F483769

General Info

Members Datasets Scaffolds Average Seq Length
859 323 1718 85

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100010499|Ga0070699_1000104996
Length 103
Sequence MAIAIKLDDLLHDRRMTLTELADRIGMALANLSILKTGKARAIRFSTLDAICEALSCQPGDILRFEPEPAGRELTAAASNEAEGNERAAESAPLHVAETLTPS

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001228 Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_joined Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
118 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
192 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
208 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
209 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
224 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
225 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
226 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
227 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
228 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
229 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
230 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
231 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
232 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
233 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
234 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
235 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
236 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
237 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
238 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
239 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
240 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
243 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
244 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
245 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
246 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
264 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
265 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
266 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
267 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
280 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
281 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
286 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
287 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
288 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
289 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
290 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
291 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
292 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
295 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
296 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
297 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
298 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
299 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
301 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
302 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
303 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
304 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
305 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
306 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
309 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
310 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
313 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
314 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
315 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
316 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
317 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
318 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
319 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
320 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
321 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
322 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
323 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.84
Nodule 0
Rhizoplane 2.33
Rhizosphere 93.36
Stem 0
Stem Tuber 0
Unclassified 3.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100010499 3300005518 Bacteria 8011
2 CNAas_1000438 3300000532 Bacteria 4015
3 SwM_110429 3300001228 Bacteria 788
4 JGI24743J22301_10045346 3300001991 Bacteria 888
5 Ga0065704_10064688 3300005289 Bacteria 532
6 Ga0065712_10177170 3300005290 Bacteria 1211
7 Ga0065712_10278298 3300005290 Bacteria 883
8 Ga0065712_10296101 3300005290 Bacteria 868
9 Ga0065715_10043198 3300005293 Bacteria 1567
10 Ga0065715_10294680 3300005293 Bacteria 1055
11 Ga0065715_10469732 3300005293 Bacteria 806
12 Ga0065715_10593873 3300005293 Bacteria 712
13 Ga0070658_10345047 3300005327 Bacteria 1274
14 Ga0070676_10042348 3300005328 Bacteria 2643
15 Ga0070676_10102863 3300005328 Bacteria 1767
16 Ga0070676_10792219 3300005328 Bacteria 699
17 Ga0070676_10852305 3300005328 Bacteria 676
18 Ga0070683_100023642 3300005329 Bacteria 5498
19 Ga0070690_100090696 3300005330 Bacteria 2012
20 Ga0070690_100219422 3300005330 Bacteria 1332
21 Ga0070670_100067209 3300005331 Unclassified 3076
22 Ga0070670_100116133 3300005331 Bacteria 2308
23 Ga0070670_100496587 3300005331 Bacteria 1085
24 Ga0070670_100591142 3300005331 Bacteria 993
25 Ga0070677_10031947 3300005333 Bacteria 2016
26 Ga0068869_100047072 3300005334 Bacteria 3113
27 Ga0068869_100242339 3300005334 Bacteria 1437
28 Ga0068869_100255621 3300005334 Bacteria 1401
29 Ga0068869_100343771 3300005334 Bacteria 1215
30 Ga0068869_100347828 3300005334 Bacteria 1208
31 Ga0068869_100518386 3300005334 Unclassified 997
32 Ga0070666_10046254 3300005335 Bacteria 2918
33 Ga0070680_100052335 3300005336 Bacteria 3333
34 Ga0070680_100258624 3300005336 Bacteria 1472
35 Ga0070680_100378330 3300005336 Bacteria 1205
36 Ga0070680_101299255 3300005336 Bacteria 630
37 Ga0070682_100010640 3300005337 Bacteria 5227
38 Ga0070682_100807322 3300005337 Bacteria 763
39 Ga0068868_100199251 3300005338 Bacteria 1668
40 Ga0068868_100513483 3300005338 Bacteria 1051
41 Ga0068868_100564099 3300005338 Bacteria 1005
42 Ga0070660_100081479 3300005339 Bacteria 2541
43 Ga0070660_100108918 3300005339 Bacteria 2202
44 Ga0070689_100117095 3300005340 Bacteria 2125
45 Ga0070689_100185298 3300005340 Unclassified 1692
46 Ga0070689_100288023 3300005340 Bacteria 1364
47 Ga0070689_100607844 3300005340 Bacteria 948
48 Ga0070691_10003235 3300005341 Bacteria 7304
49 Ga0070687_100079298 3300005343 Bacteria 1787
50 Ga0070661_100020336 3300005344 Bacteria 4733
51 Ga0070661_100045933 3300005344 Bacteria 3193
52 Ga0070692_10001289 3300005345 Bacteria 8985
53 Ga0070692_10032811 3300005345 Bacteria 2614
54 Ga0070692_10161354 3300005345 Bacteria 1285
55 Ga0070692_10316113 3300005345 Bacteria 958
56 Ga0070668_100068221 3300005347 Bacteria 2764
57 Ga0070668_101266494 3300005347 Bacteria 670
58 Ga0070668_101413762 3300005347 Bacteria 634
59 Ga0070669_100016855 3300005353 Bacteria 5215
60 Ga0070669_100017851 3300005353 Bacteria 5064
61 Ga0070669_100037604 3300005353 Bacteria 3512
62 Ga0070669_100109253 3300005353 Bacteria 2097
63 Ga0070675_100007041 3300005354 Bacteria 8647
64 Ga0070675_100045944 3300005354 Bacteria 3575
65 Ga0070675_100230781 3300005354 Bacteria 1614
66 Ga0070675_101297081 3300005354 Bacteria 671
67 Ga0070671_100005274 3300005355 Bacteria 10307
68 Ga0070671_100098298 3300005355 Unclassified 2455
69 Ga0070671_100697813 3300005355 Bacteria 880
70 Ga0070674_100022437 3300005356 Bacteria 4071
71 Ga0070674_100187600 3300005356 Unclassified 1588
72 Ga0070674_100238809 3300005356 Bacteria 1421
73 Ga0070674_101620865 3300005356 Bacteria 584
74 Ga0070673_100099216 3300005364 Unclassified 2395
75 Ga0070673_100437409 3300005364 Bacteria 1175
76 Ga0070673_100458733 3300005364 Bacteria 1147
77 Ga0070673_100480053 3300005364 Bacteria 1122
78 Ga0070673_100770756 3300005364 Bacteria 887
79 Ga0070688_100072111 3300005365 Unclassified 2212
80 Ga0070688_100274569 3300005365 Bacteria 1209
81 Ga0070688_100374404 3300005365 Unclassified 1048
82 Ga0070688_101544288 3300005365 Bacteria 541
83 Ga0070659_100038001 3300005366 Bacteria 3753
84 Ga0070659_101073649 3300005366 Bacteria 709
85 Ga0070659_101127305 3300005366 Bacteria 692
86 Ga0070667_100428967 3300005367 Bacteria 1206
87 Ga0070667_100908158 3300005367 Bacteria 820
88 Ga0070709_10000037 3300005434 Bacteria 109706
89 Ga0070714_100212411 3300005435 Bacteria 1774
90 Ga0070710_11106206 3300005437 Bacteria 582
91 Ga0070701_10006144 3300005438 Bacteria 5034
92 Ga0070701_10496041 3300005438 Bacteria 792
93 Ga0070701_10931445 3300005438 Bacteria 602
94 Ga0070711_100522812 3300005439 Bacteria 981
95 Ga0070705_100001670 3300005440 Bacteria 11610
96 Ga0070705_100033710 3300005440 Bacteria 2856
97 Ga0070705_100653671 3300005440 Bacteria 820
98 Ga0070705_100993920 3300005440 Bacteria 680
99 Ga0070700_100040946 3300005441 Bacteria 2838
100 Ga0070700_100066673 3300005441 Bacteria 2285
101 Ga0070700_100167843 3300005441 Bacteria 1517
102 Ga0070700_100268725 3300005441 Bacteria 1231
103 Ga0070700_100312644 3300005441 Bacteria 1151
104 Ga0070700_100447097 3300005441 Bacteria 982
105 Ga0070700_100691954 3300005441 Bacteria 810
106 Ga0070700_101664938 3300005441 Bacteria 547
107 Ga0070694_100008193 3300005444 Bacteria 6386
108 Ga0070694_100026032 3300005444 Bacteria 3789
109 Ga0070694_100254859 3300005444 Bacteria 1329
110 Ga0070694_100453815 3300005444 Bacteria 1013
111 Ga0070694_100552336 3300005444 Bacteria 922
112 Ga0070694_100618560 3300005444 Bacteria 874
113 Ga0070694_101111526 3300005444 Bacteria 659
114 Ga0070663_100008376 3300005455 Bacteria 6355
115 Ga0070678_100026798 3300005456 Bacteria 3903
116 Ga0070678_100377756 3300005456 Bacteria 1225
117 Ga0070678_100479105 3300005456 Bacteria 1095
118 Ga0070662_100114636 3300005457 Bacteria 2058
119 Ga0070662_100268181 3300005457 Bacteria 1378
120 Ga0070662_100797781 3300005457 Bacteria 803
121 Ga0070662_101993676 3300005457 Bacteria 502
122 Ga0070681_10009939 3300005458 Bacteria 9376
123 Ga0068867_100009422 3300005459 Bacteria 6888
124 Ga0068867_100109620 3300005459 Bacteria 2119
125 Ga0068867_100871239 3300005459 Bacteria 808
126 Ga0070685_10078426 3300005466 Unclassified 1974
127 Ga0070685_10344787 3300005466 Bacteria 1017
128 Ga0070685_10867924 3300005466 Bacteria 670
129 Ga0070706_100002422 3300005467 Bacteria 18799
130 Ga0070706_100011639 3300005467 Bacteria 8171
131 Ga0070706_100458803 3300005467 Bacteria 1186
132 Ga0070706_100851834 3300005467 Bacteria 843
133 Ga0070707_100154585 3300005468 Bacteria 2234
134 Ga0070707_100634823 3300005468 Bacteria 1031
135 Ga0070707_100966899 3300005468 Bacteria 817
136 Ga0070698_100086180 3300005471 Bacteria 3127
137 Ga0070698_100575025 3300005471 Bacteria 1067
138 Ga0070699_100588147 3300005518 Bacteria 1015
139 Ga0070699_100919180 3300005518 Bacteria 801
140 Ga0070684_100189992 3300005535 Bacteria 1868
141 Ga0070684_101252413 3300005535 Bacteria 698
142 Ga0070697_100376824 3300005536 Bacteria 1229
143 Ga0070697_100426695 3300005536 Bacteria 1152
144 Ga0068853_100360309 3300005539 Bacteria 1354
145 Ga0068853_100446556 3300005539 Bacteria 1216
146 Ga0070672_100089554 3300005543 Bacteria 2480
147 Ga0070672_100098734 3300005543 Bacteria 2365
148 Ga0070672_100222381 3300005543 Unclassified 1584
149 Ga0070672_100229254 3300005543 Bacteria 1560
150 Ga0070672_100348813 3300005543 Bacteria 1261
151 Ga0070686_100402907 3300005544 Bacteria 1041
152 Ga0070686_101385094 3300005544 Bacteria 590
153 Ga0070695_100000731 3300005545 Bacteria 17577
154 Ga0070696_100709625 3300005546 Bacteria 821
155 Ga0070665_100001390 3300005548 Bacteria 28491
156 Ga0070665_100690599 3300005548 Bacteria 1034
157 Ga0070704_100126417 3300005549 Bacteria 1973
158 Ga0070704_100165766 3300005549 Bacteria 1752
159 Ga0070704_100207469 3300005549 Bacteria 1586
160 Ga0070704_100275806 3300005549 Bacteria 1391
161 Ga0070704_100333670 3300005549 Bacteria 1275
162 Ga0070704_101113389 3300005549 Bacteria 718
163 Ga0070704_102289096 3300005549 Bacteria 503
164 Ga0068855_100178116 3300005563 Bacteria 2404
165 Ga0068855_102450627 3300005563 Bacteria 520
166 Ga0070664_100004209 3300005564 Bacteria 11567
167 Ga0070664_100215281 3300005564 Bacteria 1717
168 Ga0070664_100910295 3300005564 Bacteria 825
169 Ga0068857_100001653 3300005577 Bacteria 17904
170 Ga0068857_100038783 3300005577 Bacteria 4218
171 Ga0068857_100239576 3300005577 Bacteria 1660
172 Ga0068857_101700698 3300005577 Bacteria 617
173 Ga0068854_100027961 3300005578 Unclassified 3892
174 Ga0068854_100187585 3300005578 Bacteria 1619
175 Ga0068854_101131493 3300005578 Bacteria 699
176 Ga0068856_100225493 3300005614 Unclassified 1889
177 Ga0068856_100916798 3300005614 Unclassified 895
178 Ga0068856_101918910 3300005614 Bacteria 603
179 Ga0070702_100019185 3300005615 Bacteria 3561
180 Ga0070702_100178726 3300005615 Bacteria 1387
181 Ga0068852_100026368 3300005616 Bacteria 4722
182 Ga0068859_100005276 3300005617 Bacteria 13139
183 Ga0068859_100172661 3300005617 Unclassified 2243
184 Ga0068859_100391445 3300005617 Bacteria 1485
185 Ga0068859_100623057 3300005617 Bacteria 1171
186 Ga0068859_100764725 3300005617 Unclassified 1055
187 Ga0068859_100907399 3300005617 Bacteria 965
188 Ga0068859_101432900 3300005617 Bacteria 762
189 Ga0068859_101452187 3300005617 Bacteria 757
190 Ga0068859_102145778 3300005617 Bacteria 617
191 Ga0068864_100050254 3300005618 Bacteria 3588
192 Ga0068864_100114629 3300005618 Bacteria 2403
193 Ga0068864_102495004 3300005618 Bacteria 523
194 Ga0068866_10036074 3300005718 Bacteria 2420
195 Ga0068866_10069983 3300005718 Bacteria 1850
196 Ga0068866_11061125 3300005718 Bacteria 578
197 Ga0068861_100082437 3300005719 Bacteria 2520
198 Ga0068861_100109453 3300005719 Bacteria 2212
199 Ga0068861_100270559 3300005719 Bacteria 1459
200 Ga0068861_100274204 3300005719 Bacteria 1450
201 Ga0068861_100567234 3300005719 Bacteria 1037
202 Ga0068861_100732723 3300005719 Bacteria 922
203 Ga0068861_100967101 3300005719 Bacteria 811
204 Ga0068861_101363086 3300005719 Bacteria 692
205 Ga0068851_10063109 3300005834 Bacteria 1902
206 Ga0068851_10482625 3300005834 Bacteria 741
207 Ga0068851_10807304 3300005834 Bacteria 583
208 Ga0068870_10019217 3300005840 Unclassified 3311
209 Ga0068870_10112829 3300005840 Bacteria 1555
210 Ga0068863_100210296 3300005841 Unclassified 1873
211 Ga0068863_100264357 3300005841 Bacteria 1664
212 Ga0068863_100793910 3300005841 Bacteria 944
213 Ga0068858_100120200 3300005842 Unclassified 2456
214 Ga0068858_100493646 3300005842 Unclassified 1182
215 Ga0068858_102042875 3300005842 Bacteria 567
216 Ga0068860_100320845 3300005843 Bacteria 1520
217 Ga0068860_100489439 3300005843 Bacteria 1227
218 Ga0068860_101101383 3300005843 Bacteria 813
219 Ga0068860_101384211 3300005843 Bacteria 725
220 Ga0068862_100017030 3300005844 Bacteria 6046
221 Ga0068862_100044805 3300005844 Bacteria 3774
222 Ga0068862_100107276 3300005844 Bacteria 2449
223 Ga0068862_100286754 3300005844 Bacteria 1511
224 Ga0068862_100442469 3300005844 Bacteria 1224
225 Ga0068862_101042143 3300005844 Bacteria 811
226 Ga0068862_101428802 3300005844 Bacteria 696
227 Ga0081455_10706925 3300005937 Bacteria 641
228 Ga0081538_10309108 3300005981 Bacteria 579
229 Ga0081539_10328325 3300005985 Bacteria 649
230 Ga0070717_10259633 3300006028 Bacteria 1537
231 Ga0075365_10038031 3300006038 Bacteria 3125
232 Ga0075368_10014726 3300006042 Bacteria 2893
233 Ga0075368_10019483 3300006042 Bacteria 2562
234 Ga0075364_10010583 3300006051 Bacteria 5579
235 Ga0075364_10070346 3300006051 Bacteria 2303
236 Ga0075364_10197378 3300006051 Bacteria 1364
237 Ga0075432_10492702 3300006058 Bacteria 545
238 Ga0070712_101648939 3300006175 Bacteria 561
239 Ga0075362_10009871 3300006177 Bacteria 3708
240 Ga0075362_10177032 3300006177 Bacteria 1032
241 Ga0075367_10000361 3300006178 Bacteria 16346
242 Ga0075367_10012071 3300006178 Bacteria 4592
243 Ga0075366_10001384 3300006195 Bacteria 12141
244 Ga0075366_10069338 3300006195 Bacteria 2099
245 Ga0097621_100146286 3300006237 Bacteria 2023
246 Ga0097621_100475444 3300006237 Bacteria 1129
247 Ga0075370_10296591 3300006353 Bacteria 961
248 Ga0075370_10305194 3300006353 Bacteria 947
249 Ga0068871_100054486 3300006358 Bacteria 3245
250 Ga0068871_100251217 3300006358 Bacteria 1540
251 Ga0068871_100335327 3300006358 Bacteria 1334
252 Ga0068871_100719179 3300006358 Bacteria 916
253 Ga0075428_100033757 3300006844 Bacteria 5646
254 Ga0075428_100040132 3300006844 Bacteria 5151
255 Ga0075428_100097417 3300006844 Bacteria 3206
256 Ga0075428_100154043 3300006844 Bacteria 2497
257 Ga0075428_100248966 3300006844 Bacteria 1915
258 Ga0075428_100264770 3300006844 Bacteria 1850
259 Ga0075428_100295059 3300006844 Bacteria 1743
260 Ga0075428_100569614 3300006844 Bacteria 1210
261 Ga0075428_100687873 3300006844 Bacteria 1090
262 Ga0075428_101334624 3300006844 Bacteria 754
263 Ga0075428_102667956 3300006844 Bacteria 509
264 Ga0075430_100188638 3300006846 Bacteria 1714
265 Ga0075430_100238401 3300006846 Bacteria 1507
266 Ga0075430_100549355 3300006846 Unclassified 953
267 Ga0075430_100885403 3300006846 Bacteria 736
268 Ga0075430_101326719 3300006846 Bacteria 592
269 Ga0075430_101506216 3300006846 Bacteria 553
270 Ga0075431_100015578 3300006847 Bacteria 7705
271 Ga0075431_100070037 3300006847 Bacteria 3619
272 Ga0075431_100130159 3300006847 Bacteria 2596
273 Ga0075431_100134746 3300006847 Bacteria 2546
274 Ga0075431_100157339 3300006847 Bacteria 2338
275 Ga0075431_100282771 3300006847 Bacteria 1679
276 Ga0075431_100458400 3300006847 Bacteria 1270
277 Ga0075431_100550036 3300006847 Bacteria 1142
278 Ga0075431_100639803 3300006847 Bacteria 1045
279 Ga0075431_100639836 3300006847 Bacteria 1045
280 Ga0075431_100747247 3300006847 Bacteria 954
281 Ga0075431_100884339 3300006847 Bacteria 863
282 Ga0075433_10241624 3300006852 Bacteria 1603
283 Ga0075433_10962986 3300006852 Bacteria 744
284 Ga0075433_10967622 3300006852 Bacteria 742
285 Ga0075434_100120177 3300006871 Bacteria 2642
286 Ga0075434_100197092 3300006871 Bacteria 2034
287 Ga0075434_101691551 3300006871 Bacteria 640
288 Ga0075429_100057436 3300006880 Bacteria 3388
289 Ga0075429_100103111 3300006880 Bacteria 2491
290 Ga0075429_100186284 3300006880 Bacteria 1819
291 Ga0075429_101410497 3300006880 Bacteria 607
292 Ga0068865_100099479 3300006881 Bacteria 2126
293 Ga0068865_100423061 3300006881 Bacteria 1096
294 Ga0075436_100056914 3300006914 Bacteria 2700
295 Ga0075436_100523815 3300006914 Bacteria 869
296 Ga0075436_100993281 3300006914 Bacteria 630
297 Ga0075436_101035460 3300006914 Bacteria 617
298 Ga0097620_100005276 3300006931 Bacteria 13139
299 Ga0097620_100154690 3300006931 Bacteria 2370
300 Ga0097620_100172658 3300006931 Unclassified 2243
301 Ga0097620_100391448 3300006931 Bacteria 1485
302 Ga0097620_100623080 3300006931 Bacteria 1171
303 Ga0097620_100764775 3300006931 Unclassified 1055
304 Ga0097620_100907390 3300006931 Bacteria 965
305 Ga0097620_101433085 3300006931 Bacteria 762
306 Ga0097620_101451790 3300006931 Bacteria 757
307 Ga0097620_102145674 3300006931 Bacteria 617
308 Ga0075435_100319111 3300007076 Bacteria 1330
309 Ga0075435_100373813 3300007076 Bacteria 1224
310 Ga0099794_10622067 3300007265 Bacteria 572
311 Ga0105244_10554107 3300009036 Unclassified 529
312 Ga0105240_10441791 3300009093 Unclassified 1458
313 Ga0111539_10000298 3300009094 Bacteria 60092
314 Ga0111539_10010411 3300009094 Bacteria 11707
315 Ga0111539_10076614 3300009094 Bacteria 3938
316 Ga0111539_10121401 3300009094 Bacteria 3062
317 Ga0111539_10125381 3300009094 Bacteria 3009
318 Ga0111539_10161453 3300009094 Bacteria 2621
319 Ga0111539_10328517 3300009094 Bacteria 1780
320 Ga0111539_10666709 3300009094 Bacteria 1211
321 Ga0111539_10788261 3300009094 Bacteria 1106
322 Ga0111539_11204353 3300009094 Bacteria 880
323 Ga0111539_11266823 3300009094 Bacteria 856
324 Ga0111539_12359373 3300009094 Bacteria 617
325 Ga0105245_10070482 3300009098 Bacteria 3172
326 Ga0105245_11492332 3300009098 Bacteria 727
327 Ga0105245_11960319 3300009098 Bacteria 639
328 Ga0114129_10024546 3300009147 Bacteria 8541
329 Ga0114129_10036776 3300009147 Bacteria 6913
330 Ga0114129_10105670 3300009147 Unclassified 3890
331 Ga0114129_10155950 3300009147 Bacteria 3122
332 Ga0114129_10183643 3300009147 Bacteria 2844
333 Ga0114129_10484429 3300009147 Bacteria 1618
334 Ga0114129_10877811 3300009147 Unclassified 1138
335 Ga0114129_11031387 3300009147 Bacteria 1034
336 Ga0114129_11472485 3300009147 Bacteria 838
337 Ga0114129_12523444 3300009147 Bacteria 614
338 Ga0105243_10800963 3300009148 Bacteria 929
339 Ga0105243_11551555 3300009148 Bacteria 687
340 Ga0105243_12101242 3300009148 Bacteria 600
341 Ga0105241_10014749 3300009174 Bacteria 5720
342 Ga0105241_10883592 3300009174 Bacteria 829
343 Ga0105241_12297671 3300009174 Bacteria 537
344 Ga0105242_10030613 3300009176 Bacteria 4297
345 Ga0105242_10321528 3300009176 Bacteria 1419
346 Ga0105242_10755726 3300009176 Bacteria 958
347 Ga0105242_11200331 3300009176 Bacteria 778
348 Ga0105242_11787390 3300009176 Bacteria 653
349 Ga0105248_10012596 3300009177 Bacteria 9330
350 Ga0105248_10029131 3300009177 Bacteria 6157
351 Ga0105248_10038965 3300009177 Bacteria 5321
352 Ga0105248_10310540 3300009177 Unclassified 1776
353 Ga0105248_11586663 3300009177 Bacteria 741
354 Ga0105248_11885998 3300009177 Bacteria 678
355 Ga0105248_12347970 3300009177 Unclassified 607
356 Ga0105237_10070511 3300009545 Bacteria 3491
357 Ga0105249_10048548 3300009553 Bacteria 3869
358 Ga0105249_10170520 3300009553 Bacteria 2110
359 Ga0105249_11361368 3300009553 Bacteria 782
360 Ga0105249_11477403 3300009553 Bacteria 752
361 Ga0105249_11903173 3300009553 Bacteria 667
362 Ga0105249_12461949 3300009553 Bacteria 593
363 Ga0099796_10034566 3300010159 Bacteria 1670
364 Ga0105239_10104381 3300010375 Bacteria 3138
365 Ga0105239_10355138 3300010375 Bacteria 1655
366 Ga0105239_11385872 3300010375 Bacteria 812
367 Ga0105239_12695015 3300010375 Bacteria 580
368 Ga0105239_13541152 3300010375 Bacteria 507
369 Ga0105246_10011169 3300011119 Bacteria 5566
370 Ga0105246_11088677 3300011119 Bacteria 729
371 Ga0157314_1017071 3300012500 Bacteria 702
372 Ga0157315_1043867 3300012508 Bacteria 577
373 Ga0157373_10018525 3300013100 Bacteria 5067
374 Ga0157373_10576542 3300013100 Bacteria 818
375 Ga0157371_10009000 3300013102 Bacteria 7896
376 Ga0157374_10061088 3300013296 Bacteria 3528
377 Ga0157374_10922296 3300013296 Bacteria 891
378 Ga0157378_10031893 3300013297 Bacteria 4654
379 Ga0157378_10304267 3300013297 Bacteria 1544
380 Ga0157378_11063291 3300013297 Bacteria 845
381 Ga0157378_11325067 3300013297 Bacteria 761
382 Ga0157378_12499179 3300013297 Bacteria 569
383 Ga0163162_10070972 3300013306 Bacteria 3535
384 Ga0163162_10074555 3300013306 Bacteria 3452
385 Ga0163162_10086332 3300013306 Bacteria 3216
386 Ga0163162_10221406 3300013306 Bacteria 2022
387 Ga0163162_10259938 3300013306 Bacteria 1868
388 Ga0163162_10875065 3300013306 Bacteria 1013
389 Ga0157372_10267248 3300013307 Bacteria 1987
390 Ga0157372_11061664 3300013307 Bacteria 937
391 Ga0157375_10269241 3300013308 Bacteria 1865
392 Ga0157375_10295974 3300013308 Bacteria 1782
393 Ga0157375_10349861 3300013308 Bacteria 1644
394 Ga0157375_10665686 3300013308 Bacteria 1196
395 Ga0157375_11782893 3300013308 Bacteria 730
396 Ga0157375_11843694 3300013308 Unclassified 717
397 Ga0157375_12843008 3300013308 Bacteria 579
398 Ga0163163_10029394 3300014325 Bacteria 5286
399 Ga0163163_10124082 3300014325 Bacteria 2619
400 Ga0163163_10323400 3300014325 Bacteria 1596
401 Ga0163163_10798263 3300014325 Bacteria 1007
402 Ga0163163_10970709 3300014325 Bacteria 913
403 Ga0163163_11174451 3300014325 Bacteria 830
404 Ga0157380_10002110 3300014326 Bacteria 13334
405 Ga0157380_10004444 3300014326 Bacteria 9712
406 Ga0157380_10040625 3300014326 Bacteria 3624
407 Ga0157380_10103789 3300014326 Bacteria 2373
408 Ga0157380_10159754 3300014326 Unclassified 1958
409 Ga0157380_10682777 3300014326 Bacteria 1029
410 Ga0157380_10835579 3300014326 Bacteria 941
411 Ga0157380_11099345 3300014326 Bacteria 834
412 Ga0157380_11459544 3300014326 Bacteria 736
413 Ga0182008_10952658 3300014497 Bacteria 509
414 Ga0157377_10006871 3300014745 Bacteria 5457
415 Ga0157377_10714359 3300014745 Bacteria 729
416 Ga0157379_10049806 3300014968 Bacteria 3740
417 Ga0157379_10075833 3300014968 Bacteria 3011
418 Ga0157376_10122847 3300014969 Bacteria 2304
419 Ga0157376_10411307 3300014969 Bacteria 1310
420 Ga0157376_13126582 3300014969 Bacteria 501
421 Ga0163161_10818022 3300017792 Bacteria 784
422 Ga0163161_11128013 3300017792 Bacteria 675
423 Ga0163161_11649410 3300017792 Bacteria 567
424 Ga0213876_10486913 3300021384 Bacteria 656
425 Ga0207697_10048305 3300025315 Bacteria 1755
426 Ga0207656_10651515 3300025321 Bacteria 538
427 Ga0207642_10281518 3300025899 Bacteria 957
428 Ga0207642_10419974 3300025899 Bacteria 804
429 Ga0207685_10437075 3300025905 Bacteria 678
430 Ga0207699_10000048 3300025906 Bacteria 109686
431 Ga0207645_10007878 3300025907 Bacteria 7490
432 Ga0207645_10926302 3300025907 Bacteria 591
433 Ga0207645_11154868 3300025907 Bacteria 521
434 Ga0207684_10002226 3300025910 Bacteria 19780
435 Ga0207684_10029951 3300025910 Bacteria 4634
436 Ga0207684_10063990 3300025910 Bacteria 3122
437 Ga0207707_10105161 3300025912 Bacteria 2467
438 Ga0207707_11358165 3300025912 Bacteria 569
439 Ga0207693_10079454 3300025915 Bacteria 2567
440 Ga0207693_10536754 3300025915 Bacteria 913
441 Ga0207663_10313706 3300025916 Bacteria 1176
442 Ga0207663_11055798 3300025916 Bacteria 652
443 Ga0207660_10094231 3300025917 Bacteria 2225
444 Ga0207660_10392919 3300025917 Bacteria 1116
445 Ga0207660_10413749 3300025917 Bacteria 1087
446 Ga0207662_10293649 3300025918 Bacteria 1079
447 Ga0207662_10650282 3300025918 Bacteria 736
448 Ga0207657_10043005 3300025919 Bacteria 3983
449 Ga0207649_10779933 3300025920 Bacteria 745
450 Ga0207646_10152920 3300025922 Bacteria 2081
451 Ga0207646_10532971 3300025922 Bacteria 1057
452 Ga0207681_10046428 3300025923 Bacteria 2921
453 Ga0207681_10107909 3300025923 Bacteria 2020
454 Ga0207681_10189307 3300025923 Bacteria 1573
455 Ga0207681_10420442 3300025923 Bacteria 1083
456 Ga0207681_10755725 3300025923 Bacteria 811
457 Ga0207681_11748611 3300025923 Bacteria 519
458 Ga0207650_10036817 3300025925 Bacteria 3561
459 Ga0207650_10414666 3300025925 Bacteria 1116
460 Ga0207659_10257811 3300025926 Bacteria 1417
461 Ga0207659_10624387 3300025926 Bacteria 920
462 Ga0207659_10690114 3300025926 Bacteria 874
463 Ga0207659_10843898 3300025926 Bacteria 787
464 Ga0207659_11287101 3300025926 Bacteria 628
465 Ga0207659_11400168 3300025926 Bacteria 599
466 Ga0207687_11026955 3300025927 Bacteria 707
467 Ga0207700_10277852 3300025928 Bacteria 1440
468 Ga0207644_10066690 3300025931 Bacteria 2621
469 Ga0207644_11156876 3300025931 Bacteria 650
470 Ga0207690_10264581 3300025932 Bacteria 1333
471 Ga0207706_10449811 3300025933 Bacteria 1114
472 Ga0207686_10207472 3300025934 Bacteria 1407
473 Ga0207686_10337068 3300025934 Bacteria 1132
474 Ga0207709_10393774 3300025935 Bacteria 1057
475 Ga0207670_10173397 3300025936 Bacteria 1619
476 Ga0207670_10303102 3300025936 Bacteria 1251
477 Ga0207670_10334339 3300025936 Bacteria 1195
478 Ga0207670_11398364 3300025936 Bacteria 594
479 Ga0207669_10163902 3300025937 Bacteria 1574
480 Ga0207704_10247562 3300025938 Bacteria 1336
481 Ga0207704_10711085 3300025938 Bacteria 833
482 Ga0207665_10099647 3300025939 Bacteria 2027
483 Ga0207665_10347868 3300025939 Bacteria 1118
484 Ga0207691_10065382 3300025940 Bacteria 3292
485 Ga0207691_10184833 3300025940 Bacteria 1820
486 Ga0207691_10203166 3300025940 Bacteria 1724
487 Ga0207691_10253077 3300025940 Bacteria 1520
488 Ga0207691_10639419 3300025940 Bacteria 899
489 Ga0207711_10092154 3300025941 Bacteria 2666
490 Ga0207711_10313832 3300025941 Bacteria 1448
491 Ga0207711_10444359 3300025941 Bacteria 1207
492 Ga0207711_10899051 3300025941 Bacteria 823
493 Ga0207689_10291208 3300025942 Bacteria 1352
494 Ga0207689_11375501 3300025942 Bacteria 592
495 Ga0207689_11757217 3300025942 Bacteria 513
496 Ga0207679_10950896 3300025945 Bacteria 787
497 Ga0207679_11374753 3300025945 Bacteria 648
498 Ga0207667_12007909 3300025949 Bacteria 538
499 Ga0207651_10359944 3300025960 Bacteria 1228
500 Ga0207651_10410300 3300025960 Bacteria 1154
501 Ga0207712_10091966 3300025961 Bacteria 2235
502 Ga0207712_10430853 3300025961 Bacteria 1115
503 Ga0207712_10598682 3300025961 Bacteria 953
504 Ga0207712_11143806 3300025961 Bacteria 694
505 Ga0207712_11892805 3300025961 Bacteria 534
506 Ga0207668_12156644 3300025972 Bacteria 501
507 Ga0207640_10220809 3300025981 Bacteria 1451
508 Ga0207658_10723403 3300025986 Bacteria 900
509 Ga0207703_10215875 3300026035 Bacteria 1713
510 Ga0207703_10532207 3300026035 Bacteria 1106
511 Ga0207703_10815479 3300026035 Unclassified 891
512 Ga0207708_10001998 3300026075 Bacteria 15020
513 Ga0207708_10011776 3300026075 Bacteria 6517
514 Ga0207708_10054927 3300026075 Bacteria 3036
515 Ga0207708_10238594 3300026075 Bacteria 1462
516 Ga0207708_10661049 3300026075 Bacteria 890
517 Ga0207708_11735666 3300026075 Bacteria 548
518 Ga0207641_10279780 3300026088 Bacteria 1569
519 Ga0207641_10585444 3300026088 Bacteria 1091
520 Ga0207641_10764649 3300026088 Bacteria 954
521 Ga0207641_11750973 3300026088 Bacteria 623
522 Ga0207641_12379126 3300026088 Bacteria 529
523 Ga0207648_10013823 3300026089 Bacteria 7487
524 Ga0207648_10936802 3300026089 Bacteria 810
525 Ga0207676_10092693 3300026095 Bacteria 2485
526 Ga0207676_10330821 3300026095 Bacteria 1402
527 Ga0207676_10365836 3300026095 Bacteria 1338
528 Ga0207674_10006305 3300026116 Bacteria 13976
529 Ga0207674_10039862 3300026116 Bacteria 4867
530 Ga0207674_10051058 3300026116 Bacteria 4221
531 Ga0207675_100000867 3300026118 Bacteria 30154
532 Ga0207675_100128735 3300026118 Bacteria 2400
533 Ga0207675_100177839 3300026118 Bacteria 2036
534 Ga0207675_102134665 3300026118 Bacteria 576
535 Ga0207683_10371272 3300026121 Bacteria 1314
536 Ga0207683_11820517 3300026121 Bacteria 558
537 Ga0207698_10112530 3300026142 Bacteria 2285
538 Ga0209970_1062715 3300027614 Bacteria 684
539 Ga0209588_1117750 3300027671 Bacteria 851
540 Ga0209971_1092259 3300027682 Bacteria 739
541 Ga0209813_10005812 3300027866 Bacteria 3017
542 Ga0209974_10135504 3300027876 Bacteria 880
543 Ga0207428_10000066 3300027907 Bacteria 150622
544 Ga0207428_10005426 3300027907 Bacteria 11892
545 Ga0207428_10015476 3300027907 Bacteria 6598
546 Ga0207428_10207750 3300027907 Bacteria 1472
547 Ga0207428_10478262 3300027907 Bacteria 906
548 Ga0207428_10558529 3300027907 Bacteria 827
549 Ga0207428_11107869 3300027907 Bacteria 553
550 Ga0268266_10002405 3300028379 Bacteria 20172
551 Ga0268266_10376808 3300028379 Bacteria 1338
552 Ga0268266_11292025 3300028379 Bacteria 705
553 Ga0268265_10017066 3300028380 Bacteria 5002
554 Ga0268265_10086638 3300028380 Bacteria 2490
555 Ga0268265_10109736 3300028380 Bacteria 2250
556 Ga0268265_10253065 3300028380 Bacteria 1561
557 Ga0268265_10779720 3300028380 Bacteria 930
558 Ga0268265_11153420 3300028380 Bacteria 771
559 Ga0268265_11420507 3300028380 Bacteria 696
560 Ga0268264_10039565 3300028381 Bacteria 3896
561 Ga0268264_10339368 3300028381 Bacteria 1427
562 Ga0316177_1064781 3300030731 Bacteria 598
563 Ga0307513_10567625 3300031456 Bacteria 846
564 Ga0307408_100017167 3300031548 Bacteria 4842
565 Ga0307408_100175121 3300031548 Bacteria 1716
566 Ga0307408_100338372 3300031548 Bacteria 1273
567 Ga0307408_100877492 3300031548 Bacteria 819
568 Ga0307408_100944171 3300031548 Bacteria 792
569 Ga0307408_101369287 3300031548 Bacteria 665
570 Ga0307408_101762897 3300031548 Bacteria 591
571 Ga0307408_102435474 3300031548 Bacteria 508
572 Ga0307405_10011448 3300031731 Bacteria 4649
573 Ga0307405_10034455 3300031731 Bacteria 3013
574 Ga0307405_10057734 3300031731 Bacteria 2439
575 Ga0307405_10104424 3300031731 Bacteria 1907
576 Ga0307405_10713432 3300031731 Bacteria 832
577 Ga0307405_10861495 3300031731 Bacteria 763
578 Ga0307413_10135263 3300031824 Bacteria 1694
579 Ga0307413_10153152 3300031824 Bacteria 1609
580 Ga0307413_10278359 3300031824 Bacteria 1257
581 Ga0307413_10333073 3300031824 Bacteria 1164
582 Ga0307413_11862318 3300031824 Bacteria 540
583 Ga0307410_10014139 3300031852 Bacteria 4683
584 Ga0307410_10081763 3300031852 Bacteria 2270
585 Ga0307410_10318381 3300031852 Bacteria 1233
586 Ga0307410_10321916 3300031852 Bacteria 1227
587 Ga0307410_10619618 3300031852 Bacteria 904
588 Ga0307410_10957826 3300031852 Bacteria 736
589 Ga0307410_11122237 3300031852 Bacteria 682
590 Ga0307406_10023468 3300031901 Bacteria 3671
591 Ga0307406_10056382 3300031901 Bacteria 2516
592 Ga0307406_10458675 3300031901 Bacteria 1024
593 Ga0307407_10006993 3300031903 Bacteria 5073
594 Ga0307407_10021205 3300031903 Bacteria 3346
595 Ga0307407_10351144 3300031903 Bacteria 1044
596 Ga0307412_10014827 3300031911 Bacteria 4607
597 Ga0307412_10057037 3300031911 Bacteria 2605
598 Ga0307412_10083065 3300031911 Bacteria 2219
599 Ga0307412_10507102 3300031911 Bacteria 1005
600 Ga0307412_11177197 3300031911 Bacteria 685
601 Ga0307412_11471998 3300031911 Bacteria 618
602 Ga0307409_100035219 3300031995 Bacteria 3665
603 Ga0307409_100076558 3300031995 Bacteria 2683
604 Ga0307409_100216209 3300031995 Bacteria 1727
605 Ga0307409_100293922 3300031995 Bacteria 1508
606 Ga0307409_101259452 3300031995 Bacteria 764
607 Ga0307409_101453893 3300031995 Bacteria 712
608 Ga0307409_102542965 3300031995 Bacteria 541
609 Ga0307416_100121446 3300032002 Bacteria 2329
610 Ga0307416_100194849 3300032002 Bacteria 1915
611 Ga0307416_100395212 3300032002 Bacteria 1418
612 Ga0307416_100413723 3300032002 Bacteria 1390
613 Ga0307416_100445871 3300032002 Bacteria 1345
614 Ga0307416_100481345 3300032002 Bacteria 1301
615 Ga0307416_100524648 3300032002 Bacteria 1253
616 Ga0307416_100818722 3300032002 Bacteria 1028
617 Ga0307416_102876474 3300032002 Bacteria 576
618 Ga0307414_10054658 3300032004 Bacteria 2792
619 Ga0307414_10239440 3300032004 Bacteria 1501
620 Ga0307414_10500905 3300032004 Bacteria 1075
621 Ga0307414_10651491 3300032004 Bacteria 949
622 Ga0307414_12114687 3300032004 Bacteria 526
623 Ga0307411_10032084 3300032005 Bacteria 3242
624 Ga0307411_10039590 3300032005 Bacteria 2983
625 Ga0307411_10063104 3300032005 Bacteria 2475
626 Ga0307411_10151621 3300032005 Bacteria 1723
627 Ga0307411_10315240 3300032005 Bacteria 1260
628 Ga0307411_10946304 3300032005 Bacteria 768
629 Ga0307415_100007622 3300032126 Bacteria 5935
630 Ga0307415_100112514 3300032126 Bacteria 2023
631 Ga0307415_100165634 3300032126 Bacteria 1718
632 Ga0307415_100655663 3300032126 Bacteria 941
633 Ga0307415_100926029 3300032126 Bacteria 805
634 Ga0307415_101132942 3300032126 Bacteria 734
635 Ga0307415_102393346 3300032126 Bacteria 519
636 Ga0373951_0007495 3300035091 Bacteria 2476
637 Ga0373923_0219994 3300035111 Bacteria 882
638 Ga0373939_0121770 3300035114 Bacteria 921
639 Ga0373941_0138566 3300035115 Bacteria 883
640 Ga0373960_0040115 3300035121 Bacteria 1350
641 Ga0373943_0317411 3300035170 Bacteria 888
642 Ga0373955_0003736 3300035172 Bacteria 6707
643 Ga0373961_0446080 3300035241 Bacteria 504
644 Ga0373931_0303386 3300035691 Bacteria 987
645 Ga0373931_1006693 3300035691 Bacteria 564
646 Ga0373935_0011222 3300035692 Bacteria 5379
647 Ga0373933_1112392 3300035724 Bacteria 520
648 Ga0373947_0043176 3300035725 Bacteria 2693
649 Ga0373947_0913808 3300035725 Bacteria 599
650 Ga0373937_0484815 3300036401 Bacteria 1174
651 Ga0373925_0014810 3300037068 Bacteria 5637
652 Ga0395898_0175891 3300037466 Bacteria 2046
653 Ga0395898_0828135 3300037466 Bacteria 865
654 Ga0395905_0009165 3300037471 Bacteria 9692
655 Ga0395901_0718220 3300038443 Bacteria 995
656 Ga0436365_0119969 3300039437 Bacteria 1084
657 Ga0439436_0149421 3300041404 Bacteria 659
658 Ga0439453_0137137 3300041408 Bacteria 572
659 Ga0451804_1160570 3300041463 Bacteria 726
660 Ga0451853_3530569 3300041512 Bacteria 537
661 Ga0439431_0142074 3300041997 Bacteria 679
662 Ga0439431_0147528 3300041997 Bacteria 667
663 Ga0439433_0027623 3300041999 Bacteria 1288
664 Ga0439441_117542 3300042001 Bacteria 607
665 Ga0439449_0198896 3300042007 Bacteria 750
666 Ga0439449_0380224 3300042007 Bacteria 535
667 Ga0439457_065522 3300042014 Bacteria 825
668 Ga0439462_0067486 3300042015 Bacteria 970
669 Ga0439462_0093437 3300042015 Bacteria 826
670 Ga0450921_006500 3300042123 Bacteria 910
671 Ga0450923_035017 3300042125 Bacteria 1037
672 Ga0439446_0082683 3300042156 Bacteria 996
673 Ga0439446_0096045 3300042156 Bacteria 933
674 Ga0439446_0130544 3300042156 Bacteria 814
675 Ga0439446_0171552 3300042156 Bacteria 722
676 Ga0439446_0301250 3300042156 Bacteria 563
677 Ga0439434_0085323 3300042435 Bacteria 1005
678 Ga0439435_0225328 3300042436 Bacteria 625
679 Ga0439460_0068606 3300042461 Bacteria 1094
680 Ga0439460_0252212 3300042461 Bacteria 610
681 Ga0450916_010513 3300042530 Bacteria 1158
682 Ga0466965_0935951 3300044683 Bacteria 507
683 Ga0451576_0144062 3300045051 Bacteria 2484
684 Ga0495580_0003700 3300046472 Bacteria 12962
685 Ga0495582_0194633 3300046473 Bacteria 1157
686 Ga0495639_0231571 3300046475 Bacteria 910
687 Ga0495594_0048032 3300046499 Bacteria 2344
688 Ga0495659_0116041 3300046664 Bacteria 1050
689 Ga0495669_0003741 3300046684 Bacteria 6258
690 Ga0495686_0462972 3300047472 Bacteria 672
691 Ga0496101_0246261 3300048904 Bacteria 1392
692 Ga0496102_0074085 3300048905 Bacteria 3130
693 Ga0496103_0114979 3300048906 Bacteria 1711
694 Ga0496104_0953449 3300048907 Bacteria 762
695 Ga0496105_0041890 3300048908 Bacteria 3774
696 Ga0496106_0231579 3300048909 Bacteria 1475
697 Ga0496106_1232613 3300048909 Bacteria 582
698 Ga0496108_0129931 3300048911 Bacteria 2165
699 Ga0496109_0187789 3300048912 Bacteria 1942
700 Ga0496109_0325059 3300048912 Bacteria 1452
701 Ga0496109_1490342 3300048912 Bacteria 611
702 Ga0496110_0018180 3300048913 Bacteria 5890
703 Ga0496111_0411148 3300048914 Bacteria 999
704 Ga0496112_0384993 3300048915 Bacteria 1343
705 Ga0496112_0982564 3300048915 Bacteria 764
706 Ga0496113_0148972 3300048916 Bacteria 1845
707 Ga0496113_1597966 3300048916 Bacteria 502
708 Ga0496114_1677490 3300048917 Bacteria 524
709 Ga0496115_0150022 3300048918 Bacteria 1925
710 Ga0501292_049762 3300049515 Bacteria 741
711 Ga0501296_031518 3300049519 Bacteria 716
712 Ga0501298_050992 3300049521 Bacteria 859
713 Ga0501299_002316 3300049522 Bacteria 2629
714 Ga0501031_0264637 3300049568 Bacteria 1117
715 Ga0501033_0545687 3300049570 Bacteria 799
716 Ga0501036_0215263 3300049572 Bacteria 1614
717 Ga0501036_0598116 3300049572 Bacteria 915
718 Ga0501037_0336208 3300049573 Bacteria 1044
719 Ga0501038_0555830 3300049574 Bacteria 872
720 Ga0501038_0853153 3300049574 Bacteria 674
721 Ga0501038_1081973 3300049574 Bacteria 586
722 Ga0501039_0032531 3300049575 Bacteria 4022
723 Ga0501039_0325882 3300049575 Bacteria 1207
724 Ga0501040_1193963 3300049576 Bacteria 552
725 Ga0501040_1264715 3300049576 Bacteria 535
726 Ga0501041_0187119 3300049577 Bacteria 1297
727 Ga0501042_0415935 3300049578 Bacteria 974
728 Ga0501043_0365959 3300049579 Bacteria 1094
729 Ga0501046_0346638 3300049580 Bacteria 1079
730 Ga0501048_0030642 3300049582 Bacteria 3892
731 Ga0501048_0057040 3300049582 Bacteria 2770
732 Ga0501068_0250875 3300049584 Bacteria 1128
733 Ga0501071_0037344 3300049587 Bacteria 3468
734 Ga0501072_0492328 3300049588 Bacteria 970
735 Ga0501074_1088454 3300049590 Bacteria 561
736 Ga0501075_0119251 3300049591 Bacteria 2007
737 Ga0501075_0241404 3300049591 Bacteria 1377
738 Ga0501075_0539008 3300049591 Bacteria 891
739 Ga0501076_0052660 3300049592 Bacteria 3225
740 Ga0501076_0167828 3300049592 Bacteria 1789
741 Ga0501076_1246144 3300049592 Bacteria 612
742 Ga0501076_1741949 3300049592 Bacteria 511
743 Ga0501202_191221 3300049652 Bacteria 556
744 Ga0501210_035290 3300049657 Bacteria 533
745 Ga0501216_004589 3300049660 Bacteria 2055
746 Ga0501224_023769 3300049664 Bacteria 915
747 Ga0501249_065617 3300049679 Bacteria 844
748 Ga0501257_070247 3300049686 Bacteria 894
749 Ga0501257_118778 3300049686 Bacteria 707
750 Ga0501257_221030 3300049686 Bacteria 552
751 Ga0501259_070139 3300049688 Bacteria 750
752 Ga0501079_0026890 3300049741 Bacteria 4412
753 Ga0501079_1401708 3300049741 Bacteria 550
754 Ga0501080_0287679 3300049742 Bacteria 1493
755 Ga0501080_0382138 3300049742 Bacteria 1269
756 Ga0501080_1268427 3300049742 Bacteria 632
757 Ga0501081_0162594 3300049743 Bacteria 1609
758 Ga0501081_1245080 3300049743 Bacteria 564
759 Ga0501265_033330 3300049762 Bacteria 750
760 Ga0501271_046328 3300049768 Bacteria 579
761 Ga0501276_027757 3300049773 Bacteria 576
762 Ga0501283_025479 3300049779 Bacteria 969
763 Ga0501035_1478449 3300049822 Bacteria 519
764 Ga0501045_0037024 3300049824 Bacteria 3546
765 Ga0501045_0173888 3300049824 Bacteria 1604
766 Ga0501045_0280898 3300049824 Bacteria 1239
767 Ga0501045_1314217 3300049824 Bacteria 526
768 nmdc:mga03683_22334_c1 3300050489 Bacteria 2452
769 nmdc:mga03683_8778_c1 3300050489 Bacteria 3567
770 nmdc:mga00v17_181583_c1 3300050491 Bacteria 1358
771 nmdc:mga00v17_2275_c1 3300050491 Bacteria 9851
772 nmdc:mga00v17_43427_c1 3300050491 Bacteria 2707
773 nmdc:mga00v17_60235_c1 3300050491 Bacteria 2331
774 nmdc:mga0yw44_19051_c1 3300050492 Bacteria 3776
775 nmdc:mga0yw44_331971_c1 3300050492 Bacteria 1022
776 nmdc:mga0yw44_438494_c1 3300050492 Bacteria 885
777 nmdc:mga0yw44_708575_c1 3300050492 Bacteria 684
778 nmdc:mga0k408_137837_c1 3300050493 Bacteria 1450
779 nmdc:mga0k408_1402_c1 3300050493 Bacteria 13042
780 nmdc:mga0k408_28241_c1 3300050493 Bacteria 3190
781 nmdc:mga06z11_181171_c1 3300050494 Bacteria 1215
782 nmdc:mga06z11_221534_c1 3300050494 Bacteria 1106
783 nmdc:mga04h51_12961_c1 3300050495 Bacteria 2352
784 nmdc:mga04h51_42309_c1 3300050495 Bacteria 1493
785 nmdc:mga05p37_1012253_c1 3300050507 Bacteria 881
786 nmdc:mga05p37_1169392_c1 3300050507 Bacteria 798
787 nmdc:mga05p37_119884_c1 3300050507 Bacteria 3232
788 nmdc:mga05p37_1241864_c1 3300050507 Bacteria 765
789 nmdc:mga05p37_2033801_c1 3300050507 Bacteria 542
790 nmdc:mga05p37_29297_c1 3300050507 Bacteria 6718
791 nmdc:mga05p37_423172_c1 3300050507 Bacteria 1549
792 nmdc:mga05p37_485250_c1 3300050507 Bacteria 1422
793 nmdc:mga05p37_730712_c1 3300050507 Bacteria 1095
794 nmdc:mga09592_119210_c1 3300050508 Bacteria 2265
795 nmdc:mga09592_122076_c1 3300050508 Bacteria 2238
796 nmdc:mga09592_29725_c2 3300050508 Bacteria 1819
797 nmdc:mga09592_317760_c1 3300050508 Bacteria 1349
798 nmdc:mga09592_9642_c2 3300050508 Bacteria 5022
799 nmdc:mga0qj67_187183_c1 3300050509 Bacteria 1682
800 nmdc:mga0qj67_189495_c1 3300050509 Bacteria 1671
801 nmdc:mga0qj67_522580_c1 3300050509 Unclassified 953
802 nmdc:mga0qj67_878748_c1 3300050509 Bacteria 707
803 nmdc:mga0qj67_93243_c1 3300050509 Bacteria 2421
804 nmdc:mga0qj67_945002_c1 3300050509 Bacteria 678
805 nmdc:mga06r32_1047671_c1 3300050510 Bacteria 767
806 nmdc:mga06r32_1494677_c1 3300050510 Bacteria 616
807 nmdc:mga06r32_1521788_c1 3300050510 Bacteria 609
808 nmdc:mga06r32_213983_c1 3300050510 Bacteria 1915
809 nmdc:mga06r32_318118_c1 3300050510 Unclassified 1542
810 nmdc:mga06r32_383087_c1 3300050510 Bacteria 1389
811 nmdc:mga06r32_41016_c1 3300050510 Bacteria 4396
812 nmdc:mga06r32_48081_c1 3300050510 Bacteria 4077
813 nmdc:mga06r32_54827_c1 3300050510 Bacteria 3823
814 nmdc:mga06r32_6519_c1 3300050510 Bacteria 10487
815 nmdc:mga06r32_754432_c1 3300050510 Bacteria 936
816 nmdc:mga06r32_764207_c1 3300050510 Bacteria 929
817 nmdc:mga06r32_8990_c1 3300050510 Bacteria 9001
818 nmdc:mga06r32_91784_c1 3300050510 Bacteria 2486
819 nmdc:mga08y16_10038_c1 3300050511 Bacteria 9938
820 nmdc:mga08y16_1087708_c1 3300050511 Bacteria 775
821 nmdc:mga08y16_161947_c1 3300050511 Bacteria 2325
822 nmdc:mga08y16_1821582_c1 3300050511 Bacteria 561
823 nmdc:mga08y16_202152_c1 3300050511 Bacteria 2059
824 nmdc:mga08y16_449803_c1 3300050511 Bacteria 1314
825 nmdc:mga08y16_73628_c1 3300050511 Bacteria 3559
826 nmdc:mga08y16_830_c1 3300050511 Bacteria 29664
827 nmdc:mga08y16_860311_c1 3300050511 Bacteria 895
828 nmdc:mga08y16_887009_c1 3300050511 Bacteria 879
829 nmdc:mga0n895_1004636_c1 3300050512 Bacteria 815
830 nmdc:mga0n895_204307_c1 3300050512 Bacteria 2006
831 nmdc:mga0n895_570495_c1 3300050512 Bacteria 1136
832 nmdc:mga0rr50_1214512_c1 3300050513 Bacteria 640
833 nmdc:mga0rr50_424385_c1 3300050513 Bacteria 1125
834 nmdc:mga0rr50_556954_c1 3300050513 Bacteria 976
835 nmdc:mga08x19_430626_c1 3300050514 Bacteria 927
836 nmdc:mga08x19_48925_c1 3300050514 Bacteria 2710
837 nmdc:mga0a205_1300576_c1 3300050515 Bacteria 575
838 nmdc:mga0a205_34662_c1 3300050515 Bacteria 4843
839 nmdc:mga0a205_38498_c1 3300050515 Bacteria 4601
840 nmdc:mga0a205_577189_c1 3300050515 Bacteria 978
841 nmdc:mga0a205_655621_c1 3300050515 Bacteria 901
842 Ga0500595_115724 3300053119 Bacteria 760
843 Ga0501084_0142888 3300054114 Bacteria 2015
844 Ga0501084_0679034 3300054114 Bacteria 869
845 Ga0501084_0707502 3300054114 Bacteria 849
846 Ga0501084_1071583 3300054114 Bacteria 677
847 Ga0590071_000630 3300059421 Bacteria 10031
848 Ga0590071_020025 3300059421 Bacteria 1575
849 Ga0590071_191872 3300059421 Bacteria 537
850 Ga0590074_005790 3300059423 Bacteria 2050
851 Ga0590074_010517 3300059423 Bacteria 1546
852 Ga0590075_000859 3300059424 Bacteria 7971
853 Ga0590077_000681 3300059426 Bacteria 9039
854 Ga0590077_001351 3300059426 Bacteria 5794
855 Ga0590077_042674 3300059426 Bacteria 1010
856 Ga0590077_116015 3300059426 Bacteria 631
857 Ga0501082_0137794 3300060353 Bacteria 2118
858 Ga0501082_0845653 3300060353 Bacteria 800
859 Ga0530510_0617413 3300061734 Bacteria 825
860 Ga0070699_100010499
861 CNAas_1000438
862 SwM_110429
863 JGI24743J22301_10045346
864 Ga0065704_10064688
865 Ga0065712_10177170
866 Ga0065712_10278298
867 Ga0065712_10296101
868 Ga0065715_10043198
869 Ga0065715_10294680
870 Ga0065715_10469732
871 Ga0065715_10593873
872 Ga0070658_10345047
873 Ga0070676_10042348
874 Ga0070676_10102863
875 Ga0070676_10792219
876 Ga0070676_10852305
877 Ga0070683_100023642
878 Ga0070690_100090696
879 Ga0070690_100219422
880 Ga0070670_100067209
881 Ga0070670_100116133
882 Ga0070670_100496587
883 Ga0070670_100591142
884 Ga0070677_10031947
885 Ga0068869_100047072
886 Ga0068869_100242339
887 Ga0068869_100255621
888 Ga0068869_100343771
889 Ga0068869_100347828
890 Ga0068869_100518386
891 Ga0070666_10046254
892 Ga0070680_100052335
893 Ga0070680_100258624
894 Ga0070680_100378330
895 Ga0070680_101299255
896 Ga0070682_100010640
897 Ga0070682_100807322
898 Ga0068868_100199251
899 Ga0068868_100513483
900 Ga0068868_100564099
901 Ga0070660_100081479
902 Ga0070660_100108918
903 Ga0070689_100117095
904 Ga0070689_100185298
905 Ga0070689_100288023
906 Ga0070689_100607844
907 Ga0070691_10003235
908 Ga0070687_100079298
909 Ga0070661_100020336
910 Ga0070661_100045933
911 Ga0070692_10001289
912 Ga0070692_10032811
913 Ga0070692_10161354
914 Ga0070692_10316113
915 Ga0070668_100068221
916 Ga0070668_101266494
917 Ga0070668_101413762
918 Ga0070669_100016855
919 Ga0070669_100017851
920 Ga0070669_100037604
921 Ga0070669_100109253
922 Ga0070675_100007041
923 Ga0070675_100045944
924 Ga0070675_100230781
925 Ga0070675_101297081
926 Ga0070671_100005274
927 Ga0070671_100098298
928 Ga0070671_100697813
929 Ga0070674_100022437
930 Ga0070674_100187600
931 Ga0070674_100238809
932 Ga0070674_101620865
933 Ga0070673_100099216
934 Ga0070673_100437409
935 Ga0070673_100458733
936 Ga0070673_100480053
937 Ga0070673_100770756
938 Ga0070688_100072111
939 Ga0070688_100274569
940 Ga0070688_100374404
941 Ga0070688_101544288
942 Ga0070659_100038001
943 Ga0070659_101073649
944 Ga0070659_101127305
945 Ga0070667_100428967
946 Ga0070667_100908158
947 Ga0070709_10000037
948 Ga0070714_100212411
949 Ga0070710_11106206
950 Ga0070701_10006144
951 Ga0070701_10496041
952 Ga0070701_10931445
953 Ga0070711_100522812
954 Ga0070705_100001670
955 Ga0070705_100033710
956 Ga0070705_100653671
957 Ga0070705_100993920
958 Ga0070700_100040946
959 Ga0070700_100066673
960 Ga0070700_100167843
961 Ga0070700_100268725
962 Ga0070700_100312644
963 Ga0070700_100447097
964 Ga0070700_100691954
965 Ga0070700_101664938
966 Ga0070694_100008193
967 Ga0070694_100026032
968 Ga0070694_100254859
969 Ga0070694_100453815
970 Ga0070694_100552336
971 Ga0070694_100618560
972 Ga0070694_101111526
973 Ga0070663_100008376
974 Ga0070678_100026798
975 Ga0070678_100377756
976 Ga0070678_100479105
977 Ga0070662_100114636
978 Ga0070662_100268181
979 Ga0070662_100797781
980 Ga0070662_101993676
981 Ga0070681_10009939
982 Ga0068867_100009422
983 Ga0068867_100109620
984 Ga0068867_100871239
985 Ga0070685_10078426
986 Ga0070685_10344787
987 Ga0070685_10867924
988 Ga0070706_100002422
989 Ga0070706_100011639
990 Ga0070706_100458803
991 Ga0070706_100851834
992 Ga0070707_100154585
993 Ga0070707_100634823
994 Ga0070707_100966899
995 Ga0070698_100086180
996 Ga0070698_100575025
997 Ga0070699_100588147
998 Ga0070699_100919180
999 Ga0070684_100189992
1000 Ga0070684_101252413
1001 Ga0070697_100376824
1002 Ga0070697_100426695
1003 Ga0068853_100360309
1004 Ga0068853_100446556
1005 Ga0070672_100089554
1006 Ga0070672_100098734
1007 Ga0070672_100222381
1008 Ga0070672_100229254
1009 Ga0070672_100348813
1010 Ga0070686_100402907
1011 Ga0070686_101385094
1012 Ga0070695_100000731
1013 Ga0070696_100709625
1014 Ga0070665_100001390
1015 Ga0070665_100690599
1016 Ga0070704_100126417
1017 Ga0070704_100165766
1018 Ga0070704_100207469
1019 Ga0070704_100275806
1020 Ga0070704_100333670
1021 Ga0070704_101113389
1022 Ga0070704_102289096
1023 Ga0068855_100178116
1024 Ga0068855_102450627
1025 Ga0070664_100004209
1026 Ga0070664_100215281
1027 Ga0070664_100910295
1028 Ga0068857_100001653
1029 Ga0068857_100038783
1030 Ga0068857_100239576
1031 Ga0068857_101700698
1032 Ga0068854_100027961
1033 Ga0068854_100187585
1034 Ga0068854_101131493
1035 Ga0068856_100225493
1036 Ga0068856_100916798
1037 Ga0068856_101918910
1038 Ga0070702_100019185
1039 Ga0070702_100178726
1040 Ga0068852_100026368
1041 Ga0068859_100005276
1042 Ga0068859_100172661
1043 Ga0068859_100391445
1044 Ga0068859_100623057
1045 Ga0068859_100764725
1046 Ga0068859_100907399
1047 Ga0068859_101432900
1048 Ga0068859_101452187
1049 Ga0068859_102145778
1050 Ga0068864_100050254
1051 Ga0068864_100114629
1052 Ga0068864_102495004
1053 Ga0068866_10036074
1054 Ga0068866_10069983
1055 Ga0068866_11061125
1056 Ga0068861_100082437
1057 Ga0068861_100109453
1058 Ga0068861_100270559
1059 Ga0068861_100274204
1060 Ga0068861_100567234
1061 Ga0068861_100732723
1062 Ga0068861_100967101
1063 Ga0068861_101363086
1064 Ga0068851_10063109
1065 Ga0068851_10482625
1066 Ga0068851_10807304
1067 Ga0068870_10019217
1068 Ga0068870_10112829
1069 Ga0068863_100210296
1070 Ga0068863_100264357
1071 Ga0068863_100793910
1072 Ga0068858_100120200
1073 Ga0068858_100493646
1074 Ga0068858_102042875
1075 Ga0068860_100320845
1076 Ga0068860_100489439
1077 Ga0068860_101101383
1078 Ga0068860_101384211
1079 Ga0068862_100017030
1080 Ga0068862_100044805
1081 Ga0068862_100107276
1082 Ga0068862_100286754
1083 Ga0068862_100442469
1084 Ga0068862_101042143
1085 Ga0068862_101428802
1086 Ga0081455_10706925
1087 Ga0081538_10309108
1088 Ga0081539_10328325
1089 Ga0070717_10259633
1090 Ga0075365_10038031
1091 Ga0075368_10014726
1092 Ga0075368_10019483
1093 Ga0075364_10010583
1094 Ga0075364_10070346
1095 Ga0075364_10197378
1096 Ga0075432_10492702
1097 Ga0070712_101648939
1098 Ga0075362_10009871
1099 Ga0075362_10177032
1100 Ga0075367_10000361
1101 Ga0075367_10012071
1102 Ga0075366_10001384
1103 Ga0075366_10069338
1104 Ga0097621_100146286
1105 Ga0097621_100475444
1106 Ga0075370_10296591
1107 Ga0075370_10305194
1108 Ga0068871_100054486
1109 Ga0068871_100251217
1110 Ga0068871_100335327
1111 Ga0068871_100719179
1112 Ga0075428_100033757
1113 Ga0075428_100040132
1114 Ga0075428_100097417
1115 Ga0075428_100154043
1116 Ga0075428_100248966
1117 Ga0075428_100264770
1118 Ga0075428_100295059
1119 Ga0075428_100569614
1120 Ga0075428_100687873
1121 Ga0075428_101334624
1122 Ga0075428_102667956
1123 Ga0075430_100188638
1124 Ga0075430_100238401
1125 Ga0075430_100549355
1126 Ga0075430_100885403
1127 Ga0075430_101326719
1128 Ga0075430_101506216
1129 Ga0075431_100015578
1130 Ga0075431_100070037
1131 Ga0075431_100130159
1132 Ga0075431_100134746
1133 Ga0075431_100157339
1134 Ga0075431_100282771
1135 Ga0075431_100458400
1136 Ga0075431_100550036
1137 Ga0075431_100639803
1138 Ga0075431_100639836
1139 Ga0075431_100747247
1140 Ga0075431_100884339
1141 Ga0075433_10241624
1142 Ga0075433_10962986
1143 Ga0075433_10967622
1144 Ga0075434_100120177
1145 Ga0075434_100197092
1146 Ga0075434_101691551
1147 Ga0075429_100057436
1148 Ga0075429_100103111
1149 Ga0075429_100186284
1150 Ga0075429_101410497
1151 Ga0068865_100099479
1152 Ga0068865_100423061
1153 Ga0075436_100056914
1154 Ga0075436_100523815
1155 Ga0075436_100993281
1156 Ga0075436_101035460
1157 Ga0097620_100005276
1158 Ga0097620_100154690
1159 Ga0097620_100172658
1160 Ga0097620_100391448
1161 Ga0097620_100623080
1162 Ga0097620_100764775
1163 Ga0097620_100907390
1164 Ga0097620_101433085
1165 Ga0097620_101451790
1166 Ga0097620_102145674
1167 Ga0075435_100319111
1168 Ga0075435_100373813
1169 Ga0099794_10622067
1170 Ga0105244_10554107
1171 Ga0105240_10441791
1172 Ga0111539_10000298
1173 Ga0111539_10010411
1174 Ga0111539_10076614
1175 Ga0111539_10121401
1176 Ga0111539_10125381
1177 Ga0111539_10161453
1178 Ga0111539_10328517
1179 Ga0111539_10666709
1180 Ga0111539_10788261
1181 Ga0111539_11204353
1182 Ga0111539_11266823
1183 Ga0111539_12359373
1184 Ga0105245_10070482
1185 Ga0105245_11492332
1186 Ga0105245_11960319
1187 Ga0114129_10024546
1188 Ga0114129_10036776
1189 Ga0114129_10105670
1190 Ga0114129_10155950
1191 Ga0114129_10183643
1192 Ga0114129_10484429
1193 Ga0114129_10877811
1194 Ga0114129_11031387
1195 Ga0114129_11472485
1196 Ga0114129_12523444
1197 Ga0105243_10800963
1198 Ga0105243_11551555
1199 Ga0105243_12101242
1200 Ga0105241_10014749
1201 Ga0105241_10883592
1202 Ga0105241_12297671
1203 Ga0105242_10030613
1204 Ga0105242_10321528
1205 Ga0105242_10755726
1206 Ga0105242_11200331
1207 Ga0105242_11787390
1208 Ga0105248_10012596
1209 Ga0105248_10029131
1210 Ga0105248_10038965
1211 Ga0105248_10310540
1212 Ga0105248_11586663
1213 Ga0105248_11885998
1214 Ga0105248_12347970
1215 Ga0105237_10070511
1216 Ga0105249_10048548
1217 Ga0105249_10170520
1218 Ga0105249_11361368
1219 Ga0105249_11477403
1220 Ga0105249_11903173
1221 Ga0105249_12461949
1222 Ga0099796_10034566
1223 Ga0105239_10104381
1224 Ga0105239_10355138
1225 Ga0105239_11385872
1226 Ga0105239_12695015
1227 Ga0105239_13541152
1228 Ga0105246_10011169
1229 Ga0105246_11088677
1230 Ga0157314_1017071
1231 Ga0157315_1043867
1232 Ga0157373_10018525
1233 Ga0157373_10576542
1234 Ga0157371_10009000
1235 Ga0157374_10061088
1236 Ga0157374_10922296
1237 Ga0157378_10031893
1238 Ga0157378_10304267
1239 Ga0157378_11063291
1240 Ga0157378_11325067
1241 Ga0157378_12499179
1242 Ga0163162_10070972
1243 Ga0163162_10074555
1244 Ga0163162_10086332
1245 Ga0163162_10221406
1246 Ga0163162_10259938
1247 Ga0163162_10875065
1248 Ga0157372_10267248
1249 Ga0157372_11061664
1250 Ga0157375_10269241
1251 Ga0157375_10295974
1252 Ga0157375_10349861
1253 Ga0157375_10665686
1254 Ga0157375_11782893
1255 Ga0157375_11843694
1256 Ga0157375_12843008
1257 Ga0163163_10029394
1258 Ga0163163_10124082
1259 Ga0163163_10323400
1260 Ga0163163_10798263
1261 Ga0163163_10970709
1262 Ga0163163_11174451
1263 Ga0157380_10002110
1264 Ga0157380_10004444
1265 Ga0157380_10040625
1266 Ga0157380_10103789
1267 Ga0157380_10159754
1268 Ga0157380_10682777
1269 Ga0157380_10835579
1270 Ga0157380_11099345
1271 Ga0157380_11459544
1272 Ga0182008_10952658
1273 Ga0157377_10006871
1274 Ga0157377_10714359
1275 Ga0157379_10049806
1276 Ga0157379_10075833
1277 Ga0157376_10122847
1278 Ga0157376_10411307
1279 Ga0157376_13126582
1280 Ga0163161_10818022
1281 Ga0163161_11128013
1282 Ga0163161_11649410
1283 Ga0213876_10486913
1284 Ga0207697_10048305
1285 Ga0207656_10651515
1286 Ga0207642_10281518
1287 Ga0207642_10419974
1288 Ga0207685_10437075
1289 Ga0207699_10000048
1290 Ga0207645_10007878
1291 Ga0207645_10926302
1292 Ga0207645_11154868
1293 Ga0207684_10002226
1294 Ga0207684_10029951
1295 Ga0207684_10063990
1296 Ga0207707_10105161
1297 Ga0207707_11358165
1298 Ga0207693_10079454
1299 Ga0207693_10536754
1300 Ga0207663_10313706
1301 Ga0207663_11055798
1302 Ga0207660_10094231
1303 Ga0207660_10392919
1304 Ga0207660_10413749
1305 Ga0207662_10293649
1306 Ga0207662_10650282
1307 Ga0207657_10043005
1308 Ga0207649_10779933
1309 Ga0207646_10152920
1310 Ga0207646_10532971
1311 Ga0207681_10046428
1312 Ga0207681_10107909
1313 Ga0207681_10189307
1314 Ga0207681_10420442
1315 Ga0207681_10755725
1316 Ga0207681_11748611
1317 Ga0207650_10036817
1318 Ga0207650_10414666
1319 Ga0207659_10257811
1320 Ga0207659_10624387
1321 Ga0207659_10690114
1322 Ga0207659_10843898
1323 Ga0207659_11287101
1324 Ga0207659_11400168
1325 Ga0207687_11026955
1326 Ga0207700_10277852
1327 Ga0207644_10066690
1328 Ga0207644_11156876
1329 Ga0207690_10264581
1330 Ga0207706_10449811
1331 Ga0207686_10207472
1332 Ga0207686_10337068
1333 Ga0207709_10393774
1334 Ga0207670_10173397
1335 Ga0207670_10303102
1336 Ga0207670_10334339
1337 Ga0207670_11398364
1338 Ga0207669_10163902
1339 Ga0207704_10247562
1340 Ga0207704_10711085
1341 Ga0207665_10099647
1342 Ga0207665_10347868
1343 Ga0207691_10065382
1344 Ga0207691_10184833
1345 Ga0207691_10203166
1346 Ga0207691_10253077
1347 Ga0207691_10639419
1348 Ga0207711_10092154
1349 Ga0207711_10313832
1350 Ga0207711_10444359
1351 Ga0207711_10899051
1352 Ga0207689_10291208
1353 Ga0207689_11375501
1354 Ga0207689_11757217
1355 Ga0207679_10950896
1356 Ga0207679_11374753
1357 Ga0207667_12007909
1358 Ga0207651_10359944
1359 Ga0207651_10410300
1360 Ga0207712_10091966
1361 Ga0207712_10430853
1362 Ga0207712_10598682
1363 Ga0207712_11143806
1364 Ga0207712_11892805
1365 Ga0207668_12156644
1366 Ga0207640_10220809
1367 Ga0207658_10723403
1368 Ga0207703_10215875
1369 Ga0207703_10532207
1370 Ga0207703_10815479
1371 Ga0207708_10001998
1372 Ga0207708_10011776
1373 Ga0207708_10054927
1374 Ga0207708_10238594
1375 Ga0207708_10661049
1376 Ga0207708_11735666
1377 Ga0207641_10279780
1378 Ga0207641_10585444
1379 Ga0207641_10764649
1380 Ga0207641_11750973
1381 Ga0207641_12379126
1382 Ga0207648_10013823
1383 Ga0207648_10936802
1384 Ga0207676_10092693
1385 Ga0207676_10330821
1386 Ga0207676_10365836
1387 Ga0207674_10006305
1388 Ga0207674_10039862
1389 Ga0207674_10051058
1390 Ga0207675_100000867
1391 Ga0207675_100128735
1392 Ga0207675_100177839
1393 Ga0207675_102134665
1394 Ga0207683_10371272
1395 Ga0207683_11820517
1396 Ga0207698_10112530
1397 Ga0209970_1062715
1398 Ga0209588_1117750
1399 Ga0209971_1092259
1400 Ga0209813_10005812
1401 Ga0209974_10135504
1402 Ga0207428_10000066
1403 Ga0207428_10005426
1404 Ga0207428_10015476
1405 Ga0207428_10207750
1406 Ga0207428_10478262
1407 Ga0207428_10558529
1408 Ga0207428_11107869
1409 Ga0268266_10002405
1410 Ga0268266_10376808
1411 Ga0268266_11292025
1412 Ga0268265_10017066
1413 Ga0268265_10086638
1414 Ga0268265_10109736
1415 Ga0268265_10253065
1416 Ga0268265_10779720
1417 Ga0268265_11153420
1418 Ga0268265_11420507
1419 Ga0268264_10039565
1420 Ga0268264_10339368
1421 Ga0316177_1064781
1422 Ga0307513_10567625
1423 Ga0307408_100017167
1424 Ga0307408_100175121
1425 Ga0307408_100338372
1426 Ga0307408_100877492
1427 Ga0307408_100944171
1428 Ga0307408_101369287
1429 Ga0307408_101762897
1430 Ga0307408_102435474
1431 Ga0307405_10011448
1432 Ga0307405_10034455
1433 Ga0307405_10057734
1434 Ga0307405_10104424
1435 Ga0307405_10713432
1436 Ga0307405_10861495
1437 Ga0307413_10135263
1438 Ga0307413_10153152
1439 Ga0307413_10278359
1440 Ga0307413_10333073
1441 Ga0307413_11862318
1442 Ga0307410_10014139
1443 Ga0307410_10081763
1444 Ga0307410_10318381
1445 Ga0307410_10321916
1446 Ga0307410_10619618
1447 Ga0307410_10957826
1448 Ga0307410_11122237
1449 Ga0307406_10023468
1450 Ga0307406_10056382
1451 Ga0307406_10458675
1452 Ga0307407_10006993
1453 Ga0307407_10021205
1454 Ga0307407_10351144
1455 Ga0307412_10014827
1456 Ga0307412_10057037
1457 Ga0307412_10083065
1458 Ga0307412_10507102
1459 Ga0307412_11177197
1460 Ga0307412_11471998
1461 Ga0307409_100035219
1462 Ga0307409_100076558
1463 Ga0307409_100216209
1464 Ga0307409_100293922
1465 Ga0307409_101259452
1466 Ga0307409_101453893
1467 Ga0307409_102542965
1468 Ga0307416_100121446
1469 Ga0307416_100194849
1470 Ga0307416_100395212
1471 Ga0307416_100413723
1472 Ga0307416_100445871
1473 Ga0307416_100481345
1474 Ga0307416_100524648
1475 Ga0307416_100818722
1476 Ga0307416_102876474
1477 Ga0307414_10054658
1478 Ga0307414_10239440
1479 Ga0307414_10500905
1480 Ga0307414_10651491
1481 Ga0307414_12114687
1482 Ga0307411_10032084
1483 Ga0307411_10039590
1484 Ga0307411_10063104
1485 Ga0307411_10151621
1486 Ga0307411_10315240
1487 Ga0307411_10946304
1488 Ga0307415_100007622
1489 Ga0307415_100112514
1490 Ga0307415_100165634
1491 Ga0307415_100655663
1492 Ga0307415_100926029
1493 Ga0307415_101132942
1494 Ga0307415_102393346
1495 Ga0373951_0007495
1496 Ga0373923_0219994
1497 Ga0373939_0121770
1498 Ga0373941_0138566
1499 Ga0373960_0040115
1500 Ga0373943_0317411
1501 Ga0373955_0003736
1502 Ga0373961_0446080
1503 Ga0373931_0303386
1504 Ga0373931_1006693
1505 Ga0373935_0011222
1506 Ga0373933_1112392
1507 Ga0373947_0043176
1508 Ga0373947_0913808
1509 Ga0373937_0484815
1510 Ga0373925_0014810
1511 Ga0395898_0175891
1512 Ga0395898_0828135
1513 Ga0395905_0009165
1514 Ga0395901_0718220
1515 Ga0436365_0119969
1516 Ga0439436_0149421
1517 Ga0439453_0137137
1518 Ga0451804_1160570
1519 Ga0451853_3530569
1520 Ga0439431_0142074
1521 Ga0439431_0147528
1522 Ga0439433_0027623
1523 Ga0439441_117542
1524 Ga0439449_0198896
1525 Ga0439449_0380224
1526 Ga0439457_065522
1527 Ga0439462_0067486
1528 Ga0439462_0093437
1529 Ga0450921_006500
1530 Ga0450923_035017
1531 Ga0439446_0082683
1532 Ga0439446_0096045
1533 Ga0439446_0130544
1534 Ga0439446_0171552
1535 Ga0439446_0301250
1536 Ga0439434_0085323
1537 Ga0439435_0225328
1538 Ga0439460_0068606
1539 Ga0439460_0252212
1540 Ga0450916_010513
1541 Ga0466965_0935951
1542 Ga0451576_0144062
1543 Ga0495580_0003700
1544 Ga0495582_0194633
1545 Ga0495639_0231571
1546 Ga0495594_0048032
1547 Ga0495659_0116041
1548 Ga0495669_0003741
1549 Ga0495686_0462972
1550 Ga0496101_0246261
1551 Ga0496102_0074085
1552 Ga0496103_0114979
1553 Ga0496104_0953449
1554 Ga0496105_0041890
1555 Ga0496106_0231579
1556 Ga0496106_1232613
1557 Ga0496108_0129931
1558 Ga0496109_0187789
1559 Ga0496109_0325059
1560 Ga0496109_1490342
1561 Ga0496110_0018180
1562 Ga0496111_0411148
1563 Ga0496112_0384993
1564 Ga0496112_0982564
1565 Ga0496113_0148972
1566 Ga0496113_1597966
1567 Ga0496114_1677490
1568 Ga0496115_0150022
1569 Ga0501292_049762
1570 Ga0501296_031518
1571 Ga0501298_050992
1572 Ga0501299_002316
1573 Ga0501031_0264637
1574 Ga0501033_0545687
1575 Ga0501036_0215263
1576 Ga0501036_0598116
1577 Ga0501037_0336208
1578 Ga0501038_0555830
1579 Ga0501038_0853153
1580 Ga0501038_1081973
1581 Ga0501039_0032531
1582 Ga0501039_0325882
1583 Ga0501040_1193963
1584 Ga0501040_1264715
1585 Ga0501041_0187119
1586 Ga0501042_0415935
1587 Ga0501043_0365959
1588 Ga0501046_0346638
1589 Ga0501048_0030642
1590 Ga0501048_0057040
1591 Ga0501068_0250875
1592 Ga0501071_0037344
1593 Ga0501072_0492328
1594 Ga0501074_1088454
1595 Ga0501075_0119251
1596 Ga0501075_0241404
1597 Ga0501075_0539008
1598 Ga0501076_0052660
1599 Ga0501076_0167828
1600 Ga0501076_1246144
1601 Ga0501076_1741949
1602 Ga0501202_191221
1603 Ga0501210_035290
1604 Ga0501216_004589
1605 Ga0501224_023769
1606 Ga0501249_065617
1607 Ga0501257_070247
1608 Ga0501257_118778
1609 Ga0501257_221030
1610 Ga0501259_070139
1611 Ga0501079_0026890
1612 Ga0501079_1401708
1613 Ga0501080_0287679
1614 Ga0501080_0382138
1615 Ga0501080_1268427
1616 Ga0501081_0162594
1617 Ga0501081_1245080
1618 Ga0501265_033330
1619 Ga0501271_046328
1620 Ga0501276_027757
1621 Ga0501283_025479
1622 Ga0501035_1478449
1623 Ga0501045_0037024
1624 Ga0501045_0173888
1625 Ga0501045_0280898
1626 Ga0501045_1314217
1627 nmdc:mga03683_22334_c1
1628 nmdc:mga03683_8778_c1
1629 nmdc:mga00v17_181583_c1
1630 nmdc:mga00v17_2275_c1
1631 nmdc:mga00v17_43427_c1
1632 nmdc:mga00v17_60235_c1
1633 nmdc:mga0yw44_19051_c1
1634 nmdc:mga0yw44_331971_c1
1635 nmdc:mga0yw44_438494_c1
1636 nmdc:mga0yw44_708575_c1
1637 nmdc:mga0k408_137837_c1
1638 nmdc:mga0k408_1402_c1
1639 nmdc:mga0k408_28241_c1
1640 nmdc:mga06z11_181171_c1
1641 nmdc:mga06z11_221534_c1
1642 nmdc:mga04h51_12961_c1
1643 nmdc:mga04h51_42309_c1
1644 nmdc:mga05p37_1012253_c1
1645 nmdc:mga05p37_1169392_c1
1646 nmdc:mga05p37_119884_c1
1647 nmdc:mga05p37_1241864_c1
1648 nmdc:mga05p37_2033801_c1
1649 nmdc:mga05p37_29297_c1
1650 nmdc:mga05p37_423172_c1
1651 nmdc:mga05p37_485250_c1
1652 nmdc:mga05p37_730712_c1
1653 nmdc:mga09592_119210_c1
1654 nmdc:mga09592_122076_c1
1655 nmdc:mga09592_29725_c2
1656 nmdc:mga09592_317760_c1
1657 nmdc:mga09592_9642_c2
1658 nmdc:mga0qj67_187183_c1
1659 nmdc:mga0qj67_189495_c1
1660 nmdc:mga0qj67_522580_c1
1661 nmdc:mga0qj67_878748_c1
1662 nmdc:mga0qj67_93243_c1
1663 nmdc:mga0qj67_945002_c1
1664 nmdc:mga06r32_1047671_c1
1665 nmdc:mga06r32_1494677_c1
1666 nmdc:mga06r32_1521788_c1
1667 nmdc:mga06r32_213983_c1
1668 nmdc:mga06r32_318118_c1
1669 nmdc:mga06r32_383087_c1
1670 nmdc:mga06r32_41016_c1
1671 nmdc:mga06r32_48081_c1
1672 nmdc:mga06r32_54827_c1
1673 nmdc:mga06r32_6519_c1
1674 nmdc:mga06r32_754432_c1
1675 nmdc:mga06r32_764207_c1
1676 nmdc:mga06r32_8990_c1
1677 nmdc:mga06r32_91784_c1
1678 nmdc:mga08y16_10038_c1
1679 nmdc:mga08y16_1087708_c1
1680 nmdc:mga08y16_161947_c1
1681 nmdc:mga08y16_1821582_c1
1682 nmdc:mga08y16_202152_c1
1683 nmdc:mga08y16_449803_c1
1684 nmdc:mga08y16_73628_c1
1685 nmdc:mga08y16_830_c1
1686 nmdc:mga08y16_860311_c1
1687 nmdc:mga08y16_887009_c1
1688 nmdc:mga0n895_1004636_c1
1689 nmdc:mga0n895_204307_c1
1690 nmdc:mga0n895_570495_c1
1691 nmdc:mga0rr50_1214512_c1
1692 nmdc:mga0rr50_424385_c1
1693 nmdc:mga0rr50_556954_c1
1694 nmdc:mga08x19_430626_c1
1695 nmdc:mga08x19_48925_c1
1696 nmdc:mga0a205_1300576_c1
1697 nmdc:mga0a205_34662_c1
1698 nmdc:mga0a205_38498_c1
1699 nmdc:mga0a205_577189_c1
1700 nmdc:mga0a205_655621_c1
1701 Ga0500595_115724
1702 Ga0501084_0142888
1703 Ga0501084_0679034
1704 Ga0501084_0707502
1705 Ga0501084_1071583
1706 Ga0590071_000630
1707 Ga0590071_020025
1708 Ga0590071_191872
1709 Ga0590074_005790
1710 Ga0590074_010517
1711 Ga0590075_000859
1712 Ga0590077_000681
1713 Ga0590077_001351
1714 Ga0590077_042674
1715 Ga0590077_116015
1716 Ga0501082_0137794
1717 Ga0501082_0845653
1718 Ga0530510_0617413

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

6

68

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o81-assembly1.cif.gz_AU rabbit 80s ribosome colliding in another ribosome stalled by the sars-cov-2 pseudoknot 0.9367 7 59
6zvh-assembly1.cif.gz_i edf1-ribosome complex 0.9353 7 58
3pxp-assembly1.cif.gz_A crystal structure of a pas and dna binding domain containing protein (caur_2278) from chloroflexus aurantiacus j-10-fl at 2.30 a resolution 0.929 16 55
1x57-assembly1.cif.gz_A solution structures of the hth domain of human edf-1 protein 0.9158 7 55
3zkc-assembly1.cif.gz_A crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.9013 7 60
ID Description Score Start End Superfamily
1x57A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9158 7 55 1.10.260.40
3zkcA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9013 7 60 1.10.260.40
3qq6B00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9007 6 59 1.10.260.40
3zkcB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8897 7 60 1.10.260.40
4ybaA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8859 9 56 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A1C0BU77-F1-model_v4 Transcriptional regulator 0.9429 2 66 GO:0003677
AF-A0A0G3H5I4-F1-model_v4 Putative transcriptional regulator 0.9421 2 67 GO:0003677
AF-A0A367Y0R4-F1-model_v4 Helix-turn-helix domain-containing protein 0.9392 2 67 GO:0003677
GO:0016020
AF-A0A4R1UQP1-F1-model_v4 Putative transcriptional regulator 0.9349 2 66 GO:0003677
AF-A0A1H4JGJ5-F1-model_v4 Putative transcriptional regulator 0.9348 1 66 GO:0003677

Map