F483667

General Info

Members Datasets Scaffolds Average Seq Length
856 396 843 404

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0062825|Ga0466966_0062825_836_2044
Length 402
Sequence VKGALEGIKVVELAQIMAGPTCGMLLADMGADVIKVEKLPGGDDTRSYSEPQIAGESAAFMMMNRNKRGIAVNLKTPGGLEVVKRLLADADVVTENYRKGTLEKLGLGYEEVLKALNPRLIYCAISGYGRSGPYADKGGFDLIAQGFAGIMSITGEPGGPPAKSGTSIADINAGILAALGILAAVIAREKTGRGQVVETSLMEAAVQQTFWHAAMFFATGVNPGPTGSAHILTAPYQAFPTRDGWINIGGANQSNWERIVKVIGRPELAQDARFRTNGDRMRNLQALTPLIAERLRERPSADWIRDFEAAGVPVGPVNRIGDMLADPQVAAREMVLEVDHPRVGRMKTLGTPIKFSQTPGAVRRPAPLLGEHTREVLEELGYSGAEVEKLQREGAVFSSPTR

Samples

Sample ID Description Type Environment
1 2643221569 Achromobacter sp. Root565 Isolate Unclassified
2 2643221621 Achromobacter sp. Root83 Isolate Unclassified
3 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
4 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
5 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
6 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
7 2858950400 Achromobacter sp. K91 Isolate Unclassified
8 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
9 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
10 2941479691
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
119 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
197 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
207 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
208 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
209 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
211 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
212 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
213 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
214 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
219 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
220 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
233 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
234 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
235 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
236 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
237 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
253 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
254 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
255 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
256 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
257 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
258 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
259 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
260 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
261 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
262 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
263 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
264 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
265 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
266 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
267 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
268 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
269 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
270 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
271 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
272 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
273 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
274 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
275 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
276 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
277 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
278 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
279 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
280 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
284 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
285 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
286 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
287 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
288 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
292 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
293 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
294 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
295 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
296 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
297 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
298 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
299 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
300 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
301 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
302 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
303 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
304 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
305 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
306 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
307 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
308 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
309 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
310 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
311 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
312 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
313 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
314 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
315 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
316 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
317 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
329 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
332 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
333 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
334 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
335 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
336 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
337 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
338 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
339 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
340 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
341 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
342 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
343 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
355 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
356 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
357 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
358 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
359 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
360 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
361 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
362 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
363 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
364 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
365 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
366 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
367 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
368 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
371 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
372 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
373 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
374 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
375 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
376 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
377 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
378 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
379 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
380 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
381 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
382 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
383 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
384 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
385 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
386 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
387 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
388 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
389 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
390 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
391 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
392 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
393 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
394 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
395 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
396 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 0.12
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.8
Nodule 0.12
Rhizoplane 2.8
Rhizosphere 91
Stem 0
Stem Tuber 0
Unclassified 3.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10009669 3300003187 Bacteria 4546
2 Ga0055536_1000078 3300003781 Bacteria 83510
3 Ga0055534_1003267 3300003784 Bacteria 5170
4 Ga0065712_10153779 3300005290 Bacteria 1350
5 Ga0065715_10093842 3300005293 Bacteria 4518
6 Ga0070658_10023545 3300005327 Bacteria 4941
7 Ga0070683_100030072 3300005329 Bacteria 4925
8 Ga0070683_100035551 3300005329 Bacteria 4554
9 Ga0070690_100004977 3300005330 Bacteria 7438
10 Ga0070690_100025925 3300005330 Bacteria 3612
11 Ga0070670_100004715 3300005331 Bacteria 11440
12 Ga0070670_100033282 3300005331 Bacteria 4440
13 Ga0070670_100162152 3300005331 Bacteria 1938
14 Ga0068869_100009266 3300005334 Bacteria 6382
15 Ga0068869_100026457 3300005334 Bacteria 4039
16 Ga0068869_100045360 3300005334 Bacteria 3164
17 Ga0068869_100055053 3300005334 Bacteria 2898
18 Ga0070680_100012912 3300005336 Bacteria 6497
19 Ga0070680_100070126 3300005336 Bacteria 2879
20 Ga0068868_100002303 3300005338 Bacteria 13210
21 Ga0068868_100140757 3300005338 Bacteria 1980
22 Ga0070660_100066874 3300005339 Bacteria 2799
23 Ga0070660_100071696 3300005339 Bacteria 2705
24 Ga0070689_100013040 3300005340 Bacteria 6004
25 Ga0070689_100058778 3300005340 Bacteria 2987
26 Ga0070689_100179382 3300005340 Bacteria 1720
27 Ga0070691_10017191 3300005341 Bacteria 3329
28 Ga0070687_100041726 3300005343 Bacteria 2320
29 Ga0070687_100070244 3300005343 Bacteria 1878
30 Ga0070661_100000659 3300005344 Bacteria 25350
31 Ga0070661_100007548 3300005344 Bacteria 7503
32 Ga0070661_100047204 3300005344 Bacteria 3151
33 Ga0070661_100067057 3300005344 Bacteria 2637
34 Ga0070692_10000696 3300005345 Bacteria 10820
35 Ga0070692_10009789 3300005345 Bacteria 4338
36 Ga0070692_10027835 3300005345 Bacteria 2806
37 Ga0070668_100014114 3300005347 Bacteria 5971
38 Ga0070668_100112468 3300005347 Bacteria 2168
39 Ga0070669_100002777 3300005353 Bacteria 12628
40 Ga0070671_100113740 3300005355 Bacteria 2275
41 Ga0070673_100159082 3300005364 Bacteria 1919
42 Ga0070688_100028038 3300005365 Bacteria 3358
43 Ga0070688_100041331 3300005365 Bacteria 2829
44 Ga0070688_100150850 3300005365 Bacteria 1589
45 Ga0070659_100002518 3300005366 Bacteria 13010
46 Ga0070659_100066189 3300005366 Bacteria 2863
47 Ga0070659_100086474 3300005366 Bacteria 2509
48 Ga0070667_100090477 3300005367 Bacteria 2630
49 Ga0070667_100098296 3300005367 Bacteria 2526
50 Ga0070703_10008813 3300005406 Bacteria 2841
51 Ga0070703_10043619 3300005406 Bacteria 1407
52 Ga0070709_10028027 3300005434 Bacteria 3356
53 Ga0070714_100001230 3300005435 Bacteria 18485
54 Ga0070714_100004849 3300005435 Bacteria 10213
55 Ga0070714_100012985 3300005435 Bacteria 6662
56 Ga0070714_100027080 3300005435 Bacteria 4743
57 Ga0070713_100000039 3300005436 Bacteria 83384
58 Ga0070713_100010346 3300005436 Bacteria 6737
59 Ga0070713_100094764 3300005436 Bacteria 2574
60 Ga0070713_100103266 3300005436 Bacteria 2473
61 Ga0070710_10056986 3300005437 Bacteria 2213
62 Ga0070701_10000703 3300005438 Bacteria 11831
63 Ga0070701_10059281 3300005438 Bacteria 2012
64 Ga0070711_100014181 3300005439 Bacteria 5017
65 Ga0070711_100122753 3300005439 Bacteria 1924
66 Ga0070705_100000030 3300005440 Bacteria 71489
67 Ga0070700_100001420 3300005441 Bacteria 11926
68 Ga0070700_100007478 3300005441 Bacteria 5903
69 Ga0070700_100024997 3300005441 Bacteria 3513
70 Ga0070694_100002295 3300005444 Bacteria 11315
71 Ga0070694_100057040 3300005444 Bacteria 2654
72 Ga0070708_100041230 3300005445 Bacteria 4047
73 Ga0070708_100048373 3300005445 Bacteria 3758
74 Ga0070708_100109486 3300005445 Bacteria 2538
75 Ga0070663_100002206 3300005455 Bacteria 10895
76 Ga0070662_100002542 3300005457 Bacteria 11237
77 Ga0070662_100039776 3300005457 Bacteria 3345
78 Ga0068867_100006181 3300005459 Bacteria 8479
79 Ga0068867_100043771 3300005459 Bacteria 3278
80 Ga0068867_100141170 3300005459 Bacteria 1883
81 Ga0070707_100135214 3300005468 Bacteria 2398
82 Ga0070699_100029571 3300005518 Bacteria 4724
83 Ga0070699_100039484 3300005518 Bacteria 4086
84 Ga0070699_100072619 3300005518 Bacteria 2993
85 Ga0070679_100088227 3300005530 Bacteria 3089
86 Ga0070679_100106800 3300005530 Bacteria 2785
87 Ga0070679_100161494 3300005530 Bacteria 2215
88 Ga0070679_100190438 3300005530 Bacteria 2020
89 Ga0070684_100029664 3300005535 Bacteria 4638
90 Ga0070672_100018451 3300005543 Bacteria 5044
91 Ga0070672_100048210 3300005543 Bacteria 3309
92 Ga0070686_100016610 3300005544 Bacteria 4284
93 Ga0070686_100043687 3300005544 Bacteria 2813
94 Ga0070695_100000012 3300005545 Bacteria 69784
95 Ga0070696_100000647 3300005546 Bacteria 22250
96 Ga0070696_100033945 3300005546 Bacteria 3508
97 Ga0070693_100000027 3300005547 Bacteria 56179
98 Ga0070693_100008685 3300005547 Bacteria 5027
99 Ga0070693_100045556 3300005547 Bacteria 2487
100 Ga0070665_100033723 3300005548 Bacteria 5150
101 Ga0070665_100112933 3300005548 Bacteria 2720
102 Ga0070704_100038598 3300005549 Bacteria 3273
103 Ga0070704_100055146 3300005549 Bacteria 2816
104 Ga0068855_100002039 3300005563 Bacteria 25044
105 Ga0068855_100006103 3300005563 Bacteria 14694
106 Ga0068855_100007555 3300005563 Bacteria 13153
107 Ga0068855_100026884 3300005563 Bacteria 6885
108 Ga0068855_100066930 3300005563 Bacteria 4187
109 Ga0070664_100000157 3300005564 Bacteria 47128
110 Ga0070664_100000662 3300005564 Bacteria 26301
111 Ga0070664_100071399 3300005564 Bacteria 2975
112 Ga0070664_100166989 3300005564 Bacteria 1950
113 Ga0068857_100002118 3300005577 Bacteria 16141
114 Ga0068857_100009373 3300005577 Bacteria 8498
115 Ga0068854_100022259 3300005578 Bacteria 4314
116 Ga0068854_100110307 3300005578 Bacteria 2074
117 Ga0068856_100001976 3300005614 Bacteria 21379
118 Ga0068856_100003357 3300005614 Bacteria 16236
119 Ga0068856_100008502 3300005614 Bacteria 9983
120 Ga0068856_100079683 3300005614 Bacteria 3248
121 Ga0068856_100094237 3300005614 Bacteria 2981
122 Ga0068856_100178136 3300005614 Bacteria 2138
123 Ga0070702_100010845 3300005615 Bacteria 4509
124 Ga0070702_100028015 3300005615 Bacteria 3048
125 Ga0068852_100000463 3300005616 Bacteria 26797
126 Ga0068852_100000826 3300005616 Bacteria 20462
127 Ga0068852_100123744 3300005616 Bacteria 2372
128 Ga0068852_100175327 3300005616 Bacteria 2013
129 Ga0068859_100000392 3300005617 Bacteria 43640
130 Ga0068859_100134643 3300005617 Bacteria 2543
131 Ga0068859_100188690 3300005617 Bacteria 2145
132 Ga0068864_100021685 3300005618 Bacteria 5380
133 Ga0068864_100030787 3300005618 Bacteria 4550
134 Ga0068866_10000043 3300005718 Bacteria 48570
135 Ga0068866_10007294 3300005718 Bacteria 4628
136 Ga0068861_100001807 3300005719 Bacteria 13779
137 Ga0068861_100034057 3300005719 Bacteria 3764
138 Ga0068861_100036886 3300005719 Bacteria 3631
139 Ga0068861_100127263 3300005719 Bacteria 2063
140 Ga0068851_10000646 3300005834 Bacteria 14832
141 Ga0068851_10005030 3300005834 Bacteria 5996
142 Ga0068851_10006641 3300005834 Bacteria 5293
143 Ga0068851_10015994 3300005834 Bacteria 3583
144 Ga0068870_10024040 3300005840 Bacteria 3012
145 Ga0068863_100028084 3300005841 Bacteria 5371
146 Ga0068863_100038387 3300005841 Bacteria 4556
147 Ga0068863_100040551 3300005841 Bacteria 4427
148 Ga0068863_100071731 3300005841 Bacteria 3276
149 Ga0068858_100031020 3300005842 Bacteria 4964
150 Ga0068858_100117864 3300005842 Bacteria 2482
151 Ga0068860_100003708 3300005843 Bacteria 15716
152 Ga0068860_100026812 3300005843 Bacteria 5552
153 Ga0068860_100048523 3300005843 Bacteria 4047
154 Ga0068860_100103439 3300005843 Bacteria 2718
155 Ga0068862_100015761 3300005844 Bacteria 6281
156 Ga0068862_100051657 3300005844 Bacteria 3516
157 Ga0068862_100064192 3300005844 Bacteria 3161
158 Ga0068862_100203587 3300005844 Bacteria 1786
159 Ga0075364_10028450 3300006051 Bacteria 3578
160 Ga0070712_100026720 3300006175 Bacteria 3849
161 Ga0068871_100000355 3300006358 Bacteria 31904
162 Ga0068871_100009417 3300006358 Bacteria 7075
163 Ga0068871_100115006 3300006358 Bacteria 2267
164 Ga0068871_100154175 3300006358 Bacteria 1960
165 Ga0075428_100000433 3300006844 Bacteria 41623
166 Ga0075428_100017431 3300006844 Bacteria 7937
167 Ga0075430_100033993 3300006846 Bacteria 4326
168 Ga0075430_100138527 3300006846 Bacteria 2027
169 Ga0075431_100012395 3300006847 Bacteria 8604
170 Ga0075433_10009565 3300006852 Bacteria 7752
171 Ga0075434_100030336 3300006871 Bacteria 5324
172 Ga0075434_100275159 3300006871 Bacteria 1703
173 Ga0075429_100000037 3300006880 Bacteria 62099
174 Ga0068865_100001523 3300006881 Bacteria 13522
175 Ga0075436_100000745 3300006914 Bacteria 21546
176 Ga0075436_100090191 3300006914 Bacteria 2131
177 Ga0097620_100000392 3300006931 Bacteria 43640
178 Ga0097620_100134648 3300006931 Bacteria 2543
179 Ga0097620_100188705 3300006931 Bacteria 2145
180 Ga0075435_100037977 3300007076 Bacteria 3838
181 Ga0105240_10004865 3300009093 Bacteria 20216
182 Ga0105240_10006057 3300009093 Bacteria 17866
183 Ga0105240_10007858 3300009093 Bacteria 15392
184 Ga0105240_10017051 3300009093 Bacteria 9808
185 Ga0105240_10137311 3300009093 Bacteria 2927
186 Ga0105240_10156464 3300009093 Bacteria 2710
187 Ga0105240_10203960 3300009093 Bacteria 2316
188 Ga0111539_10002706 3300009094 Bacteria 23507
189 Ga0111539_10036739 3300009094 Bacteria 5919
190 Ga0111539_10060596 3300009094 Bacteria 4485
191 Ga0111539_10296055 3300009094 Bacteria 1883
192 Ga0111539_10321122 3300009094 Bacteria 1802
193 Ga0105245_10000177 3300009098 Bacteria 60854
194 Ga0105245_10019049 3300009098 Bacteria 6007
195 Ga0105245_10051828 3300009098 Bacteria 3679
196 Ga0105245_10246551 3300009098 Bacteria 1734
197 Ga0105245_10252363 3300009098 Bacteria 1714
198 Ga0114129_10001488 3300009147 Bacteria 31713
199 Ga0114129_10486319 3300009147 Bacteria 1614
200 Ga0105243_10000815 3300009148 Bacteria 29736
201 Ga0105243_10023905 3300009148 Bacteria 4657
202 Ga0105243_10239582 3300009148 Bacteria 1613
203 Ga0105241_10008874 3300009174 Bacteria 7394
204 Ga0105241_10011109 3300009174 Bacteria 6606
205 Ga0105242_10000061 3300009176 Bacteria 75148
206 Ga0105242_10041962 3300009176 Bacteria 3692
207 Ga0105242_10051227 3300009176 Bacteria 3364
208 Ga0105248_10001643 3300009177 Bacteria 24867
209 Ga0105248_10024460 3300009177 Bacteria 6715
210 Ga0105248_10439293 3300009177 Bacteria 1470
211 Ga0105237_10008781 3300009545 Bacteria 10901
212 Ga0105237_10037224 3300009545 Bacteria 4919
213 Ga0105237_10497672 3300009545 Bacteria 1225
214 Ga0105238_10174123 3300009551 Bacteria 2128
215 Ga0105238_10243138 3300009551 Bacteria 1777
216 Ga0105249_10038052 3300009553 Bacteria 4365
217 Ga0105249_10450239 3300009553 Bacteria 1326
218 Ga0105246_10118737 3300011119 Bacteria 1956
219 Ga0157373_10001573 3300013100 Bacteria 17415
220 Ga0157371_10002592 3300013102 Bacteria 17154
221 Ga0157371_10016262 3300013102 Bacteria 5557
222 Ga0157371_10032016 3300013102 Bacteria 3786
223 Ga0157371_10074086 3300013102 Bacteria 2411
224 Ga0157370_10001120 3300013104 Bacteria 33464
225 Ga0157370_10010117 3300013104 Bacteria 9961
226 Ga0157370_10011680 3300013104 Bacteria 9168
227 Ga0157370_10016253 3300013104 Bacteria 7540
228 Ga0157370_10063953 3300013104 Bacteria 3484
229 Ga0157370_10189109 3300013104 Bacteria 1911
230 Ga0157369_10004919 3300013105 Bacteria 15662
231 Ga0157369_10018035 3300013105 Bacteria 7919
232 Ga0157369_10018830 3300013105 Bacteria 7737
233 Ga0157369_10080806 3300013105 Bacteria 3480
234 Ga0157369_10222223 3300013105 Bacteria 1977
235 Ga0157374_10003153 3300013296 Bacteria 13861
236 Ga0157378_10006628 3300013297 Bacteria 10120
237 Ga0157378_10211414 3300013297 Bacteria 1839
238 Ga0163162_10024159 3300013306 Bacteria 5998
239 Ga0157372_10001409 3300013307 Bacteria 25953
240 Ga0157372_10004130 3300013307 Bacteria 15553
241 Ga0157372_10009719 3300013307 Bacteria 10230
242 Ga0157372_10019156 3300013307 Bacteria 7369
243 Ga0157372_10028828 3300013307 Bacteria 6059
244 Ga0157372_10105630 3300013307 Bacteria 3221
245 Ga0157372_10353122 3300013307 Bacteria 1713
246 Ga0163163_10029549 3300014325 Bacteria 5274
247 Ga0157380_10005369 3300014326 Bacteria 8954
248 Ga0157380_10027018 3300014326 Bacteria 4361
249 Ga0157380_10041923 3300014326 Bacteria 3575
250 Ga0182008_10056854 3300014497 Bacteria 1932
251 Ga0157377_10001099 3300014745 Bacteria 11433
252 Ga0157377_10011882 3300014745 Bacteria 4359
253 Ga0157377_10021138 3300014745 Bacteria 3419
254 Ga0157379_10006850 3300014968 Bacteria 9851
255 Ga0157379_10034163 3300014968 Bacteria 4532
256 Ga0157376_10009080 3300014969 Bacteria 7203
257 Ga0157376_10023143 3300014969 Bacteria 4858
258 Ga0157376_10023970 3300014969 Bacteria 4786
259 Ga0206356_11263179 3300020070 Bacteria 3204
260 Ga0207673_1005156 3300025290 Bacteria 1586
261 Ga0209675_1000087 3300025291 Bacteria 147632
262 Ga0209676_1000176 3300025292 Bacteria 152347
263 Ga0209025_1000046 3300025294 Bacteria 348962
264 Ga0209564_1000166 3300025295 Bacteria 160208
265 Ga0209564_1001192 3300025295 Bacteria 29807
266 Ga0209050_1009762 3300025298 Bacteria 4847
267 Ga0209051_1019461 3300025303 Bacteria 2960
268 Ga0207697_10006731 3300025315 Bacteria 5172
269 Ga0207656_10007190 3300025321 Bacteria 4045
270 Ga0207656_10069901 3300025321 Bacteria 1558
271 Ga0207682_10002959 3300025893 Bacteria 7456
272 Ga0207688_10002136 3300025901 Bacteria 10623
273 Ga0207699_10023529 3300025906 Bacteria 3353
274 Ga0207699_10120966 3300025906 Bacteria 1693
275 Ga0207645_10100494 3300025907 Bacteria 1866
276 Ga0207643_10001221 3300025908 Bacteria 15187
277 Ga0207705_10006285 3300025909 Bacteria 8819
278 Ga0207705_10008790 3300025909 Bacteria 7363
279 Ga0207684_10012685 3300025910 Bacteria 7316
280 Ga0207707_10016373 3300025912 Bacteria 6466
281 Ga0207707_10171738 3300025912 Bacteria 1894
282 Ga0207707_10219782 3300025912 Bacteria 1654
283 Ga0207695_10016171 3300025913 Bacteria 8749
284 Ga0207695_10024678 3300025913 Bacteria 6754
285 Ga0207695_10063273 3300025913 Bacteria 3815
286 Ga0207695_10281550 3300025913 Bacteria 1556
287 Ga0207671_10031796 3300025914 Bacteria 3931
288 Ga0207693_10016820 3300025915 Bacteria 5838
289 Ga0207693_10086019 3300025915 Bacteria 2463
290 Ga0207663_10071354 3300025916 Bacteria 2241
291 Ga0207663_10100575 3300025916 Bacteria 1941
292 Ga0207660_10000918 3300025917 Bacteria 19431
293 Ga0207662_10000613 3300025918 Bacteria 15965
294 Ga0207662_10000955 3300025918 Bacteria 13409
295 Ga0207662_10013861 3300025918 Bacteria 4512
296 Ga0207657_10000142 3300025919 Bacteria 72309
297 Ga0207657_10002457 3300025919 Bacteria 20027
298 Ga0207657_10018754 3300025919 Bacteria 6590
299 Ga0207657_10037939 3300025919 Bacteria 4296
300 Ga0207649_10079168 3300025920 Bacteria 2122
301 Ga0207652_10069331 3300025921 Bacteria 3061
302 Ga0207652_10099837 3300025921 Bacteria 2562
303 Ga0207652_10120843 3300025921 Bacteria 2330
304 Ga0207646_10034393 3300025922 Bacteria 4579
305 Ga0207681_10000912 3300025923 Bacteria 19295
306 Ga0207681_10026305 3300025923 Bacteria 3752
307 Ga0207694_10006781 3300025924 Bacteria 8697
308 Ga0207694_10010483 3300025924 Bacteria 6990
309 Ga0207694_10014521 3300025924 Bacteria 5938
310 Ga0207694_10072202 3300025924 Bacteria 2698
311 Ga0207650_10253540 3300025925 Bacteria 1425
312 Ga0207659_10041583 3300025926 Bacteria 3219
313 Ga0207687_10001330 3300025927 Bacteria 16893
314 Ga0207687_10002728 3300025927 Bacteria 11957
315 Ga0207700_10000120 3300025928 Bacteria 46325
316 Ga0207700_10100186 3300025928 Bacteria 2308
317 Ga0207700_10140288 3300025928 Bacteria 1985
318 Ga0207700_10211181 3300025928 Bacteria 1641
319 Ga0207664_10004956 3300025929 Bacteria 9058
320 Ga0207664_10008029 3300025929 Bacteria 7338
321 Ga0207664_10034956 3300025929 Bacteria 3874
322 Ga0207664_10041785 3300025929 Bacteria 3574
323 Ga0207644_10002797 3300025931 Bacteria 11244
324 Ga0207644_10041665 3300025931 Bacteria 3249
325 Ga0207644_10065328 3300025931 Bacteria 2646
326 Ga0207690_10045820 3300025932 Bacteria 2892
327 Ga0207706_10002770 3300025933 Bacteria 17037
328 Ga0207706_10033937 3300025933 Bacteria 4542
329 Ga0207706_10034357 3300025933 Bacteria 4511
330 Ga0207706_10182149 3300025933 Bacteria 1845
331 Ga0207686_10023547 3300025934 Bacteria 3558
332 Ga0207686_10027898 3300025934 Bacteria 3312
333 Ga0207686_10089750 3300025934 Bacteria 2026
334 Ga0207709_10010869 3300025935 Bacteria 5014
335 Ga0207709_10017319 3300025935 Bacteria 4020
336 Ga0207709_10027627 3300025935 Bacteria 3271
337 Ga0207709_10179714 3300025935 Bacteria 1493
338 Ga0207670_10017943 3300025936 Bacteria 4288
339 Ga0207670_10034431 3300025936 Bacteria 3273
340 Ga0207670_10060616 3300025936 Bacteria 2578
341 Ga0207670_10077602 3300025936 Bacteria 2314
342 Ga0207670_10115436 3300025936 Bacteria 1942
343 Ga0207669_10048691 3300025937 Bacteria 2520
344 Ga0207669_10146228 3300025937 Bacteria 1649
345 Ga0207704_10000892 3300025938 Bacteria 13241
346 Ga0207704_10010443 3300025938 Bacteria 4531
347 Ga0207704_10060219 3300025938 Bacteria 2348
348 Ga0207665_10008190 3300025939 Bacteria 6901
349 Ga0207665_10063847 3300025939 Bacteria 2502
350 Ga0207691_10001738 3300025940 Bacteria 21476
351 Ga0207691_10006761 3300025940 Bacteria 11060
352 Ga0207691_10032133 3300025940 Bacteria 4895
353 Ga0207711_10000116 3300025941 Bacteria 83390
354 Ga0207711_10007075 3300025941 Bacteria 9402
355 Ga0207711_10010699 3300025941 Bacteria 7630
356 Ga0207711_10050017 3300025941 Bacteria 3578
357 Ga0207689_10000209 3300025942 Bacteria 51679
358 Ga0207689_10076277 3300025942 Bacteria 2756
359 Ga0207689_10084459 3300025942 Bacteria 2610
360 Ga0207661_10099519 3300025944 Bacteria 2439
361 Ga0207679_10002033 3300025945 Bacteria 12549
362 Ga0207679_10018769 3300025945 Bacteria 4639
363 Ga0207679_10163453 3300025945 Bacteria 1825
364 Ga0207667_10000425 3300025949 Bacteria 56804
365 Ga0207667_10015677 3300025949 Bacteria 8596
366 Ga0207667_10035815 3300025949 Bacteria 5323
367 Ga0207667_10049743 3300025949 Bacteria 4425
368 Ga0207667_10084681 3300025949 Bacteria 3282
369 Ga0207667_10170035 3300025949 Bacteria 2240
370 Ga0207667_10245397 3300025949 Bacteria 1832
371 Ga0207651_10040744 3300025960 Bacteria 3077
372 Ga0207651_10178184 3300025960 Bacteria 1683
373 Ga0207651_10211092 3300025960 Bacteria 1563
374 Ga0207712_10077448 3300025961 Bacteria 2410
375 Ga0207712_10240400 3300025961 Bacteria 1458
376 Ga0207668_10006478 3300025972 Bacteria 6924
377 Ga0207668_10037525 3300025972 Bacteria 3244
378 Ga0207668_10044426 3300025972 Bacteria 3022
379 Ga0207640_10107784 3300025981 Bacteria 1968
380 Ga0207640_10138001 3300025981 Bacteria 1773
381 Ga0207640_10150683 3300025981 Bacteria 1708
382 Ga0207658_10076180 3300025986 Bacteria 2554
383 Ga0207658_10105485 3300025986 Bacteria 2217
384 Ga0207677_10000188 3300026023 Bacteria 49751
385 Ga0207677_10021913 3300026023 Bacteria 3915
386 Ga0207677_10069240 3300026023 Bacteria 2481
387 Ga0207677_10179127 3300026023 Bacteria 1666
388 Ga0207703_10004730 3300026035 Bacteria 11109
389 Ga0207703_10052242 3300026035 Bacteria 3317
390 Ga0207703_10075503 3300026035 Bacteria 2794
391 Ga0207639_10012802 3300026041 Bacteria 5853
392 Ga0207639_10051778 3300026041 Bacteria 3125
393 Ga0207639_10277326 3300026041 Bacteria 1473
394 Ga0207678_10001814 3300026067 Bacteria 19568
395 Ga0207678_10005045 3300026067 Bacteria 11846
396 Ga0207678_10068344 3300026067 Bacteria 3049
397 Ga0207678_10139044 3300026067 Bacteria 2072
398 Ga0207708_10000189 3300026075 Bacteria 48580
399 Ga0207708_10001722 3300026075 Bacteria 16178
400 Ga0207708_10003875 3300026075 Bacteria 11011
401 Ga0207708_10020959 3300026075 Bacteria 4932
402 Ga0207708_10127372 3300026075 Bacteria 1988
403 Ga0207702_10002758 3300026078 Bacteria 16441
404 Ga0207702_10002944 3300026078 Bacteria 15907
405 Ga0207702_10042356 3300026078 Bacteria 3819
406 Ga0207641_10011922 3300026088 Bacteria 7131
407 Ga0207641_10041585 3300026088 Bacteria 3852
408 Ga0207648_10000055 3300026089 Bacteria 106101
409 Ga0207648_10000242 3300026089 Bacteria 58883
410 Ga0207648_10000390 3300026089 Bacteria 48543
411 Ga0207648_10038434 3300026089 Bacteria 4211
412 Ga0207648_10273939 3300026089 Bacteria 1508
413 Ga0207676_10000230 3300026095 Bacteria 48620
414 Ga0207676_10011268 3300026095 Bacteria 6388
415 Ga0207676_10069893 3300026095 Bacteria 2813
416 Ga0207676_10308801 3300026095 Bacteria 1447
417 Ga0207674_10000301 3300026116 Bacteria 62588
418 Ga0207674_10000593 3300026116 Bacteria 47678
419 Ga0207674_10001187 3300026116 Bacteria 33877
420 Ga0207674_10015504 3300026116 Bacteria 8370
421 Ga0207674_10040984 3300026116 Bacteria 4792
422 Ga0207675_100000188 3300026118 Bacteria 56065
423 Ga0207675_100001324 3300026118 Bacteria 24798
424 Ga0207675_100003332 3300026118 Bacteria 15727
425 Ga0207675_100056778 3300026118 Bacteria 3651
426 Ga0207683_10001896 3300026121 Bacteria 18497
427 Ga0207683_10005075 3300026121 Bacteria 11294
428 Ga0207698_10000850 3300026142 Bacteria 17735
429 Ga0207698_10001265 3300026142 Bacteria 14771
430 Ga0207698_10025945 3300026142 Bacteria 4139
431 Ga0207698_10067288 3300026142 Bacteria 2824
432 Ga0207698_10117326 3300026142 Bacteria 2245
433 Ga0207698_10163739 3300026142 Bacteria 1949
434 Ga0210000_1003461 3300027462 Bacteria 2275
435 Ga0209999_1010067 3300027543 Bacteria 1708
436 Ga0209970_1001796 3300027614 Bacteria 3716
437 Ga0209970_1006352 3300027614 Bacteria 1936
438 Ga0209971_1003622 3300027682 Bacteria 3658
439 Ga0209974_10005830 3300027876 Bacteria 4318
440 Ga0207428_10003824 3300027907 Bacteria 14441
441 Ga0207428_10052067 3300027907 Bacteria 3271
442 Ga0207428_10058714 3300027907 Bacteria 3052
443 Ga0207428_10077747 3300027907 Bacteria 2598
444 Ga0268265_10003484 3300028380 Bacteria 11283
445 Ga0268265_10011033 3300028380 Bacteria 6102
446 Ga0268265_10034111 3300028380 Bacteria 3707
447 Ga0268264_10000636 3300028381 Bacteria 41794
448 Ga0268264_10060788 3300028381 Bacteria 3167
449 Ga0268264_10061585 3300028381 Bacteria 3148
450 Ga0268264_10131497 3300028381 Bacteria 2219
451 Ga0307515_10039075 3300028794 Bacteria 7564
452 Ga0307509_10012723 3300031507 Bacteria 10028
453 Ga0307509_10106706 3300031507 Bacteria 2818
454 Ga0307408_100019168 3300031548 Bacteria 4604
455 Ga0307408_100109600 3300031548 Bacteria 2118
456 Ga0307408_100186541 3300031548 Bacteria 1668
457 Ga0316579_10012072 3300031691 Bacteria 3688
458 Ga0316578_10005950 3300031728 Bacteria 5972
459 Ga0307516_10010057 3300031730 Bacteria 10463
460 Ga0307405_10020125 3300031731 Bacteria 3723
461 Ga0307413_10013780 3300031824 Bacteria 4080
462 Ga0307410_10084797 3300031852 Bacteria 2234
463 Ga0307412_10000314 3300031911 Bacteria 30725
464 Ga0307416_100005561 3300032002 Bacteria 7760
465 Ga0307416_100008798 3300032002 Bacteria 6548
466 Ga0307414_10085201 3300032004 Bacteria 2327
467 Ga0307411_10066351 3300032005 Bacteria 2424
468 Ga0307411_10268345 3300032005 Bacteria 1352
469 Ga0316583_10015301 3300032133 Bacteria 2760
470 Ga0373952_0005294 3300035092 Bacteria 2354
471 Ga0373932_0000747 3300035112 Bacteria 9705
472 Ga0373936_0001963 3300035113 Bacteria 7605
473 Ga0373941_0014905 3300035115 Bacteria 2086
474 Ga0373945_0006255 3300035116 Bacteria 3834
475 Ga0373953_0028975 3300035117 Bacteria 2139
476 Ga0373954_0000535 3300035118 Bacteria 14204
477 Ga0373956_0009731 3300035119 Bacteria 3915
478 Ga0373957_0053181 3300035120 Bacteria 1553
479 Ga0373943_0001833 3300035170 Bacteria 9609
480 Ga0373943_0007550 3300035170 Bacteria 4883
481 Ga0373946_0002403 3300035171 Bacteria 6619
482 Ga0373942_0029639 3300035207 Bacteria 1438
483 Ga0373961_0000445 3300035241 Bacteria 16770
484 Ga0373924_0091460 3300035410 Bacteria 1302
485 Ga0373931_0000646 3300035691 Bacteria 14394
486 Ga0373931_0016530 3300035691 Bacteria 3633
487 Ga0373931_0035369 3300035691 Bacteria 2597
488 Ga0373935_0004641 3300035692 Bacteria 8075
489 Ga0373935_0090830 3300035692 Bacteria 1999
490 Ga0373927_0001550 3300035695 Bacteria 17254
491 Ga0373927_0006549 3300035695 Bacteria 7934
492 Ga0373927_0044458 3300035695 Bacteria 2874
493 Ga0373927_0067240 3300035695 Bacteria 2319
494 Ga0373947_0016721 3300035725 Bacteria 4215
495 Ga0373947_0022849 3300035725 Bacteria 3630
496 Ga0373937_0037152 3300036401 Bacteria 4439
497 Ga0373937_0107364 3300036401 Bacteria 2596
498 Ga0373937_0220526 3300036401 Bacteria 1785
499 Ga0373925_0010675 3300037068 Bacteria 6660
500 Ga0373925_0011332 3300037068 Bacteria 6471
501 Ga0373925_0013181 3300037068 Bacteria 5984
502 Ga0373925_0052591 3300037068 Bacteria 3043
503 Ga0373925_0053268 3300037068 Bacteria 3024
504 Ga0373925_0077327 3300037068 Bacteria 2525
505 Ga0395899_0000216 3300037312 Bacteria 81683
506 Ga0395905_0020803 3300037471 Bacteria 6213
507 Ga0316581_0000881 3300037588 Bacteria 6342
508 Ga0395901_0000420 3300038443 Bacteria 49952
509 Ga0395901_0126643 3300038443 Bacteria 2684
510 Ga0395901_0206554 3300038443 Bacteria 2057
511 Ga0395901_0232857 3300038443 Bacteria 1923
512 Ga0436365_1401837 3300039437 Bacteria 4155
513 Ga0439441_004573 3300042001 Bacteria 2106
514 Ga0439443_002746 3300042003 Bacteria 2140
515 Ga0450923_014536 3300042125 Bacteria 1462
516 Ga0439435_0006663 3300042436 Bacteria 2603
517 Ga0439460_0000174 3300042461 Bacteria 12145
518 Ga0451577_0084105 3300042876 Bacteria 2839
519 Ga0466966_0062825 3300044684 Bacteria 2341
520 Ga0466957_0002655 3300044842 Bacteria 9651
521 Ga0451576_0010262 3300045051 Bacteria 10764
522 Ga0451576_0012994 3300045051 Bacteria 9329
523 Ga0451576_0241385 3300045051 Bacteria 1887
524 Ga0466958_0029523 3300045836 Bacteria 3254
525 Ga0495603_0014421 3300046455 Bacteria 4779
526 Ga0495603_0080530 3300046455 Bacteria 1908
527 Ga0495591_016393 3300046458 Bacteria 2581
528 Ga0495580_0000377 3300046472 Bacteria 36420
529 Ga0495580_0023285 3300046472 Bacteria 4550
530 Ga0495580_0038625 3300046472 Bacteria 3418
531 Ga0495582_0021917 3300046473 Bacteria 3495
532 Ga0495582_0078502 3300046473 Bacteria 1831
533 Ga0495605_0008415 3300046474 Bacteria 5832
534 Ga0495639_0001938 3300046475 Bacteria 9190
535 Ga0495639_0042502 3300046475 Bacteria 2050
536 Ga0495664_0011476 3300046477 Bacteria 4997
537 Ga0495584_0018299 3300046491 Bacteria 3561
538 Ga0495584_0036250 3300046491 Bacteria 2491
539 Ga0495584_0043753 3300046491 Bacteria 2260
540 Ga0495584_0102846 3300046491 Bacteria 1444
541 Ga0495585_0000070 3300046492 Bacteria 106156
542 Ga0495585_0001644 3300046492 Bacteria 17086
543 Ga0495585_0019103 3300046492 Bacteria 3954
544 Ga0495585_0021650 3300046492 Bacteria 3691
545 Ga0495585_0040026 3300046492 Bacteria 2632
546 Ga0495585_0055089 3300046492 Bacteria 2198
547 Ga0495585_0084830 3300046492 Bacteria 1712
548 Ga0495594_0009981 3300046499 Bacteria 4917
549 Ga0495594_0062827 3300046499 Bacteria 2056
550 Ga0495594_0065233 3300046499 Bacteria 2019
551 Ga0495596_0001001 3300046500 Bacteria 16800
552 Ga0495596_0002689 3300046500 Bacteria 9376
553 Ga0495596_0015806 3300046500 Bacteria 3148
554 Ga0495596_0026656 3300046500 Bacteria 2327
555 Ga0495596_0035726 3300046500 Bacteria 1969
556 Ga0495596_0065904 3300046500 Bacteria 1408
557 Ga0495607_0034192 3300046501 Bacteria 3085
558 Ga0495607_0045259 3300046501 Bacteria 2590
559 Ga0495583_0000134 3300046506 Bacteria 124077
560 Ga0495583_0001580 3300046506 Bacteria 22480
561 Ga0495583_0009231 3300046506 Bacteria 5915
562 Ga0495583_0009664 3300046506 Bacteria 5732
563 Ga0495583_0010587 3300046506 Bacteria 5364
564 Ga0495583_0013569 3300046506 Bacteria 4537
565 Ga0495583_0036365 3300046506 Bacteria 2343
566 Ga0495606_0030648 3300046507 Bacteria 3754
567 Ga0495608_0021651 3300046511 Bacteria 4413
568 Ga0495616_0000012 3300046513 Bacteria 211342
569 Ga0495616_0000113 3300046513 Bacteria 70963
570 Ga0495616_0015822 3300046513 Bacteria 4185
571 Ga0495631_0001082 3300046518 Bacteria 16898
572 Ga0495631_0004546 3300046518 Bacteria 7369
573 Ga0495631_0004936 3300046518 Bacteria 7030
574 Ga0495631_0008084 3300046518 Bacteria 5315
575 Ga0495631_0008226 3300046518 Bacteria 5259
576 Ga0495632_0000367 3300046519 Bacteria 42974
577 Ga0495632_0079468 3300046519 Bacteria 1565
578 Ga0495637_0009338 3300046520 Bacteria 4786
579 Ga0495637_0025465 3300046520 Bacteria 2665
580 Ga0495643_0008333 3300046522 Bacteria 6575
581 Ga0495643_0073302 3300046522 Bacteria 1794
582 Ga0495643_0125933 3300046522 Bacteria 1290
583 Ga0495644_0014028 3300046523 Bacteria 3071
584 Ga0495648_0006825 3300046524 Bacteria 9220
585 Ga0495648_0019489 3300046524 Bacteria 4769
586 Ga0495663_0002150 3300046525 Bacteria 6009
587 Ga0495666_0000394 3300046526 Bacteria 19198
588 Ga0495666_0020361 3300046526 Bacteria 3287
589 Ga0495666_0075288 3300046526 Bacteria 1600
590 Ga0495642_0000091 3300046528 Bacteria 53133
591 Ga0495642_0002475 3300046528 Bacteria 7514
592 Ga0495642_0004009 3300046528 Bacteria 5756
593 Ga0495642_0010964 3300046528 Bacteria 3474
594 Ga0495642_0038915 3300046528 Bacteria 1928
595 Ga0495654_0012265 3300046530 Bacteria 4607
596 Ga0495665_0036044 3300046531 Bacteria 2641
597 Ga0495586_0060934 3300046535 Bacteria 2053
598 Ga0495587_0021535 3300046536 Bacteria 3975
599 Ga0495598_0037753 3300046537 Bacteria 1395
600 Ga0495609_0001797 3300046538 Bacteria 13768
601 Ga0495609_0002536 3300046538 Bacteria 11199
602 Ga0495609_0002601 3300046538 Bacteria 10980
603 Ga0495609_0016822 3300046538 Bacteria 3404
604 Ga0495609_0072573 3300046538 Bacteria 1511
605 Ga0495597_0000178 3300046542 Bacteria 56443
606 Ga0495597_0004568 3300046542 Bacteria 7567
607 Ga0495645_0009193 3300046543 Bacteria 6904
608 Ga0495645_0020341 3300046543 Bacteria 4787
609 Ga0495622_0055307 3300046557 Bacteria 1840
610 Ga0495633_0004285 3300046558 Bacteria 9118
611 Ga0495633_0014419 3300046558 Bacteria 4135
612 Ga0495633_0039431 3300046558 Bacteria 2254
613 Ga0495667_0047134 3300046559 Bacteria 2848
614 Ga0495668_0010568 3300046616 Bacteria 5578
615 Ga0495668_0032388 3300046616 Bacteria 2941
616 Ga0495634_0018844 3300046642 Bacteria 4908
617 Ga0495611_0001951 3300046648 Bacteria 9799
618 Ga0495611_0002422 3300046648 Bacteria 8546
619 Ga0495611_0005937 3300046648 Bacteria 5209
620 Ga0495611_0036228 3300046648 Bacteria 2188
621 Ga0495625_0026412 3300046660 Bacteria 4388
622 Ga0495625_0063066 3300046660 Bacteria 2618
623 Ga0495635_0003526 3300046663 Bacteria 10823
624 Ga0495661_0000430 3300046665 Bacteria 44306
625 Ga0495661_0001062 3300046665 Bacteria 24266
626 Ga0495661_0031020 3300046665 Bacteria 3397
627 Ga0495661_0036234 3300046665 Bacteria 3090
628 Ga0495661_0039486 3300046665 Bacteria 2933
629 Ga0495661_0039678 3300046665 Bacteria 2924
630 Ga0495661_0059789 3300046665 Bacteria 2266
631 Ga0495661_0059876 3300046665 Bacteria 2264
632 Ga0495661_0060772 3300046665 Bacteria 2244
633 Ga0495661_0080296 3300046665 Bacteria 1883
634 Ga0495588_0004981 3300046674 Bacteria 5898
635 Ga0495588_0011773 3300046674 Bacteria 4114
636 Ga0495588_0024204 3300046674 Bacteria 3015
637 Ga0495588_0042123 3300046674 Bacteria 2334
638 Ga0495588_0054536 3300046674 Bacteria 2062
639 Ga0495657_0127421 3300046675 Bacteria 1598
640 Ga0495599_0022795 3300046678 Bacteria 3910
641 Ga0495623_0007657 3300046679 Bacteria 7019
642 Ga0495623_0067407 3300046679 Bacteria 2234
643 Ga0495623_0068239 3300046679 Bacteria 2218
644 Ga0495647_0006673 3300046681 Bacteria 3835
645 Ga0495669_0000013 3300046684 Bacteria 151423
646 Ga0495669_0000796 3300046684 Bacteria 13477
647 Ga0495669_0007185 3300046684 Bacteria 4666
648 Ga0495613_0016231 3300046689 Bacteria 5548
649 Ga0495613_0025151 3300046689 Bacteria 4437
650 Ga0495670_0000358 3300046691 Bacteria 21761
651 Ga0495670_0006944 3300046691 Bacteria 5576
652 Ga0495670_0010238 3300046691 Bacteria 4610
653 Ga0495670_0012060 3300046691 Bacteria 4253
654 Ga0495670_0012394 3300046691 Bacteria 4192
655 Ga0495670_0022806 3300046691 Bacteria 3091
656 Ga0495670_0023288 3300046691 Bacteria 3057
657 Ga0495671_0033144 3300046692 Bacteria 2633
658 Ga0495649_0050677 3300046694 Bacteria 2252
659 Ga0495589_0009864 3300046794 Bacteria 4962
660 Ga0495589_0010799 3300046794 Bacteria 4746
661 Ga0495589_0055975 3300046794 Bacteria 1942
662 Ga0495589_0080908 3300046794 Bacteria 1580
663 Ga0495600_0024300 3300046809 Bacteria 3900
664 Ga0495660_0009175 3300046810 Bacteria 5778
665 Ga0495660_0021301 3300046810 Bacteria 3713
666 Ga0495581_0010438 3300047315 Bacteria 5371
667 Ga0495604_0159079 3300047317 Bacteria 1597
668 Ga0495636_0011491 3300047318 Bacteria 3504
669 Ga0495636_0012632 3300047318 Bacteria 3345
670 Ga0495674_0081609 3300047319 Bacteria 2774
671 Ga0495672_0003849 3300047320 Bacteria 12621
672 Ga0495672_0063028 3300047320 Bacteria 2129
673 Ga0495676_0001263 3300047321 Bacteria 21712
674 Ga0495676_0053979 3300047321 Bacteria 3198
675 Ga0495676_0059705 3300047321 Bacteria 2993
676 Ga0495680_0089067 3300047322 Bacteria 2317
677 Ga0495683_0058034 3300047323 Bacteria 1923
678 Ga0495687_000002 3300047443 Bacteria 1085770
679 Ga0495687_000007 3300047443 Bacteria 552679
680 Ga0495675_0080182 3300047444 Bacteria 2056
681 Ga0495677_0000973 3300047445 Bacteria 11529
682 Ga0495677_0005202 3300047445 Bacteria 4949
683 Ga0495677_0038111 3300047445 Bacteria 1756
684 Ga0495679_017472 3300047446 Bacteria 2566
685 Ga0495679_022101 3300047446 Bacteria 2183
686 Ga0495679_027379 3300047446 Bacteria 1881
687 Ga0495685_001302 3300047447 Bacteria 7615
688 Ga0495673_0080279 3300047469 Bacteria 1352
689 Ga0495681_0000005 3300047470 Bacteria 225279
690 Ga0495681_0001386 3300047470 Bacteria 18292
691 Ga0495681_0032603 3300047470 Bacteria 2620
692 Ga0495681_0037363 3300047470 Bacteria 2392
693 Ga0495681_0037870 3300047470 Bacteria 2370
694 Ga0495684_0028581 3300047471 Bacteria 4280
695 Ga0495686_0000357 3300047472 Bacteria 74707
696 Ga0495686_0022306 3300047472 Bacteria 4190
697 Ga0495602_0009695 3300048088 Bacteria 10004
698 Ga0495602_0128278 3300048088 Bacteria 2028
699 Ga0495614_0010091 3300048089 Bacteria 4168
700 Ga0495614_0031656 3300048089 Bacteria 2277
701 Ga0495615_0000692 3300048090 Bacteria 4693
702 Ga0495615_0002390 3300048090 Bacteria 3007
703 Ga0495626_0000384 3300048091 Bacteria 45806
704 Ga0495626_0000792 3300048091 Bacteria 28683
705 Ga0495626_0003679 3300048091 Bacteria 9719
706 Ga0495626_0004165 3300048091 Bacteria 8977
707 Ga0495626_0017324 3300048091 Bacteria 3640
708 Ga0496102_0000318 3300048905 Bacteria 60368
709 Ga0496102_0010080 3300048905 Bacteria 8130
710 Ga0496103_0026102 3300048906 Bacteria 3535
711 Ga0496103_0092206 3300048906 Bacteria 1912
712 Ga0496104_0009253 3300048907 Bacteria 8761
713 Ga0496104_0222813 3300048907 Bacteria 1798
714 Ga0496105_0012504 3300048908 Bacteria 6720
715 Ga0496105_0069900 3300048908 Bacteria 2902
716 Ga0496106_0008585 3300048909 Bacteria 7558
717 Ga0496107_0055618 3300048910 Bacteria 2858
718 Ga0496107_0063772 3300048910 Bacteria 2670
719 Ga0496108_0042748 3300048911 Bacteria 3784
720 Ga0496109_0021784 3300048912 Bacteria 5672
721 Ga0496109_0069956 3300048912 Bacteria 3220
722 Ga0496109_0386059 3300048912 Bacteria 1323
723 Ga0496110_0001834 3300048913 Bacteria 15666
724 Ga0496110_0003288 3300048913 Bacteria 12334
725 Ga0496111_0069539 3300048914 Bacteria 2560
726 Ga0496112_0000303 3300048915 Bacteria 31772
727 Ga0496112_0038487 3300048915 Bacteria 4670
728 Ga0496112_0090875 3300048915 Bacteria 3022
729 Ga0496112_0207203 3300048915 Bacteria 1918
730 Ga0496113_0001648 3300048916 Bacteria 12591
731 Ga0496115_0007489 3300048918 Bacteria 8035
732 Ga0496116_0013599 3300048919 Bacteria 6547
733 Ga0496118_0023565 3300048921 Bacteria 5342
734 Ga0496119_0029332 3300048922 Bacteria 3733
735 Ga0496120_0069419 3300048923 Bacteria 1940
736 Ga0496121_0000568 3300048924 Bacteria 69617
737 Ga0496121_0012358 3300048924 Bacteria 9334
738 Ga0496122_0000263 3300048925 Bacteria 117762
739 Ga0496122_0079038 3300048925 Bacteria 2301
740 Ga0496122_0146633 3300048925 Bacteria 1465
741 Ga0496123_0000156 3300048926 Bacteria 139362
742 Ga0496124_0000007 3300048927 Bacteria 883534
743 Ga0496124_0107697 3300048927 Bacteria 2248
744 Ga0496125_0000105 3300048928 Bacteria 200717
745 Ga0496125_0000669 3300048928 Bacteria 57185
746 Ga0496126_0170478 3300048929 Bacteria 1854
747 Ga0495678_000024 3300049459 Bacteria 229034
748 Ga0495682_0002293 3300049460 Bacteria 9142
749 Ga0495682_0010895 3300049460 Bacteria 3504
750 Ga0495682_0013860 3300049460 Bacteria 3061
751 Ga0501031_0032599 3300049568 Bacteria 3397
752 Ga0501033_0028336 3300049570 Bacteria 4208
753 Ga0501033_0116690 3300049570 Bacteria 1939
754 Ga0501038_0001109 3300049574 Bacteria 24402
755 Ga0501038_0043315 3300049574 Bacteria 3914
756 Ga0501039_0013343 3300049575 Bacteria 6282
757 Ga0501039_0015991 3300049575 Bacteria 5745
758 Ga0501039_0160631 3300049575 Bacteria 1766
759 Ga0501040_0001909 3300049576 Bacteria 13402
760 Ga0501040_0012550 3300049576 Bacteria 5552
761 Ga0501041_0003730 3300049577 Bacteria 8760
762 Ga0501041_0025244 3300049577 Bacteria 3572
763 Ga0501042_0000383 3300049578 Bacteria 22452
764 Ga0501042_0064499 3300049578 Bacteria 2617
765 Ga0501043_0078692 3300049579 Bacteria 2591
766 Ga0501046_0001197 3300049580 Bacteria 25219
767 Ga0501047_0004365 3300049581 Bacteria 13305
768 Ga0501047_0103185 3300049581 Bacteria 2731
769 Ga0501048_0104738 3300049582 Bacteria 1996
770 Ga0501068_0033760 3300049584 Bacteria 3049
771 Ga0501068_0046140 3300049584 Bacteria 2627
772 Ga0501069_0024971 3300049585 Bacteria 3263
773 Ga0501070_0011981 3300049586 Bacteria 7317
774 Ga0501071_0020152 3300049587 Bacteria 4633
775 Ga0501071_0025763 3300049587 Bacteria 4121
776 Ga0501072_0002470 3300049588 Bacteria 13847
777 Ga0501072_0008401 3300049588 Bacteria 7838
778 Ga0501072_0054304 3300049588 Bacteria 3156
779 Ga0501073_0001346 3300049589 Bacteria 18103
780 Ga0501073_0149753 3300049589 Bacteria 1617
781 Ga0501074_0001670 3300049590 Bacteria 15110
782 Ga0501074_0053513 3300049590 Bacteria 2911
783 Ga0501075_0000525 3300049591 Bacteria 23161
784 Ga0501075_0002429 3300049591 Bacteria 12398
785 Ga0501076_0003906 3300049592 Bacteria 10504
786 Ga0501076_0013583 3300049592 Bacteria 6108
787 Ga0501077_0031416 3300049593 Bacteria 3378
788 Ga0501079_0000625 3300049741 Bacteria 23469
789 Ga0501079_0013856 3300049741 Bacteria 6150
790 Ga0501079_0014247 3300049741 Bacteria 6062
791 Ga0501080_0038003 3300049742 Bacteria 4496
792 Ga0501080_0110457 3300049742 Bacteria 2548
793 Ga0501080_0152085 3300049742 Bacteria 2138
794 Ga0501081_0000055 3300049743 Bacteria 43227
795 Ga0501081_0003584 3300049743 Bacteria 9931
796 Ga0501083_0004033 3300049744 Bacteria 10324
797 Ga0501083_0077415 3300049744 Bacteria 2207
798 Ga0501035_0002928 3300049822 Bacteria 16434
799 Ga0501035_0012650 3300049822 Bacteria 7798
800 Ga0501044_0002559 3300049823 Bacteria 20710
801 Ga0501044_0014152 3300049823 Bacteria 8613
802 Ga0501044_0049886 3300049823 Bacteria 4321
803 Ga0501044_0065389 3300049823 Bacteria 3709
804 Ga0501045_0000901 3300049824 Bacteria 19335
805 Ga0501045_0008515 3300049824 Bacteria 7149
806 nmdc:mga00v17_22490_c1 3300050491 Bacteria 3637
807 nmdc:mga00v17_5230_c1 3300050491 Bacteria 6833
808 nmdc:mga05p37_387_c1 3300050507 Bacteria 47694
809 nmdc:mga09592_17457_c1 3300050508 Bacteria 5880
810 nmdc:mga09592_212_c1 3300050508 Bacteria 41841
811 nmdc:mga09592_83861_c1 3300050508 Bacteria 2717
812 nmdc:mga0qj67_1416_c1 3300050509 Bacteria 16782
813 nmdc:mga0qj67_158294_c1 3300050509 Bacteria 1839
814 nmdc:mga0qj67_56027_c1 3300050509 Bacteria 3124
815 nmdc:mga06r32_357105_c1 3300050510 Bacteria 1446
816 nmdc:mga08y16_4065_c1 3300050511 Bacteria 15279
817 nmdc:mga08y16_76703_c1 3300050511 Bacteria 3484
818 nmdc:mga08y16_8133_c1 3300050511 Bacteria 10971
819 nmdc:mga08y16_95983_c1 3300050511 Bacteria 3088
820 nmdc:mga0n895_21679_c1 3300050512 Bacteria 6013
821 nmdc:mga0n895_354398_c1 3300050512 Bacteria 1486
822 nmdc:mga08x19_352_c1 3300050514 Bacteria 33219
823 nmdc:mga08x19_97140_c1 3300050514 Bacteria 1950
824 Ga0500635_0014303 3300053080 Bacteria 2322
825 Ga0495595_0014569 3300053084 Bacteria 3340
826 Ga0495619_0004815 3300053085 Bacteria 8567
827 Ga0495619_0037876 3300053085 Bacteria 3145
828 Ga0500566_0002758 3300053094 Bacteria 10468
829 Ga0500566_0011675 3300053094 Bacteria 5172
830 Ga0500640_004928 3300053095 Bacteria 4910
831 Ga0500554_000602 3300053102 Bacteria 7324
832 Ga0500572_000814 3300053111 Bacteria 9889
833 Ga0500595_000093 3300053119 Bacteria 61798
834 Ga0500614_000153 3300053123 Bacteria 17434
835 Ga0500559_0012960 3300053136 Bacteria 3537
836 Ga0500564_043896 3300053138 Bacteria 2055
837 Ga0500636_0033621 3300053177 Bacteria 3035
838 Ga0501084_0002498 3300054114 Bacteria 14797
839 Ga0501084_0101631 3300054114 Bacteria 2414
840 Ga0501082_0008950 3300060353 Bacteria 8640
841 Ga0501082_0051361 3300060353 Bacteria 3553
842 Ga0530510_0001004 3300061734 Bacteria 18744
843 Ga0530510_0001019 3300061734 Bacteria 18576

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10497672 Ga0105237_104976721 348
2 3300053138 Ga0500564_043896 Ga0500564_043896_893_2041 382
3 3300047470 Ga0495681_0032603 Ga0495681_0032603_460_1692 383
4 3300048091 Ga0495626_0000792 Ga0495626_0000792_8233_9465 383
5 3300013104 Ga0157370_10189109 Ga0157370_101891092 385
6 3300013105 Ga0157369_10018035 Ga0157369_100180359 385
7 3300013307 Ga0157372_10353122 Ga0157372_103531221 385
8 3300046674 Ga0495588_0054536 Ga0495588_0054536_20_1177 385
9 3300048090 Ga0495615_0002390 Ga0495615_0002390_1345_2574 385
10 3300005543 Ga0070672_100018451 Ga0070672_1000184517 389
11 3300005563 Ga0068855_100006103 Ga0068855_10000610312 389
12 3300009177 Ga0105248_10001643 Ga0105248_1000164313 389
13 3300025941 Ga0207711_10007075 Ga0207711_100070756 389
14 3300025949 Ga0207667_10015677 Ga0207667_100156775 389
15 3300025907 Ga0207645_10100494 Ga0207645_101004942 390
16 3300027682 Ga0209971_1003622 Ga0209971_10036224 390
17 3300027876 Ga0209974_10005830 Ga0209974_100058305 390
18 3300046528 Ga0495642_0002475 Ga0495642_0002475_3202_4434 391
19 3300048918 Ga0496115_0007489 Ga0496115_0007489_2747_3979 391
20 3300050491 nmdc:mga00v17_5230_c1 nmdc:mga00v17_5230_c1_599_1804 391
21 3300005347 Ga0070668_100112468 Ga0070668_1001124681 392
22 3300005843 Ga0068860_100026812 Ga0068860_1000268125 392
23 3300005844 Ga0068862_100203587 Ga0068862_1002035872 392
24 3300025972 Ga0207668_10037525 Ga0207668_100375252 392
25 3300032005 Ga0307411_10268345 Ga0307411_102683451 392
26 3300036401 Ga0373937_0220526 Ga0373937_0220526_218_1396 392
27 3300048906 Ga0496103_0026102 Ga0496103_0026102_134_1312 392
28 3300050512 nmdc:mga0n895_21679_c1 nmdc:mga0n895_21679_c1_1810_2988 392
29 3300009093 Ga0105240_10203960 Ga0105240_102039601 393
30 3300038443 Ga0395901_0126643 Ga0395901_0126643_1099_2286 393
31 3300048915 Ga0496112_0000303 Ga0496112_0000303_3080_4306 393
32 3300025961 Ga0207712_10240400 Ga0207712_102404002 394
33 3300031548 Ga0307408_100109600 Ga0307408_1001096002 394
34 3300031691 Ga0316579_10012072 Ga0316579_100120722 394
35 3300031728 Ga0316578_10005950 Ga0316578_100059503 394
36 3300032133 Ga0316583_10015301 Ga0316583_100153012 394
37 3300035695 Ga0373927_0067240 Ga0373927_0067240_540_1727 394
38 3300037068 Ga0373925_0053268 Ga0373925_0053268_489_1676 394
39 3300037588 Ga0316581_0000881 Ga0316581_0000881_1252_2439 394
40 3300046458 Ga0495591_016393 Ga0495591_016393_939_2123 394
41 3300046472 Ga0495580_0023285 Ga0495580_0023285_1861_3045 394
42 3300046473 Ga0495582_0021917 Ga0495582_0021917_1138_2322 394
43 3300046474 Ga0495605_0008415 Ga0495605_0008415_2950_4134 394
44 3300046492 Ga0495585_0001644 Ga0495585_0001644_1774_2958 394
45 3300046492 Ga0495585_0040026 Ga0495585_0040026_849_2033 394
46 3300046500 Ga0495596_0015806 Ga0495596_0015806_1587_2771 394
47 3300046500 Ga0495596_0035726 Ga0495596_0035726_762_1946 394
48 3300046500 Ga0495596_0065904 Ga0495596_0065904_187_1371 394
49 3300046501 Ga0495607_0034192 Ga0495607_0034192_827_2011 394
50 3300046506 Ga0495583_0009664 Ga0495583_0009664_3840_5024 394
51 3300046506 Ga0495583_0013569 Ga0495583_0013569_186_1370 394
52 3300046507 Ga0495606_0030648 Ga0495606_0030648_41_1225 394
53 3300046513 Ga0495616_0000012 Ga0495616_0000012_30388_31572 394
54 3300046513 Ga0495616_0015822 Ga0495616_0015822_658_1842 394
55 3300046518 Ga0495631_0001082 Ga0495631_0001082_10123_11307 394
56 3300046518 Ga0495631_0004546 Ga0495631_0004546_5221_6405 394
57 3300046518 Ga0495631_0004936 Ga0495631_0004936_3021_4205 394
58 3300046518 Ga0495631_0008084 Ga0495631_0008084_837_2021 394
59 3300046519 Ga0495632_0000367 Ga0495632_0000367_33927_35111 394
60 3300046520 Ga0495637_0009338 Ga0495637_0009338_2649_3833 394
61 3300046522 Ga0495643_0125933 Ga0495643_0125933_95_1279 394
62 3300046524 Ga0495648_0006825 Ga0495648_0006825_2107_3291 394
63 3300046524 Ga0495648_0019489 Ga0495648_0019489_2164_3348 394
64 3300046526 Ga0495666_0000394 Ga0495666_0000394_2232_3416 394
65 3300046526 Ga0495666_0020361 Ga0495666_0020361_728_1912 394
66 3300046528 Ga0495642_0000091 Ga0495642_0000091_33456_34640 394
67 3300046528 Ga0495642_0010964 Ga0495642_0010964_1063_2247 394
68 3300046528 Ga0495642_0038915 Ga0495642_0038915_558_1742 394
69 3300046530 Ga0495654_0012265 Ga0495654_0012265_1361_2545 394
70 3300046538 Ga0495609_0001797 Ga0495609_0001797_11347_12531 394
71 3300046538 Ga0495609_0002601 Ga0495609_0002601_7641_8825 394
72 3300046538 Ga0495609_0016822 Ga0495609_0016822_1617_2801 394
73 3300046538 Ga0495609_0072573 Ga0495609_0072573_35_1219 394
74 3300046542 Ga0495597_0000178 Ga0495597_0000178_43281_44465 394
75 3300046542 Ga0495597_0004568 Ga0495597_0004568_4835_6019 394
76 3300046558 Ga0495633_0004285 Ga0495633_0004285_2097_3281 394
77 3300046616 Ga0495668_0010568 Ga0495668_0010568_3338_4522 394
78 3300046642 Ga0495634_0018844 Ga0495634_0018844_2131_3315 394
79 3300046648 Ga0495611_0001951 Ga0495611_0001951_6354_7538 394
80 3300046648 Ga0495611_0036228 Ga0495611_0036228_338_1522 394
81 3300046660 Ga0495625_0026412 Ga0495625_0026412_2116_3300 394
82 3300046660 Ga0495625_0063066 Ga0495625_0063066_803_1987 394
83 3300046665 Ga0495661_0000430 Ga0495661_0000430_28927_30111 394
84 3300046665 Ga0495661_0001062 Ga0495661_0001062_12301_13485 394
85 3300046665 Ga0495661_0039678 Ga0495661_0039678_1107_2291 394
86 3300046665 Ga0495661_0059789 Ga0495661_0059789_762_1946 394
87 3300046665 Ga0495661_0080296 Ga0495661_0080296_288_1472 394
88 3300046674 Ga0495588_0004981 Ga0495588_0004981_3186_4370 394
89 3300046674 Ga0495588_0024204 Ga0495588_0024204_1012_2196 394
90 3300046679 Ga0495623_0007657 Ga0495623_0007657_4394_5578 394
91 3300046684 Ga0495669_0000796 Ga0495669_0000796_3230_4414 394
92 3300046684 Ga0495669_0007185 Ga0495669_0007185_2580_3764 394
93 3300046691 Ga0495670_0000358 Ga0495670_0000358_5132_6316 394
94 3300046691 Ga0495670_0012060 Ga0495670_0012060_1007_2191 394
95 3300046691 Ga0495670_0012394 Ga0495670_0012394_2449_3633 394
96 3300046691 Ga0495670_0023288 Ga0495670_0023288_1519_2703 394
97 3300046692 Ga0495671_0033144 Ga0495671_0033144_862_2046 394
98 3300046794 Ga0495589_0009864 Ga0495589_0009864_3637_4821 394
99 3300046794 Ga0495589_0010799 Ga0495589_0010799_3119_4303 394
100 3300046809 Ga0495600_0024300 Ga0495600_0024300_1023_2207 394
101 3300046810 Ga0495660_0009175 Ga0495660_0009175_3587_4771 394
102 3300046810 Ga0495660_0021301 Ga0495660_0021301_290_1474 394
103 3300047320 Ga0495672_0003849 Ga0495672_0003849_1202_2386 394
104 3300047320 Ga0495672_0063028 Ga0495672_0063028_571_1755 394
105 3300047443 Ga0495687_000002 Ga0495687_000002_305949_307133 394
106 3300047443 Ga0495687_000007 Ga0495687_000007_402507_403691 394
107 3300047445 Ga0495677_0000973 Ga0495677_0000973_9712_10896 394
108 3300047446 Ga0495679_017472 Ga0495679_017472_1041_2225 394
109 3300047446 Ga0495679_022101 Ga0495679_022101_466_1650 394
110 3300047446 Ga0495679_027379 Ga0495679_027379_124_1308 394
111 3300047447 Ga0495685_001302 Ga0495685_001302_6382_7566 394
112 3300047470 Ga0495681_0000005 Ga0495681_0000005_180991_182175 394
113 3300047470 Ga0495681_0001386 Ga0495681_0001386_3240_4424 394
114 3300047472 Ga0495686_0000357 Ga0495686_0000357_16964_18148 394
115 3300047472 Ga0495686_0022306 Ga0495686_0022306_2037_3221 394
116 3300048088 Ga0495602_0009695 Ga0495602_0009695_3545_4729 394
117 3300048091 Ga0495626_0003679 Ga0495626_0003679_970_2154 394
118 3300048091 Ga0495626_0004165 Ga0495626_0004165_6854_8038 394
119 3300048091 Ga0495626_0017324 Ga0495626_0017324_648_1832 394
120 3300048905 Ga0496102_0000318 Ga0496102_0000318_15428_16612 394
121 3300048912 Ga0496109_0021784 Ga0496109_0021784_3196_4380 394
122 3300048915 Ga0496112_0090875 Ga0496112_0090875_47_1231 394
123 3300048916 Ga0496113_0001648 Ga0496113_0001648_6859_8043 394
124 3300048925 Ga0496122_0000263 Ga0496122_0000263_99283_100467 394
125 3300048926 Ga0496123_0000156 Ga0496123_0000156_42686_43870 394
126 3300048927 Ga0496124_0107697 Ga0496124_0107697_836_2020 394
127 3300048928 Ga0496125_0000669 Ga0496125_0000669_38480_39664 394
128 3300049459 Ga0495678_000024 Ga0495678_000024_16278_17462 394
129 3300049460 Ga0495682_0002293 Ga0495682_0002293_3567_4751 394
130 3300049460 Ga0495682_0013860 Ga0495682_0013860_1054_2238 394
131 3300049570 Ga0501033_0116690 Ga0501033_0116690_525_1709 394
132 3300049576 Ga0501040_0012550 Ga0501040_0012550_3374_4561 394
133 3300049578 Ga0501042_0064499 Ga0501042_0064499_921_2108 394
134 3300049823 Ga0501044_0002559 Ga0501044_0002559_13622_14806 394
135 3300049823 Ga0501044_0065389 Ga0501044_0065389_914_2098 394
136 3300006051 Ga0075364_10028450 Ga0075364_100284504 395
137 3300006846 Ga0075430_100033993 Ga0075430_1000339932 395
138 3300009094 Ga0111539_10060596 Ga0111539_100605964 395
139 3300027462 Ga0210000_1003461 Ga0210000_10034612 395
140 3300027543 Ga0209999_1010067 Ga0209999_10100671 395
141 3300027614 Ga0209970_1006352 Ga0209970_10063522 395
142 3300027907 Ga0207428_10077747 Ga0207428_100777472 395
143 3300032002 Ga0307416_100008798 Ga0307416_1000087985 395
144 3300035118 Ga0373954_0000535 Ga0373954_0000535_2488_3678 395
145 3300036401 Ga0373937_0107364 Ga0373937_0107364_1082_2272 395
146 3300042003 Ga0439443_002746 Ga0439443_002746_81_1271 395
147 3300042436 Ga0439435_0006663 Ga0439435_0006663_331_1521 395
148 3300042461 Ga0439460_0000174 Ga0439460_0000174_3963_5153 395
149 3300049574 Ga0501038_0043315 Ga0501038_0043315_433_1623 395
150 3300049575 Ga0501039_0013343 Ga0501039_0013343_1464_2654 395
151 3300049577 Ga0501041_0025244 Ga0501041_0025244_608_1798 395
152 3300049579 Ga0501043_0078692 Ga0501043_0078692_616_1806 395
153 3300049587 Ga0501071_0025763 Ga0501071_0025763_2446_3636 395
154 3300049588 Ga0501072_0008401 Ga0501072_0008401_4443_5633 395
155 3300049588 Ga0501072_0054304 Ga0501072_0054304_214_1404 395
156 3300049589 Ga0501073_0149753 Ga0501073_0149753_184_1374 395
157 3300049591 Ga0501075_0002429 Ga0501075_0002429_2342_3532 395
158 3300049592 Ga0501076_0003906 Ga0501076_0003906_8739_9929 395
159 3300049741 Ga0501079_0013856 Ga0501079_0013856_579_1769 395
160 3300049742 Ga0501080_0038003 Ga0501080_0038003_1698_2888 395
161 3300049743 Ga0501081_0003584 Ga0501081_0003584_7483_8673 395
162 3300049824 Ga0501045_0008515 Ga0501045_0008515_3633_4823 395
163 3300050491 nmdc:mga00v17_22490_c1 nmdc:mga00v17_22490_c1_1706_2896 395
164 3300050511 nmdc:mga08y16_4065_c1 nmdc:mga08y16_4065_c1_11116_12306 395
165 3300050514 nmdc:mga08x19_352_c1 nmdc:mga08x19_352_c1_21148_22335 395
166 3300054114 Ga0501084_0101631 Ga0501084_0101631_570_1760 395
167 3300060353 Ga0501082_0051361 Ga0501082_0051361_958_2148 395
168 3300061734 Ga0530510_0001019 Ga0530510_0001019_12307_13497 395
169 3300005327 Ga0070658_10023545 Ga0070658_100235452 396
170 3300005330 Ga0070690_100025925 Ga0070690_1000259253 396
171 3300005331 Ga0070670_100162152 Ga0070670_1001621522 396
172 3300005334 Ga0068869_100055053 Ga0068869_1000550533 396
173 3300005338 Ga0068868_100140757 Ga0068868_1001407572 396
174 3300005339 Ga0070660_100071696 Ga0070660_1000716962 396
175 3300005340 Ga0070689_100179382 Ga0070689_1001793822 396
176 3300005343 Ga0070687_100070244 Ga0070687_1000702442 396
177 3300005345 Ga0070692_10009789 Ga0070692_100097892 396
178 3300005345 Ga0070692_10027835 Ga0070692_100278352 396
179 3300005347 Ga0070668_100014114 Ga0070668_1000141143 396
180 3300005365 Ga0070688_100150850 Ga0070688_1001508501 396
181 3300005367 Ga0070667_100090477 Ga0070667_1000904773 396
182 3300005406 Ga0070703_10043619 Ga0070703_100436192 396
183 3300005436 Ga0070713_100000039 Ga0070713_10000003966 396
184 3300005436 Ga0070713_100094764 Ga0070713_1000947643 396
185 3300005436 Ga0070713_100103266 Ga0070713_1001032662 396
186 3300005438 Ga0070701_10059281 Ga0070701_100592812 396
187 3300005439 Ga0070711_100014181 Ga0070711_1000141812 396
188 3300005441 Ga0070700_100007478 Ga0070700_1000074783 396
189 3300005445 Ga0070708_100048373 Ga0070708_1000483732 396
190 3300005445 Ga0070708_100109486 Ga0070708_1001094863 396
191 3300005457 Ga0070662_100039776 Ga0070662_1000397763 396
192 3300005459 Ga0068867_100006181 Ga0068867_1000061817 396
193 3300005468 Ga0070707_100135214 Ga0070707_1001352141 396
194 3300005518 Ga0070699_100072619 Ga0070699_1000726193 396
195 3300005530 Ga0070679_100161494 Ga0070679_1001614942 396
196 3300005543 Ga0070672_100048210 Ga0070672_1000482102 396
197 3300005544 Ga0070686_100043687 Ga0070686_1000436872 396
198 3300005547 Ga0070693_100008685 Ga0070693_1000086854 396
199 3300005548 Ga0070665_100112933 Ga0070665_1001129333 396
200 3300005616 Ga0068852_100000463 Ga0068852_10000046318 396
201 3300005617 Ga0068859_100188690 Ga0068859_1001886902 396
202 3300005719 Ga0068861_100001807 Ga0068861_10000180710 396
203 3300005719 Ga0068861_100127263 Ga0068861_1001272631 396
204 3300005834 Ga0068851_10000646 Ga0068851_100006465 396
205 3300005844 Ga0068862_100015761 Ga0068862_1000157616 396
206 3300006175 Ga0070712_100026720 Ga0070712_1000267203 396
207 3300006358 Ga0068871_100009417 Ga0068871_1000094171 396
208 3300006358 Ga0068871_100154175 Ga0068871_1001541752 396
209 3300006871 Ga0075434_100275159 Ga0075434_1002751592 396
210 3300006914 Ga0075436_100090191 Ga0075436_1000901912 396
211 3300006931 Ga0097620_100188705 Ga0097620_1001887052 396
212 3300009093 Ga0105240_10137311 Ga0105240_101373112 396
213 3300009093 Ga0105240_10156464 Ga0105240_101564642 396
214 3300009094 Ga0111539_10002706 Ga0111539_1000270611 396
215 3300009094 Ga0111539_10036739 Ga0111539_100367394 396
216 3300009094 Ga0111539_10296055 Ga0111539_102960552 396
217 3300009098 Ga0105245_10019049 Ga0105245_100190496 396
218 3300009098 Ga0105245_10246551 Ga0105245_102465512 396
219 3300009098 Ga0105245_10252363 Ga0105245_102523631 396
220 3300009148 Ga0105243_10023905 Ga0105243_100239053 396
221 3300009148 Ga0105243_10239582 Ga0105243_102395822 396
222 3300009551 Ga0105238_10174123 Ga0105238_101741232 396
223 3300009553 Ga0105249_10038052 Ga0105249_100380524 396
224 3300011119 Ga0105246_10118737 Ga0105246_101187371 396
225 3300013102 Ga0157371_10074086 Ga0157371_100740862 396
226 3300013104 Ga0157370_10001120 Ga0157370_1000112032 396
227 3300013296 Ga0157374_10003153 Ga0157374_1000315312 396
228 3300013306 Ga0163162_10024159 Ga0163162_100241596 396
229 3300013307 Ga0157372_10105630 Ga0157372_101056302 396
230 3300014325 Ga0163163_10029549 Ga0163163_100295492 396
231 3300014326 Ga0157380_10005369 Ga0157380_100053696 396
232 3300014745 Ga0157377_10021138 Ga0157377_100211383 396
233 3300014968 Ga0157379_10034163 Ga0157379_100341635 396
234 3300014969 Ga0157376_10023143 Ga0157376_100231433 396
235 3300025321 Ga0207656_10007190 Ga0207656_100071903 396
236 3300025906 Ga0207699_10120966 Ga0207699_101209662 396
237 3300025909 Ga0207705_10008790 Ga0207705_100087904 396
238 3300025913 Ga0207695_10281550 Ga0207695_102815502 396
239 3300025915 Ga0207693_10016820 Ga0207693_100168205 396
240 3300025915 Ga0207693_10086019 Ga0207693_100860193 396
241 3300025916 Ga0207663_10100575 Ga0207663_101005752 396
242 3300025918 Ga0207662_10013861 Ga0207662_100138614 396
243 3300025919 Ga0207657_10002457 Ga0207657_100024577 396
244 3300025921 Ga0207652_10099837 Ga0207652_100998371 396
245 3300025923 Ga0207681_10000912 Ga0207681_1000091213 396
246 3300025924 Ga0207694_10072202 Ga0207694_100722022 396
247 3300025927 Ga0207687_10002728 Ga0207687_100027283 396
248 3300025928 Ga0207700_10000120 Ga0207700_1000012030 396
249 3300025928 Ga0207700_10140288 Ga0207700_101402882 396
250 3300025929 Ga0207664_10004956 Ga0207664_100049569 396
251 3300025931 Ga0207644_10041665 Ga0207644_100416653 396
252 3300025933 Ga0207706_10034357 Ga0207706_100343573 396
253 3300025933 Ga0207706_10182149 Ga0207706_101821492 396
254 3300025934 Ga0207686_10027898 Ga0207686_100278982 396
255 3300025934 Ga0207686_10089750 Ga0207686_100897502 396
256 3300025935 Ga0207709_10010869 Ga0207709_100108693 396
257 3300025935 Ga0207709_10027627 Ga0207709_100276273 396
258 3300025935 Ga0207709_10179714 Ga0207709_101797142 396
259 3300025936 Ga0207670_10077602 Ga0207670_100776022 396
260 3300025937 Ga0207669_10146228 Ga0207669_101462282 396
261 3300025938 Ga0207704_10000892 Ga0207704_100008923 396
262 3300025939 Ga0207665_10008190 Ga0207665_100081904 396
263 3300025939 Ga0207665_10063847 Ga0207665_100638472 396
264 3300025941 Ga0207711_10000116 Ga0207711_100001162 396
265 3300025941 Ga0207711_10050017 Ga0207711_100500172 396
266 3300025942 Ga0207689_10076277 Ga0207689_100762773 396
267 3300025945 Ga0207679_10163453 Ga0207679_101634532 396
268 3300025949 Ga0207667_10084681 Ga0207667_100846812 396
269 3300025949 Ga0207667_10170035 Ga0207667_101700352 396
270 3300025960 Ga0207651_10040744 Ga0207651_100407442 396
271 3300025960 Ga0207651_10211092 Ga0207651_102110922 396
272 3300025961 Ga0207712_10077448 Ga0207712_100774482 396
273 3300025972 Ga0207668_10006478 Ga0207668_100064784 396
274 3300025981 Ga0207640_10138001 Ga0207640_101380012 396
275 3300025986 Ga0207658_10076180 Ga0207658_100761803 396
276 3300026023 Ga0207677_10000188 Ga0207677_1000018830 396
277 3300026035 Ga0207703_10004730 Ga0207703_100047307 396
278 3300026067 Ga0207678_10068344 Ga0207678_100683442 396
279 3300026075 Ga0207708_10003875 Ga0207708_100038757 396
280 3300026088 Ga0207641_10041585 Ga0207641_100415853 396
281 3300026089 Ga0207648_10000242 Ga0207648_1000024231 396
282 3300026089 Ga0207648_10038434 Ga0207648_100384341 396
283 3300026095 Ga0207676_10000230 Ga0207676_1000023014 396
284 3300026116 Ga0207674_10015504 Ga0207674_100155045 396
285 3300026118 Ga0207675_100003332 Ga0207675_10000333212 396
286 3300026118 Ga0207675_100056778 Ga0207675_1000567784 396
287 3300026121 Ga0207683_10001896 Ga0207683_1000189612 396
288 3300026142 Ga0207698_10000850 Ga0207698_1000085014 396
289 3300026142 Ga0207698_10163739 Ga0207698_101637392 396
290 3300027907 Ga0207428_10052067 Ga0207428_100520671 396
291 3300027907 Ga0207428_10058714 Ga0207428_100587142 396
292 3300028380 Ga0268265_10011033 Ga0268265_100110334 396
293 3300028381 Ga0268264_10131497 Ga0268264_101314972 396
294 3300035117 Ga0373953_0028975 Ga0373953_0028975_886_2079 396
295 3300035120 Ga0373957_0053181 Ga0373957_0053181_192_1388 396
296 3300035410 Ga0373924_0091460 Ga0373924_0091460_74_1270 396
297 3300035691 Ga0373931_0035369 Ga0373931_0035369_1280_2491 396
298 3300035692 Ga0373935_0090830 Ga0373935_0090830_521_1717 396
299 3300035695 Ga0373927_0001550 Ga0373927_0001550_875_2065 396
300 3300035725 Ga0373947_0022849 Ga0373947_0022849_768_1964 396
301 3300036401 Ga0373937_0037152 Ga0373937_0037152_1386_2579 396
302 3300037068 Ga0373925_0013181 Ga0373925_0013181_3833_5029 396
303 3300037068 Ga0373925_0052591 Ga0373925_0052591_1809_3005 396
304 3300039437 Ga0436365_1401837 Ga0436365_1401837_1761_2954 396
305 3300042001 Ga0439441_004573 Ga0439441_004573_139_1332 396
306 3300042125 Ga0450923_014536 Ga0450923_014536_90_1283 396
307 3300046472 Ga0495580_0038625 Ga0495580_0038625_1273_2469 396
308 3300046475 Ga0495639_0042502 Ga0495639_0042502_581_1777 396
309 3300046477 Ga0495664_0011476 Ga0495664_0011476_3027_4223 396
310 3300046491 Ga0495584_0018299 Ga0495584_0018299_239_1429 396
311 3300046511 Ga0495608_0021651 Ga0495608_0021651_2881_4074 396
312 3300046536 Ga0495587_0021535 Ga0495587_0021535_2059_3252 396
313 3300046543 Ga0495645_0009193 Ga0495645_0009193_483_1676 396
314 3300046543 Ga0495645_0020341 Ga0495645_0020341_2606_3802 396
315 3300046559 Ga0495667_0047134 Ga0495667_0047134_1487_2680 396
316 3300046663 Ga0495635_0003526 Ga0495635_0003526_827_2023 396
317 3300046675 Ga0495657_0127421 Ga0495657_0127421_60_1256 396
318 3300046678 Ga0495599_0022795 Ga0495599_0022795_1449_2642 396
319 3300046679 Ga0495623_0067407 Ga0495623_0067407_512_1705 396
320 3300046679 Ga0495623_0068239 Ga0495623_0068239_943_2139 396
321 3300046681 Ga0495647_0006673 Ga0495647_0006673_1273_2469 396
322 3300046689 Ga0495613_0016231 Ga0495613_0016231_1065_2261 396
323 3300047315 Ga0495581_0010438 Ga0495581_0010438_2317_3513 396
324 3300047319 Ga0495674_0081609 Ga0495674_0081609_1395_2591 396
325 3300047444 Ga0495675_0080182 Ga0495675_0080182_235_1431 396
326 3300047471 Ga0495684_0028581 Ga0495684_0028581_580_1776 396
327 3300048089 Ga0495614_0031656 Ga0495614_0031656_220_1416 396
328 3300048907 Ga0496104_0009253 Ga0496104_0009253_5410_6606 396
329 3300048908 Ga0496105_0069900 Ga0496105_0069900_1006_2199 396
330 3300048910 Ga0496107_0055618 Ga0496107_0055618_209_1405 396
331 3300048911 Ga0496108_0042748 Ga0496108_0042748_1420_2616 396
332 3300048912 Ga0496109_0386059 Ga0496109_0386059_102_1313 396
333 3300048915 Ga0496112_0038487 Ga0496112_0038487_1637_2833 396
334 3300048915 Ga0496112_0207203 Ga0496112_0207203_222_1415 396
335 3300049581 Ga0501047_0103185 Ga0501047_0103185_637_1830 396
336 3300049584 Ga0501068_0033760 Ga0501068_0033760_1296_2489 396
337 3300049585 Ga0501069_0024971 Ga0501069_0024971_748_1941 396
338 3300049586 Ga0501070_0011981 Ga0501070_0011981_2410_3603 396
339 3300049589 Ga0501073_0001346 Ga0501073_0001346_16052_17245 396
340 3300049590 Ga0501074_0001670 Ga0501074_0001670_12747_13940 396
341 3300049741 Ga0501079_0014247 Ga0501079_0014247_387_1580 396
342 3300049744 Ga0501083_0004033 Ga0501083_0004033_853_2046 396
343 3300050511 nmdc:mga08y16_8133_c1 nmdc:mga08y16_8133_c1_3830_5023 396
344 3300050514 nmdc:mga08x19_97140_c1 nmdc:mga08x19_97140_c1_306_1499 396
345 3300053084 Ga0495595_0014569 Ga0495595_0014569_1322_2515 396
346 3300053085 Ga0495619_0004815 Ga0495619_0004815_324_1520 396
347 3300053085 Ga0495619_0037876 Ga0495619_0037876_1513_2706 396
348 3300005290 Ga0065712_10153779 Ga0065712_101537791 397
349 3300005330 Ga0070690_100004977 Ga0070690_1000049778 397
350 3300005334 Ga0068869_100009266 Ga0068869_1000092667 397
351 3300005334 Ga0068869_100045360 Ga0068869_1000453602 397
352 3300005336 Ga0070680_100012912 Ga0070680_1000129122 397
353 3300005338 Ga0068868_100002303 Ga0068868_1000023032 397
354 3300005340 Ga0070689_100013040 Ga0070689_1000130404 397
355 3300005340 Ga0070689_100058778 Ga0070689_1000587783 397
356 3300005341 Ga0070691_10017191 Ga0070691_100171912 397
357 3300005344 Ga0070661_100067057 Ga0070661_1000670572 397
358 3300005345 Ga0070692_10000696 Ga0070692_100006964 397
359 3300005365 Ga0070688_100028038 Ga0070688_1000280383 397
360 3300005365 Ga0070688_100041331 Ga0070688_1000413312 397
361 3300005406 Ga0070703_10008813 Ga0070703_100088132 397
362 3300005435 Ga0070714_100004849 Ga0070714_1000048496 397
363 3300005435 Ga0070714_100027080 Ga0070714_1000270804 397
364 3300005438 Ga0070701_10000703 Ga0070701_100007032 397
365 3300005440 Ga0070705_100000030 Ga0070705_1000000302 397
366 3300005441 Ga0070700_100001420 Ga0070700_10000142011 397
367 3300005444 Ga0070694_100057040 Ga0070694_1000570402 397
368 3300005459 Ga0068867_100043771 Ga0068867_1000437712 397
369 3300005459 Ga0068867_100141170 Ga0068867_1001411702 397
370 3300005530 Ga0070679_100088227 Ga0070679_1000882272 397
371 3300005545 Ga0070695_100000012 Ga0070695_1000000122 397
372 3300005546 Ga0070696_100033945 Ga0070696_1000339453 397
373 3300005547 Ga0070693_100000027 Ga0070693_10000002728 397
374 3300005547 Ga0070693_100045556 Ga0070693_1000455561 397
375 3300005549 Ga0070704_100055146 Ga0070704_1000551462 397
376 3300005563 Ga0068855_100002039 Ga0068855_1000020392 397
377 3300005614 Ga0068856_100079683 Ga0068856_1000796832 397
378 3300005614 Ga0068856_100094237 Ga0068856_1000942373 397
379 3300005615 Ga0070702_100028015 Ga0070702_1000280152 397
380 3300005616 Ga0068852_100123744 Ga0068852_1001237442 397
381 3300005616 Ga0068852_100175327 Ga0068852_1001753272 397
382 3300005617 Ga0068859_100000392 Ga0068859_10000039244 397
383 3300005718 Ga0068866_10000043 Ga0068866_1000004323 397
384 3300005719 Ga0068861_100036886 Ga0068861_1000368862 397
385 3300005843 Ga0068860_100003708 Ga0068860_1000037081 397
386 3300005844 Ga0068862_100051657 Ga0068862_1000516572 397
387 3300006358 Ga0068871_100000355 Ga0068871_10000035527 397
388 3300006844 Ga0075428_100000433 Ga0075428_10000043333 397
389 3300006846 Ga0075430_100138527 Ga0075430_1001385272 397
390 3300006880 Ga0075429_100000037 Ga0075429_10000003731 397
391 3300006881 Ga0068865_100001523 Ga0068865_1000015233 397
392 3300006931 Ga0097620_100000392 Ga0097620_10000039244 397
393 3300009098 Ga0105245_10000177 Ga0105245_1000017728 397
394 3300009147 Ga0114129_10001488 Ga0114129_1000148813 397
395 3300009148 Ga0105243_10000815 Ga0105243_100008156 397
396 3300009174 Ga0105241_10008874 Ga0105241_100088746 397
397 3300009176 Ga0105242_10000061 Ga0105242_1000006129 397
398 3300009176 Ga0105242_10041962 Ga0105242_100419624 397
399 3300009553 Ga0105249_10450239 Ga0105249_104502391 397
400 3300013105 Ga0157369_10222223 Ga0157369_102222232 397
401 3300013297 Ga0157378_10006628 Ga0157378_1000662810 397
402 3300013307 Ga0157372_10028828 Ga0157372_100288286 397
403 3300014326 Ga0157380_10041923 Ga0157380_100419232 397
404 3300014969 Ga0157376_10009080 Ga0157376_100090802 397
405 3300025912 Ga0207707_10171738 Ga0207707_101717382 397
406 3300025918 Ga0207662_10000613 Ga0207662_100006133 397
407 3300025921 Ga0207652_10069331 Ga0207652_100693312 397
408 3300025924 Ga0207694_10010483 Ga0207694_100104837 397
409 3300025926 Ga0207659_10041583 Ga0207659_100415832 397
410 3300025927 Ga0207687_10001330 Ga0207687_100013302 397
411 3300025928 Ga0207700_10211181 Ga0207700_102111812 397
412 3300025929 Ga0207664_10008029 Ga0207664_100080295 397
413 3300025934 Ga0207686_10023547 Ga0207686_100235473 397
414 3300025935 Ga0207709_10017319 Ga0207709_100173194 397
415 3300025936 Ga0207670_10034431 Ga0207670_100344314 397
416 3300025936 Ga0207670_10060616 Ga0207670_100606164 397
417 3300025938 Ga0207704_10010443 Ga0207704_100104434 397
418 3300025940 Ga0207691_10032133 Ga0207691_100321334 397
419 3300025942 Ga0207689_10000209 Ga0207689_1000020943 397
420 3300026023 Ga0207677_10021913 Ga0207677_100219132 397
421 3300026035 Ga0207703_10052242 Ga0207703_100522423 397
422 3300026075 Ga0207708_10000189 Ga0207708_1000018925 397
423 3300026089 Ga0207648_10000055 Ga0207648_1000005573 397
424 3300026118 Ga0207675_100000188 Ga0207675_10000018812 397
425 3300026142 Ga0207698_10025945 Ga0207698_100259453 397
426 3300027907 Ga0207428_10003824 Ga0207428_100038245 397
427 3300028380 Ga0268265_10003484 Ga0268265_1000348411 397
428 3300028381 Ga0268264_10000636 Ga0268264_100006362 397
429 3300028381 Ga0268264_10060788 Ga0268264_100607883 397
430 3300028794 Ga0307515_10039075 Ga0307515_100390755 397
431 3300031507 Ga0307509_10106706 Ga0307509_101067063 397
432 3300031730 Ga0307516_10010057 Ga0307516_100100573 397
433 3300035092 Ga0373952_0005294 Ga0373952_0005294_462_1658 397
434 3300035112 Ga0373932_0000747 Ga0373932_0000747_1993_3189 397
435 3300035115 Ga0373941_0014905 Ga0373941_0014905_95_1291 397
436 3300035119 Ga0373956_0009731 Ga0373956_0009731_280_1476 397
437 3300035207 Ga0373942_0029639 Ga0373942_0029639_48_1244 397
438 3300035241 Ga0373961_0000445 Ga0373961_0000445_9970_11166 397
439 3300035691 Ga0373931_0000646 Ga0373931_0000646_913_2109 397
440 3300035691 Ga0373931_0016530 Ga0373931_0016530_2424_3620 397
441 3300042876 Ga0451577_0084105 Ga0451577_0084105_1241_2437 397
442 3300045051 Ga0451576_0010262 Ga0451576_0010262_9165_10361 397
443 3300045051 Ga0451576_0012994 Ga0451576_0012994_7730_8926 397
444 3300045051 Ga0451576_0241385 Ga0451576_0241385_267_1463 397
445 3300046537 Ga0495598_0037753 Ga0495598_0037753_48_1244 397
446 3300049568 Ga0501031_0032599 Ga0501031_0032599_448_1644 397
447 3300049570 Ga0501033_0028336 Ga0501033_0028336_2634_3830 397
448 3300049574 Ga0501038_0001109 Ga0501038_0001109_10363_11559 397
449 3300049575 Ga0501039_0015991 Ga0501039_0015991_2857_4053 397
450 3300049576 Ga0501040_0001909 Ga0501040_0001909_3873_5069 397
451 3300049577 Ga0501041_0003730 Ga0501041_0003730_5983_7179 397
452 3300049578 Ga0501042_0000383 Ga0501042_0000383_12817_14013 397
453 3300049580 Ga0501046_0001197 Ga0501046_0001197_13177_14373 397
454 3300049582 Ga0501048_0104738 Ga0501048_0104738_87_1283 397
455 3300049584 Ga0501068_0046140 Ga0501068_0046140_570_1766 397
456 3300049587 Ga0501071_0020152 Ga0501071_0020152_1063_2259 397
457 3300049588 Ga0501072_0002470 Ga0501072_0002470_3957_5153 397
458 3300049590 Ga0501074_0053513 Ga0501074_0053513_98_1294 397
459 3300049591 Ga0501075_0000525 Ga0501075_0000525_12934_14130 397
460 3300049592 Ga0501076_0013583 Ga0501076_0013583_3194_4390 397
461 3300049593 Ga0501077_0031416 Ga0501077_0031416_881_2077 397
462 3300049741 Ga0501079_0000625 Ga0501079_0000625_12591_13787 397
463 3300049742 Ga0501080_0110457 Ga0501080_0110457_235_1431 397
464 3300049743 Ga0501081_0000055 Ga0501081_0000055_6141_7337 397
465 3300049744 Ga0501083_0077415 Ga0501083_0077415_16_1212 397
466 3300049823 Ga0501044_0049886 Ga0501044_0049886_738_1934 397
467 3300049824 Ga0501045_0000901 Ga0501045_0000901_6661_7857 397
468 3300050507 nmdc:mga05p37_387_c1 nmdc:mga05p37_387_c1_19828_21024 397
469 3300050508 nmdc:mga09592_17457_c1 nmdc:mga09592_17457_c1_2093_3289 397
470 3300050508 nmdc:mga09592_212_c1 nmdc:mga09592_212_c1_32569_33765 397
471 3300050509 nmdc:mga0qj67_158294_c1 nmdc:mga0qj67_158294_c1_72_1268 397
472 3300050509 nmdc:mga0qj67_56027_c1 nmdc:mga0qj67_56027_c1_942_2138 397
473 3300050510 nmdc:mga06r32_357105_c1 nmdc:mga06r32_357105_c1_72_1268 397
474 3300050511 nmdc:mga08y16_76703_c1 nmdc:mga08y16_76703_c1_1280_2476 397
475 3300050511 nmdc:mga08y16_95983_c1 nmdc:mga08y16_95983_c1_1308_2504 397
476 3300053080 Ga0500635_0014303 Ga0500635_0014303_367_1563 397
477 3300053094 Ga0500566_0002758 Ga0500566_0002758_5144_6340 397
478 3300053094 Ga0500566_0011675 Ga0500566_0011675_1649_2845 397
479 3300053095 Ga0500640_004928 Ga0500640_004928_1811_3007 397
480 3300053102 Ga0500554_000602 Ga0500554_000602_4328_5524 397
481 3300053111 Ga0500572_000814 Ga0500572_000814_4608_5804 397
482 3300053119 Ga0500595_000093 Ga0500595_000093_26984_28180 397
483 3300053123 Ga0500614_000153 Ga0500614_000153_1830_3026 397
484 3300053136 Ga0500559_0012960 Ga0500559_0012960_691_1887 397
485 3300053177 Ga0500636_0033621 Ga0500636_0033621_365_1561 397
486 3300054114 Ga0501084_0002498 Ga0501084_0002498_1268_2464 397
487 3300060353 Ga0501082_0008950 Ga0501082_0008950_1957_3153 397
488 3300061734 Ga0530510_0001004 Ga0530510_0001004_13677_14873 397
489 3300006914 Ga0075436_100000745 Ga0075436_1000007456 398
490 3300031507 Ga0307509_10012723 Ga0307509_100127237 398
491 3300031548 Ga0307408_100186541 Ga0307408_1001865412 398
492 3300005435 Ga0070714_100012985 Ga0070714_1000129856 399
493 3300005436 Ga0070713_100010346 Ga0070713_1000103466 399
494 3300005437 Ga0070710_10056986 Ga0070710_100569862 399
495 3300005439 Ga0070711_100122753 Ga0070711_1001227532 399
496 3300005518 Ga0070699_100039484 Ga0070699_1000394842 399
497 3300005530 Ga0070679_100106800 Ga0070679_1001068002 399
498 3300005546 Ga0070696_100000647 Ga0070696_1000006475 399
499 3300009093 Ga0105240_10006057 Ga0105240_100060578 399
500 3300013104 Ga0157370_10010117 Ga0157370_100101175 399
501 3300025906 Ga0207699_10023529 Ga0207699_100235293 399
502 3300025913 Ga0207695_10063273 Ga0207695_100632734 399
503 3300025916 Ga0207663_10071354 Ga0207663_100713542 399
504 3300025921 Ga0207652_10120843 Ga0207652_101208433 399
505 3300025928 Ga0207700_10100186 Ga0207700_101001862 399
506 3300025929 Ga0207664_10034956 Ga0207664_100349562 399
507 3300025945 Ga0207679_10018769 Ga0207679_100187693 399
508 3300025949 Ga0207667_10049743 Ga0207667_100497433 399
509 3300027614 Ga0209970_1001796 Ga0209970_10017963 399
510 3300031548 Ga0307408_100019168 Ga0307408_1000191682 399
511 3300031731 Ga0307405_10020125 Ga0307405_100201254 399
512 3300031824 Ga0307413_10013780 Ga0307413_100137803 399
513 3300031852 Ga0307410_10084797 Ga0307410_100847971 399
514 3300032002 Ga0307416_100005561 Ga0307416_1000055615 399
515 3300032005 Ga0307411_10066351 Ga0307411_100663512 399
516 3300035113 Ga0373936_0001963 Ga0373936_0001963_3447_4649 399
517 3300035116 Ga0373945_0006255 Ga0373945_0006255_1932_3140 399
518 3300035170 Ga0373943_0001833 Ga0373943_0001833_3786_4988 399
519 3300035170 Ga0373943_0007550 Ga0373943_0007550_451_1659 399
520 3300035171 Ga0373946_0002403 Ga0373946_0002403_1689_2897 399
521 3300035692 Ga0373935_0004641 Ga0373935_0004641_6548_7756 399
522 3300035695 Ga0373927_0006549 Ga0373927_0006549_3501_4709 399
523 3300037068 Ga0373925_0010675 Ga0373925_0010675_1949_3151 399
524 3300037068 Ga0373925_0011332 Ga0373925_0011332_373_1581 399
525 3300046455 Ga0495603_0014421 Ga0495603_0014421_2264_3472 399
526 3300046472 Ga0495580_0000377 Ga0495580_0000377_16039_17247 399
527 3300046475 Ga0495639_0001938 Ga0495639_0001938_7550_8758 399
528 3300005563 Ga0068855_100026884 Ga0068855_1000268842 400
529 3300009093 Ga0105240_10017051 Ga0105240_100170518 400
530 3300013105 Ga0157369_10004919 Ga0157369_100049196 400
531 3300013307 Ga0157372_10004130 Ga0157372_1000413014 400
532 3300025321 Ga0207656_10069901 Ga0207656_100699012 400
533 3300025944 Ga0207661_10099519 Ga0207661_100995192 400
534 3300025949 Ga0207667_10035815 Ga0207667_100358152 400
535 3300026041 Ga0207639_10051778 Ga0207639_100517782 400
536 3300026142 Ga0207698_10117326 Ga0207698_101173262 400
537 3300044684 Ga0466966_0062825 Ga0466966_0062825_836_2044 400
538 3300044842 Ga0466957_0002655 Ga0466957_0002655_4427_5635 400
539 iso_pu_bacteria 2857537821 2857539115 400
540 3300005293 Ga0065715_10093842 Ga0065715_100938422 401
541 3300005366 Ga0070659_100066189 Ga0070659_1000661892 401
542 3300009545 Ga0105237_10037224 Ga0105237_100372244 401
543 3300013105 Ga0157369_10080806 Ga0157369_100808062 401
544 3300025914 Ga0207671_10031796 Ga0207671_100317963 401
545 3300025931 Ga0207644_10065328 Ga0207644_100653283 401
546 3300025932 Ga0207690_10045820 Ga0207690_100458202 401
547 3300035695 Ga0373927_0044458 Ga0373927_0044458_1156_2409 401
548 3300035725 Ga0373947_0016721 Ga0373947_0016721_1933_3186 401
549 3300037068 Ga0373925_0077327 Ga0373925_0077327_420_1673 401
550 3300046506 Ga0495583_0010587 Ga0495583_0010587_2584_3810 401
551 3300047318 Ga0495636_0011491 Ga0495636_0011491_448_1674 401
552 3300048905 Ga0496102_0010080 Ga0496102_0010080_803_2029 401
553 iso_pu_bacteria 2857542790 2857544553 401
554 iso_pu_bacteria 2858950400 2858956050 401
555 3300005331 Ga0070670_100033282 Ga0070670_1000332821 402
556 3300005344 Ga0070661_100047204 Ga0070661_1000472042 402
557 3300005366 Ga0070659_100086474 Ga0070659_1000864742 402
558 3300005367 Ga0070667_100098296 Ga0070667_1000982962 402
559 3300005564 Ga0070664_100166989 Ga0070664_1001669891 402
560 3300005578 Ga0068854_100110307 Ga0068854_1001103072 402
561 3300005834 Ga0068851_10005030 Ga0068851_100050304 402
562 3300005841 Ga0068863_100040551 Ga0068863_1000405512 402
563 3300005842 Ga0068858_100117864 Ga0068858_1001178643 402
564 3300009147 Ga0114129_10486319 Ga0114129_104863192 402
565 3300009177 Ga0105248_10439293 Ga0105248_104392931 402
566 3300014968 Ga0157379_10006850 Ga0157379_1000685011 402
567 3300025920 Ga0207649_10079168 Ga0207649_100791681 402
568 3300025981 Ga0207640_10107784 Ga0207640_101077841 402
569 3300026035 Ga0207703_10075503 Ga0207703_100755032 402
570 3300026067 Ga0207678_10139044 Ga0207678_101390442 402
571 iso_pu_bacteria 2881927736 2881928790 402
572 3300005353 Ga0070669_100002777 Ga0070669_1000027773 403
573 3300005364 Ga0070673_100159082 Ga0070673_1001590821 403
574 3300005457 Ga0070662_100002542 Ga0070662_1000025429 403
575 3300005564 Ga0070664_100071399 Ga0070664_1000713992 403
576 3300005618 Ga0068864_100030787 Ga0068864_1000307872 403
577 3300005841 Ga0068863_100071731 Ga0068863_1000717313 403
578 3300005843 Ga0068860_100048523 Ga0068860_1000485232 403
579 3300014497 Ga0182008_10056854 Ga0182008_100568542 403
580 3300014969 Ga0157376_10023970 Ga0157376_100239702 403
581 3300025923 Ga0207681_10026305 Ga0207681_100263052 403
582 3300025931 Ga0207644_10002797 Ga0207644_100027979 403
583 3300025938 Ga0207704_10060219 Ga0207704_100602192 403
584 3300025940 Ga0207691_10001738 Ga0207691_1000173814 403
585 3300025941 Ga0207711_10010699 Ga0207711_100106996 403
586 3300025960 Ga0207651_10178184 Ga0207651_101781841 403
587 3300026075 Ga0207708_10127372 Ga0207708_101273722 403
588 3300026095 Ga0207676_10069893 Ga0207676_100698932 403
589 3300026095 Ga0207676_10308801 Ga0207676_103088011 403
590 3300028381 Ga0268264_10061585 Ga0268264_100615853 403
591 3300046506 Ga0495583_0000134 Ga0495583_0000134_75962_77179 403
592 3300046506 Ga0495583_0001580 Ga0495583_0001580_20347_21564 403
593 3300046513 Ga0495616_0000113 Ga0495616_0000113_63282_64499 403
594 3300046520 Ga0495637_0025465 Ga0495637_0025465_870_2102 403
595 3300046665 Ga0495661_0060772 Ga0495661_0060772_764_1996 403
596 3300048091 Ga0495626_0000384 Ga0495626_0000384_4144_5376 403
597 iso_pu_bacteria 2887375801 2887378368 403
598 iso_pu_bacteria 8055225921 8055228768 403
599 iso_pu_bacteria 8055301274 8055308072 403
600 3300005344 Ga0070661_100007548 Ga0070661_1000075486 404
601 3300005355 Ga0070671_100113740 Ga0070671_1001137402 404
602 3300005366 Ga0070659_100002518 Ga0070659_10000251810 404
603 3300005441 Ga0070700_100024997 Ga0070700_1000249972 404
604 3300005563 Ga0068855_100066930 Ga0068855_1000669302 404
605 3300005564 Ga0070664_100000662 Ga0070664_10000066212 404
606 3300005614 Ga0068856_100001976 Ga0068856_1000019762 404
607 3300006844 Ga0075428_100017431 Ga0075428_1000174313 404
608 3300006847 Ga0075431_100012395 Ga0075431_1000123955 404
609 3300013100 Ga0157373_10001573 Ga0157373_100015736 404
610 3300013102 Ga0157371_10002592 Ga0157371_100025923 404
611 3300013307 Ga0157372_10009719 Ga0157372_100097199 404
612 3300013307 Ga0157372_10019156 Ga0157372_100191563 404
613 3300014745 Ga0157377_10011882 Ga0157377_100118823 404
614 3300025298 Ga0209050_1009762 Ga0209050_10097621 404
615 3300025303 Ga0209051_1019461 Ga0209051_10194612 404
616 3300025919 Ga0207657_10037939 Ga0207657_100379393 404
617 3300025933 Ga0207706_10002770 Ga0207706_1000277015 404
618 3300025936 Ga0207670_10115436 Ga0207670_101154362 404
619 3300025945 Ga0207679_10002033 Ga0207679_1000203312 404
620 3300025949 Ga0207667_10245397 Ga0207667_102453972 404
621 3300025986 Ga0207658_10105485 Ga0207658_101054852 404
622 3300026023 Ga0207677_10179127 Ga0207677_101791272 404
623 3300026075 Ga0207708_10020959 Ga0207708_100209592 404
624 3300026078 Ga0207702_10002944 Ga0207702_100029446 404
625 3300026089 Ga0207648_10273939 Ga0207648_102739392 404
626 3300031911 Ga0307412_10000314 Ga0307412_1000031410 404
627 3300046500 Ga0495596_0002689 Ga0495596_0002689_2999_4219 404
628 3300046522 Ga0495643_0073302 Ga0495643_0073302_505_1725 404
629 3300046523 Ga0495644_0014028 Ga0495644_0014028_1596_2816 404
630 3300046538 Ga0495609_0002536 Ga0495609_0002536_5203_6423 404
631 3300046648 Ga0495611_0005937 Ga0495611_0005937_1918_3138 404
632 3300046794 Ga0495589_0055975 Ga0495589_0055975_412_1632 404
633 3300047321 Ga0495676_0053979 Ga0495676_0053979_927_2147 404
634 3300047445 Ga0495677_0038111 Ga0495677_0038111_304_1524 404
635 3300047469 Ga0495673_0080279 Ga0495673_0080279_26_1246 404
636 3300048906 Ga0496103_0092206 Ga0496103_0092206_44_1303 404
637 3300048909 Ga0496106_0008585 Ga0496106_0008585_5944_7203 404
638 3300048910 Ga0496107_0063772 Ga0496107_0063772_1273_2532 404
639 3300048919 Ga0496116_0013599 Ga0496116_0013599_4827_6098 404
640 3300048921 Ga0496118_0023565 Ga0496118_0023565_3956_5227 404
641 3300048922 Ga0496119_0029332 Ga0496119_0029332_336_1607 404
642 3300048923 Ga0496120_0069419 Ga0496120_0069419_380_1651 404
643 3300048924 Ga0496121_0000568 Ga0496121_0000568_33557_34828 404
644 3300048925 Ga0496122_0146633 Ga0496122_0146633_84_1355 404
645 3300048928 Ga0496125_0000105 Ga0496125_0000105_48027_49298 404
646 3300048929 Ga0496126_0170478 Ga0496126_0170478_72_1343 404
647 3300050508 nmdc:mga09592_83861_c1 nmdc:mga09592_83861_c1_286_1506 404
648 3300050509 nmdc:mga0qj67_1416_c1 nmdc:mga0qj67_1416_c1_11865_13085 404
649 iso_pu_bacteria 2643221569 2643860435 404
650 iso_pu_bacteria 2941479691 2941483841 404
651 3300005329 Ga0070683_100035551 Ga0070683_1000355513 405
652 3300005331 Ga0070670_100004715 Ga0070670_1000047157 405
653 3300005434 Ga0070709_10028027 Ga0070709_100280272 405
654 3300005444 Ga0070694_100002295 Ga0070694_10000229512 405
655 3300005455 Ga0070663_100002206 Ga0070663_1000022069 405
656 3300005530 Ga0070679_100190438 Ga0070679_1001904382 405
657 3300005577 Ga0068857_100009373 Ga0068857_1000093735 405
658 3300005614 Ga0068856_100178136 Ga0068856_1001781362 405
659 3300005617 Ga0068859_100134643 Ga0068859_1001346432 405
660 3300005834 Ga0068851_10006641 Ga0068851_100066414 405
661 3300005844 Ga0068862_100064192 Ga0068862_1000641922 405
662 3300006931 Ga0097620_100134648 Ga0097620_1001346482 405
663 3300009093 Ga0105240_10004865 Ga0105240_100048656 405
664 3300009098 Ga0105245_10051828 Ga0105245_100518285 405
665 3300009174 Ga0105241_10011109 Ga0105241_100111093 405
666 3300009177 Ga0105248_10024460 Ga0105248_100244606 405
667 3300009545 Ga0105237_10008781 Ga0105237_1000878110 405
668 3300009551 Ga0105238_10243138 Ga0105238_102431382 405
669 3300013102 Ga0157371_10032016 Ga0157371_100320163 405
670 3300013104 Ga0157370_10063953 Ga0157370_100639533 405
671 3300020070 Ga0206356_11263179 Ga0206356_112631792 405
672 3300025909 Ga0207705_10006285 Ga0207705_100062855 405
673 3300025912 Ga0207707_10016373 Ga0207707_100163733 405
674 3300025913 Ga0207695_10024678 Ga0207695_100246783 405
675 3300025917 Ga0207660_10000918 Ga0207660_1000091815 405
676 3300025919 Ga0207657_10000142 Ga0207657_100001422 405
677 3300025924 Ga0207694_10014521 Ga0207694_100145216 405
678 3300025949 Ga0207667_10000425 Ga0207667_1000042515 405
679 3300025981 Ga0207640_10150683 Ga0207640_101506831 405
680 3300026023 Ga0207677_10069240 Ga0207677_100692402 405
681 3300026041 Ga0207639_10012802 Ga0207639_100128026 405
682 3300026041 Ga0207639_10277326 Ga0207639_102773262 405
683 3300026067 Ga0207678_10005045 Ga0207678_1000504511 405
684 3300026078 Ga0207702_10042356 Ga0207702_100423565 405
685 3300026116 Ga0207674_10000593 Ga0207674_1000059316 405
686 3300026116 Ga0207674_10040984 Ga0207674_100409843 405
687 3300026142 Ga0207698_10001265 Ga0207698_1000126514 405
688 3300028380 Ga0268265_10034111 Ga0268265_100341112 405
689 3300038443 Ga0395901_0206554 Ga0395901_0206554_240_1469 405
690 3300038443 Ga0395901_0232857 Ga0395901_0232857_116_1339 405
691 3300046455 Ga0495603_0080530 Ga0495603_0080530_238_1467 405
692 3300046491 Ga0495584_0036250 Ga0495584_0036250_1046_2275 405
693 3300046492 Ga0495585_0019103 Ga0495585_0019103_1601_2830 405
694 3300046499 Ga0495594_0062827 Ga0495594_0062827_802_2031 405
695 3300046499 Ga0495594_0065233 Ga0495594_0065233_53_1282 405
696 3300046500 Ga0495596_0001001 Ga0495596_0001001_545_1774 405
697 3300046506 Ga0495583_0009231 Ga0495583_0009231_1849_3078 405
698 3300046535 Ga0495586_0060934 Ga0495586_0060934_659_1888 405
699 3300046557 Ga0495622_0055307 Ga0495622_0055307_244_1473 405
700 3300046558 Ga0495633_0014419 Ga0495633_0014419_2180_3409 405
701 3300046665 Ga0495661_0036234 Ga0495661_0036234_362_1591 405
702 3300046665 Ga0495661_0059876 Ga0495661_0059876_853_2082 405
703 3300046674 Ga0495588_0011773 Ga0495588_0011773_487_1716 405
704 3300046684 Ga0495669_0000013 Ga0495669_0000013_43063_44292 405
705 3300046689 Ga0495613_0025151 Ga0495613_0025151_1423_2652 405
706 3300046691 Ga0495670_0022806 Ga0495670_0022806_1364_2593 405
707 3300046694 Ga0495649_0050677 Ga0495649_0050677_234_1463 405
708 3300046794 Ga0495589_0080908 Ga0495589_0080908_162_1391 405
709 3300047321 Ga0495676_0001263 Ga0495676_0001263_8281_9510 405
710 3300047322 Ga0495680_0089067 Ga0495680_0089067_949_2205 405
711 3300048088 Ga0495602_0128278 Ga0495602_0128278_22_1251 405
712 3300048089 Ga0495614_0010091 Ga0495614_0010091_2666_3895 405
713 3300048913 Ga0496110_0001834 Ga0496110_0001834_10148_11377 405
714 3300048914 Ga0496111_0069539 Ga0496111_0069539_231_1460 405
715 3300048924 Ga0496121_0012358 Ga0496121_0012358_1859_3100 405
716 3300048925 Ga0496122_0079038 Ga0496122_0079038_1035_2276 405
717 3300048927 Ga0496124_0000007 Ga0496124_0000007_879063_880304 405
718 3300049575 Ga0501039_0160631 Ga0501039_0160631_415_1644 405
719 3300049581 Ga0501047_0004365 Ga0501047_0004365_8458_9687 405
720 3300049822 Ga0501035_0002928 Ga0501035_0002928_3667_4896 405
721 3300049822 Ga0501035_0012650 Ga0501035_0012650_5064_6287 405
722 3300049823 Ga0501044_0014152 Ga0501044_0014152_4510_5739 405
723 iso_pu_bacteria 2643221621 2644119829 405
724 iso_pu_bacteria 2808606395 2809035609 405
725 3300005445 Ga0070708_100041230 Ga0070708_1000412302 406
726 3300005518 Ga0070699_100029571 Ga0070699_1000295712 406
727 3300005549 Ga0070704_100038598 Ga0070704_1000385983 406
728 3300006852 Ga0075433_10009565 Ga0075433_100095652 406
729 3300006871 Ga0075434_100030336 Ga0075434_1000303363 406
730 3300007076 Ga0075435_100037977 Ga0075435_1000379773 406
731 3300025910 Ga0207684_10012685 Ga0207684_100126858 406
732 3300025922 Ga0207646_10034393 Ga0207646_100343932 406
733 3300046491 Ga0495584_0043753 Ga0495584_0043753_893_2128 406
734 3300046492 Ga0495585_0021650 Ga0495585_0021650_1631_2863 406
735 3300046518 Ga0495631_0008226 Ga0495631_0008226_3201_4442 406
736 3300046525 Ga0495663_0002150 Ga0495663_0002150_713_1939 406
737 3300046558 Ga0495633_0039431 Ga0495633_0039431_852_2093 406
738 3300046616 Ga0495668_0032388 Ga0495668_0032388_171_1412 406
739 3300046665 Ga0495661_0031020 Ga0495661_0031020_1995_3236 406
740 3300046691 Ga0495670_0010238 Ga0495670_0010238_575_1804 406
741 3300047470 Ga0495681_0037870 Ga0495681_0037870_1012_2238 406
742 3300048090 Ga0495615_0000692 Ga0495615_0000692_1394_2620 406
743 3300049742 Ga0501080_0152085 Ga0501080_0152085_70_1335 406
744 3300050512 nmdc:mga0n895_354398_c1 nmdc:mga0n895_354398_c1_18_1253 406
745 iso_pu_bacteria 2834641062 2834645988 406
746 3300005336 Ga0070680_100070126 Ga0070680_1000701264 407
747 3300005339 Ga0070660_100066874 Ga0070660_1000668742 407
748 3300005344 Ga0070661_100000659 Ga0070661_1000006591 407
749 3300005435 Ga0070714_100001230 Ga0070714_1000012309 407
750 3300005535 Ga0070684_100029664 Ga0070684_1000296646 407
751 3300005563 Ga0068855_100007555 Ga0068855_1000075552 407
752 3300005564 Ga0070664_100000157 Ga0070664_10000015710 407
753 3300005577 Ga0068857_100002118 Ga0068857_1000021188 407
754 3300005578 Ga0068854_100022259 Ga0068854_1000222592 407
755 3300005614 Ga0068856_100003357 Ga0068856_10000335712 407
756 3300005614 Ga0068856_100008502 Ga0068856_1000085029 407
757 3300005616 Ga0068852_100000826 Ga0068852_1000008268 407
758 3300005834 Ga0068851_10015994 Ga0068851_100159945 407
759 3300009093 Ga0105240_10007858 Ga0105240_1000785811 407
760 3300013102 Ga0157371_10016262 Ga0157371_100162622 407
761 3300013104 Ga0157370_10011680 Ga0157370_1001168011 407
762 3300013104 Ga0157370_10016253 Ga0157370_100162533 407
763 3300013105 Ga0157369_10018830 Ga0157369_100188302 407
764 3300013307 Ga0157372_10001409 Ga0157372_1000140921 407
765 3300025912 Ga0207707_10219782 Ga0207707_102197822 407
766 3300025913 Ga0207695_10016171 Ga0207695_100161713 407
767 3300025924 Ga0207694_10006781 Ga0207694_100067818 407
768 3300025929 Ga0207664_10041785 Ga0207664_100417854 407
769 3300026078 Ga0207702_10002758 Ga0207702_1000275812 407
770 3300026116 Ga0207674_10000301 Ga0207674_1000030112 407
771 3300026142 Ga0207698_10067288 Ga0207698_100672882 407
772 3300032004 Ga0307414_10085201 Ga0307414_100852012 407
773 3300037312 Ga0395899_0000216 Ga0395899_0000216_16299_17531 407
774 3300037471 Ga0395905_0020803 Ga0395905_0020803_767_1999 407
775 3300038443 Ga0395901_0000420 Ga0395901_0000420_14578_15810 407
776 3300045836 Ga0466958_0029523 Ga0466958_0029523_1889_3133 407
777 3300046473 Ga0495582_0078502 Ga0495582_0078502_40_1272 407
778 3300046491 Ga0495584_0102846 Ga0495584_0102846_194_1426 407
779 3300046492 Ga0495585_0055089 Ga0495585_0055089_453_1685 407
780 3300046499 Ga0495594_0009981 Ga0495594_0009981_3386_4618 407
781 3300046522 Ga0495643_0008333 Ga0495643_0008333_4315_5553 407
782 3300046674 Ga0495588_0042123 Ga0495588_0042123_1075_2307 407
783 3300047318 Ga0495636_0012632 Ga0495636_0012632_1274_2506 407
784 3300047321 Ga0495676_0059705 Ga0495676_0059705_329_1561 407
785 3300047470 Ga0495681_0037363 Ga0495681_0037363_1143_2375 407
786 3300005329 Ga0070683_100030072 Ga0070683_1000300725 410
787 3300005334 Ga0068869_100026457 Ga0068869_1000264574 410
788 3300005343 Ga0070687_100041726 Ga0070687_1000417262 410
789 3300005544 Ga0070686_100016610 Ga0070686_1000166104 410
790 3300005548 Ga0070665_100033723 Ga0070665_1000337235 410
791 3300005615 Ga0070702_100010845 Ga0070702_1000108452 410
792 3300005618 Ga0068864_100021685 Ga0068864_1000216852 410
793 3300005718 Ga0068866_10007294 Ga0068866_100072944 410
794 3300005719 Ga0068861_100034057 Ga0068861_1000340572 410
795 3300005840 Ga0068870_10024040 Ga0068870_100240402 410
796 3300005841 Ga0068863_100028084 Ga0068863_1000280843 410
797 3300005841 Ga0068863_100038387 Ga0068863_1000383873 410
798 3300005842 Ga0068858_100031020 Ga0068858_1000310202 410
799 3300005843 Ga0068860_100103439 Ga0068860_1001034391 410
800 3300006358 Ga0068871_100115006 Ga0068871_1001150062 410
801 3300009094 Ga0111539_10321122 Ga0111539_103211222 410
802 3300009176 Ga0105242_10051227 Ga0105242_100512271 410
803 3300013297 Ga0157378_10211414 Ga0157378_102114142 410
804 3300014326 Ga0157380_10027018 Ga0157380_100270183 410
805 3300014745 Ga0157377_10001099 Ga0157377_100010996 410
806 3300025290 Ga0207673_1005156 Ga0207673_10051562 410
807 3300025315 Ga0207697_10006731 Ga0207697_100067311 410
808 3300025893 Ga0207682_10002959 Ga0207682_100029591 410
809 3300025901 Ga0207688_10002136 Ga0207688_1000213611 410
810 3300025908 Ga0207643_10001221 Ga0207643_100012216 410
811 3300025918 Ga0207662_10000955 Ga0207662_1000095511 410
812 3300025919 Ga0207657_10018754 Ga0207657_100187541 410
813 3300025925 Ga0207650_10253540 Ga0207650_102535401 410
814 3300025933 Ga0207706_10033937 Ga0207706_100339374 410
815 3300025936 Ga0207670_10017943 Ga0207670_100179434 410
816 3300025937 Ga0207669_10048691 Ga0207669_100486912 410
817 3300025940 Ga0207691_10006761 Ga0207691_100067616 410
818 3300025942 Ga0207689_10084459 Ga0207689_100844591 410
819 3300025972 Ga0207668_10044426 Ga0207668_100444262 410
820 3300026067 Ga0207678_10001814 Ga0207678_1000181412 410
821 3300026075 Ga0207708_10001722 Ga0207708_1000172210 410
822 3300026088 Ga0207641_10011922 Ga0207641_100119226 410
823 3300026089 Ga0207648_10000390 Ga0207648_1000039034 410
824 3300026095 Ga0207676_10011268 Ga0207676_100112686 410
825 3300026116 Ga0207674_10001187 Ga0207674_1000118720 410
826 3300026118 Ga0207675_100001324 Ga0207675_1000013249 410
827 3300026121 Ga0207683_10005075 Ga0207683_100050753 410
828 3300046492 Ga0495585_0000070 Ga0495585_0000070_60072_61328 410
829 3300046492 Ga0495585_0084830 Ga0495585_0084830_214_1464 410
830 3300046500 Ga0495596_0026656 Ga0495596_0026656_660_1910 410
831 3300046501 Ga0495607_0045259 Ga0495607_0045259_195_1445 410
832 3300046506 Ga0495583_0036365 Ga0495583_0036365_370_1620 410
833 3300046519 Ga0495632_0079468 Ga0495632_0079468_246_1496 410
834 3300046528 Ga0495642_0004009 Ga0495642_0004009_2448_3698 410
835 3300046648 Ga0495611_0002422 Ga0495611_0002422_6573_7823 410
836 3300046665 Ga0495661_0039486 Ga0495661_0039486_649_1899 410
837 3300046691 Ga0495670_0006944 Ga0495670_0006944_3468_4718 410
838 3300047323 Ga0495683_0058034 Ga0495683_0058034_463_1713 410
839 3300047445 Ga0495677_0005202 Ga0495677_0005202_3489_4739 410
840 3300048907 Ga0496104_0222813 Ga0496104_0222813_189_1448 410
841 3300048908 Ga0496105_0012504 Ga0496105_0012504_1674_2945 410
842 3300048912 Ga0496109_0069956 Ga0496109_0069956_1154_2413 410
843 3300048913 Ga0496110_0003288 Ga0496110_0003288_6403_7674 410
844 3300049460 Ga0495682_0010895 Ga0495682_0010895_20_1270 410
845 iso_pu_bacteria 8003400568 8003403328 410
846 3300003187 JGI25151J46595_10009669 JGI25151J46595_100096694 415
847 3300003781 Ga0055536_1000078 Ga0055536_100007821 415
848 3300003784 Ga0055534_1003267 Ga0055534_10032673 415
849 3300025291 Ga0209675_1000087 Ga0209675_100008722 415
850 3300025292 Ga0209676_1000176 Ga0209676_100017662 415
851 3300025294 Ga0209025_1000046 Ga0209025_1000046109 415
852 3300025295 Ga0209564_1000166 Ga0209564_1000166143 415
853 3300025295 Ga0209564_1001192 Ga0209564_100119222 415
854 3300046526 Ga0495666_0075288 Ga0495666_0075288_214_1506 415
855 3300046531 Ga0495665_0036044 Ga0495665_0036044_1325_2617 415
856 3300047317 Ga0495604_0159079 Ga0495604_0159079_260_1552 415

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

5

373

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hl6-assembly2.cif.gz_C yfde from escherichia coli 0.9526 10 388
4hl6-assembly2.cif.gz_C yfde from escherichia coli 0.9477 10 388
1pt8-assembly1.cif.gz_B crystal structure of the yfdw gene product of e. coli, in complex with oxalate and acetyl-coa 0.9418 10 401
5yit-assembly2.cif.gz_D crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.9406 10 381
1vgr-assembly1.cif.gz_B formyl-coa transferase mutant asp169 to glu 0.9393 10 401
ID Description Score Start End Superfamily
af_Q4V9F2_1_227_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9705 31 243 3.40.50.10540
af_Q9VDL4_46_327_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9681 10 290 3.40.50.10540
af_Q68FU4_261_348_3.30.1540.10 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9636 234 321 3.30.1540.10
af_Q9VDL4_46_327_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9614 10 290 3.40.50.10540
4hl6E02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9604 233 324 3.30.1540.10
ID Description Score Start End GO Terms
AF-A0A497KNB9-F1-model_v4 CoA transferase 0.9863 10 403 GO:0008410
AF-A0A1F9DFM9-F1-model_v4 Formyl-CoA transferase 0.9859 10 401 GO:0008410
AF-A0A0R3CBW1-F1-model_v4 CoA-transferase 0.9848 13 405 GO:0008410
AF-A0A7W7Q1P1-F1-model_v4 Formyl-CoA transferase (EC 2.8.3.16) 0.9838 10 403 GO:0033608
AF-A0A5N9BBE6-F1-model_v4 CoA transferase 0.9836 9 405 GO:0008410

Feature Viewer

pLDDT pTM Quality
92.48 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map