 3300006038 | Ga0075365_10365871 | Ga0075365_103658711 | 295 |
| 474 | 3300006042 | Ga0075368_10001310 | Ga0075368_1000131013 | 295 |
| 475 | 3300006042 | Ga0075368_10053169 | Ga0075368_100531693 | 295 |
| 476 | 3300006051 | Ga0075364_10034559 | Ga0075364_100345594 | 295 |
| 477 | 3300006051 | Ga0075364_10094518 | Ga0075364_100945182 | 295 |
| 478 | 3300006051 | Ga0075364_10094907 | Ga0075364_100949072 | 295 |
| 479 | 3300006173 | Ga0070716_100369146 | Ga0070716_1003691461 | 295 |
| 480 | 3300006177 | Ga0075362_10057914 | Ga0075362_100579143 | 295 |
| 481 | 3300006177 | Ga0075362_10152772 | Ga0075362_101527721 | 295 |
| 482 | 3300006178 | Ga0075367_10104468 | Ga0075367_101044683 | 295 |
| 483 | 3300006195 | Ga0075366_10024997 | Ga0075366_100249972 | 295 |
| 484 | 3300006237 | Ga0097621_100189042 | Ga0097621_1001890421 | 295 |
| 485 | 3300006353 | Ga0075370_10016014 | Ga0075370_100160143 | 295 |
| 486 | 3300006353 | Ga0075370_10020457 | Ga0075370_100204574 | 295 |
| 487 | 3300006353 | Ga0075370_10021827 | Ga0075370_100218273 | 295 |
| 488 | 3300006358 | Ga0068871_100056998 | Ga0068871_1000569984 | 295 |
| 489 | 3300006358 | Ga0068871_100219258 | Ga0068871_1002192582 | 295 |
| 490 | 3300006844 | Ga0075428_100109095 | Ga0075428_1001090952 | 295 |
| 491 | 3300006852 | Ga0075433_10202065 | Ga0075433_102020653 | 295 |
| 492 | 3300006931 | Ga0097620_100072273 | Ga0097620_1000722734 | 295 |
| 493 | 3300006931 | Ga0097620_100253598 | Ga0097620_1002535981 | 295 |
| 494 | 3300006931 | Ga0097620_100292652 | Ga0097620_1002926521 | 295 |
| 495 | 3300006931 | Ga0097620_100417601 | Ga0097620_1004176011 | 295 |
| 496 | 3300009093 | Ga0105240_10009596 | Ga0105240_100095967 | 295 |
| 497 | 3300009093 | Ga0105240_10545065 | Ga0105240_105450651 | 295 |
| 498 | 3300009101 | Ga0105247_10001533 | Ga0105247_1000153312 | 295 |
| 499 | 3300009101 | Ga0105247_10026061 | Ga0105247_100260613 | 295 |
| 500 | 3300009101 | Ga0105247_10058271 | Ga0105247_100582711 | 295 |
| 501 | 3300009101 | Ga0105247_10079986 | Ga0105247_100799862 | 295 |
| 502 | 3300009101 | Ga0105247_10155475 | Ga0105247_101554752 | 295 |
| 503 | 3300009147 | Ga0114129_10028043 | Ga0114129_100280433 | 295 |
| 504 | 3300009174 | Ga0105241_10010784 | Ga0105241_1001078410 | 295 |
| 505 | 3300009174 | Ga0105241_10232469 | Ga0105241_102324691 | 295 |
| 506 | 3300009177 | Ga0105248_10055495 | Ga0105248_100554954 | 295 |
| 507 | 3300009177 | Ga0105248_10428425 | Ga0105248_104284252 | 295 |
| 508 | 3300009177 | Ga0105248_10714848 | Ga0105248_107148481 | 295 |
| 509 | 3300009545 | Ga0105237_10106355 | Ga0105237_101063551 | 295 |
| 510 | 3300009545 | Ga0105237_10366550 | Ga0105237_103665502 | 295 |
| 511 | 3300009551 | Ga0105238_10009724 | Ga0105238_100097242 | 295 |
| 512 | 3300009551 | Ga0105238_10044871 | Ga0105238_100448715 | 295 |
| 513 | 3300009551 | Ga0105238_10242621 | Ga0105238_102426212 | 295 |
| 514 | 3300010159 | Ga0099796_10003294 | Ga0099796_100032945 | 295 |
| 515 | 3300010375 | Ga0105239_10011556 | Ga0105239_1001155610 | 295 |
| 516 | 3300010375 | Ga0105239_10066307 | Ga0105239_100663072 | 295 |
| 517 | 3300010375 | Ga0105239_10084806 | Ga0105239_100848062 | 295 |
| 518 | 3300010375 | Ga0105239_10144508 | Ga0105239_101445082 | 295 |
| 519 | 3300011119 | Ga0105246_10195447 | Ga0105246_101954473 | 295 |
| 520 | 3300013105 | Ga0157369_10034285 | Ga0157369_100342856 | 295 |
| 521 | 3300013296 | Ga0157374_10062976 | Ga0157374_100629762 | 295 |
| 522 | 3300013306 | Ga0163162_10189496 | Ga0163162_101894962 | 295 |
| 523 | 3300013306 | Ga0163162_10343215 | Ga0163162_103432152 | 295 |
| 524 | 3300013308 | Ga0157375_10169282 | Ga0157375_101692822 | 295 |
| 525 | 3300014325 | Ga0163163_10028321 | Ga0163163_100283212 | 295 |
| 526 | 3300014325 | Ga0163163_10031629 | Ga0163163_100316291 | 295 |
| 527 | 3300014325 | Ga0163163_10044799 | Ga0163163_100447992 | 295 |
| 528 | 3300014325 | Ga0163163_10883568 | Ga0163163_108835681 | 295 |
| 529 | 3300024227 | Ga0228598_1028294 | Ga0228598_10282941 | 295 |
| 530 | 3300025230 | Ga0209563_105637 | Ga0209563_1056372 | 295 |
| 531 | 3300025253 | Ga0209677_101030 | Ga0209677_10103013 | 295 |
| 532 | 3300025261 | Ga0209233_1001936 | Ga0209233_100193612 | 295 |
| 533 | 3300025297 | Ga0209758_1011448 | Ga0209758_10114483 | 295 |
| 534 | 3300025302 | Ga0207426_1017410 | Ga0207426_10174102 | 295 |
| 535 | 3300025304 | Ga0209257_1025055 | Ga0209257_10250552 | 295 |
| 536 | 3300025321 | Ga0207656_10009757 | Ga0207656_100097576 | 295 |
| 537 | 3300025711 | Ga0207696_1056267 | Ga0207696_10562671 | 295 |
| 538 | 3300025900 | Ga0207710_10013025 | Ga0207710_100130257 | 295 |
| 539 | 3300025904 | Ga0207647_10003775 | Ga0207647_100037753 | 295 |
| 540 | 3300025908 | Ga0207643_10051800 | Ga0207643_100518002 | 295 |
| 541 | 3300025909 | Ga0207705_10070646 | Ga0207705_100706461 | 295 |
| 542 | 3300025911 | Ga0207654_10061873 | Ga0207654_100618733 | 295 |
| 543 | 3300025912 | Ga0207707_10000852 | Ga0207707_1000085230 | 295 |
| 544 | 3300025912 | Ga0207707_10020269 | Ga0207707_1002026910 | 295 |
| 545 | 3300025912 | Ga0207707_10021472 | Ga0207707_100214723 | 295 |
| 546 | 3300025913 | Ga0207695_10089162 | Ga0207695_100891625 | 295 |
| 547 | 3300025914 | Ga0207671_10021759 | Ga0207671_100217592 | 295 |
| 548 | 3300025914 | Ga0207671_10033060 | Ga0207671_100330603 | 295 |
| 549 | 3300025914 | Ga0207671_10048218 | Ga0207671_100482185 | 295 |
| 550 | 3300025916 | Ga0207663_10189769 | Ga0207663_101897693 | 295 |
| 551 | 3300025917 | Ga0207660_10035846 | Ga0207660_100358462 | 295 |
| 552 | 3300025918 | Ga0207662_10248026 | Ga0207662_102480261 | 295 |
| 553 | 3300025919 | Ga0207657_10001809 | Ga0207657_1000180913 | 295 |
| 554 | 3300025919 | Ga0207657_10069596 | Ga0207657_100695962 | 295 |
| 555 | 3300025921 | Ga0207652_10024173 | Ga0207652_100241735 | 295 |
| 556 | 3300025921 | Ga0207652_10054223 | Ga0207652_100542235 | 295 |
| 557 | 3300025921 | Ga0207652_10278323 | Ga0207652_102783231 | 295 |
| 558 | 3300025924 | Ga0207694_10109458 | Ga0207694_101094582 | 295 |
| 559 | 3300025924 | Ga0207694_10309257 | Ga0207694_103092572 | 295 |
| 560 | 3300025925 | Ga0207650_10035414 | Ga0207650_100354143 | 295 |
| 561 | 3300025927 | Ga0207687_10420633 | Ga0207687_104206332 | 295 |
| 562 | 3300025928 | Ga0207700_10096591 | Ga0207700_100965911 | 295 |
| 563 | 3300025928 | Ga0207700_10153428 | Ga0207700_101534283 | 295 |
| 564 | 3300025929 | Ga0207664_10031373 | Ga0207664_100313733 | 295 |
| 565 | 3300025932 | Ga0207690_10198749 | Ga0207690_101987491 | 295 |
| 566 | 3300025932 | Ga0207690_10213028 | Ga0207690_102130283 | 295 |
| 567 | 3300025933 | Ga0207706_10153068 | Ga0207706_101530682 | 295 |
| 568 | 3300025936 | Ga0207670_10075306 | Ga0207670_100753062 | 295 |
| 569 | 3300025937 | Ga0207669_10008544 | Ga0207669_100085441 | 295 |
| 570 | 3300025938 | Ga0207704_10262480 | Ga0207704_102624801 | 295 |
| 571 | 3300025942 | Ga0207689_10020170 | Ga0207689_100201706 | 295 |
| 572 | 3300025942 | Ga0207689_10145801 | Ga0207689_101458012 | 295 |
| 573 | 3300025945 | Ga0207679_10084232 | Ga0207679_100842324 | 295 |
| 574 | 3300025945 | Ga0207679_10617280 | Ga0207679_106172801 | 295 |
| 575 | 3300025949 | Ga0207667_10160532 | Ga0207667_101605322 | 295 |
| 576 | 3300025949 | Ga0207667_10198924 | Ga0207667_101989242 | 295 |
| 577 | 3300025972 | Ga0207668_10011404 | Ga0207668_100114043 | 295 |
| 578 | 3300025972 | Ga0207668_10119743 | Ga0207668_101197432 | 295 |
| 579 | 3300025972 | Ga0207668_10181033 | Ga0207668_101810332 | 295 |
| 580 | 3300025972 | Ga0207668_10245383 | Ga0207668_102453831 | 295 |
| 581 | 3300025981 | Ga0207640_10211011 | Ga0207640_102110112 | 295 |
| 582 | 3300025986 | Ga0207658_10488385 | Ga0207658_104883852 | 295 |
| 583 | 3300026035 | Ga0207703_10050169 | Ga0207703_100501693 | 295 |
| 584 | 3300026035 | Ga0207703_10050909 | Ga0207703_100509094 | 295 |
| 585 | 3300026035 | Ga0207703_10231537 | Ga0207703_102315371 | 295 |
| 586 | 3300026041 | Ga0207639_10064297 | Ga0207639_100642973 | 295 |
| 587 | 3300026041 | Ga0207639_10115154 | Ga0207639_101151543 | 295 |
| 588 | 3300026041 | Ga0207639_10312384 | Ga0207639_103123842 | 295 |
| 589 | 3300026067 | Ga0207678_10021070 | Ga0207678_100210701 | 295 |
| 590 | 3300026067 | Ga0207678_10033154 | Ga0207678_100331541 | 295 |
| 591 | 3300026067 | Ga0207678_10042251 | Ga0207678_100422511 | 295 |
| 592 | 3300026067 | Ga0207678_10102649 | Ga0207678_101026491 | 295 |
| 593 | 3300026075 | Ga0207708_10352876 | Ga0207708_103528761 | 295 |
| 594 | 3300026078 | Ga0207702_10077004 | Ga0207702_100770041 | 295 |
| 595 | 3300026089 | Ga0207648_10150898 | Ga0207648_101508982 | 295 |
| 596 | 3300026089 | Ga0207648_10282059 | Ga0207648_102820591 | 295 |
| 597 | 3300026116 | Ga0207674_10095816 | Ga0207674_100958161 | 295 |
| 598 | 3300026116 | Ga0207674_10203567 | Ga0207674_102035672 | 295 |
| 599 | 3300026116 | Ga0207674_10248758 | Ga0207674_102487582 | 295 |
| 600 | 3300026121 | Ga0207683_10011948 | Ga0207683_100119483 | 295 |
| 601 | 3300026121 | Ga0207683_10513344 | Ga0207683_105133441 | 295 |
| 602 | 3300028379 | Ga0268266_10001147 | Ga0268266_100011475 | 295 |
| 603 | 3300028379 | Ga0268266_10012847 | Ga0268266_100128473 | 295 |
| 604 | 3300028379 | Ga0268266_10208799 | Ga0268266_102087992 | 295 |
| 605 | 3300028380 | Ga0268265_10070496 | Ga0268265_100704963 | 295 |
| 606 | 3300028380 | Ga0268265_10327782 | Ga0268265_103277822 | 295 |
| 607 | 3300028380 | Ga0268265_10475331 | Ga0268265_104753311 | 295 |
| 608 | 3300028381 | Ga0268264_10000035 | Ga0268264_10000035243 | 295 |
| 609 | 3300028666 | Ga0265336_10007256 | Ga0265336_100072563 | 295 |
| 610 | 3300028786 | Ga0307517_10000062 | Ga0307517_1000006272 | 295 |
| 611 | 3300028786 | Ga0307517_10145509 | Ga0307517_101455091 | 295 |
| 612 | 3300028800 | Ga0265338_10000090 | Ga0265338_1000009064 | 295 |
| 613 | 3300030521 | Ga0307511_10114045 | Ga0307511_101140451 | 295 |
| 614 | 3300031090 | Ga0265760_10063895 | Ga0265760_100638951 | 295 |
| 615 | 3300031235 | Ga0265330_10014093 | Ga0265330_100140933 | 295 |
| 616 | 3300031235 | Ga0265330_10093526 | Ga0265330_100935261 | 295 |
| 617 | 3300031238 | Ga0265332_10100524 | Ga0265332_101005241 | 295 |
| 618 | 3300031239 | Ga0265328_10091540 | Ga0265328_100915401 | 295 |
| 619 | 3300031241 | Ga0265325_10010500 | Ga0265325_100105005 | 295 |
| 620 | 3300031247 | Ga0265340_10001031 | Ga0265340_1000103112 | 295 |
| 621 | 3300031250 | Ga0265331_10018997 | Ga0265331_100189973 | 295 |
| 622 | 3300031344 | Ga0265316_10197153 | Ga0265316_101971533 | 295 |
| 623 | 3300031456 | Ga0307513_10099663 | Ga0307513_100996633 | 295 |
| 624 | 3300031616 | Ga0307508_10040142 | Ga0307508_100401422 | 295 |
| 625 | 3300031712 | Ga0265342_10013292 | Ga0265342_100132925 | 295 |
| 626 | 3300031712 | Ga0265342_10104007 | Ga0265342_101040072 | 295 |
| 627 | 3300031730 | Ga0307516_10011695 | Ga0307516_1001169511 | 295 |
| 628 | 3300031730 | Ga0307516_10140049 | Ga0307516_101400492 | 295 |
| 629 | 3300032002 | Ga0307416_100642267 | Ga0307416_1006422671 | 295 |
| 630 | 3300033179 | Ga0307507_10024960 | Ga0307507_100249604 | 295 |
| 631 | 3300033180 | Ga0307510_10060001 | Ga0307510_100600012 | 295 |
| 632 | 3300035113 | Ga0373936_0009685 | Ga0373936_0009685_2424_3311 | 295 |
| 633 | 3300035116 | Ga0373945_0005237 | Ga0373945_0005237_24_911 | 295 |
| 634 | 3300035117 | Ga0373953_0057994 | Ga0373953_0057994_551_1438 | 295 |
| 635 | 3300035119 | Ga0373956_0002575 | Ga0373956_0002575_5703_6590 | 295 |
| 636 | 3300035119 | Ga0373956_0128359 | Ga0373956_0128359_21_908 | 295 |
| 637 | 3300035120 | Ga0373957_0018780 | Ga0373957_0018780_576_1463 | 295 |
| 638 | 3300035410 | Ga0373924_0028005 | Ga0373924_0028005_701_1588 | 295 |
| 639 | 3300035410 | Ga0373924_0146509 | Ga0373924_0146509_51_971 | 295 |
| 640 | 3300035692 | Ga0373935_0000495 | Ga0373935_0000495_5308_6195 | 295 |
| 641 | 3300035692 | Ga0373935_0024822 | Ga0373935_0024822_2135_3022 | 295 |
| 642 | 3300035695 | Ga0373927_0000308 | Ga0373927_0000308_5910_6797 | 295 |
| 643 | 3300035695 | Ga0373927_0035573 | Ga0373927_0035573_2034_2921 | 295 |
| 644 | 3300035724 | Ga0373933_0097509 | Ga0373933_0097509_76_963 | 295 |
| 645 | 3300035725 | Ga0373947_0005725 | Ga0373947_0005725_805_1692 | 295 |
| 646 | 3300035725 | Ga0373947_0090878 | Ga0373947_0090878_567_1454 | 295 |
| 647 | 3300035725 | Ga0373947_0299119 | Ga0373947_0299119_108_995 | 295 |
| 648 | 3300036401 | Ga0373937_0235958 | Ga0373937_0235958_187_1074 | 295 |
| 649 | 3300037068 | Ga0373925_0090147 | Ga0373925_0090147_1433_2320 | 295 |
| 650 | 3300041491 | Ga0451833_1020682 | Ga0451833_1020682_444_1385 | 295 |
| 651 | 3300044765 | Ga0466970_0183282 | Ga0466970_0183282_18_905 | 295 |
| 652 | 3300046454 | Ga0495592_0079852 | Ga0495592_0079852_60_947 | 295 |
| 653 | 3300046454 | Ga0495592_0129753 | Ga0495592_0129753_309_1196 | 295 |
| 654 | 3300046455 | Ga0495603_0004869 | Ga0495603_0004869_2926_3813 | 295 |
| 655 | 3300046455 | Ga0495603_0027231 | Ga0495603_0027231_95_1009 | 295 |
| 656 | 3300046455 | Ga0495603_0045833 | Ga0495603_0045833_1268_2155 | 295 |
| 657 | 3300046455 | Ga0495603_0080797 | Ga0495603_0080797_783_1670 | 295 |
| 658 | 3300046457 | Ga0495590_0109560 | Ga0495590_0109560_33_920 | 295 |
| 659 | 3300046459 | Ga0495629_0000170 | Ga0495629_0000170_40319_41206 | 295 |
| 660 | 3300046461 | Ga0495641_0002571 | Ga0495641_0002571_11891_12778 | 295 |
| 661 | 3300046461 | Ga0495641_0089224 | Ga0495641_0089224_371_1258 | 295 |
| 662 | 3300046463 | Ga0495653_0011588 | Ga0495653_0011588_1787_2674 | 295 |
| 663 | 3300046472 | Ga0495580_0017329 | Ga0495580_0017329_4441_5328 | 295 |
| 664 | 3300046473 | Ga0495582_0000053 | Ga0495582_0000053_37405_38292 | 295 |
| 665 | 3300046475 | Ga0495639_0142744 | Ga0495639_0142744_22_909 | 295 |
| 666 | 3300046476 | Ga0495662_0001239 | Ga0495662_0001239_11513_12400 | 295 |
| 667 | 3300046477 | Ga0495664_0032278 | Ga0495664_0032278_755_1675 | 295 |
| 668 | 3300046477 | Ga0495664_0033605 | Ga0495664_0033605_591_1478 | 295 |
| 669 | 3300046477 | Ga0495664_0044554 | Ga0495664_0044554_153_1040 | 295 |
| 670 | 3300046491 | Ga0495584_0108005 | Ga0495584_0108005_66_953 | 295 |
| 671 | 3300046499 | Ga0495594_0000267 | Ga0495594_0000267_14004_14891 | 295 |
| 672 | 3300046507 | Ga0495606_0052387 | Ga0495606_0052387_1757_2644 | 295 |
| 673 | 3300046512 | Ga0495610_0075023 | Ga0495610_0075023_559_1446 | 295 |
| 674 | 3300046513 | Ga0495616_0016545 | Ga0495616_0016545_1185_2072 | 295 |
| 675 | 3300046514 | Ga0495618_0220549 | Ga0495618_0220549_60_947 | 295 |
| 676 | 3300046516 | Ga0495628_0118293 | Ga0495628_0118293_511_1398 | 295 |
| 677 | 3300046518 | Ga0495631_0086109 | Ga0495631_0086109_203_1090 | 295 |
| 678 | 3300046524 | Ga0495648_0033620 | Ga0495648_0033620_380_1267 | 295 |
| 679 | 3300046524 | Ga0495648_0111587 | Ga0495648_0111587_162_1049 | 295 |
| 680 | 3300046528 | Ga0495642_0031105 | Ga0495642_0031105_1139_2026 | 295 |
| 681 | 3300046529 | Ga0495652_0256485 | Ga0495652_0256485_293_1180 | 295 |
| 682 | 3300046531 | Ga0495665_0000132 | Ga0495665_0000132_19765_20652 | 295 |
| 683 | 3300046533 | Ga0495640_0001291 | Ga0495640_0001291_2368_3255 | 295 |
| 684 | 3300046533 | Ga0495640_0015413 | Ga0495640_0015413_4494_5381 | 295 |
| 685 | 3300046536 | Ga0495587_0015115 | Ga0495587_0015115_3196_4083 | 295 |
| 686 | 3300046539 | Ga0495621_0103384 | Ga0495621_0103384_118_1005 | 295 |
| 687 | 3300046542 | Ga0495597_0030349 | Ga0495597_0030349_1426_2313 | 295 |
| 688 | 3300046542 | Ga0495597_0083184 | Ga0495597_0083184_302_1189 | 295 |
| 689 | 3300046542 | Ga0495597_0085406 | Ga0495597_0085406_255_1142 | 295 |
| 690 | 3300046543 | Ga0495645_0010809 | Ga0495645_0010809_3287_4258 | 295 |
| 691 | 3300046557 | Ga0495622_0001348 | Ga0495622_0001348_2981_3868 | 295 |
| 692 | 3300046557 | Ga0495622_0002929 | Ga0495622_0002929_4928_5815 | 295 |
| 693 | 3300046557 | Ga0495622_0041556 | Ga0495622_0041556_1175_2062 | 295 |
| 694 | 3300046557 | Ga0495622_0080095 | Ga0495622_0080095_599_1486 | 295 |
| 695 | 3300046559 | Ga0495667_0005418 | Ga0495667_0005418_1221_2108 | 295 |
| 696 | 3300046559 | Ga0495667_0028437 | Ga0495667_0028437_394_1281 | 295 |
| 697 | 3300046615 | Ga0495656_0047694 | Ga0495656_0047694_140_1027 | 295 |
| 698 | 3300046615 | Ga0495656_0050859 | Ga0495656_0050859_811_1698 | 295 |
| 699 | 3300046615 | Ga0495656_0065503 | Ga0495656_0065503_168_1055 | 295 |
| 700 | 3300046615 | Ga0495656_0106833 | Ga0495656_0106833_91_1005 | 295 |
| 701 | 3300046616 | Ga0495668_0012998 | Ga0495668_0012998_1878_2765 | 295 |
| 702 | 3300046642 | Ga0495634_0002240 | Ga0495634_0002240_103_990 | 295 |
| 703 | 3300046642 | Ga0495634_0018593 | Ga0495634_0018593_2335_3222 | 295 |
| 704 | 3300046648 | Ga0495611_0036090 | Ga0495611_0036090_807_1694 | 295 |
| 705 | 3300046660 | Ga0495625_0259145 | Ga0495625_0259145_164_1051 | 295 |
| 706 | 3300046663 | Ga0495635_0000488 | Ga0495635_0000488_14169_15056 | 295 |
| 707 | 3300046674 | Ga0495588_0002203 | Ga0495588_0002203_7162_8049 | 295 |
| 708 | 3300046674 | Ga0495588_0005592 | Ga0495588_0005592_3216_4103 | 295 |
| 709 | 3300046675 | Ga0495657_0005629 | Ga0495657_0005629_8441_9328 | 295 |
| 710 | 3300046678 | Ga0495599_0016569 | Ga0495599_0016569_576_1463 | 295 |
| 711 | 3300046679 | Ga0495623_0006603 | Ga0495623_0006603_2708_3595 | 295 |
| 712 | 3300046679 | Ga0495623_0007892 | Ga0495623_0007892_1412_2299 | 295 |
| 713 | 3300046679 | Ga0495623_0104473 | Ga0495623_0104473_285_1205 | 295 |
| 714 | 3300046680 | Ga0495646_0009689 | Ga0495646_0009689_2964_3851 | 295 |
| 715 | 3300046680 | Ga0495646_0071730 | Ga0495646_0071730_1028_1915 | 295 |
| 716 | 3300046680 | Ga0495646_0115748 | Ga0495646_0115748_285_1172 | 295 |
| 717 | 3300046681 | Ga0495647_0049145 | Ga0495647_0049145_285_1172 | 295 |
| 718 | 3300046683 | Ga0495658_0000326 | Ga0495658_0000326_24765_25652 | 295 |
| 719 | 3300046690 | Ga0495624_0013743 | Ga0495624_0013743_2923_3810 | 295 |
| 720 | 3300046694 | Ga0495649_0045033 | Ga0495649_0045033_308_1195 | 295 |
| 721 | 3300046809 | Ga0495600_0000650 | Ga0495600_0000650_8967_9854 | 295 |
| 722 | 3300046810 | Ga0495660_0195389 | Ga0495660_0195389_26_913 | 295 |
| 723 | 3300047315 | Ga0495581_0001133 | Ga0495581_0001133_11887_12774 | 295 |
| 724 | 3300047315 | Ga0495581_0090122 | Ga0495581_0090122_96_1010 | 295 |
| 725 | 3300047317 | Ga0495604_0000498 | Ga0495604_0000498_21541_22428 | 295 |
| 726 | 3300047317 | Ga0495604_0052607 | Ga0495604_0052607_72_959 | 295 |
| 727 | 3300047319 | Ga0495674_0001834 | Ga0495674_0001834_5053_5940 | 295 |
| 728 | 3300047319 | Ga0495674_0016302 | Ga0495674_0016302_2350_3237 | 295 |
| 729 | 3300047319 | Ga0495674_0028485 | Ga0495674_0028485_3915_4802 | 295 |
| 730 | 3300047321 | Ga0495676_0008173 | Ga0495676_0008173_4668_5555 | 295 |
| 731 | 3300047322 | Ga0495680_0013407 | Ga0495680_0013407_3814_4701 | 295 |
| 732 | 3300047323 | Ga0495683_0110308 | Ga0495683_0110308_24_911 | 295 |
| 733 | 3300047443 | Ga0495687_011999 | Ga0495687_011999_3101_3988 | 295 |
| 734 | 3300047444 | Ga0495675_0022696 | Ga0495675_0022696_2421_3308 | 295 |
| 735 | 3300047445 | Ga0495677_0015523 | Ga0495677_0015523_1732_2619 | 295 |
| 736 | 3300047673 | Ga0495593_0000177 | Ga0495593_0000177_3123_4010 | 295 |
| 737 | 3300048088 | Ga0495602_0027291 | Ga0495602_0027291_117_1004 | 295 |
| 738 | 3300048088 | Ga0495602_0267054 | Ga0495602_0267054_119_1006 | 295 |
| 739 | 3300048089 | Ga0495614_0078924 | Ga0495614_0078924_117_1004 | 295 |
| 740 | 3300048904 | Ga0496101_0050198 | Ga0496101_0050198_1894_2781 | 295 |
| 741 | 3300048904 | Ga0496101_0155233 | Ga0496101_0155233_850_1737 | 295 |
| 742 | 3300048905 | Ga0496102_0017501 | Ga0496102_0017501_3326_4213 | 295 |
| 743 | 3300048905 | Ga0496102_0079063 | Ga0496102_0079063_1949_2836 | 295 |
| 744 | 3300048905 | Ga0496102_0159880 | Ga0496102_0159880_352_1239 | 295 |
| 745 | 3300048906 | Ga0496103_0025616 | Ga0496103_0025616_1253_2140 | 295 |
| 746 | 3300048906 | Ga0496103_0142593 | Ga0496103_0142593_365_1252 | 295 |
| 747 | 3300048907 | Ga0496104_0036927 | Ga0496104_0036927_2870_3757 | 295 |
| 748 | 3300048907 | Ga0496104_0080212 | Ga0496104_0080212_1925_2812 | 295 |
| 749 | 3300048908 | Ga0496105_0014472 | Ga0496105_0014472_213_1100 | 295 |
| 750 | 3300048908 | Ga0496105_0015437 | Ga0496105_0015437_3510_4397 | 295 |
| 751 | 3300048909 | Ga0496106_0186206 | Ga0496106_0186206_711_1598 | 295 |
| 752 | 3300048910 | Ga0496107_0013514 | Ga0496107_0013514_821_1708 | 295 |
| 753 | 3300048910 | Ga0496107_0146499 | Ga0496107_0146499_600_1487 | 295 |
| 754 | 3300048910 | Ga0496107_0153829 | Ga0496107_0153829_256_1143 | 295 |
| 755 | 3300048911 | Ga0496108_0094243 | Ga0496108_0094243_1372_2259 | 295 |
| 756 | 3300048911 | Ga0496108_0116962 | Ga0496108_0116962_1316_2203 | 295 |
| 757 | 3300048912 | Ga0496109_0159816 | Ga0496109_0159816_560_1447 | 295 |
| 758 | 3300048912 | Ga0496109_0475972 | Ga0496109_0475972_176_1063 | 295 |
| 759 | 3300048913 | Ga0496110_0068905 | Ga0496110_0068905_1788_2675 | 295 |
| 760 | 3300048913 | Ga0496110_0074545 | Ga0496110_0074545_905_1792 | 295 |
| 761 | 3300048914 | Ga0496111_0113665 | Ga0496111_0113665_327_1214 | 295 |
| 762 | 3300048915 | Ga0496112_0008432 | Ga0496112_0008432_4262_5149 | 295 |
| 763 | 3300048915 | Ga0496112_0049558 | Ga0496112_0049558_1373_2260 | 295 |
| 764 | 3300048915 | Ga0496112_0169472 | Ga0496112_0169472_842_1729 | 295 |
| 765 | 3300048915 | Ga0496112_0199224 | Ga0496112_0199224_728_1615 | 295 |
| 766 | 3300048915 | Ga0496112_0225277 | Ga0496112_0225277_64_951 | 295 |
| 767 | 3300048916 | Ga0496113_0023942 | Ga0496113_0023942_2792_3679 | 295 |
| 768 | 3300048916 | Ga0496113_0041640 | Ga0496113_0041640_109_996 | 295 |
| 769 | 3300048916 | Ga0496113_0072765 | Ga0496113_0072765_896_1783 | 295 |
| 770 | 3300048916 | Ga0496113_0216856 | Ga0496113_0216856_341_1228 | 295 |
| 771 | 3300048917 | Ga0496114_0057140 | Ga0496114_0057140_1553_2440 | 295 |
| 772 | 3300048917 | Ga0496114_0069331 | Ga0496114_0069331_651_1538 | 295 |
| 773 | 3300048918 | Ga0496115_0054832 | Ga0496115_0054832_1487_2374 | 295 |
| 774 | 3300048918 | Ga0496115_0196421 | Ga0496115_0196421_531_1418 | 295 |
| 775 | 3300048918 | Ga0496115_0388025 | Ga0496115_0388025_37_924 | 295 |
| 776 | 3300048919 | Ga0496116_0089361 | Ga0496116_0089361_644_1531 | 295 |
| 777 | 3300048920 | Ga0496117_0048980 | Ga0496117_0048980_1986_2873 | 295 |
| 778 | 3300048921 | Ga0496118_0102522 | Ga0496118_0102522_597_1484 | 295 |
| 779 | 3300048921 | Ga0496118_0111484 | Ga0496118_0111484_213_1100 | 295 |
| 780 | 3300048921 | Ga0496118_0185012 | Ga0496118_0185012_275_1162 | 295 |
| 781 | 3300048922 | Ga0496119_0048413 | Ga0496119_0048413_583_1470 | 295 |
| 782 | 3300048924 | Ga0496121_0000221 | Ga0496121_0000221_83657_84544 | 295 |
| 783 | 3300048924 | Ga0496121_0017083 | Ga0496121_0017083_5752_6639 | 295 |
| 784 | 3300048924 | Ga0496121_0086670 | Ga0496121_0086670_182_1069 | 295 |
| 785 | 3300048924 | Ga0496121_0102906 | Ga0496121_0102906_197_1084 | 295 |
| 786 | 3300048924 | Ga0496121_0156564 | Ga0496121_0156564_558_1445 | 295 |
| 787 | 3300048924 | Ga0496121_0161880 | Ga0496121_0161880_737_1624 | 295 |
| 788 | 3300048924 | Ga0496121_0193624 | Ga0496121_0193624_316_1203 | 295 |
| 789 | 3300048925 | Ga0496122_0179906 | Ga0496122_0179906_108_995 | 295 |
| 790 | 3300048927 | Ga0496124_0213720 | Ga0496124_0213720_177_1064 | 295 |
| 791 | 3300048927 | Ga0496124_0281733 | Ga0496124_0281733_260_1147 | 295 |
| 792 | 3300048928 | Ga0496125_0008068 | Ga0496125_0008068_9032_9919 | 295 |
| 793 | 3300048928 | Ga0496125_0054723 | Ga0496125_0054723_1824_2711 | 295 |
| 794 | 3300048929 | Ga0496126_0094406 | Ga0496126_0094406_251_1138 | 295 |
| 795 | 3300048929 | Ga0496126_0095251 | Ga0496126_0095251_1031_1918 | 295 |
| 796 | 3300048929 | Ga0496126_0110749 | Ga0496126_0110749_1243_2130 | 295 |
| 797 | 3300048929 | Ga0496126_0116159 | Ga0496126_0116159_1259_2146 | 295 |
| 798 | 3300048929 | Ga0496126_0158617 | Ga0496126_0158617_323_1213 | 295 |
| 799 | 3300049459 | Ga0495678_027212 | Ga0495678_027212_1265_2152 | 295 |
| 800 | 3300050489 | nmdc:mga03683_65994_c1 | nmdc:mga03683_65994_c1_255_1142 | 295 |
| 801 | 3300050490 | nmdc:mga03n38_34268_c1 | nmdc:mga03n38_34268_c1_1031_1918 | 295 |
| 802 | 3300050491 | nmdc:mga00v17_31841_c1 | nmdc:mga00v17_31841_c1_798_1685 | 295 |
| 803 | 3300050492 | nmdc:mga0yw44_130991_c1 | nmdc:mga0yw44_130991_c1_715_1602 | 295 |
| 804 | 3300050492 | nmdc:mga0yw44_4430_c1 | nmdc:mga0yw44_4430_c1_3562_4449 | 295 |
| 805 | 3300050492 | nmdc:mga0yw44_66574_c1 | nmdc:mga0yw44_66574_c1_176_1078 | 295 |
| 806 | 3300050492 | nmdc:mga0yw44_7412_c1 | nmdc:mga0yw44_7412_c1_871_1812 | 295 |
| 807 | 3300050494 | nmdc:mga06z11_67830_c1 | nmdc:mga06z11_67830_c1_719_1606 | 295 |
| 808 | 3300050494 | nmdc:mga06z11_98991_c1 | nmdc:mga06z11_98991_c1_179_1066 | 295 |
| 809 | 3300050495 | nmdc:mga04h51_83276_c1 | nmdc:mga04h51_83276_c1_212_1099 | 295 |
| 810 | 3300050496 | nmdc:mga07m45_114109_c1 | nmdc:mga07m45_114109_c1_260_1147 | 295 |
| 811 | 3300050496 | nmdc:mga07m45_19251_c1 | nmdc:mga07m45_19251_c1_748_1635 | 295 |
| 812 | 3300050508 | nmdc:mga09592_389107_c1 | nmdc:mga09592_389107_c1_304_1191 | 295 |
| 813 | 3300050516 | nmdc:mga0sz30_24843_c1 | nmdc:mga0sz30_24843_c1_1513_2400 | 295 |
| 814 | 3300053077 | Ga0495601_0053969 | Ga0495601_0053969_369_1256 | 295 |
| 815 | 3300053078 | Ga0495612_0012545 | Ga0495612_0012545_187_1074 | 295 |
| 816 | 3300053080 | Ga0500635_0007712 | Ga0500635_0007712_1417_2304 | 295 |
| 817 | 3300053091 | Ga0500647_0018825 | Ga0500647_0018825_851_1738 | 295 |
| 818 | 3300053093 | Ga0500651_0004903 | Ga0500651_0004903_6658_7545 | 295 |
| 819 | 3300053094 | Ga0500566_0000020 | Ga0500566_0000020_46595_47482 | 295 |
| 820 | 3300053094 | Ga0500566_0010191 | Ga0500566_0010191_4066_4953 | 295 |
| 821 | 3300053094 | Ga0500566_0037138 | Ga0500566_0037138_1410_2297 | 295 |
| 822 | 3300053095 | Ga0500640_000957 | Ga0500640_000957_2117_3004 | 295 |
| 823 | 3300053096 | Ga0500641_0001024 | Ga0500641_0001024_1049_1951 | 295 |
| 824 | 3300053102 | Ga0500554_009927 | Ga0500554_009927_912_1799 | 295 |
| 825 | 3300053109 | Ga0500569_015557 | Ga0500569_015557_537_1424 | 295 |
| 826 | 3300053111 | Ga0500572_000455 | Ga0500572_000455_1758_2645 | 295 |
| 827 | 3300053111 | Ga0500572_000882 | Ga0500572_000882_6304_7191 | 295 |
| 828 | 3300053118 | Ga0500594_0049090 | Ga0500594_0049090_195_1082 | 295 |
| 829 | 3300053119 | Ga0500595_000977 | Ga0500595_000977_8675_9562 | 295 |
| 830 | 3300053119 | Ga0500595_008725 | Ga0500595_008725_412_1299 | 295 |
| 831 | 3300053119 | Ga0500595_026419 | Ga0500595_026419_985_1872 | 295 |
| 832 | 3300053122 | Ga0500608_005725 | Ga0500608_005725_3439_4326 | 295 |
| 833 | 3300053123 | Ga0500614_000134 | Ga0500614_000134_15868_16755 | 295 |
| 834 | 3300053130 | Ga0500642_0042106 | Ga0500642_0042106_246_1133 | 295 |
| 835 | 3300053133 | Ga0500655_006594 | Ga0500655_006594_1010_1897 | 295 |
| 836 | 3300053136 | Ga0500559_0000930 | Ga0500559_0000930_12832_13719 | 295 |
| 837 | 3300053136 | Ga0500559_0003043 | Ga0500559_0003043_5143_6030 | 295 |
| 838 | 3300053150 | Ga0500603_002632 | Ga0500603_002632_1605_2492 | 295 |
| 839 | 3300053150 | Ga0500603_073093 | Ga0500603_073093_53_940 | 295 |
| 840 | 3300053156 | Ga0500622_0041194 | Ga0500622_0041194_306_1193 | 295 |
| 841 | 3300053158 | Ga0500627_0080499 | Ga0500627_0080499_319_1206 | 295 |
| 842 | 3300053159 | Ga0500630_001295 | Ga0500630_001295_4550_5437 | 295 |
| 843 | 3300053162 | Ga0500638_010552 | Ga0500638_010552_2414_3301 | 295 |
| 844 | 3300053162 | Ga0500638_086904 | Ga0500638_086904_298_1185 | 295 |
| 845 | 3300053163 | Ga0500639_000111 | Ga0500639_000111_29235_30122 | 295 |
| 846 | 3300053177 | Ga0500636_0082938 | Ga0500636_0082938_632_1537 | 295 |
| 847 | 3300053178 | Ga0500637_0000941 | Ga0500637_0000941_6812_7699 | 295 |
| 848 | 3300053730 | Ga0500645_024807 | Ga0500645_024807_378_1265 | 295 |
| 849 | 3300053735 | Ga0500596_000483 | Ga0500596_000483_6294_7181 | 295 |
| 850 | 3300053737 | Ga0500601_004478 | Ga0500601_004478_434_1321 | 295 |
| 851 | 3300055283 | Ga0500661_000091 | Ga0500661_000091_10281_11168 | 295 |
| 852 | iso_pu_bacteria | 2617270741 | 2617373367 | 295 |
| 853 | iso_pu_bacteria | 2935916978 | 2935922219 | 295 |
| 854 | iso_pu_bacteria | 2935926038 | 2935929037 | 295 |
| 855 | iso_pu_bacteria | 2935934488 | 2935935668 | 295 |
| 856 | iso_pu_bacteria | 2935942939 | 2935947234 | 295 |
| 857 | iso_pu_bacteria | 2935951376 | 2935953672 | 295 |
| 858 | iso_pu_bacteria | 2935967501 | 2935968698 | 295 |
| 859 | iso_pu_bacteria | 8019687851 | 8019694372 | 295 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3f67-assembly1.cif.gz_A | crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 | 0.9596 | 55 | 291 |
| 3f67-assembly1.cif.gz_A | crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 | 0.9441 | 55 | 291 |
| 4zv9-assembly6.cif.gz_F | 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai | 0.8818 | 54 | 291 |
| 8g3d-assembly1.cif.gz_3D | 48-nm doublet microtubule from tetrahymena thermophila strain k40r | 0.8653 | 43 | 291 |
| 1ggv-assembly1.cif.gz_A | crystal structure of the c123s mutant of dienelactone hydrolase (dlh) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf) | 0.8605 | 61 | 291 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3f67A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9501 | 55 | 291 | 3.40.50.1820 |
| 3f67A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9383 | 55 | 291 | 3.40.50.1820 |
| 4zv9B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8941 | 54 | 291 | 3.40.50.1820 |
| af_I6XF92_3_241_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8938 | 58 | 288 | 3.40.50.1820 |
| af_Q54MZ9_1_255_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8842 | 56 | 291 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537QQY5-F1-model_v4 | Dienelactone hydrolase family protein | 0.9901 | 162 | 293 |
GO:0016787
|
| AF-A0A2V6PZB4-F1-model_v4 | Dienelactone hydrolase domain-containing protein | 0.9873 | 175 | 293 |
GO:0016787
|
| AF-A0A376RS75-F1-model_v4 | Putative hydrolase | 0.9872 | 142 | 291 |
GO:0016787
|
| AF-A0A447PSE4-F1-model_v4 | Dienelactone hydrolase (EC 3.1.1.45) | 0.9865 | 141 | 291 |
GO:0008806
|
| AF-A0A485B8N0-F1-model_v4 | Dienelactone hydrolase family | 0.9864 | 170 | 292 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar