F483667
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 856 | 396 | 843 | 404 |
Family's Representative Sequence
| Representative Sequence | 3300044684|Ga0466966_0062825|Ga0466966_0062825_836_2044 |
| Length | 402 |
| Sequence | VKGALEGIKVVELAQIMAGPTCGMLLADMGADVIKVEKLPGGDDTRSYSEPQIAGESAAFMMMNRNKRGIAVNLKTPGGLEVVKRLLADADVVTENYRKGTLEKLGLGYEEVLKALNPRLIYCAISGYGRSGPYADKGGFDLIAQGFAGIMSITGEPGGPPAKSGTSIADINAGILAALGILAAVIAREKTGRGQVVETSLMEAAVQQTFWHAAMFFATGVNPGPTGSAHILTAPYQAFPTRDGWINIGGANQSNWERIVKVIGRPELAQDARFRTNGDRMRNLQALTPLIAERLRERPSADWIRDFEAAGVPVGPVNRIGDMLADPQVAAREMVLEVDHPRVGRMKTLGTPIKFSQTPGAVRRPAPLLGEHTREVLEELGYSGAEVEKLQREGAVFSSPTR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 2 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 3 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 4 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 5 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 6 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 7 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 8 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 9 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 10 | 2941479691 | |||
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 194 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 197 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 198 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 207 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 208 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 213 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 233 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 234 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 235 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 236 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 237 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 238 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 239 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 241 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 242 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 329 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 330 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 331 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 332 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 333 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 334 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 335 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 336 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 337 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 338 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 339 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 340 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 341 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 372 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 380 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 383 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 384 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 385 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 386 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 387 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 388 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 389 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 391 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 394 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 395 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 396 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.36 |
| Metatranscriptomes | 0.12 |
| Isolates | 1.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.8 |
| Nodule | 0.12 |
| Rhizoplane | 2.8 |
| Rhizosphere | 91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10009669 | 3300003187 | Bacteria | 4546 |
| 2 | Ga0055536_1000078 | 3300003781 | Bacteria | 83510 |
| 3 | Ga0055534_1003267 | 3300003784 | Bacteria | 5170 |
| 4 | Ga0065712_10153779 | 3300005290 | Bacteria | 1350 |
| 5 | Ga0065715_10093842 | 3300005293 | Bacteria | 4518 |
| 6 | Ga0070658_10023545 | 3300005327 | Bacteria | 4941 |
| 7 | Ga0070683_100030072 | 3300005329 | Bacteria | 4925 |
| 8 | Ga0070683_100035551 | 3300005329 | Bacteria | 4554 |
| 9 | Ga0070690_100004977 | 3300005330 | Bacteria | 7438 |
| 10 | Ga0070690_100025925 | 3300005330 | Bacteria | 3612 |
| 11 | Ga0070670_100004715 | 3300005331 | Bacteria | 11440 |
| 12 | Ga0070670_100033282 | 3300005331 | Bacteria | 4440 |
| 13 | Ga0070670_100162152 | 3300005331 | Bacteria | 1938 |
| 14 | Ga0068869_100009266 | 3300005334 | Bacteria | 6382 |
| 15 | Ga0068869_100026457 | 3300005334 | Bacteria | 4039 |
| 16 | Ga0068869_100045360 | 3300005334 | Bacteria | 3164 |
| 17 | Ga0068869_100055053 | 3300005334 | Bacteria | 2898 |
| 18 | Ga0070680_100012912 | 3300005336 | Bacteria | 6497 |
| 19 | Ga0070680_100070126 | 3300005336 | Bacteria | 2879 |
| 20 | Ga0068868_100002303 | 3300005338 | Bacteria | 13210 |
| 21 | Ga0068868_100140757 | 3300005338 | Bacteria | 1980 |
| 22 | Ga0070660_100066874 | 3300005339 | Bacteria | 2799 |
| 23 | Ga0070660_100071696 | 3300005339 | Bacteria | 2705 |
| 24 | Ga0070689_100013040 | 3300005340 | Bacteria | 6004 |
| 25 | Ga0070689_100058778 | 3300005340 | Bacteria | 2987 |
| 26 | Ga0070689_100179382 | 3300005340 | Bacteria | 1720 |
| 27 | Ga0070691_10017191 | 3300005341 | Bacteria | 3329 |
| 28 | Ga0070687_100041726 | 3300005343 | Bacteria | 2320 |
| 29 | Ga0070687_100070244 | 3300005343 | Bacteria | 1878 |
| 30 | Ga0070661_100000659 | 3300005344 | Bacteria | 25350 |
| 31 | Ga0070661_100007548 | 3300005344 | Bacteria | 7503 |
| 32 | Ga0070661_100047204 | 3300005344 | Bacteria | 3151 |
| 33 | Ga0070661_100067057 | 3300005344 | Bacteria | 2637 |
| 34 | Ga0070692_10000696 | 3300005345 | Bacteria | 10820 |
| 35 | Ga0070692_10009789 | 3300005345 | Bacteria | 4338 |
| 36 | Ga0070692_10027835 | 3300005345 | Bacteria | 2806 |
| 37 | Ga0070668_100014114 | 3300005347 | Bacteria | 5971 |
| 38 | Ga0070668_100112468 | 3300005347 | Bacteria | 2168 |
| 39 | Ga0070669_100002777 | 3300005353 | Bacteria | 12628 |
| 40 | Ga0070671_100113740 | 3300005355 | Bacteria | 2275 |
| 41 | Ga0070673_100159082 | 3300005364 | Bacteria | 1919 |
| 42 | Ga0070688_100028038 | 3300005365 | Bacteria | 3358 |
| 43 | Ga0070688_100041331 | 3300005365 | Bacteria | 2829 |
| 44 | Ga0070688_100150850 | 3300005365 | Bacteria | 1589 |
| 45 | Ga0070659_100002518 | 3300005366 | Bacteria | 13010 |
| 46 | Ga0070659_100066189 | 3300005366 | Bacteria | 2863 |
| 47 | Ga0070659_100086474 | 3300005366 | Bacteria | 2509 |
| 48 | Ga0070667_100090477 | 3300005367 | Bacteria | 2630 |
| 49 | Ga0070667_100098296 | 3300005367 | Bacteria | 2526 |
| 50 | Ga0070703_10008813 | 3300005406 | Bacteria | 2841 |
| 51 | Ga0070703_10043619 | 3300005406 | Bacteria | 1407 |
| 52 | Ga0070709_10028027 | 3300005434 | Bacteria | 3356 |
| 53 | Ga0070714_100001230 | 3300005435 | Bacteria | 18485 |
| 54 | Ga0070714_100004849 | 3300005435 | Bacteria | 10213 |
| 55 | Ga0070714_100012985 | 3300005435 | Bacteria | 6662 |
| 56 | Ga0070714_100027080 | 3300005435 | Bacteria | 4743 |
| 57 | Ga0070713_100000039 | 3300005436 | Bacteria | 83384 |
| 58 | Ga0070713_100010346 | 3300005436 | Bacteria | 6737 |
| 59 | Ga0070713_100094764 | 3300005436 | Bacteria | 2574 |
| 60 | Ga0070713_100103266 | 3300005436 | Bacteria | 2473 |
| 61 | Ga0070710_10056986 | 3300005437 | Bacteria | 2213 |
| 62 | Ga0070701_10000703 | 3300005438 | Bacteria | 11831 |
| 63 | Ga0070701_10059281 | 3300005438 | Bacteria | 2012 |
| 64 | Ga0070711_100014181 | 3300005439 | Bacteria | 5017 |
| 65 | Ga0070711_100122753 | 3300005439 | Bacteria | 1924 |
| 66 | Ga0070705_100000030 | 3300005440 | Bacteria | 71489 |
| 67 | Ga0070700_100001420 | 3300005441 | Bacteria | 11926 |
| 68 | Ga0070700_100007478 | 3300005441 | Bacteria | 5903 |
| 69 | Ga0070700_100024997 | 3300005441 | Bacteria | 3513 |
| 70 | Ga0070694_100002295 | 3300005444 | Bacteria | 11315 |
| 71 | Ga0070694_100057040 | 3300005444 | Bacteria | 2654 |
| 72 | Ga0070708_100041230 | 3300005445 | Bacteria | 4047 |
| 73 | Ga0070708_100048373 | 3300005445 | Bacteria | 3758 |
| 74 | Ga0070708_100109486 | 3300005445 | Bacteria | 2538 |
| 75 | Ga0070663_100002206 | 3300005455 | Bacteria | 10895 |
| 76 | Ga0070662_100002542 | 3300005457 | Bacteria | 11237 |
| 77 | Ga0070662_100039776 | 3300005457 | Bacteria | 3345 |
| 78 | Ga0068867_100006181 | 3300005459 | Bacteria | 8479 |
| 79 | Ga0068867_100043771 | 3300005459 | Bacteria | 3278 |
| 80 | Ga0068867_100141170 | 3300005459 | Bacteria | 1883 |
| 81 | Ga0070707_100135214 | 3300005468 | Bacteria | 2398 |
| 82 | Ga0070699_100029571 | 3300005518 | Bacteria | 4724 |
| 83 | Ga0070699_100039484 | 3300005518 | Bacteria | 4086 |
| 84 | Ga0070699_100072619 | 3300005518 | Bacteria | 2993 |
| 85 | Ga0070679_100088227 | 3300005530 | Bacteria | 3089 |
| 86 | Ga0070679_100106800 | 3300005530 | Bacteria | 2785 |
| 87 | Ga0070679_100161494 | 3300005530 | Bacteria | 2215 |
| 88 | Ga0070679_100190438 | 3300005530 | Bacteria | 2020 |
| 89 | Ga0070684_100029664 | 3300005535 | Bacteria | 4638 |
| 90 | Ga0070672_100018451 | 3300005543 | Bacteria | 5044 |
| 91 | Ga0070672_100048210 | 3300005543 | Bacteria | 3309 |
| 92 | Ga0070686_100016610 | 3300005544 | Bacteria | 4284 |
| 93 | Ga0070686_100043687 | 3300005544 | Bacteria | 2813 |
| 94 | Ga0070695_100000012 | 3300005545 | Bacteria | 69784 |
| 95 | Ga0070696_100000647 | 3300005546 | Bacteria | 22250 |
| 96 | Ga0070696_100033945 | 3300005546 | Bacteria | 3508 |
| 97 | Ga0070693_100000027 | 3300005547 | Bacteria | 56179 |
| 98 | Ga0070693_100008685 | 3300005547 | Bacteria | 5027 |
| 99 | Ga0070693_100045556 | 3300005547 | Bacteria | 2487 |
| 100 | Ga0070665_100033723 | 3300005548 | Bacteria | 5150 |
| 101 | Ga0070665_100112933 | 3300005548 | Bacteria | 2720 |
| 102 | Ga0070704_100038598 | 3300005549 | Bacteria | 3273 |
| 103 | Ga0070704_100055146 | 3300005549 | Bacteria | 2816 |
| 104 | Ga0068855_100002039 | 3300005563 | Bacteria | 25044 |
| 105 | Ga0068855_100006103 | 3300005563 | Bacteria | 14694 |
| 106 | Ga0068855_100007555 | 3300005563 | Bacteria | 13153 |
| 107 | Ga0068855_100026884 | 3300005563 | Bacteria | 6885 |
| 108 | Ga0068855_100066930 | 3300005563 | Bacteria | 4187 |
| 109 | Ga0070664_100000157 | 3300005564 | Bacteria | 47128 |
| 110 | Ga0070664_100000662 | 3300005564 | Bacteria | 26301 |
| 111 | Ga0070664_100071399 | 3300005564 | Bacteria | 2975 |
| 112 | Ga0070664_100166989 | 3300005564 | Bacteria | 1950 |
| 113 | Ga0068857_100002118 | 3300005577 | Bacteria | 16141 |
| 114 | Ga0068857_100009373 | 3300005577 | Bacteria | 8498 |
| 115 | Ga0068854_100022259 | 3300005578 | Bacteria | 4314 |
| 116 | Ga0068854_100110307 | 3300005578 | Bacteria | 2074 |
| 117 | Ga0068856_100001976 | 3300005614 | Bacteria | 21379 |
| 118 | Ga0068856_100003357 | 3300005614 | Bacteria | 16236 |
| 119 | Ga0068856_100008502 | 3300005614 | Bacteria | 9983 |
| 120 | Ga0068856_100079683 | 3300005614 | Bacteria | 3248 |
| 121 | Ga0068856_100094237 | 3300005614 | Bacteria | 2981 |
| 122 | Ga0068856_100178136 | 3300005614 | Bacteria | 2138 |
| 123 | Ga0070702_100010845 | 3300005615 | Bacteria | 4509 |
| 124 | Ga0070702_100028015 | 3300005615 | Bacteria | 3048 |
| 125 | Ga0068852_100000463 | 3300005616 | Bacteria | 26797 |
| 126 | Ga0068852_100000826 | 3300005616 | Bacteria | 20462 |
| 127 | Ga0068852_100123744 | 3300005616 | Bacteria | 2372 |
| 128 | Ga0068852_100175327 | 3300005616 | Bacteria | 2013 |
| 129 | Ga0068859_100000392 | 3300005617 | Bacteria | 43640 |
| 130 | Ga0068859_100134643 | 3300005617 | Bacteria | 2543 |
| 131 | Ga0068859_100188690 | 3300005617 | Bacteria | 2145 |
| 132 | Ga0068864_100021685 | 3300005618 | Bacteria | 5380 |
| 133 | Ga0068864_100030787 | 3300005618 | Bacteria | 4550 |
| 134 | Ga0068866_10000043 | 3300005718 | Bacteria | 48570 |
| 135 | Ga0068866_10007294 | 3300005718 | Bacteria | 4628 |
| 136 | Ga0068861_100001807 | 3300005719 | Bacteria | 13779 |
| 137 | Ga0068861_100034057 | 3300005719 | Bacteria | 3764 |
| 138 | Ga0068861_100036886 | 3300005719 | Bacteria | 3631 |
| 139 | Ga0068861_100127263 | 3300005719 | Bacteria | 2063 |
| 140 | Ga0068851_10000646 | 3300005834 | Bacteria | 14832 |
| 141 | Ga0068851_10005030 | 3300005834 | Bacteria | 5996 |
| 142 | Ga0068851_10006641 | 3300005834 | Bacteria | 5293 |
| 143 | Ga0068851_10015994 | 3300005834 | Bacteria | 3583 |
| 144 | Ga0068870_10024040 | 3300005840 | Bacteria | 3012 |
| 145 | Ga0068863_100028084 | 3300005841 | Bacteria | 5371 |
| 146 | Ga0068863_100038387 | 3300005841 | Bacteria | 4556 |
| 147 | Ga0068863_100040551 | 3300005841 | Bacteria | 4427 |
| 148 | Ga0068863_100071731 | 3300005841 | Bacteria | 3276 |
| 149 | Ga0068858_100031020 | 3300005842 | Bacteria | 4964 |
| 150 | Ga0068858_100117864 | 3300005842 | Bacteria | 2482 |
| 151 | Ga0068860_100003708 | 3300005843 | Bacteria | 15716 |
| 152 | Ga0068860_100026812 | 3300005843 | Bacteria | 5552 |
| 153 | Ga0068860_100048523 | 3300005843 | Bacteria | 4047 |
| 154 | Ga0068860_100103439 | 3300005843 | Bacteria | 2718 |
| 155 | Ga0068862_100015761 | 3300005844 | Bacteria | 6281 |
| 156 | Ga0068862_100051657 | 3300005844 | Bacteria | 3516 |
| 157 | Ga0068862_100064192 | 3300005844 | Bacteria | 3161 |
| 158 | Ga0068862_100203587 | 3300005844 | Bacteria | 1786 |
| 159 | Ga0075364_10028450 | 3300006051 | Bacteria | 3578 |
| 160 | Ga0070712_100026720 | 3300006175 | Bacteria | 3849 |
| 161 | Ga0068871_100000355 | 3300006358 | Bacteria | 31904 |
| 162 | Ga0068871_100009417 | 3300006358 | Bacteria | 7075 |
| 163 | Ga0068871_100115006 | 3300006358 | Bacteria | 2267 |
| 164 | Ga0068871_100154175 | 3300006358 | Bacteria | 1960 |
| 165 | Ga0075428_100000433 | 3300006844 | Bacteria | 41623 |
| 166 | Ga0075428_100017431 | 3300006844 | Bacteria | 7937 |
| 167 | Ga0075430_100033993 | 3300006846 | Bacteria | 4326 |
| 168 | Ga0075430_100138527 | 3300006846 | Bacteria | 2027 |
| 169 | Ga0075431_100012395 | 3300006847 | Bacteria | 8604 |
| 170 | Ga0075433_10009565 | 3300006852 | Bacteria | 7752 |
| 171 | Ga0075434_100030336 | 3300006871 | Bacteria | 5324 |
| 172 | Ga0075434_100275159 | 3300006871 | Bacteria | 1703 |
| 173 | Ga0075429_100000037 | 3300006880 | Bacteria | 62099 |
| 174 | Ga0068865_100001523 | 3300006881 | Bacteria | 13522 |
| 175 | Ga0075436_100000745 | 3300006914 | Bacteria | 21546 |
| 176 | Ga0075436_100090191 | 3300006914 | Bacteria | 2131 |
| 177 | Ga0097620_100000392 | 3300006931 | Bacteria | 43640 |
| 178 | Ga0097620_100134648 | 3300006931 | Bacteria | 2543 |
| 179 | Ga0097620_100188705 | 3300006931 | Bacteria | 2145 |
| 180 | Ga0075435_100037977 | 3300007076 | Bacteria | 3838 |
| 181 | Ga0105240_10004865 | 3300009093 | Bacteria | 20216 |
| 182 | Ga0105240_10006057 | 3300009093 | Bacteria | 17866 |
| 183 | Ga0105240_10007858 | 3300009093 | Bacteria | 15392 |
| 184 | Ga0105240_10017051 | 3300009093 | Bacteria | 9808 |
| 185 | Ga0105240_10137311 | 3300009093 | Bacteria | 2927 |
| 186 | Ga0105240_10156464 | 3300009093 | Bacteria | 2710 |
| 187 | Ga0105240_10203960 | 3300009093 | Bacteria | 2316 |
| 188 | Ga0111539_10002706 | 3300009094 | Bacteria | 23507 |
| 189 | Ga0111539_10036739 | 3300009094 | Bacteria | 5919 |
| 190 | Ga0111539_10060596 | 3300009094 | Bacteria | 4485 |
| 191 | Ga0111539_10296055 | 3300009094 | Bacteria | 1883 |
| 192 | Ga0111539_10321122 | 3300009094 | Bacteria | 1802 |
| 193 | Ga0105245_10000177 | 3300009098 | Bacteria | 60854 |
| 194 | Ga0105245_10019049 | 3300009098 | Bacteria | 6007 |
| 195 | Ga0105245_10051828 | 3300009098 | Bacteria | 3679 |
| 196 | Ga0105245_10246551 | 3300009098 | Bacteria | 1734 |
| 197 | Ga0105245_10252363 | 3300009098 | Bacteria | 1714 |
| 198 | Ga0114129_10001488 | 3300009147 | Bacteria | 31713 |
| 199 | Ga0114129_10486319 | 3300009147 | Bacteria | 1614 |
| 200 | Ga0105243_10000815 | 3300009148 | Bacteria | 29736 |
| 201 | Ga0105243_10023905 | 3300009148 | Bacteria | 4657 |
| 202 | Ga0105243_10239582 | 3300009148 | Bacteria | 1613 |
| 203 | Ga0105241_10008874 | 3300009174 | Bacteria | 7394 |
| 204 | Ga0105241_10011109 | 3300009174 | Bacteria | 6606 |
| 205 | Ga0105242_10000061 | 3300009176 | Bacteria | 75148 |
| 206 | Ga0105242_10041962 | 3300009176 | Bacteria | 3692 |
| 207 | Ga0105242_10051227 | 3300009176 | Bacteria | 3364 |
| 208 | Ga0105248_10001643 | 3300009177 | Bacteria | 24867 |
| 209 | Ga0105248_10024460 | 3300009177 | Bacteria | 6715 |
| 210 | Ga0105248_10439293 | 3300009177 | Bacteria | 1470 |
| 211 | Ga0105237_10008781 | 3300009545 | Bacteria | 10901 |
| 212 | Ga0105237_10037224 | 3300009545 | Bacteria | 4919 |
| 213 | Ga0105237_10497672 | 3300009545 | Bacteria | 1225 |
| 214 | Ga0105238_10174123 | 3300009551 | Bacteria | 2128 |
| 215 | Ga0105238_10243138 | 3300009551 | Bacteria | 1777 |
| 216 | Ga0105249_10038052 | 3300009553 | Bacteria | 4365 |
| 217 | Ga0105249_10450239 | 3300009553 | Bacteria | 1326 |
| 218 | Ga0105246_10118737 | 3300011119 | Bacteria | 1956 |
| 219 | Ga0157373_10001573 | 3300013100 | Bacteria | 17415 |
| 220 | Ga0157371_10002592 | 3300013102 | Bacteria | 17154 |
| 221 | Ga0157371_10016262 | 3300013102 | Bacteria | 5557 |
| 222 | Ga0157371_10032016 | 3300013102 | Bacteria | 3786 |
| 223 | Ga0157371_10074086 | 3300013102 | Bacteria | 2411 |
| 224 | Ga0157370_10001120 | 3300013104 | Bacteria | 33464 |
| 225 | Ga0157370_10010117 | 3300013104 | Bacteria | 9961 |
| 226 | Ga0157370_10011680 | 3300013104 | Bacteria | 9168 |
| 227 | Ga0157370_10016253 | 3300013104 | Bacteria | 7540 |
| 228 | Ga0157370_10063953 | 3300013104 | Bacteria | 3484 |
| 229 | Ga0157370_10189109 | 3300013104 | Bacteria | 1911 |
| 230 | Ga0157369_10004919 | 3300013105 | Bacteria | 15662 |
| 231 | Ga0157369_10018035 | 3300013105 | Bacteria | 7919 |
| 232 | Ga0157369_10018830 | 3300013105 | Bacteria | 7737 |
| 233 | Ga0157369_10080806 | 3300013105 | Bacteria | 3480 |
| 234 | Ga0157369_10222223 | 3300013105 | Bacteria | 1977 |
| 235 | Ga0157374_10003153 | 3300013296 | Bacteria | 13861 |
| 236 | Ga0157378_10006628 | 3300013297 | Bacteria | 10120 |
| 237 | Ga0157378_10211414 | 3300013297 | Bacteria | 1839 |
| 238 | Ga0163162_10024159 | 3300013306 | Bacteria | 5998 |
| 239 | Ga0157372_10001409 | 3300013307 | Bacteria | 25953 |
| 240 | Ga0157372_10004130 | 3300013307 | Bacteria | 15553 |
| 241 | Ga0157372_10009719 | 3300013307 | Bacteria | 10230 |
| 242 | Ga0157372_10019156 | 3300013307 | Bacteria | 7369 |
| 243 | Ga0157372_10028828 | 3300013307 | Bacteria | 6059 |
| 244 | Ga0157372_10105630 | 3300013307 | Bacteria | 3221 |
| 245 | Ga0157372_10353122 | 3300013307 | Bacteria | 1713 |
| 246 | Ga0163163_10029549 | 3300014325 | Bacteria | 5274 |
| 247 | Ga0157380_10005369 | 3300014326 | Bacteria | 8954 |
| 248 | Ga0157380_10027018 | 3300014326 | Bacteria | 4361 |
| 249 | Ga0157380_10041923 | 3300014326 | Bacteria | 3575 |
| 250 | Ga0182008_10056854 | 3300014497 | Bacteria | 1932 |
| 251 | Ga0157377_10001099 | 3300014745 | Bacteria | 11433 |
| 252 | Ga0157377_10011882 | 3300014745 | Bacteria | 4359 |
| 253 | Ga0157377_10021138 | 3300014745 | Bacteria | 3419 |
| 254 | Ga0157379_10006850 | 3300014968 | Bacteria | 9851 |
| 255 | Ga0157379_10034163 | 3300014968 | Bacteria | 4532 |
| 256 | Ga0157376_10009080 | 3300014969 | Bacteria | 7203 |
| 257 | Ga0157376_10023143 | 3300014969 | Bacteria | 4858 |
| 258 | Ga0157376_10023970 | 3300014969 | Bacteria | 4786 |
| 259 | Ga0206356_11263179 | 3300020070 | Bacteria | 3204 |
| 260 | Ga0207673_1005156 | 3300025290 | Bacteria | 1586 |
| 261 | Ga0209675_1000087 | 3300025291 | Bacteria | 147632 |
| 262 | Ga0209676_1000176 | 3300025292 | Bacteria | 152347 |
| 263 | Ga0209025_1000046 | 3300025294 | Bacteria | 348962 |
| 264 | Ga0209564_1000166 | 3300025295 | Bacteria | 160208 |
| 265 | Ga0209564_1001192 | 3300025295 | Bacteria | 29807 |
| 266 | Ga0209050_1009762 | 3300025298 | Bacteria | 4847 |
| 267 | Ga0209051_1019461 | 3300025303 | Bacteria | 2960 |
| 268 | Ga0207697_10006731 | 3300025315 | Bacteria | 5172 |
| 269 | Ga0207656_10007190 | 3300025321 | Bacteria | 4045 |
| 270 | Ga0207656_10069901 | 3300025321 | Bacteria | 1558 |
| 271 | Ga0207682_10002959 | 3300025893 | Bacteria | 7456 |
| 272 | Ga0207688_10002136 | 3300025901 | Bacteria | 10623 |
| 273 | Ga0207699_10023529 | 3300025906 | Bacteria | 3353 |
| 274 | Ga0207699_10120966 | 3300025906 | Bacteria | 1693 |
| 275 | Ga0207645_10100494 | 3300025907 | Bacteria | 1866 |
| 276 | Ga0207643_10001221 | 3300025908 | Bacteria | 15187 |
| 277 | Ga0207705_10006285 | 3300025909 | Bacteria | 8819 |
| 278 | Ga0207705_10008790 | 3300025909 | Bacteria | 7363 |
| 279 | Ga0207684_10012685 | 3300025910 | Bacteria | 7316 |
| 280 | Ga0207707_10016373 | 3300025912 | Bacteria | 6466 |
| 281 | Ga0207707_10171738 | 3300025912 | Bacteria | 1894 |
| 282 | Ga0207707_10219782 | 3300025912 | Bacteria | 1654 |
| 283 | Ga0207695_10016171 | 3300025913 | Bacteria | 8749 |
| 284 | Ga0207695_10024678 | 3300025913 | Bacteria | 6754 |
| 285 | Ga0207695_10063273 | 3300025913 | Bacteria | 3815 |
| 286 | Ga0207695_10281550 | 3300025913 | Bacteria | 1556 |
| 287 | Ga0207671_10031796 | 3300025914 | Bacteria | 3931 |
| 288 | Ga0207693_10016820 | 3300025915 | Bacteria | 5838 |
| 289 | Ga0207693_10086019 | 3300025915 | Bacteria | 2463 |
| 290 | Ga0207663_10071354 | 3300025916 | Bacteria | 2241 |
| 291 | Ga0207663_10100575 | 3300025916 | Bacteria | 1941 |
| 292 | Ga0207660_10000918 | 3300025917 | Bacteria | 19431 |
| 293 | Ga0207662_10000613 | 3300025918 | Bacteria | 15965 |
| 294 | Ga0207662_10000955 | 3300025918 | Bacteria | 13409 |
| 295 | Ga0207662_10013861 | 3300025918 | Bacteria | 4512 |
| 296 | Ga0207657_10000142 | 3300025919 | Bacteria | 72309 |
| 297 | Ga0207657_10002457 | 3300025919 | Bacteria | 20027 |
| 298 | Ga0207657_10018754 | 3300025919 | Bacteria | 6590 |
| 299 | Ga0207657_10037939 | 3300025919 | Bacteria | 4296 |
| 300 | Ga0207649_10079168 | 3300025920 | Bacteria | 2122 |
| 301 | Ga0207652_10069331 | 3300025921 | Bacteria | 3061 |
| 302 | Ga0207652_10099837 | 3300025921 | Bacteria | 2562 |
| 303 | Ga0207652_10120843 | 3300025921 | Bacteria | 2330 |
| 304 | Ga0207646_10034393 | 3300025922 | Bacteria | 4579 |
| 305 | Ga0207681_10000912 | 3300025923 | Bacteria | 19295 |
| 306 | Ga0207681_10026305 | 3300025923 | Bacteria | 3752 |
| 307 | Ga0207694_10006781 | 3300025924 | Bacteria | 8697 |
| 308 | Ga0207694_10010483 | 3300025924 | Bacteria | 6990 |
| 309 | Ga0207694_10014521 | 3300025924 | Bacteria | 5938 |
| 310 | Ga0207694_10072202 | 3300025924 | Bacteria | 2698 |
| 311 | Ga0207650_10253540 | 3300025925 | Bacteria | 1425 |
| 312 | Ga0207659_10041583 | 3300025926 | Bacteria | 3219 |
| 313 | Ga0207687_10001330 | 3300025927 | Bacteria | 16893 |
| 314 | Ga0207687_10002728 | 3300025927 | Bacteria | 11957 |
| 315 | Ga0207700_10000120 | 3300025928 | Bacteria | 46325 |
| 316 | Ga0207700_10100186 | 3300025928 | Bacteria | 2308 |
| 317 | Ga0207700_10140288 | 3300025928 | Bacteria | 1985 |
| 318 | Ga0207700_10211181 | 3300025928 | Bacteria | 1641 |
| 319 | Ga0207664_10004956 | 3300025929 | Bacteria | 9058 |
| 320 | Ga0207664_10008029 | 3300025929 | Bacteria | 7338 |
| 321 | Ga0207664_10034956 | 3300025929 | Bacteria | 3874 |
| 322 | Ga0207664_10041785 | 3300025929 | Bacteria | 3574 |
| 323 | Ga0207644_10002797 | 3300025931 | Bacteria | 11244 |
| 324 | Ga0207644_10041665 | 3300025931 | Bacteria | 3249 |
| 325 | Ga0207644_10065328 | 3300025931 | Bacteria | 2646 |
| 326 | Ga0207690_10045820 | 3300025932 | Bacteria | 2892 |
| 327 | Ga0207706_10002770 | 3300025933 | Bacteria | 17037 |
| 328 | Ga0207706_10033937 | 3300025933 | Bacteria | 4542 |
| 329 | Ga0207706_10034357 | 3300025933 | Bacteria | 4511 |
| 330 | Ga0207706_10182149 | 3300025933 | Bacteria | 1845 |
| 331 | Ga0207686_10023547 | 3300025934 | Bacteria | 3558 |
| 332 | Ga0207686_10027898 | 3300025934 | Bacteria | 3312 |
| 333 | Ga0207686_10089750 | 3300025934 | Bacteria | 2026 |
| 334 | Ga0207709_10010869 | 3300025935 | Bacteria | 5014 |
| 335 | Ga0207709_10017319 | 3300025935 | Bacteria | 4020 |
| 336 | Ga0207709_10027627 | 3300025935 | Bacteria | 3271 |
| 337 | Ga0207709_10179714 | 3300025935 | Bacteria | 1493 |
| 338 | Ga0207670_10017943 | 3300025936 | Bacteria | 4288 |
| 339 | Ga0207670_10034431 | 3300025936 | Bacteria | 3273 |
| 340 | Ga0207670_10060616 | 3300025936 | Bacteria | 2578 |
| 341 | Ga0207670_10077602 | 3300025936 | Bacteria | 2314 |
| 342 | Ga0207670_10115436 | 3300025936 | Bacteria | 1942 |
| 343 | Ga0207669_10048691 | 3300025937 | Bacteria | 2520 |
| 344 | Ga0207669_10146228 | 3300025937 | Bacteria | 1649 |
| 345 | Ga0207704_10000892 | 3300025938 | Bacteria | 13241 |
| 346 | Ga0207704_10010443 | 3300025938 | Bacteria | 4531 |
| 347 | Ga0207704_10060219 | 3300025938 | Bacteria | 2348 |
| 348 | Ga0207665_10008190 | 3300025939 | Bacteria | 6901 |
| 349 | Ga0207665_10063847 | 3300025939 | Bacteria | 2502 |
| 350 | Ga0207691_10001738 | 3300025940 | Bacteria | 21476 |
| 351 | Ga0207691_10006761 | 3300025940 | Bacteria | 11060 |
| 352 | Ga0207691_10032133 | 3300025940 | Bacteria | 4895 |
| 353 | Ga0207711_10000116 | 3300025941 | Bacteria | 83390 |
| 354 | Ga0207711_10007075 | 3300025941 | Bacteria | 9402 |
| 355 | Ga0207711_10010699 | 3300025941 | Bacteria | 7630 |
| 356 | Ga0207711_10050017 | 3300025941 | Bacteria | 3578 |
| 357 | Ga0207689_10000209 | 3300025942 | Bacteria | 51679 |
| 358 | Ga0207689_10076277 | 3300025942 | Bacteria | 2756 |
| 359 | Ga0207689_10084459 | 3300025942 | Bacteria | 2610 |
| 360 | Ga0207661_10099519 | 3300025944 | Bacteria | 2439 |
| 361 | Ga0207679_10002033 | 3300025945 | Bacteria | 12549 |
| 362 | Ga0207679_10018769 | 3300025945 | Bacteria | 4639 |
| 363 | Ga0207679_10163453 | 3300025945 | Bacteria | 1825 |
| 364 | Ga0207667_10000425 | 3300025949 | Bacteria | 56804 |
| 365 | Ga0207667_10015677 | 3300025949 | Bacteria | 8596 |
| 366 | Ga0207667_10035815 | 3300025949 | Bacteria | 5323 |
| 367 | Ga0207667_10049743 | 3300025949 | Bacteria | 4425 |
| 368 | Ga0207667_10084681 | 3300025949 | Bacteria | 3282 |
| 369 | Ga0207667_10170035 | 3300025949 | Bacteria | 2240 |
| 370 | Ga0207667_10245397 | 3300025949 | Bacteria | 1832 |
| 371 | Ga0207651_10040744 | 3300025960 | Bacteria | 3077 |
| 372 | Ga0207651_10178184 | 3300025960 | Bacteria | 1683 |
| 373 | Ga0207651_10211092 | 3300025960 | Bacteria | 1563 |
| 374 | Ga0207712_10077448 | 3300025961 | Bacteria | 2410 |
| 375 | Ga0207712_10240400 | 3300025961 | Bacteria | 1458 |
| 376 | Ga0207668_10006478 | 3300025972 | Bacteria | 6924 |
| 377 | Ga0207668_10037525 | 3300025972 | Bacteria | 3244 |
| 378 | Ga0207668_10044426 | 3300025972 | Bacteria | 3022 |
| 379 | Ga0207640_10107784 | 3300025981 | Bacteria | 1968 |
| 380 | Ga0207640_10138001 | 3300025981 | Bacteria | 1773 |
| 381 | Ga0207640_10150683 | 3300025981 | Bacteria | 1708 |
| 382 | Ga0207658_10076180 | 3300025986 | Bacteria | 2554 |
| 383 | Ga0207658_10105485 | 3300025986 | Bacteria | 2217 |
| 384 | Ga0207677_10000188 | 3300026023 | Bacteria | 49751 |
| 385 | Ga0207677_10021913 | 3300026023 | Bacteria | 3915 |
| 386 | Ga0207677_10069240 | 3300026023 | Bacteria | 2481 |
| 387 | Ga0207677_10179127 | 3300026023 | Bacteria | 1666 |
| 388 | Ga0207703_10004730 | 3300026035 | Bacteria | 11109 |
| 389 | Ga0207703_10052242 | 3300026035 | Bacteria | 3317 |
| 390 | Ga0207703_10075503 | 3300026035 | Bacteria | 2794 |
| 391 | Ga0207639_10012802 | 3300026041 | Bacteria | 5853 |
| 392 | Ga0207639_10051778 | 3300026041 | Bacteria | 3125 |
| 393 | Ga0207639_10277326 | 3300026041 | Bacteria | 1473 |
| 394 | Ga0207678_10001814 | 3300026067 | Bacteria | 19568 |
| 395 | Ga0207678_10005045 | 3300026067 | Bacteria | 11846 |
| 396 | Ga0207678_10068344 | 3300026067 | Bacteria | 3049 |
| 397 | Ga0207678_10139044 | 3300026067 | Bacteria | 2072 |
| 398 | Ga0207708_10000189 | 3300026075 | Bacteria | 48580 |
| 399 | Ga0207708_10001722 | 3300026075 | Bacteria | 16178 |
| 400 | Ga0207708_10003875 | 3300026075 | Bacteria | 11011 |
| 401 | Ga0207708_10020959 | 3300026075 | Bacteria | 4932 |
| 402 | Ga0207708_10127372 | 3300026075 | Bacteria | 1988 |
| 403 | Ga0207702_10002758 | 3300026078 | Bacteria | 16441 |
| 404 | Ga0207702_10002944 | 3300026078 | Bacteria | 15907 |
| 405 | Ga0207702_10042356 | 3300026078 | Bacteria | 3819 |
| 406 | Ga0207641_10011922 | 3300026088 | Bacteria | 7131 |
| 407 | Ga0207641_10041585 | 3300026088 | Bacteria | 3852 |
| 408 | Ga0207648_10000055 | 3300026089 | Bacteria | 106101 |
| 409 | Ga0207648_10000242 | 3300026089 | Bacteria | 58883 |
| 410 | Ga0207648_10000390 | 3300026089 | Bacteria | 48543 |
| 411 | Ga0207648_10038434 | 3300026089 | Bacteria | 4211 |
| 412 | Ga0207648_10273939 | 3300026089 | Bacteria | 1508 |
| 413 | Ga0207676_10000230 | 3300026095 | Bacteria | 48620 |
| 414 | Ga0207676_10011268 | 3300026095 | Bacteria | 6388 |
| 415 | Ga0207676_10069893 | 3300026095 | Bacteria | 2813 |
| 416 | Ga0207676_10308801 | 3300026095 | Bacteria | 1447 |
| 417 | Ga0207674_10000301 | 3300026116 | Bacteria | 62588 |
| 418 | Ga0207674_10000593 | 3300026116 | Bacteria | 47678 |
| 419 | Ga0207674_10001187 | 3300026116 | Bacteria | 33877 |
| 420 | Ga0207674_10015504 | 3300026116 | Bacteria | 8370 |
| 421 | Ga0207674_10040984 | 3300026116 | Bacteria | 4792 |
| 422 | Ga0207675_100000188 | 3300026118 | Bacteria | 56065 |
| 423 | Ga0207675_100001324 | 3300026118 | Bacteria | 24798 |
| 424 | Ga0207675_100003332 | 3300026118 | Bacteria | 15727 |
| 425 | Ga0207675_100056778 | 3300026118 | Bacteria | 3651 |
| 426 | Ga0207683_10001896 | 3300026121 | Bacteria | 18497 |
| 427 | Ga0207683_10005075 | 3300026121 | Bacteria | 11294 |
| 428 | Ga0207698_10000850 | 3300026142 | Bacteria | 17735 |
| 429 | Ga0207698_10001265 | 3300026142 | Bacteria | 14771 |
| 430 | Ga0207698_10025945 | 3300026142 | Bacteria | 4139 |
| 431 | Ga0207698_10067288 | 3300026142 | Bacteria | 2824 |
| 432 | Ga0207698_10117326 | 3300026142 | Bacteria | 2245 |
| 433 | Ga0207698_10163739 | 3300026142 | Bacteria | 1949 |
| 434 | Ga0210000_1003461 | 3300027462 | Bacteria | 2275 |
| 435 | Ga0209999_1010067 | 3300027543 | Bacteria | 1708 |
| 436 | Ga0209970_1001796 | 3300027614 | Bacteria | 3716 |
| 437 | Ga0209970_1006352 | 3300027614 | Bacteria | 1936 |
| 438 | Ga0209971_1003622 | 3300027682 | Bacteria | 3658 |
| 439 | Ga0209974_10005830 | 3300027876 | Bacteria | 4318 |
| 440 | Ga0207428_10003824 | 3300027907 | Bacteria | 14441 |
| 441 | Ga0207428_10052067 | 3300027907 | Bacteria | 3271 |
| 442 | Ga0207428_10058714 | 3300027907 | Bacteria | 3052 |
| 443 | Ga0207428_10077747 | 3300027907 | Bacteria | 2598 |
| 444 | Ga0268265_10003484 | 3300028380 | Bacteria | 11283 |
| 445 | Ga0268265_10011033 | 3300028380 | Bacteria | 6102 |
| 446 | Ga0268265_10034111 | 3300028380 | Bacteria | 3707 |
| 447 | Ga0268264_10000636 | 3300028381 | Bacteria | 41794 |
| 448 | Ga0268264_10060788 | 3300028381 | Bacteria | 3167 |
| 449 | Ga0268264_10061585 | 3300028381 | Bacteria | 3148 |
| 450 | Ga0268264_10131497 | 3300028381 | Bacteria | 2219 |
| 451 | Ga0307515_10039075 | 3300028794 | Bacteria | 7564 |
| 452 | Ga0307509_10012723 | 3300031507 | Bacteria | 10028 |
| 453 | Ga0307509_10106706 | 3300031507 | Bacteria | 2818 |
| 454 | Ga0307408_100019168 | 3300031548 | Bacteria | 4604 |
| 455 | Ga0307408_100109600 | 3300031548 | Bacteria | 2118 |
| 456 | Ga0307408_100186541 | 3300031548 | Bacteria | 1668 |
| 457 | Ga0316579_10012072 | 3300031691 | Bacteria | 3688 |
| 458 | Ga0316578_10005950 | 3300031728 | Bacteria | 5972 |
| 459 | Ga0307516_10010057 | 3300031730 | Bacteria | 10463 |
| 460 | Ga0307405_10020125 | 3300031731 | Bacteria | 3723 |
| 461 | Ga0307413_10013780 | 3300031824 | Bacteria | 4080 |
| 462 | Ga0307410_10084797 | 3300031852 | Bacteria | 2234 |
| 463 | Ga0307412_10000314 | 3300031911 | Bacteria | 30725 |
| 464 | Ga0307416_100005561 | 3300032002 | Bacteria | 7760 |
| 465 | Ga0307416_100008798 | 3300032002 | Bacteria | 6548 |
| 466 | Ga0307414_10085201 | 3300032004 | Bacteria | 2327 |
| 467 | Ga0307411_10066351 | 3300032005 | Bacteria | 2424 |
| 468 | Ga0307411_10268345 | 3300032005 | Bacteria | 1352 |
| 469 | Ga0316583_10015301 | 3300032133 | Bacteria | 2760 |
| 470 | Ga0373952_0005294 | 3300035092 | Bacteria | 2354 |
| 471 | Ga0373932_0000747 | 3300035112 | Bacteria | 9705 |
| 472 | Ga0373936_0001963 | 3300035113 | Bacteria | 7605 |
| 473 | Ga0373941_0014905 | 3300035115 | Bacteria | 2086 |
| 474 | Ga0373945_0006255 | 3300035116 | Bacteria | 3834 |
| 475 | Ga0373953_0028975 | 3300035117 | Bacteria | 2139 |
| 476 | Ga0373954_0000535 | 3300035118 | Bacteria | 14204 |
| 477 | Ga0373956_0009731 | 3300035119 | Bacteria | 3915 |
| 478 | Ga0373957_0053181 | 3300035120 | Bacteria | 1553 |
| 479 | Ga0373943_0001833 | 3300035170 | Bacteria | 9609 |
| 480 | Ga0373943_0007550 | 3300035170 | Bacteria | 4883 |
| 481 | Ga0373946_0002403 | 3300035171 | Bacteria | 6619 |
| 482 | Ga0373942_0029639 | 3300035207 | Bacteria | 1438 |
| 483 | Ga0373961_0000445 | 3300035241 | Bacteria | 16770 |
| 484 | Ga0373924_0091460 | 3300035410 | Bacteria | 1302 |
| 485 | Ga0373931_0000646 | 3300035691 | Bacteria | 14394 |
| 486 | Ga0373931_0016530 | 3300035691 | Bacteria | 3633 |
| 487 | Ga0373931_0035369 | 3300035691 | Bacteria | 2597 |
| 488 | Ga0373935_0004641 | 3300035692 | Bacteria | 8075 |
| 489 | Ga0373935_0090830 | 3300035692 | Bacteria | 1999 |
| 490 | Ga0373927_0001550 | 3300035695 | Bacteria | 17254 |
| 491 | Ga0373927_0006549 | 3300035695 | Bacteria | 7934 |
| 492 | Ga0373927_0044458 | 3300035695 | Bacteria | 2874 |
| 493 | Ga0373927_0067240 | 3300035695 | Bacteria | 2319 |
| 494 | Ga0373947_0016721 | 3300035725 | Bacteria | 4215 |
| 495 | Ga0373947_0022849 | 3300035725 | Bacteria | 3630 |
| 496 | Ga0373937_0037152 | 3300036401 | Bacteria | 4439 |
| 497 | Ga0373937_0107364 | 3300036401 | Bacteria | 2596 |
| 498 | Ga0373937_0220526 | 3300036401 | Bacteria | 1785 |
| 499 | Ga0373925_0010675 | 3300037068 | Bacteria | 6660 |
| 500 | Ga0373925_0011332 | 3300037068 | Bacteria | 6471 |
| 501 | Ga0373925_0013181 | 3300037068 | Bacteria | 5984 |
| 502 | Ga0373925_0052591 | 3300037068 | Bacteria | 3043 |
| 503 | Ga0373925_0053268 | 3300037068 | Bacteria | 3024 |
| 504 | Ga0373925_0077327 | 3300037068 | Bacteria | 2525 |
| 505 | Ga0395899_0000216 | 3300037312 | Bacteria | 81683 |
| 506 | Ga0395905_0020803 | 3300037471 | Bacteria | 6213 |
| 507 | Ga0316581_0000881 | 3300037588 | Bacteria | 6342 |
| 508 | Ga0395901_0000420 | 3300038443 | Bacteria | 49952 |
| 509 | Ga0395901_0126643 | 3300038443 | Bacteria | 2684 |
| 510 | Ga0395901_0206554 | 3300038443 | Bacteria | 2057 |
| 511 | Ga0395901_0232857 | 3300038443 | Bacteria | 1923 |
| 512 | Ga0436365_1401837 | 3300039437 | Bacteria | 4155 |
| 513 | Ga0439441_004573 | 3300042001 | Bacteria | 2106 |
| 514 | Ga0439443_002746 | 3300042003 | Bacteria | 2140 |
| 515 | Ga0450923_014536 | 3300042125 | Bacteria | 1462 |
| 516 | Ga0439435_0006663 | 3300042436 | Bacteria | 2603 |
| 517 | Ga0439460_0000174 | 3300042461 | Bacteria | 12145 |
| 518 | Ga0451577_0084105 | 3300042876 | Bacteria | 2839 |
| 519 | Ga0466966_0062825 | 3300044684 | Bacteria | 2341 |
| 520 | Ga0466957_0002655 | 3300044842 | Bacteria | 9651 |
| 521 | Ga0451576_0010262 | 3300045051 | Bacteria | 10764 |
| 522 | Ga0451576_0012994 | 3300045051 | Bacteria | 9329 |
| 523 | Ga0451576_0241385 | 3300045051 | Bacteria | 1887 |
| 524 | Ga0466958_0029523 | 3300045836 | Bacteria | 3254 |
| 525 | Ga0495603_0014421 | 3300046455 | Bacteria | 4779 |
| 526 | Ga0495603_0080530 | 3300046455 | Bacteria | 1908 |
| 527 | Ga0495591_016393 | 3300046458 | Bacteria | 2581 |
| 528 | Ga0495580_0000377 | 3300046472 | Bacteria | 36420 |
| 529 | Ga0495580_0023285 | 3300046472 | Bacteria | 4550 |
| 530 | Ga0495580_0038625 | 3300046472 | Bacteria | 3418 |
| 531 | Ga0495582_0021917 | 3300046473 | Bacteria | 3495 |
| 532 | Ga0495582_0078502 | 3300046473 | Bacteria | 1831 |
| 533 | Ga0495605_0008415 | 3300046474 | Bacteria | 5832 |
| 534 | Ga0495639_0001938 | 3300046475 | Bacteria | 9190 |
| 535 | Ga0495639_0042502 | 3300046475 | Bacteria | 2050 |
| 536 | Ga0495664_0011476 | 3300046477 | Bacteria | 4997 |
| 537 | Ga0495584_0018299 | 3300046491 | Bacteria | 3561 |
| 538 | Ga0495584_0036250 | 3300046491 | Bacteria | 2491 |
| 539 | Ga0495584_0043753 | 3300046491 | Bacteria | 2260 |
| 540 | Ga0495584_0102846 | 3300046491 | Bacteria | 1444 |
| 541 | Ga0495585_0000070 | 3300046492 | Bacteria | 106156 |
| 542 | Ga0495585_0001644 | 3300046492 | Bacteria | 17086 |
| 543 | Ga0495585_0019103 | 3300046492 | Bacteria | 3954 |
| 544 | Ga0495585_0021650 | 3300046492 | Bacteria | 3691 |
| 545 | Ga0495585_0040026 | 3300046492 | Bacteria | 2632 |
| 546 | Ga0495585_0055089 | 3300046492 | Bacteria | 2198 |
| 547 | Ga0495585_0084830 | 3300046492 | Bacteria | 1712 |
| 548 | Ga0495594_0009981 | 3300046499 | Bacteria | 4917 |
| 549 | Ga0495594_0062827 | 3300046499 | Bacteria | 2056 |
| 550 | Ga0495594_0065233 | 3300046499 | Bacteria | 2019 |
| 551 | Ga0495596_0001001 | 3300046500 | Bacteria | 16800 |
| 552 | Ga0495596_0002689 | 3300046500 | Bacteria | 9376 |
| 553 | Ga0495596_0015806 | 3300046500 | Bacteria | 3148 |
| 554 | Ga0495596_0026656 | 3300046500 | Bacteria | 2327 |
| 555 | Ga0495596_0035726 | 3300046500 | Bacteria | 1969 |
| 556 | Ga0495596_0065904 | 3300046500 | Bacteria | 1408 |
| 557 | Ga0495607_0034192 | 3300046501 | Bacteria | 3085 |
| 558 | Ga0495607_0045259 | 3300046501 | Bacteria | 2590 |
| 559 | Ga0495583_0000134 | 3300046506 | Bacteria | 124077 |
| 560 | Ga0495583_0001580 | 3300046506 | Bacteria | 22480 |
| 561 | Ga0495583_0009231 | 3300046506 | Bacteria | 5915 |
| 562 | Ga0495583_0009664 | 3300046506 | Bacteria | 5732 |
| 563 | Ga0495583_0010587 | 3300046506 | Bacteria | 5364 |
| 564 | Ga0495583_0013569 | 3300046506 | Bacteria | 4537 |
| 565 | Ga0495583_0036365 | 3300046506 | Bacteria | 2343 |
| 566 | Ga0495606_0030648 | 3300046507 | Bacteria | 3754 |
| 567 | Ga0495608_0021651 | 3300046511 | Bacteria | 4413 |
| 568 | Ga0495616_0000012 | 3300046513 | Bacteria | 211342 |
| 569 | Ga0495616_0000113 | 3300046513 | Bacteria | 70963 |
| 570 | Ga0495616_0015822 | 3300046513 | Bacteria | 4185 |
| 571 | Ga0495631_0001082 | 3300046518 | Bacteria | 16898 |
| 572 | Ga0495631_0004546 | 3300046518 | Bacteria | 7369 |
| 573 | Ga0495631_0004936 | 3300046518 | Bacteria | 7030 |
| 574 | Ga0495631_0008084 | 3300046518 | Bacteria | 5315 |
| 575 | Ga0495631_0008226 | 3300046518 | Bacteria | 5259 |
| 576 | Ga0495632_0000367 | 3300046519 | Bacteria | 42974 |
| 577 | Ga0495632_0079468 | 3300046519 | Bacteria | 1565 |
| 578 | Ga0495637_0009338 | 3300046520 | Bacteria | 4786 |
| 579 | Ga0495637_0025465 | 3300046520 | Bacteria | 2665 |
| 580 | Ga0495643_0008333 | 3300046522 | Bacteria | 6575 |
| 581 | Ga0495643_0073302 | 3300046522 | Bacteria | 1794 |
| 582 | Ga0495643_0125933 | 3300046522 | Bacteria | 1290 |
| 583 | Ga0495644_0014028 | 3300046523 | Bacteria | 3071 |
| 584 | Ga0495648_0006825 | 3300046524 | Bacteria | 9220 |
| 585 | Ga0495648_0019489 | 3300046524 | Bacteria | 4769 |
| 586 | Ga0495663_0002150 | 3300046525 | Bacteria | 6009 |
| 587 | Ga0495666_0000394 | 3300046526 | Bacteria | 19198 |
| 588 | Ga0495666_0020361 | 3300046526 | Bacteria | 3287 |
| 589 | Ga0495666_0075288 | 3300046526 | Bacteria | 1600 |
| 590 | Ga0495642_0000091 | 3300046528 | Bacteria | 53133 |
| 591 | Ga0495642_0002475 | 3300046528 | Bacteria | 7514 |
| 592 | Ga0495642_0004009 | 3300046528 | Bacteria | 5756 |
| 593 | Ga0495642_0010964 | 3300046528 | Bacteria | 3474 |
| 594 | Ga0495642_0038915 | 3300046528 | Bacteria | 1928 |
| 595 | Ga0495654_0012265 | 3300046530 | Bacteria | 4607 |
| 596 | Ga0495665_0036044 | 3300046531 | Bacteria | 2641 |
| 597 | Ga0495586_0060934 | 3300046535 | Bacteria | 2053 |
| 598 | Ga0495587_0021535 | 3300046536 | Bacteria | 3975 |
| 599 | Ga0495598_0037753 | 3300046537 | Bacteria | 1395 |
| 600 | Ga0495609_0001797 | 3300046538 | Bacteria | 13768 |
| 601 | Ga0495609_0002536 | 3300046538 | Bacteria | 11199 |
| 602 | Ga0495609_0002601 | 3300046538 | Bacteria | 10980 |
| 603 | Ga0495609_0016822 | 3300046538 | Bacteria | 3404 |
| 604 | Ga0495609_0072573 | 3300046538 | Bacteria | 1511 |
| 605 | Ga0495597_0000178 | 3300046542 | Bacteria | 56443 |
| 606 | Ga0495597_0004568 | 3300046542 | Bacteria | 7567 |
| 607 | Ga0495645_0009193 | 3300046543 | Bacteria | 6904 |
| 608 | Ga0495645_0020341 | 3300046543 | Bacteria | 4787 |
| 609 | Ga0495622_0055307 | 3300046557 | Bacteria | 1840 |
| 610 | Ga0495633_0004285 | 3300046558 | Bacteria | 9118 |
| 611 | Ga0495633_0014419 | 3300046558 | Bacteria | 4135 |
| 612 | Ga0495633_0039431 | 3300046558 | Bacteria | 2254 |
| 613 | Ga0495667_0047134 | 3300046559 | Bacteria | 2848 |
| 614 | Ga0495668_0010568 | 3300046616 | Bacteria | 5578 |
| 615 | Ga0495668_0032388 | 3300046616 | Bacteria | 2941 |
| 616 | Ga0495634_0018844 | 3300046642 | Bacteria | 4908 |
| 617 | Ga0495611_0001951 | 3300046648 | Bacteria | 9799 |
| 618 | Ga0495611_0002422 | 3300046648 | Bacteria | 8546 |
| 619 | Ga0495611_0005937 | 3300046648 | Bacteria | 5209 |
| 620 | Ga0495611_0036228 | 3300046648 | Bacteria | 2188 |
| 621 | Ga0495625_0026412 | 3300046660 | Bacteria | 4388 |
| 622 | Ga0495625_0063066 | 3300046660 | Bacteria | 2618 |
| 623 | Ga0495635_0003526 | 3300046663 | Bacteria | 10823 |
| 624 | Ga0495661_0000430 | 3300046665 | Bacteria | 44306 |
| 625 | Ga0495661_0001062 | 3300046665 | Bacteria | 24266 |
| 626 | Ga0495661_0031020 | 3300046665 | Bacteria | 3397 |
| 627 | Ga0495661_0036234 | 3300046665 | Bacteria | 3090 |
| 628 | Ga0495661_0039486 | 3300046665 | Bacteria | 2933 |
| 629 | Ga0495661_0039678 | 3300046665 | Bacteria | 2924 |
| 630 | Ga0495661_0059789 | 3300046665 | Bacteria | 2266 |
| 631 | Ga0495661_0059876 | 3300046665 | Bacteria | 2264 |
| 632 | Ga0495661_0060772 | 3300046665 | Bacteria | 2244 |
| 633 | Ga0495661_0080296 | 3300046665 | Bacteria | 1883 |
| 634 | Ga0495588_0004981 | 3300046674 | Bacteria | 5898 |
| 635 | Ga0495588_0011773 | 3300046674 | Bacteria | 4114 |
| 636 | Ga0495588_0024204 | 3300046674 | Bacteria | 3015 |
| 637 | Ga0495588_0042123 | 3300046674 | Bacteria | 2334 |
| 638 | Ga0495588_0054536 | 3300046674 | Bacteria | 2062 |
| 639 | Ga0495657_0127421 | 3300046675 | Bacteria | 1598 |
| 640 | Ga0495599_0022795 | 3300046678 | Bacteria | 3910 |
| 641 | Ga0495623_0007657 | 3300046679 | Bacteria | 7019 |
| 642 | Ga0495623_0067407 | 3300046679 | Bacteria | 2234 |
| 643 | Ga0495623_0068239 | 3300046679 | Bacteria | 2218 |
| 644 | Ga0495647_0006673 | 3300046681 | Bacteria | 3835 |
| 645 | Ga0495669_0000013 | 3300046684 | Bacteria | 151423 |
| 646 | Ga0495669_0000796 | 3300046684 | Bacteria | 13477 |
| 647 | Ga0495669_0007185 | 3300046684 | Bacteria | 4666 |
| 648 | Ga0495613_0016231 | 3300046689 | Bacteria | 5548 |
| 649 | Ga0495613_0025151 | 3300046689 | Bacteria | 4437 |
| 650 | Ga0495670_0000358 | 3300046691 | Bacteria | 21761 |
| 651 | Ga0495670_0006944 | 3300046691 | Bacteria | 5576 |
| 652 | Ga0495670_0010238 | 3300046691 | Bacteria | 4610 |
| 653 | Ga0495670_0012060 | 3300046691 | Bacteria | 4253 |
| 654 | Ga0495670_0012394 | 3300046691 | Bacteria | 4192 |
| 655 | Ga0495670_0022806 | 3300046691 | Bacteria | 3091 |
| 656 | Ga0495670_0023288 | 3300046691 | Bacteria | 3057 |
| 657 | Ga0495671_0033144 | 3300046692 | Bacteria | 2633 |
| 658 | Ga0495649_0050677 | 3300046694 | Bacteria | 2252 |
| 659 | Ga0495589_0009864 | 3300046794 | Bacteria | 4962 |
| 660 | Ga0495589_0010799 | 3300046794 | Bacteria | 4746 |
| 661 | Ga0495589_0055975 | 3300046794 | Bacteria | 1942 |
| 662 | Ga0495589_0080908 | 3300046794 | Bacteria | 1580 |
| 663 | Ga0495600_0024300 | 3300046809 | Bacteria | 3900 |
| 664 | Ga0495660_0009175 | 3300046810 | Bacteria | 5778 |
| 665 | Ga0495660_0021301 | 3300046810 | Bacteria | 3713 |
| 666 | Ga0495581_0010438 | 3300047315 | Bacteria | 5371 |
| 667 | Ga0495604_0159079 | 3300047317 | Bacteria | 1597 |
| 668 | Ga0495636_0011491 | 3300047318 | Bacteria | 3504 |
| 669 | Ga0495636_0012632 | 3300047318 | Bacteria | 3345 |
| 670 | Ga0495674_0081609 | 3300047319 | Bacteria | 2774 |
| 671 | Ga0495672_0003849 | 3300047320 | Bacteria | 12621 |
| 672 | Ga0495672_0063028 | 3300047320 | Bacteria | 2129 |
| 673 | Ga0495676_0001263 | 3300047321 | Bacteria | 21712 |
| 674 | Ga0495676_0053979 | 3300047321 | Bacteria | 3198 |
| 675 | Ga0495676_0059705 | 3300047321 | Bacteria | 2993 |
| 676 | Ga0495680_0089067 | 3300047322 | Bacteria | 2317 |
| 677 | Ga0495683_0058034 | 3300047323 | Bacteria | 1923 |
| 678 | Ga0495687_000002 | 3300047443 | Bacteria | 1085770 |
| 679 | Ga0495687_000007 | 3300047443 | Bacteria | 552679 |
| 680 | Ga0495675_0080182 | 3300047444 | Bacteria | 2056 |
| 681 | Ga0495677_0000973 | 3300047445 | Bacteria | 11529 |
| 682 | Ga0495677_0005202 | 3300047445 | Bacteria | 4949 |
| 683 | Ga0495677_0038111 | 3300047445 | Bacteria | 1756 |
| 684 | Ga0495679_017472 | 3300047446 | Bacteria | 2566 |
| 685 | Ga0495679_022101 | 3300047446 | Bacteria | 2183 |
| 686 | Ga0495679_027379 | 3300047446 | Bacteria | 1881 |
| 687 | Ga0495685_001302 | 3300047447 | Bacteria | 7615 |
| 688 | Ga0495673_0080279 | 3300047469 | Bacteria | 1352 |
| 689 | Ga0495681_0000005 | 3300047470 | Bacteria | 225279 |
| 690 | Ga0495681_0001386 | 3300047470 | Bacteria | 18292 |
| 691 | Ga0495681_0032603 | 3300047470 | Bacteria | 2620 |
| 692 | Ga0495681_0037363 | 3300047470 | Bacteria | 2392 |
| 693 | Ga0495681_0037870 | 3300047470 | Bacteria | 2370 |
| 694 | Ga0495684_0028581 | 3300047471 | Bacteria | 4280 |
| 695 | Ga0495686_0000357 | 3300047472 | Bacteria | 74707 |
| 696 | Ga0495686_0022306 | 3300047472 | Bacteria | 4190 |
| 697 | Ga0495602_0009695 | 3300048088 | Bacteria | 10004 |
| 698 | Ga0495602_0128278 | 3300048088 | Bacteria | 2028 |
| 699 | Ga0495614_0010091 | 3300048089 | Bacteria | 4168 |
| 700 | Ga0495614_0031656 | 3300048089 | Bacteria | 2277 |
| 701 | Ga0495615_0000692 | 3300048090 | Bacteria | 4693 |
| 702 | Ga0495615_0002390 | 3300048090 | Bacteria | 3007 |
| 703 | Ga0495626_0000384 | 3300048091 | Bacteria | 45806 |
| 704 | Ga0495626_0000792 | 3300048091 | Bacteria | 28683 |
| 705 | Ga0495626_0003679 | 3300048091 | Bacteria | 9719 |
| 706 | Ga0495626_0004165 | 3300048091 | Bacteria | 8977 |
| 707 | Ga0495626_0017324 | 3300048091 | Bacteria | 3640 |
| 708 | Ga0496102_0000318 | 3300048905 | Bacteria | 60368 |
| 709 | Ga0496102_0010080 | 3300048905 | Bacteria | 8130 |
| 710 | Ga0496103_0026102 | 3300048906 | Bacteria | 3535 |
| 711 | Ga0496103_0092206 | 3300048906 | Bacteria | 1912 |
| 712 | Ga0496104_0009253 | 3300048907 | Bacteria | 8761 |
| 713 | Ga0496104_0222813 | 3300048907 | Bacteria | 1798 |
| 714 | Ga0496105_0012504 | 3300048908 | Bacteria | 6720 |
| 715 | Ga0496105_0069900 | 3300048908 | Bacteria | 2902 |
| 716 | Ga0496106_0008585 | 3300048909 | Bacteria | 7558 |
| 717 | Ga0496107_0055618 | 3300048910 | Bacteria | 2858 |
| 718 | Ga0496107_0063772 | 3300048910 | Bacteria | 2670 |
| 719 | Ga0496108_0042748 | 3300048911 | Bacteria | 3784 |
| 720 | Ga0496109_0021784 | 3300048912 | Bacteria | 5672 |
| 721 | Ga0496109_0069956 | 3300048912 | Bacteria | 3220 |
| 722 | Ga0496109_0386059 | 3300048912 | Bacteria | 1323 |
| 723 | Ga0496110_0001834 | 3300048913 | Bacteria | 15666 |
| 724 | Ga0496110_0003288 | 3300048913 | Bacteria | 12334 |
| 725 | Ga0496111_0069539 | 3300048914 | Bacteria | 2560 |
| 726 | Ga0496112_0000303 | 3300048915 | Bacteria | 31772 |
| 727 | Ga0496112_0038487 | 3300048915 | Bacteria | 4670 |
| 728 | Ga0496112_0090875 | 3300048915 | Bacteria | 3022 |
| 729 | Ga0496112_0207203 | 3300048915 | Bacteria | 1918 |
| 730 | Ga0496113_0001648 | 3300048916 | Bacteria | 12591 |
| 731 | Ga0496115_0007489 | 3300048918 | Bacteria | 8035 |
| 732 | Ga0496116_0013599 | 3300048919 | Bacteria | 6547 |
| 733 | Ga0496118_0023565 | 3300048921 | Bacteria | 5342 |
| 734 | Ga0496119_0029332 | 3300048922 | Bacteria | 3733 |
| 735 | Ga0496120_0069419 | 3300048923 | Bacteria | 1940 |
| 736 | Ga0496121_0000568 | 3300048924 | Bacteria | 69617 |
| 737 | Ga0496121_0012358 | 3300048924 | Bacteria | 9334 |
| 738 | Ga0496122_0000263 | 3300048925 | Bacteria | 117762 |
| 739 | Ga0496122_0079038 | 3300048925 | Bacteria | 2301 |
| 740 | Ga0496122_0146633 | 3300048925 | Bacteria | 1465 |
| 741 | Ga0496123_0000156 | 3300048926 | Bacteria | 139362 |
| 742 | Ga0496124_0000007 | 3300048927 | Bacteria | 883534 |
| 743 | Ga0496124_0107697 | 3300048927 | Bacteria | 2248 |
| 744 | Ga0496125_0000105 | 3300048928 | Bacteria | 200717 |
| 745 | Ga0496125_0000669 | 3300048928 | Bacteria | 57185 |
| 746 | Ga0496126_0170478 | 3300048929 | Bacteria | 1854 |
| 747 | Ga0495678_000024 | 3300049459 | Bacteria | 229034 |
| 748 | Ga0495682_0002293 | 3300049460 | Bacteria | 9142 |
| 749 | Ga0495682_0010895 | 3300049460 | Bacteria | 3504 |
| 750 | Ga0495682_0013860 | 3300049460 | Bacteria | 3061 |
| 751 | Ga0501031_0032599 | 3300049568 | Bacteria | 3397 |
| 752 | Ga0501033_0028336 | 3300049570 | Bacteria | 4208 |
| 753 | Ga0501033_0116690 | 3300049570 | Bacteria | 1939 |
| 754 | Ga0501038_0001109 | 3300049574 | Bacteria | 24402 |
| 755 | Ga0501038_0043315 | 3300049574 | Bacteria | 3914 |
| 756 | Ga0501039_0013343 | 3300049575 | Bacteria | 6282 |
| 757 | Ga0501039_0015991 | 3300049575 | Bacteria | 5745 |
| 758 | Ga0501039_0160631 | 3300049575 | Bacteria | 1766 |
| 759 | Ga0501040_0001909 | 3300049576 | Bacteria | 13402 |
| 760 | Ga0501040_0012550 | 3300049576 | Bacteria | 5552 |
| 761 | Ga0501041_0003730 | 3300049577 | Bacteria | 8760 |
| 762 | Ga0501041_0025244 | 3300049577 | Bacteria | 3572 |
| 763 | Ga0501042_0000383 | 3300049578 | Bacteria | 22452 |
| 764 | Ga0501042_0064499 | 3300049578 | Bacteria | 2617 |
| 765 | Ga0501043_0078692 | 3300049579 | Bacteria | 2591 |
| 766 | Ga0501046_0001197 | 3300049580 | Bacteria | 25219 |
| 767 | Ga0501047_0004365 | 3300049581 | Bacteria | 13305 |
| 768 | Ga0501047_0103185 | 3300049581 | Bacteria | 2731 |
| 769 | Ga0501048_0104738 | 3300049582 | Bacteria | 1996 |
| 770 | Ga0501068_0033760 | 3300049584 | Bacteria | 3049 |
| 771 | Ga0501068_0046140 | 3300049584 | Bacteria | 2627 |
| 772 | Ga0501069_0024971 | 3300049585 | Bacteria | 3263 |
| 773 | Ga0501070_0011981 | 3300049586 | Bacteria | 7317 |
| 774 | Ga0501071_0020152 | 3300049587 | Bacteria | 4633 |
| 775 | Ga0501071_0025763 | 3300049587 | Bacteria | 4121 |
| 776 | Ga0501072_0002470 | 3300049588 | Bacteria | 13847 |
| 777 | Ga0501072_0008401 | 3300049588 | Bacteria | 7838 |
| 778 | Ga0501072_0054304 | 3300049588 | Bacteria | 3156 |
| 779 | Ga0501073_0001346 | 3300049589 | Bacteria | 18103 |
| 780 | Ga0501073_0149753 | 3300049589 | Bacteria | 1617 |
| 781 | Ga0501074_0001670 | 3300049590 | Bacteria | 15110 |
| 782 | Ga0501074_0053513 | 3300049590 | Bacteria | 2911 |
| 783 | Ga0501075_0000525 | 3300049591 | Bacteria | 23161 |
| 784 | Ga0501075_0002429 | 3300049591 | Bacteria | 12398 |
| 785 | Ga0501076_0003906 | 3300049592 | Bacteria | 10504 |
| 786 | Ga0501076_0013583 | 3300049592 | Bacteria | 6108 |
| 787 | Ga0501077_0031416 | 3300049593 | Bacteria | 3378 |
| 788 | Ga0501079_0000625 | 3300049741 | Bacteria | 23469 |
| 789 | Ga0501079_0013856 | 3300049741 | Bacteria | 6150 |
| 790 | Ga0501079_0014247 | 3300049741 | Bacteria | 6062 |
| 791 | Ga0501080_0038003 | 3300049742 | Bacteria | 4496 |
| 792 | Ga0501080_0110457 | 3300049742 | Bacteria | 2548 |
| 793 | Ga0501080_0152085 | 3300049742 | Bacteria | 2138 |
| 794 | Ga0501081_0000055 | 3300049743 | Bacteria | 43227 |
| 795 | Ga0501081_0003584 | 3300049743 | Bacteria | 9931 |
| 796 | Ga0501083_0004033 | 3300049744 | Bacteria | 10324 |
| 797 | Ga0501083_0077415 | 3300049744 | Bacteria | 2207 |
| 798 | Ga0501035_0002928 | 3300049822 | Bacteria | 16434 |
| 799 | Ga0501035_0012650 | 3300049822 | Bacteria | 7798 |
| 800 | Ga0501044_0002559 | 3300049823 | Bacteria | 20710 |
| 801 | Ga0501044_0014152 | 3300049823 | Bacteria | 8613 |
| 802 | Ga0501044_0049886 | 3300049823 | Bacteria | 4321 |
| 803 | Ga0501044_0065389 | 3300049823 | Bacteria | 3709 |
| 804 | Ga0501045_0000901 | 3300049824 | Bacteria | 19335 |
| 805 | Ga0501045_0008515 | 3300049824 | Bacteria | 7149 |
| 806 | nmdc:mga00v17_22490_c1 | 3300050491 | Bacteria | 3637 |
| 807 | nmdc:mga00v17_5230_c1 | 3300050491 | Bacteria | 6833 |
| 808 | nmdc:mga05p37_387_c1 | 3300050507 | Bacteria | 47694 |
| 809 | nmdc:mga09592_17457_c1 | 3300050508 | Bacteria | 5880 |
| 810 | nmdc:mga09592_212_c1 | 3300050508 | Bacteria | 41841 |
| 811 | nmdc:mga09592_83861_c1 | 3300050508 | Bacteria | 2717 |
| 812 | nmdc:mga0qj67_1416_c1 | 3300050509 | Bacteria | 16782 |
| 813 | nmdc:mga0qj67_158294_c1 | 3300050509 | Bacteria | 1839 |
| 814 | nmdc:mga0qj67_56027_c1 | 3300050509 | Bacteria | 3124 |
| 815 | nmdc:mga06r32_357105_c1 | 3300050510 | Bacteria | 1446 |
| 816 | nmdc:mga08y16_4065_c1 | 3300050511 | Bacteria | 15279 |
| 817 | nmdc:mga08y16_76703_c1 | 3300050511 | Bacteria | 3484 |
| 818 | nmdc:mga08y16_8133_c1 | 3300050511 | Bacteria | 10971 |
| 819 | nmdc:mga08y16_95983_c1 | 3300050511 | Bacteria | 3088 |
| 820 | nmdc:mga0n895_21679_c1 | 3300050512 | Bacteria | 6013 |
| 821 | nmdc:mga0n895_354398_c1 | 3300050512 | Bacteria | 1486 |
| 822 | nmdc:mga08x19_352_c1 | 3300050514 | Bacteria | 33219 |
| 823 | nmdc:mga08x19_97140_c1 | 3300050514 | Bacteria | 1950 |
| 824 | Ga0500635_0014303 | 3300053080 | Bacteria | 2322 |
| 825 | Ga0495595_0014569 | 3300053084 | Bacteria | 3340 |
| 826 | Ga0495619_0004815 | 3300053085 | Bacteria | 8567 |
| 827 | Ga0495619_0037876 | 3300053085 | Bacteria | 3145 |
| 828 | Ga0500566_0002758 | 3300053094 | Bacteria | 10468 |
| 829 | Ga0500566_0011675 | 3300053094 | Bacteria | 5172 |
| 830 | Ga0500640_004928 | 3300053095 | Bacteria | 4910 |
| 831 | Ga0500554_000602 | 3300053102 | Bacteria | 7324 |
| 832 | Ga0500572_000814 | 3300053111 | Bacteria | 9889 |
| 833 | Ga0500595_000093 | 3300053119 | Bacteria | 61798 |
| 834 | Ga0500614_000153 | 3300053123 | Bacteria | 17434 |
| 835 | Ga0500559_0012960 | 3300053136 | Bacteria | 3537 |
| 836 | Ga0500564_043896 | 3300053138 | Bacteria | 2055 |
| 837 | Ga0500636_0033621 | 3300053177 | Bacteria | 3035 |
| 838 | Ga0501084_0002498 | 3300054114 | Bacteria | 14797 |
| 839 | Ga0501084_0101631 | 3300054114 | Bacteria | 2414 |
| 840 | Ga0501082_0008950 | 3300060353 | Bacteria | 8640 |
| 841 | Ga0501082_0051361 | 3300060353 | Bacteria | 3553 |
| 842 | Ga0530510_0001004 | 3300061734 | Bacteria | 18744 |
| 843 | Ga0530510_0001019 | 3300061734 | Bacteria | 18576 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009545 | Ga0105237_10497672 | Ga0105237_104976721 | 348 |
| 2 | 3300053138 | Ga0500564_043896 | Ga0500564_043896_893_2041 | 382 |
| 3 | 3300047470 | Ga0495681_0032603 | Ga0495681_0032603_460_1692 | 383 |
| 4 | 3300048091 | Ga0495626_0000792 | Ga0495626_0000792_8233_9465 | 383 |
| 5 | 3300013104 | Ga0157370_10189109 | Ga0157370_101891092 | 385 |
| 6 | 3300013105 | Ga0157369_10018035 | Ga0157369_100180359 | 385 |
| 7 | 3300013307 | Ga0157372_10353122 | Ga0157372_103531221 | 385 |
| 8 | 3300046674 | Ga0495588_0054536 | Ga0495588_0054536_20_1177 | 385 |
| 9 | 3300048090 | Ga0495615_0002390 | Ga0495615_0002390_1345_2574 | 385 |
| 10 | 3300005543 | Ga0070672_100018451 | Ga0070672_1000184517 | 389 |
| 11 | 3300005563 | Ga0068855_100006103 | Ga0068855_10000610312 | 389 |
| 12 | 3300009177 | Ga0105248_10001643 | Ga0105248_1000164313 | 389 |
| 13 | 3300025941 | Ga0207711_10007075 | Ga0207711_100070756 | 389 |
| 14 | 3300025949 | Ga0207667_10015677 | Ga0207667_100156775 | 389 |
| 15 | 3300025907 | Ga0207645_10100494 | Ga0207645_101004942 | 390 |
| 16 | 3300027682 | Ga0209971_1003622 | Ga0209971_10036224 | 390 |
| 17 | 3300027876 | Ga0209974_10005830 | Ga0209974_100058305 | 390 |
| 18 | 3300046528 | Ga0495642_0002475 | Ga0495642_0002475_3202_4434 | 391 |
| 19 | 3300048918 | Ga0496115_0007489 | Ga0496115_0007489_2747_3979 | 391 |
| 20 | 3300050491 | nmdc:mga00v17_5230_c1 | nmdc:mga00v17_5230_c1_599_1804 | 391 |
| 21 | 3300005347 | Ga0070668_100112468 | Ga0070668_1001124681 | 392 |
| 22 | 3300005843 | Ga0068860_100026812 | Ga0068860_1000268125 | 392 |
| 23 | 3300005844 | Ga0068862_100203587 | Ga0068862_1002035872 | 392 |
| 24 | 3300025972 | Ga0207668_10037525 | Ga0207668_100375252 | 392 |
| 25 | 3300032005 | Ga0307411_10268345 | Ga0307411_102683451 | 392 |
| 26 | 3300036401 | Ga0373937_0220526 | Ga0373937_0220526_218_1396 | 392 |
| 27 | 3300048906 | Ga0496103_0026102 | Ga0496103_0026102_134_1312 | 392 |
| 28 | 3300050512 | nmdc:mga0n895_21679_c1 | nmdc:mga0n895_21679_c1_1810_2988 | 392 |
| 29 | 3300009093 | Ga0105240_10203960 | Ga0105240_102039601 | 393 |
| 30 | 3300038443 | Ga0395901_0126643 | Ga0395901_0126643_1099_2286 | 393 |
| 31 | 3300048915 | Ga0496112_0000303 | Ga0496112_0000303_3080_4306 | 393 |
| 32 | 3300025961 | Ga0207712_10240400 | Ga0207712_102404002 | 394 |
| 33 | 3300031548 | Ga0307408_100109600 | Ga0307408_1001096002 | 394 |
| 34 | 3300031691 | Ga0316579_10012072 | Ga0316579_100120722 | 394 |
| 35 | 3300031728 | Ga0316578_10005950 | Ga0316578_100059503 | 394 |
| 36 | 3300032133 | Ga0316583_10015301 | Ga0316583_100153012 | 394 |
| 37 | 3300035695 | Ga0373927_0067240 | Ga0373927_0067240_540_1727 | 394 |
| 38 | 3300037068 | Ga0373925_0053268 | Ga0373925_0053268_489_1676 | 394 |
| 39 | 3300037588 | Ga0316581_0000881 | Ga0316581_0000881_1252_2439 | 394 |
| 40 | 3300046458 | Ga0495591_016393 | Ga0495591_016393_939_2123 | 394 |
| 41 | 3300046472 | Ga0495580_0023285 | Ga0495580_0023285_1861_3045 | 394 |
| 42 | 3300046473 | Ga0495582_0021917 | Ga0495582_0021917_1138_2322 | 394 |
| 43 | 3300046474 | Ga0495605_0008415 | Ga0495605_0008415_2950_4134 | 394 |
| 44 | 3300046492 | Ga0495585_0001644 | Ga0495585_0001644_1774_2958 | 394 |
| 45 | 3300046492 | Ga0495585_0040026 | Ga0495585_0040026_849_2033 | 394 |
| 46 | 3300046500 | Ga0495596_0015806 | Ga0495596_0015806_1587_2771 | 394 |
| 47 | 3300046500 | Ga0495596_0035726 | Ga0495596_0035726_762_1946 | 394 |
| 48 | 3300046500 | Ga0495596_0065904 | Ga0495596_0065904_187_1371 | 394 |
| 49 | 3300046501 | Ga0495607_0034192 | Ga0495607_0034192_827_2011 | 394 |
| 50 | 3300046506 | Ga0495583_0009664 | Ga0495583_0009664_3840_5024 | 394 |
| 51 | 3300046506 | Ga0495583_0013569 | Ga0495583_0013569_186_1370 | 394 |
| 52 | 3300046507 | Ga0495606_0030648 | Ga0495606_0030648_41_1225 | 394 |
| 53 | 3300046513 | Ga0495616_0000012 | Ga0495616_0000012_30388_31572 | 394 |
| 54 | 3300046513 | Ga0495616_0015822 | Ga0495616_0015822_658_1842 | 394 |
| 55 | 3300046518 | Ga0495631_0001082 | Ga0495631_0001082_10123_11307 | 394 |
| 56 | 3300046518 | Ga0495631_0004546 | Ga0495631_0004546_5221_6405 | 394 |
| 57 | 3300046518 | Ga0495631_0004936 | Ga0495631_0004936_3021_4205 | 394 |
| 58 | 3300046518 | Ga0495631_0008084 | Ga0495631_0008084_837_2021 | 394 |
| 59 | 3300046519 | Ga0495632_0000367 | Ga0495632_0000367_33927_35111 | 394 |
| 60 | 3300046520 | Ga0495637_0009338 | Ga0495637_0009338_2649_3833 | 394 |
| 61 | 3300046522 | Ga0495643_0125933 | Ga0495643_0125933_95_1279 | 394 |
| 62 | 3300046524 | Ga0495648_0006825 | Ga0495648_0006825_2107_3291 | 394 |
| 63 | 3300046524 | Ga0495648_0019489 | Ga0495648_0019489_2164_3348 | 394 |
| 64 | 3300046526 | Ga0495666_0000394 | Ga0495666_0000394_2232_3416 | 394 |
| 65 | 3300046526 | Ga0495666_0020361 | Ga0495666_0020361_728_1912 | 394 |
| 66 | 3300046528 | Ga0495642_0000091 | Ga0495642_0000091_33456_34640 | 394 |
| 67 | 3300046528 | Ga0495642_0010964 | Ga0495642_0010964_1063_2247 | 394 |
| 68 | 3300046528 | Ga0495642_0038915 | Ga0495642_0038915_558_1742 | 394 |
| 69 | 3300046530 | Ga0495654_0012265 | Ga0495654_0012265_1361_2545 | 394 |
| 70 | 3300046538 | Ga0495609_0001797 | Ga0495609_0001797_11347_12531 | 394 |
| 71 | 3300046538 | Ga0495609_0002601 | Ga0495609_0002601_7641_8825 | 394 |
| 72 | 3300046538 | Ga0495609_0016822 | Ga0495609_0016822_1617_2801 | 394 |
| 73 | 3300046538 | Ga0495609_0072573 | Ga0495609_0072573_35_1219 | 394 |
| 74 | 3300046542 | Ga0495597_0000178 | Ga0495597_0000178_43281_44465 | 394 |
| 75 | 3300046542 | Ga0495597_0004568 | Ga0495597_0004568_4835_6019 | 394 |
| 76 | 3300046558 | Ga0495633_0004285 | Ga0495633_0004285_2097_3281 | 394 |
| 77 | 3300046616 | Ga0495668_0010568 | Ga0495668_0010568_3338_4522 | 394 |
| 78 | 3300046642 | Ga0495634_0018844 | Ga0495634_0018844_2131_3315 | 394 |
| 79 | 3300046648 | Ga0495611_0001951 | Ga0495611_0001951_6354_7538 | 394 |
| 80 | 3300046648 | Ga0495611_0036228 | Ga0495611_0036228_338_1522 | 394 |
| 81 | 3300046660 | Ga0495625_0026412 | Ga0495625_0026412_2116_3300 | 394 |
| 82 | 3300046660 | Ga0495625_0063066 | Ga0495625_0063066_803_1987 | 394 |
| 83 | 3300046665 | Ga0495661_0000430 | Ga0495661_0000430_28927_30111 | 394 |
| 84 | 3300046665 | Ga0495661_0001062 | Ga0495661_0001062_12301_13485 | 394 |
| 85 | 3300046665 | Ga0495661_0039678 | Ga0495661_0039678_1107_2291 | 394 |
| 86 | 3300046665 | Ga0495661_0059789 | Ga0495661_0059789_762_1946 | 394 |
| 87 | 3300046665 | Ga0495661_0080296 | Ga0495661_0080296_288_1472 | 394 |
| 88 | 3300046674 | Ga0495588_0004981 | Ga0495588_0004981_3186_4370 | 394 |
| 89 | 3300046674 | Ga0495588_0024204 | Ga0495588_0024204_1012_2196 | 394 |
| 90 | 3300046679 | Ga0495623_0007657 | Ga0495623_0007657_4394_5578 | 394 |
| 91 | 3300046684 | Ga0495669_0000796 | Ga0495669_0000796_3230_4414 | 394 |
| 92 | 3300046684 | Ga0495669_0007185 | Ga0495669_0007185_2580_3764 | 394 |
| 93 | 3300046691 | Ga0495670_0000358 | Ga0495670_0000358_5132_6316 | 394 |
| 94 | 3300046691 | Ga0495670_0012060 | Ga0495670_0012060_1007_2191 | 394 |
| 95 | 3300046691 | Ga0495670_0012394 | Ga0495670_0012394_2449_3633 | 394 |
| 96 | 3300046691 | Ga0495670_0023288 | Ga0495670_0023288_1519_2703 | 394 |
| 97 | 3300046692 | Ga0495671_0033144 | Ga0495671_0033144_862_2046 | 394 |
| 98 | 3300046794 | Ga0495589_0009864 | Ga0495589_0009864_3637_4821 | 394 |
| 99 | 3300046794 | Ga0495589_0010799 | Ga0495589_0010799_3119_4303 | 394 |
| 100 | 3300046809 | Ga0495600_0024300 | Ga0495600_0024300_1023_2207 | 394 |
| 101 | 3300046810 | Ga0495660_0009175 | Ga0495660_0009175_3587_4771 | 394 |
| 102 | 3300046810 | Ga0495660_0021301 | Ga0495660_0021301_290_1474 | 394 |
| 103 | 3300047320 | Ga0495672_0003849 | Ga0495672_0003849_1202_2386 | 394 |
| 104 | 3300047320 | Ga0495672_0063028 | Ga0495672_0063028_571_1755 | 394 |
| 105 | 3300047443 | Ga0495687_000002 | Ga0495687_000002_305949_307133 | 394 |
| 106 | 3300047443 | Ga0495687_000007 | Ga0495687_000007_402507_403691 | 394 |
| 107 | 3300047445 | Ga0495677_0000973 | Ga0495677_0000973_9712_10896 | 394 |
| 108 | 3300047446 | Ga0495679_017472 | Ga0495679_017472_1041_2225 | 394 |
| 109 | 3300047446 | Ga0495679_022101 | Ga0495679_022101_466_1650 | 394 |
| 110 | 3300047446 | Ga0495679_027379 | Ga0495679_027379_124_1308 | 394 |
| 111 | 3300047447 | Ga0495685_001302 | Ga0495685_001302_6382_7566 | 394 |
| 112 | 3300047470 | Ga0495681_0000005 | Ga0495681_0000005_180991_182175 | 394 |
| 113 | 3300047470 | Ga0495681_0001386 | Ga0495681_0001386_3240_4424 | 394 |
| 114 | 3300047472 | Ga0495686_0000357 | Ga0495686_0000357_16964_18148 | 394 |
| 115 | 3300047472 | Ga0495686_0022306 | Ga0495686_0022306_2037_3221 | 394 |
| 116 | 3300048088 | Ga0495602_0009695 | Ga0495602_0009695_3545_4729 | 394 |
| 117 | 3300048091 | Ga0495626_0003679 | Ga0495626_0003679_970_2154 | 394 |
| 118 | 3300048091 | Ga0495626_0004165 | Ga0495626_0004165_6854_8038 | 394 |
| 119 | 3300048091 | Ga0495626_0017324 | Ga0495626_0017324_648_1832 | 394 |
| 120 | 3300048905 | Ga0496102_0000318 | Ga0496102_0000318_15428_16612 | 394 |
| 121 | 3300048912 | Ga0496109_0021784 | Ga0496109_0021784_3196_4380 | 394 |
| 122 | 3300048915 | Ga0496112_0090875 | Ga0496112_0090875_47_1231 | 394 |
| 123 | 3300048916 | Ga0496113_0001648 | Ga0496113_0001648_6859_8043 | 394 |
| 124 | 3300048925 | Ga0496122_0000263 | Ga0496122_0000263_99283_100467 | 394 |
| 125 | 3300048926 | Ga0496123_0000156 | Ga0496123_0000156_42686_43870 | 394 |
| 126 | 3300048927 | Ga0496124_0107697 | Ga0496124_0107697_836_2020 | 394 |
| 127 | 3300048928 | Ga0496125_0000669 | Ga0496125_0000669_38480_39664 | 394 |
| 128 | 3300049459 | Ga0495678_000024 | Ga0495678_000024_16278_17462 | 394 |
| 129 | 3300049460 | Ga0495682_0002293 | Ga0495682_0002293_3567_4751 | 394 |
| 130 | 3300049460 | Ga0495682_0013860 | Ga0495682_0013860_1054_2238 | 394 |
| 131 | 3300049570 | Ga0501033_0116690 | Ga0501033_0116690_525_1709 | 394 |
| 132 | 3300049576 | Ga0501040_0012550 | Ga0501040_0012550_3374_4561 | 394 |
| 133 | 3300049578 | Ga0501042_0064499 | Ga0501042_0064499_921_2108 | 394 |
| 134 | 3300049823 | Ga0501044_0002559 | Ga0501044_0002559_13622_14806 | 394 |
| 135 | 3300049823 | Ga0501044_0065389 | Ga0501044_0065389_914_2098 | 394 |
| 136 | 3300006051 | Ga0075364_10028450 | Ga0075364_100284504 | 395 |
| 137 | 3300006846 | Ga0075430_100033993 | Ga0075430_1000339932 | 395 |
| 138 | 3300009094 | Ga0111539_10060596 | Ga0111539_100605964 | 395 |
| 139 | 3300027462 | Ga0210000_1003461 | Ga0210000_10034612 | 395 |
| 140 | 3300027543 | Ga0209999_1010067 | Ga0209999_10100671 | 395 |
| 141 | 3300027614 | Ga0209970_1006352 | Ga0209970_10063522 | 395 |
| 142 | 3300027907 | Ga0207428_10077747 | Ga0207428_100777472 | 395 |
| 143 | 3300032002 | Ga0307416_100008798 | Ga0307416_1000087985 | 395 |
| 144 | 3300035118 | Ga0373954_0000535 | Ga0373954_0000535_2488_3678 | 395 |
| 145 | 3300036401 | Ga0373937_0107364 | Ga0373937_0107364_1082_2272 | 395 |
| 146 | 3300042003 | Ga0439443_002746 | Ga0439443_002746_81_1271 | 395 |
| 147 | 3300042436 | Ga0439435_0006663 | Ga0439435_0006663_331_1521 | 395 |
| 148 | 3300042461 | Ga0439460_0000174 | Ga0439460_0000174_3963_5153 | 395 |
| 149 | 3300049574 | Ga0501038_0043315 | Ga0501038_0043315_433_1623 | 395 |
| 150 | 3300049575 | Ga0501039_0013343 | Ga0501039_0013343_1464_2654 | 395 |
| 151 | 3300049577 | Ga0501041_0025244 | Ga0501041_0025244_608_1798 | 395 |
| 152 | 3300049579 | Ga0501043_0078692 | Ga0501043_0078692_616_1806 | 395 |
| 153 | 3300049587 | Ga0501071_0025763 | Ga0501071_0025763_2446_3636 | 395 |
| 154 | 3300049588 | Ga0501072_0008401 | Ga0501072_0008401_4443_5633 | 395 |
| 155 | 3300049588 | Ga0501072_0054304 | Ga0501072_0054304_214_1404 | 395 |
| 156 | 3300049589 | Ga0501073_0149753 | Ga0501073_0149753_184_1374 | 395 |
| 157 | 3300049591 | Ga0501075_0002429 | Ga0501075_0002429_2342_3532 | 395 |
| 158 | 3300049592 | Ga0501076_0003906 | Ga0501076_0003906_8739_9929 | 395 |
| 159 | 3300049741 | Ga0501079_0013856 | Ga0501079_0013856_579_1769 | 395 |
| 160 | 3300049742 | Ga0501080_0038003 | Ga0501080_0038003_1698_2888 | 395 |
| 161 | 3300049743 | Ga0501081_0003584 | Ga0501081_0003584_7483_8673 | 395 |
| 162 | 3300049824 | Ga0501045_0008515 | Ga0501045_0008515_3633_4823 | 395 |
| 163 | 3300050491 | nmdc:mga00v17_22490_c1 | nmdc:mga00v17_22490_c1_1706_2896 | 395 |
| 164 | 3300050511 | nmdc:mga08y16_4065_c1 | nmdc:mga08y16_4065_c1_11116_12306 | 395 |
| 165 | 3300050514 | nmdc:mga08x19_352_c1 | nmdc:mga08x19_352_c1_21148_22335 | 395 |
| 166 | 3300054114 | Ga0501084_0101631 | Ga0501084_0101631_570_1760 | 395 |
| 167 | 3300060353 | Ga0501082_0051361 | Ga0501082_0051361_958_2148 | 395 |
| 168 | 3300061734 | Ga0530510_0001019 | Ga0530510_0001019_12307_13497 | 395 |
| 169 | 3300005327 | Ga0070658_10023545 | Ga0070658_100235452 | 396 |
| 170 | 3300005330 | Ga0070690_100025925 | Ga0070690_1000259253 | 396 |
| 171 | 3300005331 | Ga0070670_100162152 | Ga0070670_1001621522 | 396 |
| 172 | 3300005334 | Ga0068869_100055053 | Ga0068869_1000550533 | 396 |
| 173 | 3300005338 | Ga0068868_100140757 | Ga0068868_1001407572 | 396 |
| 174 | 3300005339 | Ga0070660_100071696 | Ga0070660_1000716962 | 396 |
| 175 | 3300005340 | Ga0070689_100179382 | Ga0070689_1001793822 | 396 |
| 176 | 3300005343 | Ga0070687_100070244 | Ga0070687_1000702442 | 396 |
| 177 | 3300005345 | Ga0070692_10009789 | Ga0070692_100097892 | 396 |
| 178 | 3300005345 | Ga0070692_10027835 | Ga0070692_100278352 | 396 |
| 179 | 3300005347 | Ga0070668_100014114 | Ga0070668_1000141143 | 396 |
| 180 | 3300005365 | Ga0070688_100150850 | Ga0070688_1001508501 | 396 |
| 181 | 3300005367 | Ga0070667_100090477 | Ga0070667_1000904773 | 396 |
| 182 | 3300005406 | Ga0070703_10043619 | Ga0070703_100436192 | 396 |
| 183 | 3300005436 | Ga0070713_100000039 | Ga0070713_10000003966 | 396 |
| 184 | 3300005436 | Ga0070713_100094764 | Ga0070713_1000947643 | 396 |
| 185 | 3300005436 | Ga0070713_100103266 | Ga0070713_1001032662 | 396 |
| 186 | 3300005438 | Ga0070701_10059281 | Ga0070701_100592812 | 396 |
| 187 | 3300005439 | Ga0070711_100014181 | Ga0070711_1000141812 | 396 |
| 188 | 3300005441 | Ga0070700_100007478 | Ga0070700_1000074783 | 396 |
| 189 | 3300005445 | Ga0070708_100048373 | Ga0070708_1000483732 | 396 |
| 190 | 3300005445 | Ga0070708_100109486 | Ga0070708_1001094863 | 396 |
| 191 | 3300005457 | Ga0070662_100039776 | Ga0070662_1000397763 | 396 |
| 192 | 3300005459 | Ga0068867_100006181 | Ga0068867_1000061817 | 396 |
| 193 | 3300005468 | Ga0070707_100135214 | Ga0070707_1001352141 | 396 |
| 194 | 3300005518 | Ga0070699_100072619 | Ga0070699_1000726193 | 396 |
| 195 | 3300005530 | Ga0070679_100161494 | Ga0070679_1001614942 | 396 |
| 196 | 3300005543 | Ga0070672_100048210 | Ga0070672_1000482102 | 396 |
| 197 | 3300005544 | Ga0070686_100043687 | Ga0070686_1000436872 | 396 |
| 198 | 3300005547 | Ga0070693_100008685 | Ga0070693_1000086854 | 396 |
| 199 | 3300005548 | Ga0070665_100112933 | Ga0070665_1001129333 | 396 |
| 200 | 3300005616 | Ga0068852_100000463 | Ga0068852_10000046318 | 396 |
| 201 | 3300005617 | Ga0068859_100188690 | Ga0068859_1001886902 | 396 |
| 202 | 3300005719 | Ga0068861_100001807 | Ga0068861_10000180710 | 396 |
| 203 | 3300005719 | Ga0068861_100127263 | Ga0068861_1001272631 | 396 |
| 204 | 3300005834 | Ga0068851_10000646 | Ga0068851_100006465 | 396 |
| 205 | 3300005844 | Ga0068862_100015761 | Ga0068862_1000157616 | 396 |
| 206 | 3300006175 | Ga0070712_100026720 | Ga0070712_1000267203 | 396 |
| 207 | 3300006358 | Ga0068871_100009417 | Ga0068871_1000094171 | 396 |
| 208 | 3300006358 | Ga0068871_100154175 | Ga0068871_1001541752 | 396 |
| 209 | 3300006871 | Ga0075434_100275159 | Ga0075434_1002751592 | 396 |
| 210 | 3300006914 | Ga0075436_100090191 | Ga0075436_1000901912 | 396 |
| 211 | 3300006931 | Ga0097620_100188705 | Ga0097620_1001887052 | 396 |
| 212 | 3300009093 | Ga0105240_10137311 | Ga0105240_101373112 | 396 |
| 213 | 3300009093 | Ga0105240_10156464 | Ga0105240_101564642 | 396 |
| 214 | 3300009094 | Ga0111539_10002706 | Ga0111539_1000270611 | 396 |
| 215 | 3300009094 | Ga0111539_10036739 | Ga0111539_100367394 | 396 |
| 216 | 3300009094 | Ga0111539_10296055 | Ga0111539_102960552 | 396 |
| 217 | 3300009098 | Ga0105245_10019049 | Ga0105245_100190496 | 396 |
| 218 | 3300009098 | Ga0105245_10246551 | Ga0105245_102465512 | 396 |
| 219 | 3300009098 | Ga0105245_10252363 | Ga0105245_102523631 | 396 |
| 220 | 3300009148 | Ga0105243_10023905 | Ga0105243_100239053 | 396 |
| 221 | 3300009148 | Ga0105243_10239582 | Ga0105243_102395822 | 396 |
| 222 | 3300009551 | Ga0105238_10174123 | Ga0105238_101741232 | 396 |
| 223 | 3300009553 | Ga0105249_10038052 | Ga0105249_100380524 | 396 |
| 224 | 3300011119 | Ga0105246_10118737 | Ga0105246_101187371 | 396 |
| 225 | 3300013102 | Ga0157371_10074086 | Ga0157371_100740862 | 396 |
| 226 | 3300013104 | Ga0157370_10001120 | Ga0157370_1000112032 | 396 |
| 227 | 3300013296 | Ga0157374_10003153 | Ga0157374_1000315312 | 396 |
| 228 | 3300013306 | Ga0163162_10024159 | Ga0163162_100241596 | 396 |
| 229 | 3300013307 | Ga0157372_10105630 | Ga0157372_101056302 | 396 |
| 230 | 3300014325 | Ga0163163_10029549 | Ga0163163_100295492 | 396 |
| 231 | 3300014326 | Ga0157380_10005369 | Ga0157380_100053696 | 396 |
| 232 | 3300014745 | Ga0157377_10021138 | Ga0157377_100211383 | 396 |
| 233 | 3300014968 | Ga0157379_10034163 | Ga0157379_100341635 | 396 |
| 234 | 3300014969 | Ga0157376_10023143 | Ga0157376_100231433 | 396 |
| 235 | 3300025321 | Ga0207656_10007190 | Ga0207656_100071903 | 396 |
| 236 | 3300025906 | Ga0207699_10120966 | Ga0207699_101209662 | 396 |
| 237 | 3300025909 | Ga0207705_10008790 | Ga0207705_100087904 | 396 |
| 238 | 3300025913 | Ga0207695_10281550 | Ga0207695_102815502 | 396 |
| 239 | 3300025915 | Ga0207693_10016820 | Ga0207693_100168205 | 396 |
| 240 | 3300025915 | Ga0207693_10086019 | Ga0207693_100860193 | 396 |
| 241 | 3300025916 | Ga0207663_10100575 | Ga0207663_101005752 | 396 |
| 242 | 3300025918 | Ga0207662_10013861 | Ga0207662_100138614 | 396 |
| 243 | 3300025919 | Ga0207657_10002457 | Ga0207657_100024577 | 396 |
| 244 | 3300025921 | Ga0207652_10099837 | Ga0207652_100998371 | 396 |
| 245 | 3300025923 | Ga0207681_10000912 | Ga0207681_1000091213 | 396 |
| 246 | 3300025924 | Ga0207694_10072202 | Ga0207694_100722022 | 396 |
| 247 | 3300025927 | Ga0207687_10002728 | Ga0207687_100027283 | 396 |
| 248 | 3300025928 | Ga0207700_10000120 | Ga0207700_1000012030 | 396 |
| 249 | 3300025928 | Ga0207700_10140288 | Ga0207700_101402882 | 396 |
| 250 | 3300025929 | Ga0207664_10004956 | Ga0207664_100049569 | 396 |
| 251 | 3300025931 | Ga0207644_10041665 | Ga0207644_100416653 | 396 |
| 252 | 3300025933 | Ga0207706_10034357 | Ga0207706_100343573 | 396 |
| 253 | 3300025933 | Ga0207706_10182149 | Ga0207706_101821492 | 396 |
| 254 | 3300025934 | Ga0207686_10027898 | Ga0207686_100278982 | 396 |
| 255 | 3300025934 | Ga0207686_10089750 | Ga0207686_100897502 | 396 |
| 256 | 3300025935 | Ga0207709_10010869 | Ga0207709_100108693 | 396 |
| 257 | 3300025935 | Ga0207709_10027627 | Ga0207709_100276273 | 396 |
| 258 | 3300025935 | Ga0207709_10179714 | Ga0207709_101797142 | 396 |
| 259 | 3300025936 | Ga0207670_10077602 | Ga0207670_100776022 | 396 |
| 260 | 3300025937 | Ga0207669_10146228 | Ga0207669_101462282 | 396 |
| 261 | 3300025938 | Ga0207704_10000892 | Ga0207704_100008923 | 396 |
| 262 | 3300025939 | Ga0207665_10008190 | Ga0207665_100081904 | 396 |
| 263 | 3300025939 | Ga0207665_10063847 | Ga0207665_100638472 | 396 |
| 264 | 3300025941 | Ga0207711_10000116 | Ga0207711_100001162 | 396 |
| 265 | 3300025941 | Ga0207711_10050017 | Ga0207711_100500172 | 396 |
| 266 | 3300025942 | Ga0207689_10076277 | Ga0207689_100762773 | 396 |
| 267 | 3300025945 | Ga0207679_10163453 | Ga0207679_101634532 | 396 |
| 268 | 3300025949 | Ga0207667_10084681 | Ga0207667_100846812 | 396 |
| 269 | 3300025949 | Ga0207667_10170035 | Ga0207667_101700352 | 396 |
| 270 | 3300025960 | Ga0207651_10040744 | Ga0207651_100407442 | 396 |
| 271 | 3300025960 | Ga0207651_10211092 | Ga0207651_102110922 | 396 |
| 272 | 3300025961 | Ga0207712_10077448 | Ga0207712_100774482 | 396 |
| 273 | 3300025972 | Ga0207668_10006478 | Ga0207668_100064784 | 396 |
| 274 | 3300025981 | Ga0207640_10138001 | Ga0207640_101380012 | 396 |
| 275 | 3300025986 | Ga0207658_10076180 | Ga0207658_100761803 | 396 |
| 276 | 3300026023 | Ga0207677_10000188 | Ga0207677_1000018830 | 396 |
| 277 | 3300026035 | Ga0207703_10004730 | Ga0207703_100047307 | 396 |
| 278 | 3300026067 | Ga0207678_10068344 | Ga0207678_100683442 | 396 |
| 279 | 3300026075 | Ga0207708_10003875 | Ga0207708_100038757 | 396 |
| 280 | 3300026088 | Ga0207641_10041585 | Ga0207641_100415853 | 396 |
| 281 | 3300026089 | Ga0207648_10000242 | Ga0207648_1000024231 | 396 |
| 282 | 3300026089 | Ga0207648_10038434 | Ga0207648_100384341 | 396 |
| 283 | 3300026095 | Ga0207676_10000230 | Ga0207676_1000023014 | 396 |
| 284 | 3300026116 | Ga0207674_10015504 | Ga0207674_100155045 | 396 |
| 285 | 3300026118 | Ga0207675_100003332 | Ga0207675_10000333212 | 396 |
| 286 | 3300026118 | Ga0207675_100056778 | Ga0207675_1000567784 | 396 |
| 287 | 3300026121 | Ga0207683_10001896 | Ga0207683_1000189612 | 396 |
| 288 | 3300026142 | Ga0207698_10000850 | Ga0207698_1000085014 | 396 |
| 289 | 3300026142 | Ga0207698_10163739 | Ga0207698_101637392 | 396 |
| 290 | 3300027907 | Ga0207428_10052067 | Ga0207428_100520671 | 396 |
| 291 | 3300027907 | Ga0207428_10058714 | Ga0207428_100587142 | 396 |
| 292 | 3300028380 | Ga0268265_10011033 | Ga0268265_100110334 | 396 |
| 293 | 3300028381 | Ga0268264_10131497 | Ga0268264_101314972 | 396 |
| 294 | 3300035117 | Ga0373953_0028975 | Ga0373953_0028975_886_2079 | 396 |
| 295 | 3300035120 | Ga0373957_0053181 | Ga0373957_0053181_192_1388 | 396 |
| 296 | 3300035410 | Ga0373924_0091460 | Ga0373924_0091460_74_1270 | 396 |
| 297 | 3300035691 | Ga0373931_0035369 | Ga0373931_0035369_1280_2491 | 396 |
| 298 | 3300035692 | Ga0373935_0090830 | Ga0373935_0090830_521_1717 | 396 |
| 299 | 3300035695 | Ga0373927_0001550 | Ga0373927_0001550_875_2065 | 396 |
| 300 | 3300035725 | Ga0373947_0022849 | Ga0373947_0022849_768_1964 | 396 |
| 301 | 3300036401 | Ga0373937_0037152 | Ga0373937_0037152_1386_2579 | 396 |
| 302 | 3300037068 | Ga0373925_0013181 | Ga0373925_0013181_3833_5029 | 396 |
| 303 | 3300037068 | Ga0373925_0052591 | Ga0373925_0052591_1809_3005 | 396 |
| 304 | 3300039437 | Ga0436365_1401837 | Ga0436365_1401837_1761_2954 | 396 |
| 305 | 3300042001 | Ga0439441_004573 | Ga0439441_004573_139_1332 | 396 |
| 306 | 3300042125 | Ga0450923_014536 | Ga0450923_014536_90_1283 | 396 |
| 307 | 3300046472 | Ga0495580_0038625 | Ga0495580_0038625_1273_2469 | 396 |
| 308 | 3300046475 | Ga0495639_0042502 | Ga0495639_0042502_581_1777 | 396 |
| 309 | 3300046477 | Ga0495664_0011476 | Ga0495664_0011476_3027_4223 | 396 |
| 310 | 3300046491 | Ga0495584_0018299 | Ga0495584_0018299_239_1429 | 396 |
| 311 | 3300046511 | Ga0495608_0021651 | Ga0495608_0021651_2881_4074 | 396 |
| 312 | 3300046536 | Ga0495587_0021535 | Ga0495587_0021535_2059_3252 | 396 |
| 313 | 3300046543 | Ga0495645_0009193 | Ga0495645_0009193_483_1676 | 396 |
| 314 | 3300046543 | Ga0495645_0020341 | Ga0495645_0020341_2606_3802 | 396 |
| 315 | 3300046559 | Ga0495667_0047134 | Ga0495667_0047134_1487_2680 | 396 |
| 316 | 3300046663 | Ga0495635_0003526 | Ga0495635_0003526_827_2023 | 396 |
| 317 | 3300046675 | Ga0495657_0127421 | Ga0495657_0127421_60_1256 | 396 |
| 318 | 3300046678 | Ga0495599_0022795 | Ga0495599_0022795_1449_2642 | 396 |
| 319 | 3300046679 | Ga0495623_0067407 | Ga0495623_0067407_512_1705 | 396 |
| 320 | 3300046679 | Ga0495623_0068239 | Ga0495623_0068239_943_2139 | 396 |
| 321 | 3300046681 | Ga0495647_0006673 | Ga0495647_0006673_1273_2469 | 396 |
| 322 | 3300046689 | Ga0495613_0016231 | Ga0495613_0016231_1065_2261 | 396 |
| 323 | 3300047315 | Ga0495581_0010438 | Ga0495581_0010438_2317_3513 | 396 |
| 324 | 3300047319 | Ga0495674_0081609 | Ga0495674_0081609_1395_2591 | 396 |
| 325 | 3300047444 | Ga0495675_0080182 | Ga0495675_0080182_235_1431 | 396 |
| 326 | 3300047471 | Ga0495684_0028581 | Ga0495684_0028581_580_1776 | 396 |
| 327 | 3300048089 | Ga0495614_0031656 | Ga0495614_0031656_220_1416 | 396 |
| 328 | 3300048907 | Ga0496104_0009253 | Ga0496104_0009253_5410_6606 | 396 |
| 329 | 3300048908 | Ga0496105_0069900 | Ga0496105_0069900_1006_2199 | 396 |
| 330 | 3300048910 | Ga0496107_0055618 | Ga0496107_0055618_209_1405 | 396 |
| 331 | 3300048911 | Ga0496108_0042748 | Ga0496108_0042748_1420_2616 | 396 |
| 332 | 3300048912 | Ga0496109_0386059 | Ga0496109_0386059_102_1313 | 396 |
| 333 | 3300048915 | Ga0496112_0038487 | Ga0496112_0038487_1637_2833 | 396 |
| 334 | 3300048915 | Ga0496112_0207203 | Ga0496112_0207203_222_1415 | 396 |
| 335 | 3300049581 | Ga0501047_0103185 | Ga0501047_0103185_637_1830 | 396 |
| 336 | 3300049584 | Ga0501068_0033760 | Ga0501068_0033760_1296_2489 | 396 |
| 337 | 3300049585 | Ga0501069_0024971 | Ga0501069_0024971_748_1941 | 396 |
| 338 | 3300049586 | Ga0501070_0011981 | Ga0501070_0011981_2410_3603 | 396 |
| 339 | 3300049589 | Ga0501073_0001346 | Ga0501073_0001346_16052_17245 | 396 |
| 340 | 3300049590 | Ga0501074_0001670 | Ga0501074_0001670_12747_13940 | 396 |
| 341 | 3300049741 | Ga0501079_0014247 | Ga0501079_0014247_387_1580 | 396 |
| 342 | 3300049744 | Ga0501083_0004033 | Ga0501083_0004033_853_2046 | 396 |
| 343 | 3300050511 | nmdc:mga08y16_8133_c1 | nmdc:mga08y16_8133_c1_3830_5023 | 396 |
| 344 | 3300050514 | nmdc:mga08x19_97140_c1 | nmdc:mga08x19_97140_c1_306_1499 | 396 |
| 345 | 3300053084 | Ga0495595_0014569 | Ga0495595_0014569_1322_2515 | 396 |
| 346 | 3300053085 | Ga0495619_0004815 | Ga0495619_0004815_324_1520 | 396 |
| 347 | 3300053085 | Ga0495619_0037876 | Ga0495619_0037876_1513_2706 | 396 |
| 348 | 3300005290 | Ga0065712_10153779 | Ga0065712_101537791 | 397 |
| 349 | 3300005330 | Ga0070690_100004977 | Ga0070690_1000049778 | 397 |
| 350 | 3300005334 | Ga0068869_100009266 | Ga0068869_1000092667 | 397 |
| 351 | 3300005334 | Ga0068869_100045360 | Ga0068869_1000453602 | 397 |
| 352 | 3300005336 | Ga0070680_100012912 | Ga0070680_1000129122 | 397 |
| 353 | 3300005338 | Ga0068868_100002303 | Ga0068868_1000023032 | 397 |
| 354 | 3300005340 | Ga0070689_100013040 | Ga0070689_1000130404 | 397 |
| 355 | 3300005340 | Ga0070689_100058778 | Ga0070689_1000587783 | 397 |
| 356 | 3300005341 | Ga0070691_10017191 | Ga0070691_100171912 | 397 |
| 357 | 3300005344 | Ga0070661_100067057 | Ga0070661_1000670572 | 397 |
| 358 | 3300005345 | Ga0070692_10000696 | Ga0070692_100006964 | 397 |
| 359 | 3300005365 | Ga0070688_100028038 | Ga0070688_1000280383 | 397 |
| 360 | 3300005365 | Ga0070688_100041331 | Ga0070688_1000413312 | 397 |
| 361 | 3300005406 | Ga0070703_10008813 | Ga0070703_100088132 | 397 |
| 362 | 3300005435 | Ga0070714_100004849 | Ga0070714_1000048496 | 397 |
| 363 | 3300005435 | Ga0070714_100027080 | Ga0070714_1000270804 | 397 |
| 364 | 3300005438 | Ga0070701_10000703 | Ga0070701_100007032 | 397 |
| 365 | 3300005440 | Ga0070705_100000030 | Ga0070705_1000000302 | 397 |
| 366 | 3300005441 | Ga0070700_100001420 | Ga0070700_10000142011 | 397 |
| 367 | 3300005444 | Ga0070694_100057040 | Ga0070694_1000570402 | 397 |
| 368 | 3300005459 | Ga0068867_100043771 | Ga0068867_1000437712 | 397 |
| 369 | 3300005459 | Ga0068867_100141170 | Ga0068867_1001411702 | 397 |
| 370 | 3300005530 | Ga0070679_100088227 | Ga0070679_1000882272 | 397 |
| 371 | 3300005545 | Ga0070695_100000012 | Ga0070695_1000000122 | 397 |
| 372 | 3300005546 | Ga0070696_100033945 | Ga0070696_1000339453 | 397 |
| 373 | 3300005547 | Ga0070693_100000027 | Ga0070693_10000002728 | 397 |
| 374 | 3300005547 | Ga0070693_100045556 | Ga0070693_1000455561 | 397 |
| 375 | 3300005549 | Ga0070704_100055146 | Ga0070704_1000551462 | 397 |
| 376 | 3300005563 | Ga0068855_100002039 | Ga0068855_1000020392 | 397 |
| 377 | 3300005614 | Ga0068856_100079683 | Ga0068856_1000796832 | 397 |
| 378 | 3300005614 | Ga0068856_100094237 | Ga0068856_1000942373 | 397 |
| 379 | 3300005615 | Ga0070702_100028015 | Ga0070702_1000280152 | 397 |
| 380 | 3300005616 | Ga0068852_100123744 | Ga0068852_1001237442 | 397 |
| 381 | 3300005616 | Ga0068852_100175327 | Ga0068852_1001753272 | 397 |
| 382 | 3300005617 | Ga0068859_100000392 | Ga0068859_10000039244 | 397 |
| 383 | 3300005718 | Ga0068866_10000043 | Ga0068866_1000004323 | 397 |
| 384 | 3300005719 | Ga0068861_100036886 | Ga0068861_1000368862 | 397 |
| 385 | 3300005843 | Ga0068860_100003708 | Ga0068860_1000037081 | 397 |
| 386 | 3300005844 | Ga0068862_100051657 | Ga0068862_1000516572 | 397 |
| 387 | 3300006358 | Ga0068871_100000355 | Ga0068871_10000035527 | 397 |
| 388 | 3300006844 | Ga0075428_100000433 | Ga0075428_10000043333 | 397 |
| 389 | 3300006846 | Ga0075430_100138527 | Ga0075430_1001385272 | 397 |
| 390 | 3300006880 | Ga0075429_100000037 | Ga0075429_10000003731 | 397 |
| 391 | 3300006881 | Ga0068865_100001523 | Ga0068865_1000015233 | 397 |
| 392 | 3300006931 | Ga0097620_100000392 | Ga0097620_10000039244 | 397 |
| 393 | 3300009098 | Ga0105245_10000177 | Ga0105245_1000017728 | 397 |
| 394 | 3300009147 | Ga0114129_10001488 | Ga0114129_1000148813 | 397 |
| 395 | 3300009148 | Ga0105243_10000815 | Ga0105243_100008156 | 397 |
| 396 | 3300009174 | Ga0105241_10008874 | Ga0105241_100088746 | 397 |
| 397 | 3300009176 | Ga0105242_10000061 | Ga0105242_1000006129 | 397 |
| 398 | 3300009176 | Ga0105242_10041962 | Ga0105242_100419624 | 397 |
| 399 | 3300009553 | Ga0105249_10450239 | Ga0105249_104502391 | 397 |
| 400 | 3300013105 | Ga0157369_10222223 | Ga0157369_102222232 | 397 |
| 401 | 3300013297 | Ga0157378_10006628 | Ga0157378_1000662810 | 397 |
| 402 | 3300013307 | Ga0157372_10028828 | Ga0157372_100288286 | 397 |
| 403 | 3300014326 | Ga0157380_10041923 | Ga0157380_100419232 | 397 |
| 404 | 3300014969 | Ga0157376_10009080 | Ga0157376_100090802 | 397 |
| 405 | 3300025912 | Ga0207707_10171738 | Ga0207707_101717382 | 397 |
| 406 | 3300025918 | Ga0207662_10000613 | Ga0207662_100006133 | 397 |
| 407 | 3300025921 | Ga0207652_10069331 | Ga0207652_100693312 | 397 |
| 408 | 3300025924 | Ga0207694_10010483 | Ga0207694_100104837 | 397 |
| 409 | 3300025926 | Ga0207659_10041583 | Ga0207659_100415832 | 397 |
| 410 | 3300025927 | Ga0207687_10001330 | Ga0207687_100013302 | 397 |
| 411 | 3300025928 | Ga0207700_10211181 | Ga0207700_102111812 | 397 |
| 412 | 3300025929 | Ga0207664_10008029 | Ga0207664_100080295 | 397 |
| 413 | 3300025934 | Ga0207686_10023547 | Ga0207686_100235473 | 397 |
| 414 | 3300025935 | Ga0207709_10017319 | Ga0207709_100173194 | 397 |
| 415 | 3300025936 | Ga0207670_10034431 | Ga0207670_100344314 | 397 |
| 416 | 3300025936 | Ga0207670_10060616 | Ga0207670_100606164 | 397 |
| 417 | 3300025938 | Ga0207704_10010443 | Ga0207704_100104434 | 397 |
| 418 | 3300025940 | Ga0207691_10032133 | Ga0207691_100321334 | 397 |
| 419 | 3300025942 | Ga0207689_10000209 | Ga0207689_1000020943 | 397 |
| 420 | 3300026023 | Ga0207677_10021913 | Ga0207677_100219132 | 397 |
| 421 | 3300026035 | Ga0207703_10052242 | Ga0207703_100522423 | 397 |
| 422 | 3300026075 | Ga0207708_10000189 | Ga0207708_1000018925 | 397 |
| 423 | 3300026089 | Ga0207648_10000055 | Ga0207648_1000005573 | 397 |
| 424 | 3300026118 | Ga0207675_100000188 | Ga0207675_10000018812 | 397 |
| 425 | 3300026142 | Ga0207698_10025945 | Ga0207698_100259453 | 397 |
| 426 | 3300027907 | Ga0207428_10003824 | Ga0207428_100038245 | 397 |
| 427 | 3300028380 | Ga0268265_10003484 | Ga0268265_1000348411 | 397 |
| 428 | 3300028381 | Ga0268264_10000636 | Ga0268264_100006362 | 397 |
| 429 | 3300028381 | Ga0268264_10060788 | Ga0268264_100607883 | 397 |
| 430 | 3300028794 | Ga0307515_10039075 | Ga0307515_100390755 | 397 |
| 431 | 3300031507 | Ga0307509_10106706 | Ga0307509_101067063 | 397 |
| 432 | 3300031730 | Ga0307516_10010057 | Ga0307516_100100573 | 397 |
| 433 | 3300035092 | Ga0373952_0005294 | Ga0373952_0005294_462_1658 | 397 |
| 434 | 3300035112 | Ga0373932_0000747 | Ga0373932_0000747_1993_3189 | 397 |
| 435 | 3300035115 | Ga0373941_0014905 | Ga0373941_0014905_95_1291 | 397 |
| 436 | 3300035119 | Ga0373956_0009731 | Ga0373956_0009731_280_1476 | 397 |
| 437 | 3300035207 | Ga0373942_0029639 | Ga0373942_0029639_48_1244 | 397 |
| 438 | 3300035241 | Ga0373961_0000445 | Ga0373961_0000445_9970_11166 | 397 |
| 439 | 3300035691 | Ga0373931_0000646 | Ga0373931_0000646_913_2109 | 397 |
| 440 | 3300035691 | Ga0373931_0016530 | Ga0373931_0016530_2424_3620 | 397 |
| 441 | 3300042876 | Ga0451577_0084105 | Ga0451577_0084105_1241_2437 | 397 |
| 442 | 3300045051 | Ga0451576_0010262 | Ga0451576_0010262_9165_10361 | 397 |
| 443 | 3300045051 | Ga0451576_0012994 | Ga0451576_0012994_7730_8926 | 397 |
| 444 | 3300045051 | Ga0451576_0241385 | Ga0451576_0241385_267_1463 | 397 |
| 445 | 3300046537 | Ga0495598_0037753 | Ga0495598_0037753_48_1244 | 397 |
| 446 | 3300049568 | Ga0501031_0032599 | Ga0501031_0032599_448_1644 | 397 |
| 447 | 3300049570 | Ga0501033_0028336 | Ga0501033_0028336_2634_3830 | 397 |
| 448 | 3300049574 | Ga0501038_0001109 | Ga0501038_0001109_10363_11559 | 397 |
| 449 | 3300049575 | Ga0501039_0015991 | Ga0501039_0015991_2857_4053 | 397 |
| 450 | 3300049576 | Ga0501040_0001909 | Ga0501040_0001909_3873_5069 | 397 |
| 451 | 3300049577 | Ga0501041_0003730 | Ga0501041_0003730_5983_7179 | 397 |
| 452 | 3300049578 | Ga0501042_0000383 | Ga0501042_0000383_12817_14013 | 397 |
| 453 | 3300049580 | Ga0501046_0001197 | Ga0501046_0001197_13177_14373 | 397 |
| 454 | 3300049582 | Ga0501048_0104738 | Ga0501048_0104738_87_1283 | 397 |
| 455 | 3300049584 | Ga0501068_0046140 | Ga0501068_0046140_570_1766 | 397 |
| 456 | 3300049587 | Ga0501071_0020152 | Ga0501071_0020152_1063_2259 | 397 |
| 457 | 3300049588 | Ga0501072_0002470 | Ga0501072_0002470_3957_5153 | 397 |
| 458 | 3300049590 | Ga0501074_0053513 | Ga0501074_0053513_98_1294 | 397 |
| 459 | 3300049591 | Ga0501075_0000525 | Ga0501075_0000525_12934_14130 | 397 |
| 460 | 3300049592 | Ga0501076_0013583 | Ga0501076_0013583_3194_4390 | 397 |
| 461 | 3300049593 | Ga0501077_0031416 | Ga0501077_0031416_881_2077 | 397 |
| 462 | 3300049741 | Ga0501079_0000625 | Ga0501079_0000625_12591_13787 | 397 |
| 463 | 3300049742 | Ga0501080_0110457 | Ga0501080_0110457_235_1431 | 397 |
| 464 | 3300049743 | Ga0501081_0000055 | Ga0501081_0000055_6141_7337 | 397 |
| 465 | 3300049744 | Ga0501083_0077415 | Ga0501083_0077415_16_1212 | 397 |
| 466 | 3300049823 | Ga0501044_0049886 | Ga0501044_0049886_738_1934 | 397 |
| 467 | 3300049824 | Ga0501045_0000901 | Ga0501045_0000901_6661_7857 | 397 |
| 468 | 3300050507 | nmdc:mga05p37_387_c1 | nmdc:mga05p37_387_c1_19828_21024 | 397 |
| 469 | 3300050508 | nmdc:mga09592_17457_c1 | nmdc:mga09592_17457_c1_2093_3289 | 397 |
| 470 | 3300050508 | nmdc:mga09592_212_c1 | nmdc:mga09592_212_c1_32569_33765 | 397 |
| 471 | 3300050509 | nmdc:mga0qj67_158294_c1 | nmdc:mga0qj67_158294_c1_72_1268 | 397 |
| 472 | 3300050509 | nmdc:mga0qj67_56027_c1 | nmdc:mga0qj67_56027_c1_942_2138 | 397 |
| 473 | 3300050510 | nmdc:mga06r32_357105_c1 | nmdc:mga06r32_357105_c1_72_1268 | 397 |
| 474 | 3300050511 | nmdc:mga08y16_76703_c1 | nmdc:mga08y16_76703_c1_1280_2476 | 397 |
| 475 | 3300050511 | nmdc:mga08y16_95983_c1 | nmdc:mga08y16_95983_c1_1308_2504 | 397 |
| 476 | 3300053080 | Ga0500635_0014303 | Ga0500635_0014303_367_1563 | 397 |
| 477 | 3300053094 | Ga0500566_0002758 | Ga0500566_0002758_5144_6340 | 397 |
| 478 | 3300053094 | Ga0500566_0011675 | Ga0500566_0011675_1649_2845 | 397 |
| 479 | 3300053095 | Ga0500640_004928 | Ga0500640_004928_1811_3007 | 397 |
| 480 | 3300053102 | Ga0500554_000602 | Ga0500554_000602_4328_5524 | 397 |
| 481 | 3300053111 | Ga0500572_000814 | Ga0500572_000814_4608_5804 | 397 |
| 482 | 3300053119 | Ga0500595_000093 | Ga0500595_000093_26984_28180 | 397 |
| 483 | 3300053123 | Ga0500614_000153 | Ga0500614_000153_1830_3026 | 397 |
| 484 | 3300053136 | Ga0500559_0012960 | Ga0500559_0012960_691_1887 | 397 |
| 485 | 3300053177 | Ga0500636_0033621 | Ga0500636_0033621_365_1561 | 397 |
| 486 | 3300054114 | Ga0501084_0002498 | Ga0501084_0002498_1268_2464 | 397 |
| 487 | 3300060353 | Ga0501082_0008950 | Ga0501082_0008950_1957_3153 | 397 |
| 488 | 3300061734 | Ga0530510_0001004 | Ga0530510_0001004_13677_14873 | 397 |
| 489 | 3300006914 | Ga0075436_100000745 | Ga0075436_1000007456 | 398 |
| 490 | 3300031507 | Ga0307509_10012723 | Ga0307509_100127237 | 398 |
| 491 | 3300031548 | Ga0307408_100186541 | Ga0307408_1001865412 | 398 |
| 492 | 3300005435 | Ga0070714_100012985 | Ga0070714_1000129856 | 399 |
| 493 | 3300005436 | Ga0070713_100010346 | Ga0070713_1000103466 | 399 |
| 494 | 3300005437 | Ga0070710_10056986 | Ga0070710_100569862 | 399 |
| 495 | 3300005439 | Ga0070711_100122753 | Ga0070711_1001227532 | 399 |
| 496 | 3300005518 | Ga0070699_100039484 | Ga0070699_1000394842 | 399 |
| 497 | 3300005530 | Ga0070679_100106800 | Ga0070679_1001068002 | 399 |
| 498 | 3300005546 | Ga0070696_100000647 | Ga0070696_1000006475 | 399 |
| 499 | 3300009093 | Ga0105240_10006057 | Ga0105240_100060578 | 399 |
| 500 | 3300013104 | Ga0157370_10010117 | Ga0157370_100101175 | 399 |
| 501 | 3300025906 | Ga0207699_10023529 | Ga0207699_100235293 | 399 |
| 502 | 3300025913 | Ga0207695_10063273 | Ga0207695_100632734 | 399 |
| 503 | 3300025916 | Ga0207663_10071354 | Ga0207663_100713542 | 399 |
| 504 | 3300025921 | Ga0207652_10120843 | Ga0207652_101208433 | 399 |
| 505 | 3300025928 | Ga0207700_10100186 | Ga0207700_101001862 | 399 |
| 506 | 3300025929 | Ga0207664_10034956 | Ga0207664_100349562 | 399 |
| 507 | 3300025945 | Ga0207679_10018769 | Ga0207679_100187693 | 399 |
| 508 | 3300025949 | Ga0207667_10049743 | Ga0207667_100497433 | 399 |
| 509 | 3300027614 | Ga0209970_1001796 | Ga0209970_10017963 | 399 |
| 510 | 3300031548 | Ga0307408_100019168 | Ga0307408_1000191682 | 399 |
| 511 | 3300031731 | Ga0307405_10020125 | Ga0307405_100201254 | 399 |
| 512 | 3300031824 | Ga0307413_10013780 | Ga0307413_100137803 | 399 |
| 513 | 3300031852 | Ga0307410_10084797 | Ga0307410_100847971 | 399 |
| 514 | 3300032002 | Ga0307416_100005561 | Ga0307416_1000055615 | 399 |
| 515 | 3300032005 | Ga0307411_10066351 | Ga0307411_100663512 | 399 |
| 516 | 3300035113 | Ga0373936_0001963 | Ga0373936_0001963_3447_4649 | 399 |
| 517 | 3300035116 | Ga0373945_0006255 | Ga0373945_0006255_1932_3140 | 399 |
| 518 | 3300035170 | Ga0373943_0001833 | Ga0373943_0001833_3786_4988 | 399 |
| 519 | 3300035170 | Ga0373943_0007550 | Ga0373943_0007550_451_1659 | 399 |
| 520 | 3300035171 | Ga0373946_0002403 | Ga0373946_0002403_1689_2897 | 399 |
| 521 | 3300035692 | Ga0373935_0004641 | Ga0373935_0004641_6548_7756 | 399 |
| 522 | 3300035695 | Ga0373927_0006549 | Ga0373927_0006549_3501_4709 | 399 |
| 523 | 3300037068 | Ga0373925_0010675 | Ga0373925_0010675_1949_3151 | 399 |
| 524 | 3300037068 | Ga0373925_0011332 | Ga0373925_0011332_373_1581 | 399 |
| 525 | 3300046455 | Ga0495603_0014421 | Ga0495603_0014421_2264_3472 | 399 |
| 526 | 3300046472 | Ga0495580_0000377 | Ga0495580_0000377_16039_17247 | 399 |
| 527 | 3300046475 | Ga0495639_0001938 | Ga0495639_0001938_7550_8758 | 399 |
| 528 | 3300005563 | Ga0068855_100026884 | Ga0068855_1000268842 | 400 |
| 529 | 3300009093 | Ga0105240_10017051 | Ga0105240_100170518 | 400 |
| 530 | 3300013105 | Ga0157369_10004919 | Ga0157369_100049196 | 400 |
| 531 | 3300013307 | Ga0157372_10004130 | Ga0157372_1000413014 | 400 |
| 532 | 3300025321 | Ga0207656_10069901 | Ga0207656_100699012 | 400 |
| 533 | 3300025944 | Ga0207661_10099519 | Ga0207661_100995192 | 400 |
| 534 | 3300025949 | Ga0207667_10035815 | Ga0207667_100358152 | 400 |
| 535 | 3300026041 | Ga0207639_10051778 | Ga0207639_100517782 | 400 |
| 536 | 3300026142 | Ga0207698_10117326 | Ga0207698_101173262 | 400 |
| 537 | 3300044684 | Ga0466966_0062825 | Ga0466966_0062825_836_2044 | 400 |
| 538 | 3300044842 | Ga0466957_0002655 | Ga0466957_0002655_4427_5635 | 400 |
| 539 | iso_pu_bacteria | 2857537821 | 2857539115 | 400 |
| 540 | 3300005293 | Ga0065715_10093842 | Ga0065715_100938422 | 401 |
| 541 | 3300005366 | Ga0070659_100066189 | Ga0070659_1000661892 | 401 |
| 542 | 3300009545 | Ga0105237_10037224 | Ga0105237_100372244 | 401 |
| 543 | 3300013105 | Ga0157369_10080806 | Ga0157369_100808062 | 401 |
| 544 | 3300025914 | Ga0207671_10031796 | Ga0207671_100317963 | 401 |
| 545 | 3300025931 | Ga0207644_10065328 | Ga0207644_100653283 | 401 |
| 546 | 3300025932 | Ga0207690_10045820 | Ga0207690_100458202 | 401 |
| 547 | 3300035695 | Ga0373927_0044458 | Ga0373927_0044458_1156_2409 | 401 |
| 548 | 3300035725 | Ga0373947_0016721 | Ga0373947_0016721_1933_3186 | 401 |
| 549 | 3300037068 | Ga0373925_0077327 | Ga0373925_0077327_420_1673 | 401 |
| 550 | 3300046506 | Ga0495583_0010587 | Ga0495583_0010587_2584_3810 | 401 |
| 551 | 3300047318 | Ga0495636_0011491 | Ga0495636_0011491_448_1674 | 401 |
| 552 | 3300048905 | Ga0496102_0010080 | Ga0496102_0010080_803_2029 | 401 |
| 553 | iso_pu_bacteria | 2857542790 | 2857544553 | 401 |
| 554 | iso_pu_bacteria | 2858950400 | 2858956050 | 401 |
| 555 | 3300005331 | Ga0070670_100033282 | Ga0070670_1000332821 | 402 |
| 556 | 3300005344 | Ga0070661_100047204 | Ga0070661_1000472042 | 402 |
| 557 | 3300005366 | Ga0070659_100086474 | Ga0070659_1000864742 | 402 |
| 558 | 3300005367 | Ga0070667_100098296 | Ga0070667_1000982962 | 402 |
| 559 | 3300005564 | Ga0070664_100166989 | Ga0070664_1001669891 | 402 |
| 560 | 3300005578 | Ga0068854_100110307 | Ga0068854_1001103072 | 402 |
| 561 | 3300005834 | Ga0068851_10005030 | Ga0068851_100050304 | 402 |
| 562 | 3300005841 | Ga0068863_100040551 | Ga0068863_1000405512 | 402 |
| 563 | 3300005842 | Ga0068858_100117864 | Ga0068858_1001178643 | 402 |
| 564 | 3300009147 | Ga0114129_10486319 | Ga0114129_104863192 | 402 |
| 565 | 3300009177 | Ga0105248_10439293 | Ga0105248_104392931 | 402 |
| 566 | 3300014968 | Ga0157379_10006850 | Ga0157379_1000685011 | 402 |
| 567 | 3300025920 | Ga0207649_10079168 | Ga0207649_100791681 | 402 |
| 568 | 3300025981 | Ga0207640_10107784 | Ga0207640_101077841 | 402 |
| 569 | 3300026035 | Ga0207703_10075503 | Ga0207703_100755032 | 402 |
| 570 | 3300026067 | Ga0207678_10139044 | Ga0207678_101390442 | 402 |
| 571 | iso_pu_bacteria | 2881927736 | 2881928790 | 402 |
| 572 | 3300005353 | Ga0070669_100002777 | Ga0070669_1000027773 | 403 |
| 573 | 3300005364 | Ga0070673_100159082 | Ga0070673_1001590821 | 403 |
| 574 | 3300005457 | Ga0070662_100002542 | Ga0070662_1000025429 | 403 |
| 575 | 3300005564 | Ga0070664_100071399 | Ga0070664_1000713992 | 403 |
| 576 | 3300005618 | Ga0068864_100030787 | Ga0068864_1000307872 | 403 |
| 577 | 3300005841 | Ga0068863_100071731 | Ga0068863_1000717313 | 403 |
| 578 | 3300005843 | Ga0068860_100048523 | Ga0068860_1000485232 | 403 |
| 579 | 3300014497 | Ga0182008_10056854 | Ga0182008_100568542 | 403 |
| 580 | 3300014969 | Ga0157376_10023970 | Ga0157376_100239702 | 403 |
| 581 | 3300025923 | Ga0207681_10026305 | Ga0207681_100263052 | 403 |
| 582 | 3300025931 | Ga0207644_10002797 | Ga0207644_100027979 | 403 |
| 583 | 3300025938 | Ga0207704_10060219 | Ga0207704_100602192 | 403 |
| 584 | 3300025940 | Ga0207691_10001738 | Ga0207691_1000173814 | 403 |
| 585 | 3300025941 | Ga0207711_10010699 | Ga0207711_100106996 | 403 |
| 586 | 3300025960 | Ga0207651_10178184 | Ga0207651_101781841 | 403 |
| 587 | 3300026075 | Ga0207708_10127372 | Ga0207708_101273722 | 403 |
| 588 | 3300026095 | Ga0207676_10069893 | Ga0207676_100698932 | 403 |
| 589 | 3300026095 | Ga0207676_10308801 | Ga0207676_103088011 | 403 |
| 590 | 3300028381 | Ga0268264_10061585 | Ga0268264_100615853 | 403 |
| 591 | 3300046506 | Ga0495583_0000134 | Ga0495583_0000134_75962_77179 | 403 |
| 592 | 3300046506 | Ga0495583_0001580 | Ga0495583_0001580_20347_21564 | 403 |
| 593 | 3300046513 | Ga0495616_0000113 | Ga0495616_0000113_63282_64499 | 403 |
| 594 | 3300046520 | Ga0495637_0025465 | Ga0495637_0025465_870_2102 | 403 |
| 595 | 3300046665 | Ga0495661_0060772 | Ga0495661_0060772_764_1996 | 403 |
| 596 | 3300048091 | Ga0495626_0000384 | Ga0495626_0000384_4144_5376 | 403 |
| 597 | iso_pu_bacteria | 2887375801 | 2887378368 | 403 |
| 598 | iso_pu_bacteria | 8055225921 | 8055228768 | 403 |
| 599 | iso_pu_bacteria | 8055301274 | 8055308072 | 403 |
| 600 | 3300005344 | Ga0070661_100007548 | Ga0070661_1000075486 | 404 |
| 601 | 3300005355 | Ga0070671_100113740 | Ga0070671_1001137402 | 404 |
| 602 | 3300005366 | Ga0070659_100002518 | Ga0070659_10000251810 | 404 |
| 603 | 3300005441 | Ga0070700_100024997 | Ga0070700_1000249972 | 404 |
| 604 | 3300005563 | Ga0068855_100066930 | Ga0068855_1000669302 | 404 |
| 605 | 3300005564 | Ga0070664_100000662 | Ga0070664_10000066212 | 404 |
| 606 | 3300005614 | Ga0068856_100001976 | Ga0068856_1000019762 | 404 |
| 607 | 3300006844 | Ga0075428_100017431 | Ga0075428_1000174313 | 404 |
| 608 | 3300006847 | Ga0075431_100012395 | Ga0075431_1000123955 | 404 |
| 609 | 3300013100 | Ga0157373_10001573 | Ga0157373_100015736 | 404 |
| 610 | 3300013102 | Ga0157371_10002592 | Ga0157371_100025923 | 404 |
| 611 | 3300013307 | Ga0157372_10009719 | Ga0157372_100097199 | 404 |
| 612 | 3300013307 | Ga0157372_10019156 | Ga0157372_100191563 | 404 |
| 613 | 3300014745 | Ga0157377_10011882 | Ga0157377_100118823 | 404 |
| 614 | 3300025298 | Ga0209050_1009762 | Ga0209050_10097621 | 404 |
| 615 | 3300025303 | Ga0209051_1019461 | Ga0209051_10194612 | 404 |
| 616 | 3300025919 | Ga0207657_10037939 | Ga0207657_100379393 | 404 |
| 617 | 3300025933 | Ga0207706_10002770 | Ga0207706_1000277015 | 404 |
| 618 | 3300025936 | Ga0207670_10115436 | Ga0207670_101154362 | 404 |
| 619 | 3300025945 | Ga0207679_10002033 | Ga0207679_1000203312 | 404 |
| 620 | 3300025949 | Ga0207667_10245397 | Ga0207667_102453972 | 404 |
| 621 | 3300025986 | Ga0207658_10105485 | Ga0207658_101054852 | 404 |
| 622 | 3300026023 | Ga0207677_10179127 | Ga0207677_101791272 | 404 |
| 623 | 3300026075 | Ga0207708_10020959 | Ga0207708_100209592 | 404 |
| 624 | 3300026078 | Ga0207702_10002944 | Ga0207702_100029446 | 404 |
| 625 | 3300026089 | Ga0207648_10273939 | Ga0207648_102739392 | 404 |
| 626 | 3300031911 | Ga0307412_10000314 | Ga0307412_1000031410 | 404 |
| 627 | 3300046500 | Ga0495596_0002689 | Ga0495596_0002689_2999_4219 | 404 |
| 628 | 3300046522 | Ga0495643_0073302 | Ga0495643_0073302_505_1725 | 404 |
| 629 | 3300046523 | Ga0495644_0014028 | Ga0495644_0014028_1596_2816 | 404 |
| 630 | 3300046538 | Ga0495609_0002536 | Ga0495609_0002536_5203_6423 | 404 |
| 631 | 3300046648 | Ga0495611_0005937 | Ga0495611_0005937_1918_3138 | 404 |
| 632 | 3300046794 | Ga0495589_0055975 | Ga0495589_0055975_412_1632 | 404 |
| 633 | 3300047321 | Ga0495676_0053979 | Ga0495676_0053979_927_2147 | 404 |
| 634 | 3300047445 | Ga0495677_0038111 | Ga0495677_0038111_304_1524 | 404 |
| 635 | 3300047469 | Ga0495673_0080279 | Ga0495673_0080279_26_1246 | 404 |
| 636 | 3300048906 | Ga0496103_0092206 | Ga0496103_0092206_44_1303 | 404 |
| 637 | 3300048909 | Ga0496106_0008585 | Ga0496106_0008585_5944_7203 | 404 |
| 638 | 3300048910 | Ga0496107_0063772 | Ga0496107_0063772_1273_2532 | 404 |
| 639 | 3300048919 | Ga0496116_0013599 | Ga0496116_0013599_4827_6098 | 404 |
| 640 | 3300048921 | Ga0496118_0023565 | Ga0496118_0023565_3956_5227 | 404 |
| 641 | 3300048922 | Ga0496119_0029332 | Ga0496119_0029332_336_1607 | 404 |
| 642 | 3300048923 | Ga0496120_0069419 | Ga0496120_0069419_380_1651 | 404 |
| 643 | 3300048924 | Ga0496121_0000568 | Ga0496121_0000568_33557_34828 | 404 |
| 644 | 3300048925 | Ga0496122_0146633 | Ga0496122_0146633_84_1355 | 404 |
| 645 | 3300048928 | Ga0496125_0000105 | Ga0496125_0000105_48027_49298 | 404 |
| 646 | 3300048929 | Ga0496126_0170478 | Ga0496126_0170478_72_1343 | 404 |
| 647 | 3300050508 | nmdc:mga09592_83861_c1 | nmdc:mga09592_83861_c1_286_1506 | 404 |
| 648 | 3300050509 | nmdc:mga0qj67_1416_c1 | nmdc:mga0qj67_1416_c1_11865_13085 | 404 |
| 649 | iso_pu_bacteria | 2643221569 | 2643860435 | 404 |
| 650 | iso_pu_bacteria | 2941479691 | 2941483841 | 404 |
| 651 | 3300005329 | Ga0070683_100035551 | Ga0070683_1000355513 | 405 |
| 652 | 3300005331 | Ga0070670_100004715 | Ga0070670_1000047157 | 405 |
| 653 | 3300005434 | Ga0070709_10028027 | Ga0070709_100280272 | 405 |
| 654 | 3300005444 | Ga0070694_100002295 | Ga0070694_10000229512 | 405 |
| 655 | 3300005455 | Ga0070663_100002206 | Ga0070663_1000022069 | 405 |
| 656 | 3300005530 | Ga0070679_100190438 | Ga0070679_1001904382 | 405 |
| 657 | 3300005577 | Ga0068857_100009373 | Ga0068857_1000093735 | 405 |
| 658 | 3300005614 | Ga0068856_100178136 | Ga0068856_1001781362 | 405 |
| 659 | 3300005617 | Ga0068859_100134643 | Ga0068859_1001346432 | 405 |
| 660 | 3300005834 | Ga0068851_10006641 | Ga0068851_100066414 | 405 |
| 661 | 3300005844 | Ga0068862_100064192 | Ga0068862_1000641922 | 405 |
| 662 | 3300006931 | Ga0097620_100134648 | Ga0097620_1001346482 | 405 |
| 663 | 3300009093 | Ga0105240_10004865 | Ga0105240_100048656 | 405 |
| 664 | 3300009098 | Ga0105245_10051828 | Ga0105245_100518285 | 405 |
| 665 | 3300009174 | Ga0105241_10011109 | Ga0105241_100111093 | 405 |
| 666 | 3300009177 | Ga0105248_10024460 | Ga0105248_100244606 | 405 |
| 667 | 3300009545 | Ga0105237_10008781 | Ga0105237_1000878110 | 405 |
| 668 | 3300009551 | Ga0105238_10243138 | Ga0105238_102431382 | 405 |
| 669 | 3300013102 | Ga0157371_10032016 | Ga0157371_100320163 | 405 |
| 670 | 3300013104 | Ga0157370_10063953 | Ga0157370_100639533 | 405 |
| 671 | 3300020070 | Ga0206356_11263179 | Ga0206356_112631792 | 405 |
| 672 | 3300025909 | Ga0207705_10006285 | Ga0207705_100062855 | 405 |
| 673 | 3300025912 | Ga0207707_10016373 | Ga0207707_100163733 | 405 |
| 674 | 3300025913 | Ga0207695_10024678 | Ga0207695_100246783 | 405 |
| 675 | 3300025917 | Ga0207660_10000918 | Ga0207660_1000091815 | 405 |
| 676 | 3300025919 | Ga0207657_10000142 | Ga0207657_100001422 | 405 |
| 677 | 3300025924 | Ga0207694_10014521 | Ga0207694_100145216 | 405 |
| 678 | 3300025949 | Ga0207667_10000425 | Ga0207667_1000042515 | 405 |
| 679 | 3300025981 | Ga0207640_10150683 | Ga0207640_101506831 | 405 |
| 680 | 3300026023 | Ga0207677_10069240 | Ga0207677_100692402 | 405 |
| 681 | 3300026041 | Ga0207639_10012802 | Ga0207639_100128026 | 405 |
| 682 | 3300026041 | Ga0207639_10277326 | Ga0207639_102773262 | 405 |
| 683 | 3300026067 | Ga0207678_10005045 | Ga0207678_1000504511 | 405 |
| 684 | 3300026078 | Ga0207702_10042356 | Ga0207702_100423565 | 405 |
| 685 | 3300026116 | Ga0207674_10000593 | Ga0207674_1000059316 | 405 |
| 686 | 3300026116 | Ga0207674_10040984 | Ga0207674_100409843 | 405 |
| 687 | 3300026142 | Ga0207698_10001265 | Ga0207698_1000126514 | 405 |
| 688 | 3300028380 | Ga0268265_10034111 | Ga0268265_100341112 | 405 |
| 689 | 3300038443 | Ga0395901_0206554 | Ga0395901_0206554_240_1469 | 405 |
| 690 | 3300038443 | Ga0395901_0232857 | Ga0395901_0232857_116_1339 | 405 |
| 691 | 3300046455 | Ga0495603_0080530 | Ga0495603_0080530_238_1467 | 405 |
| 692 | 3300046491 | Ga0495584_0036250 | Ga0495584_0036250_1046_2275 | 405 |
| 693 | 3300046492 | Ga0495585_0019103 | Ga0495585_0019103_1601_2830 | 405 |
| 694 | 3300046499 | Ga0495594_0062827 | Ga0495594_0062827_802_2031 | 405 |
| 695 | 3300046499 | Ga0495594_0065233 | Ga0495594_0065233_53_1282 | 405 |
| 696 | 3300046500 | Ga0495596_0001001 | Ga0495596_0001001_545_1774 | 405 |
| 697 | 3300046506 | Ga0495583_0009231 | Ga0495583_0009231_1849_3078 | 405 |
| 698 | 3300046535 | Ga0495586_0060934 | Ga0495586_0060934_659_1888 | 405 |
| 699 | 3300046557 | Ga0495622_0055307 | Ga0495622_0055307_244_1473 | 405 |
| 700 | 3300046558 | Ga0495633_0014419 | Ga0495633_0014419_2180_3409 | 405 |
| 701 | 3300046665 | Ga0495661_0036234 | Ga0495661_0036234_362_1591 | 405 |
| 702 | 3300046665 | Ga0495661_0059876 | Ga0495661_0059876_853_2082 | 405 |
| 703 | 3300046674 | Ga0495588_0011773 | Ga0495588_0011773_487_1716 | 405 |
| 704 | 3300046684 | Ga0495669_0000013 | Ga0495669_0000013_43063_44292 | 405 |
| 705 | 3300046689 | Ga0495613_0025151 | Ga0495613_0025151_1423_2652 | 405 |
| 706 | 3300046691 | Ga0495670_0022806 | Ga0495670_0022806_1364_2593 | 405 |
| 707 | 3300046694 | Ga0495649_0050677 | Ga0495649_0050677_234_1463 | 405 |
| 708 | 3300046794 | Ga0495589_0080908 | Ga0495589_0080908_162_1391 | 405 |
| 709 | 3300047321 | Ga0495676_0001263 | Ga0495676_0001263_8281_9510 | 405 |
| 710 | 3300047322 | Ga0495680_0089067 | Ga0495680_0089067_949_2205 | 405 |
| 711 | 3300048088 | Ga0495602_0128278 | Ga0495602_0128278_22_1251 | 405 |
| 712 | 3300048089 | Ga0495614_0010091 | Ga0495614_0010091_2666_3895 | 405 |
| 713 | 3300048913 | Ga0496110_0001834 | Ga0496110_0001834_10148_11377 | 405 |
| 714 | 3300048914 | Ga0496111_0069539 | Ga0496111_0069539_231_1460 | 405 |
| 715 | 3300048924 | Ga0496121_0012358 | Ga0496121_0012358_1859_3100 | 405 |
| 716 | 3300048925 | Ga0496122_0079038 | Ga0496122_0079038_1035_2276 | 405 |
| 717 | 3300048927 | Ga0496124_0000007 | Ga0496124_0000007_879063_880304 | 405 |
| 718 | 3300049575 | Ga0501039_0160631 | Ga0501039_0160631_415_1644 | 405 |
| 719 | 3300049581 | Ga0501047_0004365 | Ga0501047_0004365_8458_9687 | 405 |
| 720 | 3300049822 | Ga0501035_0002928 | Ga0501035_0002928_3667_4896 | 405 |
| 721 | 3300049822 | Ga0501035_0012650 | Ga0501035_0012650_5064_6287 | 405 |
| 722 | 3300049823 | Ga0501044_0014152 | Ga0501044_0014152_4510_5739 | 405 |
| 723 | iso_pu_bacteria | 2643221621 | 2644119829 | 405 |
| 724 | iso_pu_bacteria | 2808606395 | 2809035609 | 405 |
| 725 | 3300005445 | Ga0070708_100041230 | Ga0070708_1000412302 | 406 |
| 726 | 3300005518 | Ga0070699_100029571 | Ga0070699_1000295712 | 406 |
| 727 | 3300005549 | Ga0070704_100038598 | Ga0070704_1000385983 | 406 |
| 728 | 3300006852 | Ga0075433_10009565 | Ga0075433_100095652 | 406 |
| 729 | 3300006871 | Ga0075434_100030336 | Ga0075434_1000303363 | 406 |
| 730 | 3300007076 | Ga0075435_100037977 | Ga0075435_1000379773 | 406 |
| 731 | 3300025910 | Ga0207684_10012685 | Ga0207684_100126858 | 406 |
| 732 | 3300025922 | Ga0207646_10034393 | Ga0207646_100343932 | 406 |
| 733 | 3300046491 | Ga0495584_0043753 | Ga0495584_0043753_893_2128 | 406 |
| 734 | 3300046492 | Ga0495585_0021650 | Ga0495585_0021650_1631_2863 | 406 |
| 735 | 3300046518 | Ga0495631_0008226 | Ga0495631_0008226_3201_4442 | 406 |
| 736 | 3300046525 | Ga0495663_0002150 | Ga0495663_0002150_713_1939 | 406 |
| 737 | 3300046558 | Ga0495633_0039431 | Ga0495633_0039431_852_2093 | 406 |
| 738 | 3300046616 | Ga0495668_0032388 | Ga0495668_0032388_171_1412 | 406 |
| 739 | 3300046665 | Ga0495661_0031020 | Ga0495661_0031020_1995_3236 | 406 |
| 740 | 3300046691 | Ga0495670_0010238 | Ga0495670_0010238_575_1804 | 406 |
| 741 | 3300047470 | Ga0495681_0037870 | Ga0495681_0037870_1012_2238 | 406 |
| 742 | 3300048090 | Ga0495615_0000692 | Ga0495615_0000692_1394_2620 | 406 |
| 743 | 3300049742 | Ga0501080_0152085 | Ga0501080_0152085_70_1335 | 406 |
| 744 | 3300050512 | nmdc:mga0n895_354398_c1 | nmdc:mga0n895_354398_c1_18_1253 | 406 |
| 745 | iso_pu_bacteria | 2834641062 | 2834645988 | 406 |
| 746 | 3300005336 | Ga0070680_100070126 | Ga0070680_1000701264 | 407 |
| 747 | 3300005339 | Ga0070660_100066874 | Ga0070660_1000668742 | 407 |
| 748 | 3300005344 | Ga0070661_100000659 | Ga0070661_1000006591 | 407 |
| 749 | 3300005435 | Ga0070714_100001230 | Ga0070714_1000012309 | 407 |
| 750 | 3300005535 | Ga0070684_100029664 | Ga0070684_1000296646 | 407 |
| 751 | 3300005563 | Ga0068855_100007555 | Ga0068855_1000075552 | 407 |
| 752 | 3300005564 | Ga0070664_100000157 | Ga0070664_10000015710 | 407 |
| 753 | 3300005577 | Ga0068857_100002118 | Ga0068857_1000021188 | 407 |
| 754 | 3300005578 | Ga0068854_100022259 | Ga0068854_1000222592 | 407 |
| 755 | 3300005614 | Ga0068856_100003357 | Ga0068856_10000335712 | 407 |
| 756 | 3300005614 | Ga0068856_100008502 | Ga0068856_1000085029 | 407 |
| 757 | 3300005616 | Ga0068852_100000826 | Ga0068852_1000008268 | 407 |
| 758 | 3300005834 | Ga0068851_10015994 | Ga0068851_100159945 | 407 |
| 759 | 3300009093 | Ga0105240_10007858 | Ga0105240_1000785811 | 407 |
| 760 | 3300013102 | Ga0157371_10016262 | Ga0157371_100162622 | 407 |
| 761 | 3300013104 | Ga0157370_10011680 | Ga0157370_1001168011 | 407 |
| 762 | 3300013104 | Ga0157370_10016253 | Ga0157370_100162533 | 407 |
| 763 | 3300013105 | Ga0157369_10018830 | Ga0157369_100188302 | 407 |
| 764 | 3300013307 | Ga0157372_10001409 | Ga0157372_1000140921 | 407 |
| 765 | 3300025912 | Ga0207707_10219782 | Ga0207707_102197822 | 407 |
| 766 | 3300025913 | Ga0207695_10016171 | Ga0207695_100161713 | 407 |
| 767 | 3300025924 | Ga0207694_10006781 | Ga0207694_100067818 | 407 |
| 768 | 3300025929 | Ga0207664_10041785 | Ga0207664_100417854 | 407 |
| 769 | 3300026078 | Ga0207702_10002758 | Ga0207702_1000275812 | 407 |
| 770 | 3300026116 | Ga0207674_10000301 | Ga0207674_1000030112 | 407 |
| 771 | 3300026142 | Ga0207698_10067288 | Ga0207698_100672882 | 407 |
| 772 | 3300032004 | Ga0307414_10085201 | Ga0307414_100852012 | 407 |
| 773 | 3300037312 | Ga0395899_0000216 | Ga0395899_0000216_16299_17531 | 407 |
| 774 | 3300037471 | Ga0395905_0020803 | Ga0395905_0020803_767_1999 | 407 |
| 775 | 3300038443 | Ga0395901_0000420 | Ga0395901_0000420_14578_15810 | 407 |
| 776 | 3300045836 | Ga0466958_0029523 | Ga0466958_0029523_1889_3133 | 407 |
| 777 | 3300046473 | Ga0495582_0078502 | Ga0495582_0078502_40_1272 | 407 |
| 778 | 3300046491 | Ga0495584_0102846 | Ga0495584_0102846_194_1426 | 407 |
| 779 | 3300046492 | Ga0495585_0055089 | Ga0495585_0055089_453_1685 | 407 |
| 780 | 3300046499 | Ga0495594_0009981 | Ga0495594_0009981_3386_4618 | 407 |
| 781 | 3300046522 | Ga0495643_0008333 | Ga0495643_0008333_4315_5553 | 407 |
| 782 | 3300046674 | Ga0495588_0042123 | Ga0495588_0042123_1075_2307 | 407 |
| 783 | 3300047318 | Ga0495636_0012632 | Ga0495636_0012632_1274_2506 | 407 |
| 784 | 3300047321 | Ga0495676_0059705 | Ga0495676_0059705_329_1561 | 407 |
| 785 | 3300047470 | Ga0495681_0037363 | Ga0495681_0037363_1143_2375 | 407 |
| 786 | 3300005329 | Ga0070683_100030072 | Ga0070683_1000300725 | 410 |
| 787 | 3300005334 | Ga0068869_100026457 | Ga0068869_1000264574 | 410 |
| 788 | 3300005343 | Ga0070687_100041726 | Ga0070687_1000417262 | 410 |
| 789 | 3300005544 | Ga0070686_100016610 | Ga0070686_1000166104 | 410 |
| 790 | 3300005548 | Ga0070665_100033723 | Ga0070665_1000337235 | 410 |
| 791 | 3300005615 | Ga0070702_100010845 | Ga0070702_1000108452 | 410 |
| 792 | 3300005618 | Ga0068864_100021685 | Ga0068864_1000216852 | 410 |
| 793 | 3300005718 | Ga0068866_10007294 | Ga0068866_100072944 | 410 |
| 794 | 3300005719 | Ga0068861_100034057 | Ga0068861_1000340572 | 410 |
| 795 | 3300005840 | Ga0068870_10024040 | Ga0068870_100240402 | 410 |
| 796 | 3300005841 | Ga0068863_100028084 | Ga0068863_1000280843 | 410 |
| 797 | 3300005841 | Ga0068863_100038387 | Ga0068863_1000383873 | 410 |
| 798 | 3300005842 | Ga0068858_100031020 | Ga0068858_1000310202 | 410 |
| 799 | 3300005843 | Ga0068860_100103439 | Ga0068860_1001034391 | 410 |
| 800 | 3300006358 | Ga0068871_100115006 | Ga0068871_1001150062 | 410 |
| 801 | 3300009094 | Ga0111539_10321122 | Ga0111539_103211222 | 410 |
| 802 | 3300009176 | Ga0105242_10051227 | Ga0105242_100512271 | 410 |
| 803 | 3300013297 | Ga0157378_10211414 | Ga0157378_102114142 | 410 |
| 804 | 3300014326 | Ga0157380_10027018 | Ga0157380_100270183 | 410 |
| 805 | 3300014745 | Ga0157377_10001099 | Ga0157377_100010996 | 410 |
| 806 | 3300025290 | Ga0207673_1005156 | Ga0207673_10051562 | 410 |
| 807 | 3300025315 | Ga0207697_10006731 | Ga0207697_100067311 | 410 |
| 808 | 3300025893 | Ga0207682_10002959 | Ga0207682_100029591 | 410 |
| 809 | 3300025901 | Ga0207688_10002136 | Ga0207688_1000213611 | 410 |
| 810 | 3300025908 | Ga0207643_10001221 | Ga0207643_100012216 | 410 |
| 811 | 3300025918 | Ga0207662_10000955 | Ga0207662_1000095511 | 410 |
| 812 | 3300025919 | Ga0207657_10018754 | Ga0207657_100187541 | 410 |
| 813 | 3300025925 | Ga0207650_10253540 | Ga0207650_102535401 | 410 |
| 814 | 3300025933 | Ga0207706_10033937 | Ga0207706_100339374 | 410 |
| 815 | 3300025936 | Ga0207670_10017943 | Ga0207670_100179434 | 410 |
| 816 | 3300025937 | Ga0207669_10048691 | Ga0207669_100486912 | 410 |
| 817 | 3300025940 | Ga0207691_10006761 | Ga0207691_100067616 | 410 |
| 818 | 3300025942 | Ga0207689_10084459 | Ga0207689_100844591 | 410 |
| 819 | 3300025972 | Ga0207668_10044426 | Ga0207668_100444262 | 410 |
| 820 | 3300026067 | Ga0207678_10001814 | Ga0207678_1000181412 | 410 |
| 821 | 3300026075 | Ga0207708_10001722 | Ga0207708_1000172210 | 410 |
| 822 | 3300026088 | Ga0207641_10011922 | Ga0207641_100119226 | 410 |
| 823 | 3300026089 | Ga0207648_10000390 | Ga0207648_1000039034 | 410 |
| 824 | 3300026095 | Ga0207676_10011268 | Ga0207676_100112686 | 410 |
| 825 | 3300026116 | Ga0207674_10001187 | Ga0207674_1000118720 | 410 |
| 826 | 3300026118 | Ga0207675_100001324 | Ga0207675_1000013249 | 410 |
| 827 | 3300026121 | Ga0207683_10005075 | Ga0207683_100050753 | 410 |
| 828 | 3300046492 | Ga0495585_0000070 | Ga0495585_0000070_60072_61328 | 410 |
| 829 | 3300046492 | Ga0495585_0084830 | Ga0495585_0084830_214_1464 | 410 |
| 830 | 3300046500 | Ga0495596_0026656 | Ga0495596_0026656_660_1910 | 410 |
| 831 | 3300046501 | Ga0495607_0045259 | Ga0495607_0045259_195_1445 | 410 |
| 832 | 3300046506 | Ga0495583_0036365 | Ga0495583_0036365_370_1620 | 410 |
| 833 | 3300046519 | Ga0495632_0079468 | Ga0495632_0079468_246_1496 | 410 |
| 834 | 3300046528 | Ga0495642_0004009 | Ga0495642_0004009_2448_3698 | 410 |
| 835 | 3300046648 | Ga0495611_0002422 | Ga0495611_0002422_6573_7823 | 410 |
| 836 | 3300046665 | Ga0495661_0039486 | Ga0495661_0039486_649_1899 | 410 |
| 837 | 3300046691 | Ga0495670_0006944 | Ga0495670_0006944_3468_4718 | 410 |
| 838 | 3300047323 | Ga0495683_0058034 | Ga0495683_0058034_463_1713 | 410 |
| 839 | 3300047445 | Ga0495677_0005202 | Ga0495677_0005202_3489_4739 | 410 |
| 840 | 3300048907 | Ga0496104_0222813 | Ga0496104_0222813_189_1448 | 410 |
| 841 | 3300048908 | Ga0496105_0012504 | Ga0496105_0012504_1674_2945 | 410 |
| 842 | 3300048912 | Ga0496109_0069956 | Ga0496109_0069956_1154_2413 | 410 |
| 843 | 3300048913 | Ga0496110_0003288 | Ga0496110_0003288_6403_7674 | 410 |
| 844 | 3300049460 | Ga0495682_0010895 | Ga0495682_0010895_20_1270 | 410 |
| 845 | iso_pu_bacteria | 8003400568 | 8003403328 | 410 |
| 846 | 3300003187 | JGI25151J46595_10009669 | JGI25151J46595_100096694 | 415 |
| 847 | 3300003781 | Ga0055536_1000078 | Ga0055536_100007821 | 415 |
| 848 | 3300003784 | Ga0055534_1003267 | Ga0055534_10032673 | 415 |
| 849 | 3300025291 | Ga0209675_1000087 | Ga0209675_100008722 | 415 |
| 850 | 3300025292 | Ga0209676_1000176 | Ga0209676_100017662 | 415 |
| 851 | 3300025294 | Ga0209025_1000046 | Ga0209025_1000046109 | 415 |
| 852 | 3300025295 | Ga0209564_1000166 | Ga0209564_1000166143 | 415 |
| 853 | 3300025295 | Ga0209564_1001192 | Ga0209564_100119222 | 415 |
| 854 | 3300046526 | Ga0495666_0075288 | Ga0495666_0075288_214_1506 | 415 |
| 855 | 3300046531 | Ga0495665_0036044 | Ga0495665_0036044_1325_2617 | 415 |
| 856 | 3300047317 | Ga0495604_0159079 | Ga0495604_0159079_260_1552 | 415 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hl6-assembly2.cif.gz_C | yfde from escherichia coli | 0.9526 | 10 | 388 |
| 4hl6-assembly2.cif.gz_C | yfde from escherichia coli | 0.9477 | 10 | 388 |
| 1pt8-assembly1.cif.gz_B | crystal structure of the yfdw gene product of e. coli, in complex with oxalate and acetyl-coa | 0.9418 | 10 | 401 |
| 5yit-assembly2.cif.gz_D | crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis | 0.9406 | 10 | 381 |
| 1vgr-assembly1.cif.gz_B | formyl-coa transferase mutant asp169 to glu | 0.9393 | 10 | 401 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4V9F2_1_227_3.40.50.10540 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 | 0.9705 | 31 | 243 | 3.40.50.10540 |
| af_Q9VDL4_46_327_3.40.50.10540 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 | 0.9681 | 10 | 290 | 3.40.50.10540 |
| af_Q68FU4_261_348_3.30.1540.10 | Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 | 0.9636 | 234 | 321 | 3.30.1540.10 |
| af_Q9VDL4_46_327_3.40.50.10540 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 | 0.9614 | 10 | 290 | 3.40.50.10540 |
| 4hl6E02 | Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 | 0.9604 | 233 | 324 | 3.30.1540.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A497KNB9-F1-model_v4 | CoA transferase | 0.9863 | 10 | 403 |
GO:0008410
|
| AF-A0A1F9DFM9-F1-model_v4 | Formyl-CoA transferase | 0.9859 | 10 | 401 |
GO:0008410
|
| AF-A0A0R3CBW1-F1-model_v4 | CoA-transferase | 0.9848 | 13 | 405 |
GO:0008410
|
| AF-A0A7W7Q1P1-F1-model_v4 | Formyl-CoA transferase (EC 2.8.3.16) | 0.9838 | 10 | 403 |
GO:0033608
|
| AF-A0A5N9BBE6-F1-model_v4 | CoA transferase | 0.9836 | 9 | 405 |
GO:0008410
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar