F483651
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 856 | 418 | 845 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300005544|Ga0070686_100107244|Ga0070686_1001072443 |
| Length | 149 |
| Sequence | MRGRLIESLSRANEAVFNRENHMARIAGVDIPRNKKIEVSITYIFGIGAANGMVILKKANVNPSTRVRDLTEEEVGRIREVVDREYRVEGDLRREVQLNIKRLMDIACYRGLRHRKGMPVRGQRTRTNARTRRGRKGQAIGIKKKTAKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 2 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 3 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 4 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 5 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 6 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 7 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 11 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 16 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 19 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 112 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 132 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 139 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 140 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 197 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 203 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 207 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 208 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 211 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 212 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 213 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 218 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 220 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 221 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 224 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 231 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 234 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 235 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 236 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 237 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 240 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 241 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 242 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 243 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 245 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 246 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 253 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 254 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 255 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 256 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 257 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 258 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 259 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 260 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 261 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 262 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 263 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 264 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 265 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 266 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 267 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 268 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 300 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 301 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 302 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 303 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 304 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 305 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 308 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 309 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 310 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 311 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 312 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 313 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 314 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 315 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 316 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 348 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 349 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 363 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 364 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 365 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 366 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 367 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 368 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 369 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 370 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 371 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 372 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 373 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 374 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 414 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 415 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 416 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 417 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 418 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.04 |
| Metatranscriptomes | 20.68 |
| Isolates | 1.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.92 |
| Nodule | 0.23 |
| Rhizoplane | 3.86 |
| Rhizosphere | 88.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10005150 | 3300003203 | Bacteria | 6068 |
| 2 | rootH1_10031668 | 3300003323 | Bacteria | 5520 |
| 3 | JGI25407J50210_10009225 | 3300003373 | Bacteria | 2495 |
| 4 | Ga0007417J51691_1058728 | 3300003544 | Bacteria | 819 |
| 5 | Ga0007410J51695_1062137 | 3300003574 | Bacteria | 619 |
| 6 | Ga0007409J51694_1055064 | 3300003575 | Bacteria | 1902 |
| 7 | Ga0007409J51694_1071519 | 3300003575 | Bacteria | 539 |
| 8 | Ga0007429J51699_1100314 | 3300003579 | Bacteria | 971 |
| 9 | Ga0058859_10015336 | 3300004798 | Bacteria | 770 |
| 10 | Ga0058859_11551370 | 3300004798 | Bacteria | 789 |
| 11 | Ga0058859_11778114 | 3300004798 | Bacteria | 3341 |
| 12 | Ga0058863_11594786 | 3300004799 | Bacteria | 835 |
| 13 | Ga0058863_11945250 | 3300004799 | Bacteria | 2022 |
| 14 | Ga0058861_10017791 | 3300004800 | Bacteria | 2438 |
| 15 | Ga0058861_10648189 | 3300004800 | Bacteria | 838 |
| 16 | Ga0058861_11220782 | 3300004800 | Unclassified | 1385 |
| 17 | Ga0058860_10013830 | 3300004801 | Bacteria | 594 |
| 18 | Ga0058860_10205765 | 3300004801 | Bacteria | 515 |
| 19 | Ga0058860_12064927 | 3300004801 | Bacteria | 683 |
| 20 | Ga0058860_12081306 | 3300004801 | Bacteria | 702 |
| 21 | Ga0058862_10088370 | 3300004803 | Bacteria | 1230 |
| 22 | Ga0058862_11852680 | 3300004803 | Bacteria | 2461 |
| 23 | Ga0058862_12088318 | 3300004803 | Bacteria | 1428 |
| 24 | Ga0058862_12231526 | 3300004803 | Bacteria | 594 |
| 25 | Ga0058862_12481273 | 3300004803 | Bacteria | 5090 |
| 26 | Ga0058862_12560532 | 3300004803 | Bacteria | 1232 |
| 27 | Ga0058862_12561774 | 3300004803 | Bacteria | 652 |
| 28 | Ga0058862_12761214 | 3300004803 | Bacteria | 991 |
| 29 | Ga0058862_12854382 | 3300004803 | Bacteria | 1077 |
| 30 | Ga0065704_10324636 | 3300005289 | Bacteria | 847 |
| 31 | Ga0070658_10004878 | 3300005327 | Bacteria | 10928 |
| 32 | Ga0070658_10204966 | 3300005327 | Bacteria | 1665 |
| 33 | Ga0070658_10949111 | 3300005327 | Bacteria | 748 |
| 34 | Ga0070683_100062110 | 3300005329 | Bacteria | 3473 |
| 35 | Ga0070683_100338735 | 3300005329 | Bacteria | 1432 |
| 36 | Ga0070690_100462428 | 3300005330 | Bacteria | 943 |
| 37 | Ga0070690_101257374 | 3300005330 | Bacteria | 592 |
| 38 | Ga0070670_101106232 | 3300005331 | Bacteria | 723 |
| 39 | Ga0070670_101985024 | 3300005331 | Bacteria | 536 |
| 40 | Ga0070677_10046592 | 3300005333 | Bacteria | 1734 |
| 41 | Ga0068869_100007769 | 3300005334 | Bacteria | 6879 |
| 42 | Ga0068869_100394002 | 3300005334 | Bacteria | 1137 |
| 43 | Ga0070666_10033476 | 3300005335 | Bacteria | 3400 |
| 44 | Ga0070666_10313703 | 3300005335 | Bacteria | 1118 |
| 45 | Ga0070666_10717353 | 3300005335 | Bacteria | 734 |
| 46 | Ga0070682_100065359 | 3300005337 | Bacteria | 2311 |
| 47 | Ga0070682_100107622 | 3300005337 | Bacteria | 1852 |
| 48 | Ga0070682_100173119 | 3300005337 | Bacteria | 1502 |
| 49 | Ga0070682_100206362 | 3300005337 | Bacteria | 1390 |
| 50 | Ga0068868_100001063 | 3300005338 | Bacteria | 18804 |
| 51 | Ga0068868_100002784 | 3300005338 | Bacteria | 12116 |
| 52 | Ga0068868_100016636 | 3300005338 | Bacteria | 5469 |
| 53 | Ga0070660_100066916 | 3300005339 | Bacteria | 2798 |
| 54 | Ga0070689_100317127 | 3300005340 | Bacteria | 1301 |
| 55 | Ga0070689_100613530 | 3300005340 | Bacteria | 943 |
| 56 | Ga0070689_100713250 | 3300005340 | Bacteria | 877 |
| 57 | Ga0070691_10009724 | 3300005341 | Bacteria | 4387 |
| 58 | Ga0070691_10190321 | 3300005341 | Bacteria | 1073 |
| 59 | Ga0070691_10267874 | 3300005341 | Bacteria | 922 |
| 60 | Ga0070687_100062007 | 3300005343 | Bacteria | 1978 |
| 61 | Ga0070692_10375941 | 3300005345 | Bacteria | 890 |
| 62 | Ga0070668_100045774 | 3300005347 | Bacteria | 3357 |
| 63 | Ga0070668_100333913 | 3300005347 | Bacteria | 1279 |
| 64 | Ga0070669_100083826 | 3300005353 | Bacteria | 2378 |
| 65 | Ga0070669_101057863 | 3300005353 | Bacteria | 698 |
| 66 | Ga0070675_100173942 | 3300005354 | Bacteria | 1858 |
| 67 | Ga0070675_101556168 | 3300005354 | Bacteria | 610 |
| 68 | Ga0070671_100295611 | 3300005355 | Bacteria | 1378 |
| 69 | Ga0070671_100600657 | 3300005355 | Bacteria | 951 |
| 70 | Ga0070674_100564701 | 3300005356 | Bacteria | 957 |
| 71 | Ga0070674_100628653 | 3300005356 | Bacteria | 910 |
| 72 | Ga0070673_100028802 | 3300005364 | Bacteria | 4135 |
| 73 | Ga0070673_101679540 | 3300005364 | Bacteria | 601 |
| 74 | Ga0070688_101317990 | 3300005365 | Bacteria | 583 |
| 75 | Ga0070667_100014403 | 3300005367 | Bacteria | 6534 |
| 76 | Ga0070667_100447653 | 3300005367 | Bacteria | 1180 |
| 77 | Ga0070667_101111627 | 3300005367 | Bacteria | 739 |
| 78 | Ga0070703_10237895 | 3300005406 | Bacteria | 733 |
| 79 | Ga0070709_10000287 | 3300005434 | Bacteria | 32074 |
| 80 | Ga0070714_100001531 | 3300005435 | Bacteria | 16859 |
| 81 | Ga0070714_100074068 | 3300005435 | Bacteria | 2951 |
| 82 | Ga0070714_100357483 | 3300005435 | Bacteria | 1373 |
| 83 | Ga0070713_100000752 | 3300005436 | Bacteria | 20729 |
| 84 | Ga0070713_100003809 | 3300005436 | Bacteria | 9978 |
| 85 | Ga0070713_102070154 | 3300005436 | Bacteria | 552 |
| 86 | Ga0070705_100030655 | 3300005440 | Bacteria | 2971 |
| 87 | Ga0070705_100140505 | 3300005440 | Bacteria | 1588 |
| 88 | Ga0070694_100732716 | 3300005444 | Bacteria | 806 |
| 89 | Ga0070694_100789697 | 3300005444 | Bacteria | 778 |
| 90 | Ga0070708_100483923 | 3300005445 | Bacteria | 1167 |
| 91 | Ga0070663_100190503 | 3300005455 | Bacteria | 1596 |
| 92 | Ga0070678_100035055 | 3300005456 | Bacteria | 3500 |
| 93 | Ga0070678_100102809 | 3300005456 | Bacteria | 2218 |
| 94 | Ga0070678_102080239 | 3300005456 | Bacteria | 538 |
| 95 | Ga0070678_102361106 | 3300005456 | Bacteria | 505 |
| 96 | Ga0070662_100069527 | 3300005457 | Bacteria | 2592 |
| 97 | Ga0070662_101401841 | 3300005457 | Bacteria | 602 |
| 98 | Ga0070681_10102025 | 3300005458 | Bacteria | 2814 |
| 99 | Ga0068867_100031077 | 3300005459 | Bacteria | 3854 |
| 100 | Ga0068867_100045142 | 3300005459 | Bacteria | 3230 |
| 101 | Ga0068867_100307117 | 3300005459 | Bacteria | 1310 |
| 102 | Ga0068867_100370145 | 3300005459 | Bacteria | 1201 |
| 103 | Ga0070685_10023219 | 3300005466 | Bacteria | 3394 |
| 104 | Ga0070706_100204437 | 3300005467 | Bacteria | 1845 |
| 105 | Ga0070707_100440745 | 3300005468 | Bacteria | 1263 |
| 106 | Ga0070707_100564069 | 3300005468 | Bacteria | 1101 |
| 107 | Ga0070707_100979356 | 3300005468 | Bacteria | 811 |
| 108 | Ga0070699_100180303 | 3300005518 | Bacteria | 1874 |
| 109 | Ga0070699_100266384 | 3300005518 | Bacteria | 1533 |
| 110 | Ga0070679_100208662 | 3300005530 | Bacteria | 1918 |
| 111 | Ga0070679_100246928 | 3300005530 | Bacteria | 1741 |
| 112 | Ga0070684_100012677 | 3300005535 | Bacteria | 6763 |
| 113 | Ga0070684_100379590 | 3300005535 | Bacteria | 1302 |
| 114 | Ga0070684_100387191 | 3300005535 | Bacteria | 1288 |
| 115 | Ga0070684_100545540 | 3300005535 | Bacteria | 1076 |
| 116 | Ga0070697_100082909 | 3300005536 | Bacteria | 2644 |
| 117 | Ga0070697_100249451 | 3300005536 | Bacteria | 1518 |
| 118 | Ga0070697_101174481 | 3300005536 | Bacteria | 684 |
| 119 | Ga0068853_100054623 | 3300005539 | Bacteria | 3442 |
| 120 | Ga0068853_100921056 | 3300005539 | Bacteria | 840 |
| 121 | Ga0068853_100982656 | 3300005539 | Bacteria | 812 |
| 122 | Ga0070672_100164427 | 3300005543 | Bacteria | 1843 |
| 123 | Ga0070672_100390898 | 3300005543 | Bacteria | 1191 |
| 124 | Ga0070672_101192960 | 3300005543 | Bacteria | 678 |
| 125 | Ga0070686_100069104 | 3300005544 | Bacteria | 2306 |
| 126 | Ga0070686_100107244 | 3300005544 | Bacteria | 1897 |
| 127 | Ga0070696_100147544 | 3300005546 | Bacteria | 1724 |
| 128 | Ga0070696_100257079 | 3300005546 | Bacteria | 1323 |
| 129 | Ga0070696_100283047 | 3300005546 | Bacteria | 1264 |
| 130 | Ga0070693_100113168 | 3300005547 | Bacteria | 1673 |
| 131 | Ga0070693_100146860 | 3300005547 | Bacteria | 1490 |
| 132 | Ga0070665_100202700 | 3300005548 | Bacteria | 1984 |
| 133 | Ga0070665_100761615 | 3300005548 | Bacteria | 981 |
| 134 | Ga0070704_100046496 | 3300005549 | Bacteria | 3027 |
| 135 | Ga0070704_101384334 | 3300005549 | Bacteria | 645 |
| 136 | Ga0068855_100374116 | 3300005563 | Bacteria | 1565 |
| 137 | Ga0068855_100383109 | 3300005563 | Bacteria | 1544 |
| 138 | Ga0068857_100008064 | 3300005577 | Bacteria | 9085 |
| 139 | Ga0068857_100342271 | 3300005577 | Bacteria | 1384 |
| 140 | Ga0068857_100862349 | 3300005577 | Bacteria | 867 |
| 141 | Ga0068857_101088557 | 3300005577 | Bacteria | 771 |
| 142 | Ga0068854_100511854 | 3300005578 | Bacteria | 1012 |
| 143 | Ga0068854_100660387 | 3300005578 | Bacteria | 899 |
| 144 | Ga0068856_100038121 | 3300005614 | Bacteria | 4717 |
| 145 | Ga0070702_100010797 | 3300005615 | Bacteria | 4515 |
| 146 | Ga0070702_101304655 | 3300005615 | Bacteria | 590 |
| 147 | Ga0070702_101467705 | 3300005615 | Bacteria | 560 |
| 148 | Ga0068852_102423230 | 3300005616 | Bacteria | 545 |
| 149 | Ga0068859_100058552 | 3300005617 | Bacteria | 3881 |
| 150 | Ga0068859_100068084 | 3300005617 | Bacteria | 3595 |
| 151 | Ga0068859_100674726 | 3300005617 | Bacteria | 1125 |
| 152 | Ga0068859_102124019 | 3300005617 | Bacteria | 620 |
| 153 | Ga0068859_102810840 | 3300005617 | Bacteria | 534 |
| 154 | Ga0068866_10037041 | 3300005718 | Bacteria | 2394 |
| 155 | Ga0068866_10162411 | 3300005718 | Bacteria | 1304 |
| 156 | Ga0068866_10668450 | 3300005718 | Bacteria | 709 |
| 157 | Ga0068861_100416822 | 3300005719 | Bacteria | 1196 |
| 158 | Ga0068861_101521615 | 3300005719 | Bacteria | 657 |
| 159 | Ga0068861_101768534 | 3300005719 | Bacteria | 612 |
| 160 | Ga0068851_10153838 | 3300005834 | Bacteria | 1259 |
| 161 | Ga0068870_10002377 | 3300005840 | Bacteria | 7827 |
| 162 | Ga0068863_100334496 | 3300005841 | Bacteria | 1472 |
| 163 | Ga0068863_100351346 | 3300005841 | Bacteria | 1436 |
| 164 | Ga0068863_100389505 | 3300005841 | Bacteria | 1362 |
| 165 | Ga0068863_100492275 | 3300005841 | Bacteria | 1207 |
| 166 | Ga0068863_101499214 | 3300005841 | Bacteria | 683 |
| 167 | Ga0068860_100043631 | 3300005843 | Bacteria | 4277 |
| 168 | Ga0068860_100089660 | 3300005843 | Bacteria | 2928 |
| 169 | Ga0068862_101048855 | 3300005844 | Bacteria | 808 |
| 170 | Ga0081538_10005557 | 3300005981 | Bacteria | 11312 |
| 171 | Ga0081538_10025517 | 3300005981 | Bacteria | 4163 |
| 172 | Ga0081539_10000072 | 3300005985 | Bacteria | 232726 |
| 173 | Ga0081539_10004359 | 3300005985 | Bacteria | 15776 |
| 174 | Ga0070717_10672712 | 3300006028 | Bacteria | 940 |
| 175 | Ga0070715_10015070 | 3300006163 | Bacteria | 2876 |
| 176 | Ga0070712_100123654 | 3300006175 | Bacteria | 1951 |
| 177 | Ga0075366_10113191 | 3300006195 | Bacteria | 1633 |
| 178 | Ga0075366_10181106 | 3300006195 | Bacteria | 1280 |
| 179 | Ga0097621_100011986 | 3300006237 | Bacteria | 6415 |
| 180 | Ga0097621_100028937 | 3300006237 | Bacteria | 4372 |
| 181 | Ga0097621_100119649 | 3300006237 | Bacteria | 2232 |
| 182 | Ga0097621_101027592 | 3300006237 | Bacteria | 772 |
| 183 | Ga0097621_101121116 | 3300006237 | Bacteria | 739 |
| 184 | Ga0068871_100012756 | 3300006358 | Bacteria | 6215 |
| 185 | Ga0075428_100644896 | 3300006844 | Bacteria | 1130 |
| 186 | Ga0075430_100300743 | 3300006846 | Bacteria | 1327 |
| 187 | Ga0075430_100376334 | 3300006846 | Bacteria | 1172 |
| 188 | Ga0075431_100002441 | 3300006847 | Bacteria | 17888 |
| 189 | Ga0075433_10015274 | 3300006852 | Bacteria | 6294 |
| 190 | Ga0075433_10016739 | 3300006852 | Bacteria | 6053 |
| 191 | Ga0075433_10146799 | 3300006852 | Bacteria | 2097 |
| 192 | Ga0075434_100039407 | 3300006871 | Bacteria | 4682 |
| 193 | Ga0075434_100562457 | 3300006871 | Bacteria | 1160 |
| 194 | Ga0075434_102012433 | 3300006871 | Bacteria | 583 |
| 195 | Ga0075429_100817737 | 3300006880 | Bacteria | 816 |
| 196 | Ga0068865_100067348 | 3300006881 | Bacteria | 2529 |
| 197 | Ga0068865_100103143 | 3300006881 | Bacteria | 2091 |
| 198 | Ga0068865_101432084 | 3300006881 | Bacteria | 617 |
| 199 | Ga0097620_100058548 | 3300006931 | Bacteria | 3881 |
| 200 | Ga0097620_100068093 | 3300006931 | Bacteria | 3595 |
| 201 | Ga0097620_100674757 | 3300006931 | Bacteria | 1125 |
| 202 | Ga0097620_100980998 | 3300006931 | Bacteria | 927 |
| 203 | Ga0097620_102123909 | 3300006931 | Bacteria | 620 |
| 204 | Ga0097620_102811674 | 3300006931 | Bacteria | 534 |
| 205 | Ga0075435_100152699 | 3300007076 | Bacteria | 1942 |
| 206 | Ga0105240_10775736 | 3300009093 | Bacteria | 1040 |
| 207 | Ga0111539_10041238 | 3300009094 | Bacteria | 5550 |
| 208 | Ga0111539_11571081 | 3300009094 | Bacteria | 763 |
| 209 | Ga0105245_10449169 | 3300009098 | Bacteria | 1297 |
| 210 | Ga0114129_10006513 | 3300009147 | Bacteria | 16568 |
| 211 | Ga0114129_10032401 | 3300009147 | Bacteria | 7386 |
| 212 | Ga0114129_10291592 | 3300009147 | Bacteria | 2177 |
| 213 | Ga0114129_10304184 | 3300009147 | Bacteria | 2124 |
| 214 | Ga0114129_10659542 | 3300009147 | Bacteria | 1349 |
| 215 | Ga0114129_11020356 | 3300009147 | Bacteria | 1041 |
| 216 | Ga0114129_11143786 | 3300009147 | Bacteria | 972 |
| 217 | Ga0114129_11739705 | 3300009147 | Bacteria | 760 |
| 218 | Ga0105243_10117314 | 3300009148 | Bacteria | 2237 |
| 219 | Ga0105243_10148900 | 3300009148 | Bacteria | 2006 |
| 220 | Ga0105243_10233304 | 3300009148 | Bacteria | 1634 |
| 221 | Ga0105243_10295437 | 3300009148 | Bacteria | 1466 |
| 222 | Ga0105243_10686561 | 3300009148 | Bacteria | 996 |
| 223 | Ga0105241_10156169 | 3300009174 | Bacteria | 1871 |
| 224 | Ga0105241_11925681 | 3300009174 | Bacteria | 580 |
| 225 | Ga0105242_10011746 | 3300009176 | Bacteria | 6736 |
| 226 | Ga0105242_10045883 | 3300009176 | Bacteria | 3543 |
| 227 | Ga0105242_10360933 | 3300009176 | Bacteria | 1345 |
| 228 | Ga0105242_12762276 | 3300009176 | Bacteria | 541 |
| 229 | Ga0105248_10058121 | 3300009177 | Bacteria | 4342 |
| 230 | Ga0105248_10437935 | 3300009177 | Bacteria | 1472 |
| 231 | Ga0105249_10500340 | 3300009553 | Bacteria | 1260 |
| 232 | Ga0105249_12324716 | 3300009553 | Unclassified | 609 |
| 233 | Ga0105249_12863410 | 3300009553 | Bacteria | 554 |
| 234 | Ga0105239_11333003 | 3300010375 | Bacteria | 828 |
| 235 | Ga0105246_10306561 | 3300011119 | Bacteria | 1284 |
| 236 | Ga0105246_10328381 | 3300011119 | Bacteria | 1246 |
| 237 | Ga0105246_10339176 | 3300011119 | Bacteria | 1228 |
| 238 | Ga0105246_11893922 | 3300011119 | Bacteria | 572 |
| 239 | Ga0157324_1038710 | 3300012506 | Bacteria | 574 |
| 240 | Ga0154010_136519 | 3300013062 | Bacteria | 609 |
| 241 | Ga0157373_10307442 | 3300013100 | Bacteria | 1126 |
| 242 | Ga0157371_10064200 | 3300013102 | Bacteria | 2602 |
| 243 | Ga0157371_10668166 | 3300013102 | Bacteria | 776 |
| 244 | Ga0157370_10289959 | 3300013104 | Bacteria | 1511 |
| 245 | Ga0157370_11230718 | 3300013104 | Bacteria | 675 |
| 246 | Ga0157369_10900785 | 3300013105 | Bacteria | 907 |
| 247 | Ga0157374_10130270 | 3300013296 | Bacteria | 2434 |
| 248 | Ga0157374_10171084 | 3300013296 | Bacteria | 2119 |
| 249 | Ga0157374_11283256 | 3300013296 | Bacteria | 754 |
| 250 | Ga0157378_10005839 | 3300013297 | Bacteria | 10791 |
| 251 | Ga0157378_10094032 | 3300013297 | Bacteria | 2729 |
| 252 | Ga0157378_10250264 | 3300013297 | Bacteria | 1696 |
| 253 | Ga0157378_10643767 | 3300013297 | Bacteria | 1075 |
| 254 | Ga0157378_11455173 | 3300013297 | Bacteria | 729 |
| 255 | Ga0157378_11674727 | 3300013297 | Bacteria | 683 |
| 256 | Ga0163162_10038469 | 3300013306 | Bacteria | 4774 |
| 257 | Ga0163162_10184062 | 3300013306 | Bacteria | 2215 |
| 258 | Ga0163162_10242652 | 3300013306 | Bacteria | 1933 |
| 259 | Ga0163162_10682823 | 3300013306 | Bacteria | 1149 |
| 260 | Ga0163162_12136836 | 3300013306 | Bacteria | 642 |
| 261 | Ga0157372_10160060 | 3300013307 | Bacteria | 2602 |
| 262 | Ga0157372_10226498 | 3300013307 | Bacteria | 2167 |
| 263 | Ga0157372_10233574 | 3300013307 | Bacteria | 2132 |
| 264 | Ga0157372_10689465 | 3300013307 | Bacteria | 1189 |
| 265 | Ga0157372_11449944 | 3300013307 | Bacteria | 791 |
| 266 | Ga0157375_10131733 | 3300013308 | Bacteria | 2620 |
| 267 | Ga0157375_10143967 | 3300013308 | Bacteria | 2513 |
| 268 | Ga0157375_10280603 | 3300013308 | Bacteria | 1829 |
| 269 | Ga0163163_10276709 | 3300014325 | Bacteria | 1730 |
| 270 | Ga0163163_11217941 | 3300014325 | Bacteria | 815 |
| 271 | Ga0163163_11454181 | 3300014325 | Bacteria | 747 |
| 272 | Ga0157380_10004578 | 3300014326 | Bacteria | 9601 |
| 273 | Ga0157380_10082084 | 3300014326 | Bacteria | 2638 |
| 274 | Ga0157380_10350663 | 3300014326 | Bacteria | 1381 |
| 275 | Ga0157380_10960690 | 3300014326 | Bacteria | 885 |
| 276 | Ga0157380_10989690 | 3300014326 | Bacteria | 873 |
| 277 | Ga0157380_11251326 | 3300014326 | Bacteria | 788 |
| 278 | Ga0157380_11465959 | 3300014326 | Bacteria | 735 |
| 279 | Ga0157380_11508863 | 3300014326 | Bacteria | 725 |
| 280 | Ga0157377_10867265 | 3300014745 | Bacteria | 672 |
| 281 | Ga0157377_11093103 | 3300014745 | Bacteria | 610 |
| 282 | Ga0157379_10169789 | 3300014968 | Bacteria | 1969 |
| 283 | Ga0157376_10013099 | 3300014969 | Bacteria | 6177 |
| 284 | Ga0157376_10017026 | 3300014969 | Bacteria | 5534 |
| 285 | Ga0157376_10332507 | 3300014969 | Bacteria | 1448 |
| 286 | Ga0157376_10435455 | 3300014969 | Bacteria | 1275 |
| 287 | Ga0163161_10519792 | 3300017792 | Bacteria | 972 |
| 288 | Ga0197907_10166582 | 3300020069 | Bacteria | 1096 |
| 289 | Ga0197907_10544785 | 3300020069 | Bacteria | 1030 |
| 290 | Ga0197907_10643572 | 3300020069 | Bacteria | 2802 |
| 291 | Ga0197907_10684168 | 3300020069 | Bacteria | 1519 |
| 292 | Ga0197907_11002581 | 3300020069 | Unclassified | 1231 |
| 293 | Ga0197907_11115412 | 3300020069 | Bacteria | 941 |
| 294 | Ga0197907_11171440 | 3300020069 | Bacteria | 1091 |
| 295 | Ga0197907_11244701 | 3300020069 | Bacteria | 904 |
| 296 | Ga0197907_11340891 | 3300020069 | Bacteria | 821 |
| 297 | Ga0197907_11347398 | 3300020069 | Bacteria | 853 |
| 298 | Ga0206356_10029991 | 3300020070 | Unclassified | 1925 |
| 299 | Ga0206356_10387064 | 3300020070 | Bacteria | 1484 |
| 300 | Ga0206356_10393104 | 3300020070 | Bacteria | 940 |
| 301 | Ga0206356_10527780 | 3300020070 | Bacteria | 1720 |
| 302 | Ga0206356_10589241 | 3300020070 | Bacteria | 1011 |
| 303 | Ga0206356_11184870 | 3300020070 | Bacteria | 942 |
| 304 | Ga0206356_11234993 | 3300020070 | Bacteria | 1338 |
| 305 | Ga0206356_11465735 | 3300020070 | Bacteria | 1187 |
| 306 | Ga0206356_11475959 | 3300020070 | Bacteria | 1063 |
| 307 | Ga0206356_11723060 | 3300020070 | Bacteria | 1773 |
| 308 | Ga0206349_1149751 | 3300020075 | Unclassified | 1685 |
| 309 | Ga0206349_1306057 | 3300020075 | Bacteria | 610 |
| 310 | Ga0206349_1416863 | 3300020075 | Bacteria | 1123 |
| 311 | Ga0206349_1428736 | 3300020075 | Bacteria | 1353 |
| 312 | Ga0206349_1451067 | 3300020075 | Bacteria | 1016 |
| 313 | Ga0206349_1547646 | 3300020075 | Bacteria | 686 |
| 314 | Ga0206349_1630809 | 3300020075 | Bacteria | 1879 |
| 315 | Ga0206349_1746519 | 3300020075 | Bacteria | 1214 |
| 316 | Ga0206355_1023074 | 3300020076 | Bacteria | 903 |
| 317 | Ga0206355_1291002 | 3300020076 | Bacteria | 616 |
| 318 | Ga0206355_1525315 | 3300020076 | Bacteria | 896 |
| 319 | Ga0206355_1716015 | 3300020076 | Bacteria | 727 |
| 320 | Ga0206351_10122949 | 3300020077 | Bacteria | 957 |
| 321 | Ga0206351_10168106 | 3300020077 | Bacteria | 1466 |
| 322 | Ga0206351_10458947 | 3300020077 | Bacteria | 1663 |
| 323 | Ga0206351_10693876 | 3300020077 | Bacteria | 627 |
| 324 | Ga0206351_10913767 | 3300020077 | Bacteria | 933 |
| 325 | Ga0206352_10519505 | 3300020078 | Bacteria | 568 |
| 326 | Ga0206352_10603617 | 3300020078 | Bacteria | 979 |
| 327 | Ga0206352_10636518 | 3300020078 | Bacteria | 809 |
| 328 | Ga0206352_10752522 | 3300020078 | Bacteria | 1120 |
| 329 | Ga0206352_11134617 | 3300020078 | Bacteria | 1063 |
| 330 | Ga0206352_11154477 | 3300020078 | Bacteria | 502 |
| 331 | Ga0206352_11339826 | 3300020078 | Bacteria | 1720 |
| 332 | Ga0206350_10235783 | 3300020080 | Bacteria | 2202 |
| 333 | Ga0206350_10358460 | 3300020080 | Bacteria | 971 |
| 334 | Ga0206350_10692694 | 3300020080 | Bacteria | 1656 |
| 335 | Ga0206350_10805923 | 3300020080 | Bacteria | 916 |
| 336 | Ga0206350_11230380 | 3300020080 | Bacteria | 564 |
| 337 | Ga0206350_11476777 | 3300020080 | Bacteria | 1178 |
| 338 | Ga0206350_11522585 | 3300020080 | Bacteria | 1616 |
| 339 | Ga0206354_10365710 | 3300020081 | Unclassified | 1385 |
| 340 | Ga0206354_10736349 | 3300020081 | Bacteria | 3446 |
| 341 | Ga0206354_10803466 | 3300020081 | Bacteria | 904 |
| 342 | Ga0206354_10843853 | 3300020081 | Bacteria | 1088 |
| 343 | Ga0206354_11078476 | 3300020081 | Bacteria | 1183 |
| 344 | Ga0206354_11150211 | 3300020081 | Bacteria | 1156 |
| 345 | Ga0206354_11220093 | 3300020081 | Bacteria | 894 |
| 346 | Ga0206354_11311334 | 3300020081 | Bacteria | 947 |
| 347 | Ga0206354_11618312 | 3300020081 | Bacteria | 1103 |
| 348 | Ga0206353_10011578 | 3300020082 | Bacteria | 1750 |
| 349 | Ga0206353_10034385 | 3300020082 | Bacteria | 549 |
| 350 | Ga0206353_10705318 | 3300020082 | Bacteria | 1476 |
| 351 | Ga0206353_10883225 | 3300020082 | Bacteria | 1140 |
| 352 | Ga0206353_11236968 | 3300020082 | Bacteria | 1180 |
| 353 | Ga0206353_11328929 | 3300020082 | Unclassified | 1137 |
| 354 | Ga0206353_12033233 | 3300020082 | Bacteria | 938 |
| 355 | Ga0154015_1137626 | 3300020610 | Bacteria | 621 |
| 356 | Ga0154015_1210807 | 3300020610 | Bacteria | 902 |
| 357 | Ga0213875_10022465 | 3300021388 | Bacteria | 3016 |
| 358 | Ga0213875_10025319 | 3300021388 | Bacteria | 2826 |
| 359 | Ga0213875_10515005 | 3300021388 | Bacteria | 575 |
| 360 | Ga0213871_10053535 | 3300021441 | Bacteria | 1111 |
| 361 | Ga0224712_10000389 | 3300022467 | Bacteria | 8566 |
| 362 | Ga0224712_10001802 | 3300022467 | Bacteria | 5107 |
| 363 | Ga0224712_10086997 | 3300022467 | Bacteria | 1301 |
| 364 | Ga0224712_10092846 | 3300022467 | Bacteria | 1267 |
| 365 | Ga0224712_10096658 | 3300022467 | Bacteria | 1246 |
| 366 | Ga0224712_10184076 | 3300022467 | Unclassified | 942 |
| 367 | Ga0224712_10471685 | 3300022467 | Bacteria | 604 |
| 368 | Ga0224712_10689410 | 3300022467 | Bacteria | 502 |
| 369 | Ga0207653_10050968 | 3300025885 | Bacteria | 1377 |
| 370 | Ga0207682_10034095 | 3300025893 | Bacteria | 2051 |
| 371 | Ga0207642_10085593 | 3300025899 | Bacteria | 1543 |
| 372 | Ga0207642_10153283 | 3300025899 | Bacteria | 1229 |
| 373 | Ga0207642_10161529 | 3300025899 | Bacteria | 1203 |
| 374 | Ga0207688_10020657 | 3300025901 | Bacteria | 3595 |
| 375 | Ga0207680_10013559 | 3300025903 | Bacteria | 4192 |
| 376 | Ga0207680_10635716 | 3300025903 | Bacteria | 764 |
| 377 | Ga0207685_10030205 | 3300025905 | Bacteria | 1927 |
| 378 | Ga0207699_10000308 | 3300025906 | Bacteria | 26108 |
| 379 | Ga0207645_10000354 | 3300025907 | Bacteria | 38157 |
| 380 | Ga0207645_10005100 | 3300025907 | Bacteria | 9614 |
| 381 | Ga0207643_10005287 | 3300025908 | Bacteria | 6908 |
| 382 | Ga0207705_10380852 | 3300025909 | Bacteria | 1090 |
| 383 | Ga0207705_11169708 | 3300025909 | Bacteria | 591 |
| 384 | Ga0207684_10059589 | 3300025910 | Bacteria | 3242 |
| 385 | Ga0207684_10686332 | 3300025910 | Bacteria | 871 |
| 386 | Ga0207684_10785242 | 3300025910 | Bacteria | 806 |
| 387 | Ga0207654_10197559 | 3300025911 | Bacteria | 1322 |
| 388 | Ga0207707_10037560 | 3300025912 | Bacteria | 4233 |
| 389 | Ga0207707_11065343 | 3300025912 | Bacteria | 660 |
| 390 | Ga0207695_10466604 | 3300025913 | Bacteria | 1145 |
| 391 | Ga0207671_10928472 | 3300025914 | Bacteria | 687 |
| 392 | Ga0207662_10084359 | 3300025918 | Bacteria | 1943 |
| 393 | Ga0207649_11219873 | 3300025920 | Bacteria | 594 |
| 394 | Ga0207652_10196319 | 3300025921 | Bacteria | 1816 |
| 395 | Ga0207652_10343020 | 3300025921 | Bacteria | 1348 |
| 396 | Ga0207652_10416074 | 3300025921 | Bacteria | 1212 |
| 397 | Ga0207646_10007605 | 3300025922 | Bacteria | 10977 |
| 398 | Ga0207646_10343928 | 3300025922 | Bacteria | 1348 |
| 399 | Ga0207646_10661806 | 3300025922 | Bacteria | 935 |
| 400 | Ga0207681_10157824 | 3300025923 | Bacteria | 1706 |
| 401 | Ga0207681_10212848 | 3300025923 | Bacteria | 1491 |
| 402 | Ga0207650_10127944 | 3300025925 | Bacteria | 1985 |
| 403 | Ga0207650_10767795 | 3300025925 | Bacteria | 816 |
| 404 | Ga0207659_10016365 | 3300025926 | Bacteria | 4824 |
| 405 | Ga0207659_10150503 | 3300025926 | Bacteria | 1817 |
| 406 | Ga0207687_10388270 | 3300025927 | Bacteria | 1145 |
| 407 | Ga0207700_10000991 | 3300025928 | Bacteria | 16378 |
| 408 | Ga0207700_10006673 | 3300025928 | Bacteria | 6999 |
| 409 | Ga0207700_11437110 | 3300025928 | Bacteria | 613 |
| 410 | Ga0207664_10003417 | 3300025929 | Bacteria | 10582 |
| 411 | Ga0207664_10020594 | 3300025929 | Bacteria | 4891 |
| 412 | Ga0207644_10273141 | 3300025931 | Bacteria | 1355 |
| 413 | Ga0207644_10395917 | 3300025931 | Bacteria | 1128 |
| 414 | Ga0207706_10108625 | 3300025933 | Bacteria | 2441 |
| 415 | Ga0207706_10145637 | 3300025933 | Bacteria | 2084 |
| 416 | Ga0207686_10038789 | 3300025934 | Bacteria | 2885 |
| 417 | Ga0207686_10065759 | 3300025934 | Bacteria | 2313 |
| 418 | Ga0207686_11424028 | 3300025934 | Bacteria | 571 |
| 419 | Ga0207709_10028863 | 3300025935 | Bacteria | 3211 |
| 420 | Ga0207709_10211916 | 3300025935 | Bacteria | 1391 |
| 421 | Ga0207709_10699968 | 3300025935 | Bacteria | 811 |
| 422 | Ga0207670_11634489 | 3300025936 | Bacteria | 548 |
| 423 | Ga0207669_10010070 | 3300025937 | Bacteria | 4537 |
| 424 | Ga0207669_11698326 | 3300025937 | Bacteria | 539 |
| 425 | Ga0207669_11869443 | 3300025937 | Bacteria | 513 |
| 426 | Ga0207704_10092963 | 3300025938 | Bacteria | 1987 |
| 427 | Ga0207704_10199743 | 3300025938 | Bacteria | 1462 |
| 428 | Ga0207704_10930075 | 3300025938 | Bacteria | 732 |
| 429 | Ga0207665_11165695 | 3300025939 | Bacteria | 615 |
| 430 | Ga0207691_10048624 | 3300025940 | Bacteria | 3888 |
| 431 | Ga0207691_10353298 | 3300025940 | Bacteria | 1257 |
| 432 | Ga0207691_11653908 | 3300025940 | Bacteria | 519 |
| 433 | Ga0207711_10110779 | 3300025941 | Bacteria | 2441 |
| 434 | Ga0207689_10026074 | 3300025942 | Bacteria | 4894 |
| 435 | Ga0207689_10062686 | 3300025942 | Bacteria | 3058 |
| 436 | Ga0207661_10000901 | 3300025944 | Bacteria | 19459 |
| 437 | Ga0207661_10090826 | 3300025944 | Bacteria | 2544 |
| 438 | Ga0207661_10302056 | 3300025944 | Bacteria | 1435 |
| 439 | Ga0207661_10820742 | 3300025944 | Bacteria | 856 |
| 440 | Ga0207661_11921319 | 3300025944 | Bacteria | 538 |
| 441 | Ga0207667_11651317 | 3300025949 | Bacteria | 608 |
| 442 | Ga0207651_10003788 | 3300025960 | Bacteria | 7487 |
| 443 | Ga0207651_10122057 | 3300025960 | Bacteria | 1978 |
| 444 | Ga0207651_11972691 | 3300025960 | Bacteria | 525 |
| 445 | Ga0207712_10152649 | 3300025961 | Bacteria | 1786 |
| 446 | Ga0207640_10012564 | 3300025981 | Bacteria | 4827 |
| 447 | Ga0207640_11581856 | 3300025981 | Bacteria | 590 |
| 448 | Ga0207658_10072055 | 3300025986 | Bacteria | 2618 |
| 449 | Ga0207677_10000955 | 3300026023 | Bacteria | 16077 |
| 450 | Ga0207677_10012528 | 3300026023 | Bacteria | 4879 |
| 451 | Ga0207677_10066707 | 3300026023 | Bacteria | 2517 |
| 452 | Ga0207677_10589414 | 3300026023 | Bacteria | 974 |
| 453 | Ga0207677_10712461 | 3300026023 | Bacteria | 891 |
| 454 | Ga0207678_10221199 | 3300026067 | Bacteria | 1621 |
| 455 | Ga0207678_10520767 | 3300026067 | Bacteria | 1038 |
| 456 | Ga0207678_10936204 | 3300026067 | Bacteria | 766 |
| 457 | Ga0207708_10083471 | 3300026075 | Bacteria | 2456 |
| 458 | Ga0207708_10476064 | 3300026075 | Bacteria | 1043 |
| 459 | Ga0207708_11658662 | 3300026075 | Bacteria | 562 |
| 460 | Ga0207702_10005948 | 3300026078 | Bacteria | 10596 |
| 461 | Ga0207702_10973673 | 3300026078 | Bacteria | 841 |
| 462 | Ga0207702_12383049 | 3300026078 | Bacteria | 517 |
| 463 | Ga0207641_10045565 | 3300026088 | Bacteria | 3693 |
| 464 | Ga0207641_10332071 | 3300026088 | Bacteria | 1444 |
| 465 | Ga0207641_11045234 | 3300026088 | Bacteria | 814 |
| 466 | Ga0207641_11740028 | 3300026088 | Bacteria | 625 |
| 467 | Ga0207648_10000404 | 3300026089 | Bacteria | 48036 |
| 468 | Ga0207648_10032257 | 3300026089 | Bacteria | 4626 |
| 469 | Ga0207648_10032981 | 3300026089 | Bacteria | 4569 |
| 470 | Ga0207648_10350658 | 3300026089 | Bacteria | 1330 |
| 471 | Ga0207648_10419092 | 3300026089 | Bacteria | 1215 |
| 472 | Ga0207674_10003661 | 3300026116 | Bacteria | 18744 |
| 473 | Ga0207674_10116450 | 3300026116 | Bacteria | 2643 |
| 474 | Ga0207674_10160041 | 3300026116 | Bacteria | 2206 |
| 475 | Ga0207675_100124672 | 3300026118 | Bacteria | 2439 |
| 476 | Ga0207675_100562955 | 3300026118 | Bacteria | 1140 |
| 477 | Ga0207675_100793680 | 3300026118 | Bacteria | 960 |
| 478 | Ga0207675_101523636 | 3300026118 | Bacteria | 689 |
| 479 | Ga0207683_10000603 | 3300026121 | Bacteria | 33155 |
| 480 | Ga0207683_10003746 | 3300026121 | Bacteria | 13185 |
| 481 | Ga0207683_10032516 | 3300026121 | Bacteria | 4531 |
| 482 | Ga0207683_10062368 | 3300026121 | Bacteria | 3283 |
| 483 | Ga0207683_11326396 | 3300026121 | Bacteria | 666 |
| 484 | Ga0209966_1040538 | 3300027695 | Bacteria | 969 |
| 485 | Ga0268266_10382418 | 3300028379 | Bacteria | 1328 |
| 486 | Ga0268266_10768529 | 3300028379 | Bacteria | 930 |
| 487 | Ga0268265_10150746 | 3300028380 | Bacteria | 1961 |
| 488 | Ga0268265_10501408 | 3300028380 | Bacteria | 1144 |
| 489 | Ga0268265_10672792 | 3300028380 | Bacteria | 997 |
| 490 | Ga0268264_10090125 | 3300028381 | Bacteria | 2642 |
| 491 | Ga0268264_10652629 | 3300028381 | Bacteria | 1041 |
| 492 | Ga0268264_10870715 | 3300028381 | Bacteria | 903 |
| 493 | Ga0268264_12615061 | 3300028381 | Bacteria | 509 |
| 494 | Ga0311001_1072227 | 3300029277 | Bacteria | 597 |
| 495 | Ga0265760_10101364 | 3300031090 | Bacteria | 910 |
| 496 | Ga0265330_10000095 | 3300031235 | Bacteria | 74593 |
| 497 | Ga0265330_10079062 | 3300031235 | Bacteria | 1418 |
| 498 | Ga0265330_10217746 | 3300031235 | Bacteria | 806 |
| 499 | Ga0265332_10000222 | 3300031238 | Bacteria | 45648 |
| 500 | Ga0265328_10022244 | 3300031239 | Unclassified | 2414 |
| 501 | Ga0265328_10213498 | 3300031239 | Bacteria | 734 |
| 502 | Ga0265320_10085198 | 3300031240 | Bacteria | 1471 |
| 503 | Ga0265325_10383069 | 3300031241 | Bacteria | 618 |
| 504 | Ga0265329_10005084 | 3300031242 | Bacteria | 5366 |
| 505 | Ga0265339_10013550 | 3300031249 | Bacteria | 4938 |
| 506 | Ga0265339_10139822 | 3300031249 | Bacteria | 1233 |
| 507 | Ga0265331_10090337 | 3300031250 | Bacteria | 1416 |
| 508 | Ga0265331_10100609 | 3300031250 | Bacteria | 1330 |
| 509 | Ga0265327_10057516 | 3300031251 | Bacteria | 2000 |
| 510 | Ga0265316_10000450 | 3300031344 | Bacteria | 46576 |
| 511 | Ga0265316_10061578 | 3300031344 | Bacteria | 2914 |
| 512 | Ga0265314_10000076 | 3300031711 | Bacteria | 146266 |
| 513 | Ga0265342_10000759 | 3300031712 | Bacteria | 32969 |
| 514 | Ga0265342_10031591 | 3300031712 | Bacteria | 3273 |
| 515 | Ga0316578_10858856 | 3300031728 | Bacteria | 525 |
| 516 | Ga0307405_10059631 | 3300031731 | Bacteria | 2405 |
| 517 | Ga0307410_11184973 | 3300031852 | Bacteria | 665 |
| 518 | Ga0307407_11545976 | 3300031903 | Bacteria | 525 |
| 519 | Ga0307409_102478970 | 3300031995 | Bacteria | 547 |
| 520 | Ga0307409_102909583 | 3300031995 | Bacteria | 506 |
| 521 | Ga0307416_100197294 | 3300032002 | Bacteria | 1905 |
| 522 | Ga0307416_100938527 | 3300032002 | Bacteria | 967 |
| 523 | Ga0307414_10941371 | 3300032004 | Bacteria | 793 |
| 524 | Ga0307411_12295821 | 3300032005 | Bacteria | 507 |
| 525 | Ga0373944_0256664 | 3300035089 | Bacteria | 647 |
| 526 | Ga0373952_0028057 | 3300035092 | Bacteria | 1233 |
| 527 | Ga0373939_0372785 | 3300035114 | Bacteria | 586 |
| 528 | Ga0373953_0019614 | 3300035117 | Bacteria | 2518 |
| 529 | Ga0373954_0068740 | 3300035118 | Bacteria | 1681 |
| 530 | Ga0373954_0134894 | 3300035118 | Bacteria | 1203 |
| 531 | Ga0373943_0059847 | 3300035170 | Bacteria | 1900 |
| 532 | Ga0373943_0151500 | 3300035170 | Bacteria | 1257 |
| 533 | Ga0373946_0532174 | 3300035171 | Bacteria | 605 |
| 534 | Ga0373955_0038216 | 3300035172 | Bacteria | 2557 |
| 535 | Ga0373955_0381778 | 3300035172 | Bacteria | 855 |
| 536 | Ga0373927_0150719 | 3300035695 | Bacteria | 1523 |
| 537 | Ga0373947_0172282 | 3300035725 | Bacteria | 1405 |
| 538 | Ga0373947_0194384 | 3300035725 | Bacteria | 1325 |
| 539 | Ga0373947_0209826 | 3300035725 | Bacteria | 1277 |
| 540 | Ga0373937_0044920 | 3300036401 | Bacteria | 4036 |
| 541 | Ga0373937_0091557 | 3300036401 | Bacteria | 2818 |
| 542 | Ga0265778_020976 | 3300036457 | Bacteria | 807 |
| 543 | Ga0316582_0006998 | 3300036647 | Bacteria | 5976 |
| 544 | Ga0316584_0154220 | 3300036712 | Bacteria | 1709 |
| 545 | Ga0373925_0908300 | 3300037068 | Bacteria | 726 |
| 546 | Ga0395899_0274789 | 3300037312 | Bacteria | 1148 |
| 547 | Ga0395900_0388831 | 3300037418 | Bacteria | 1361 |
| 548 | Ga0395900_0455995 | 3300037418 | Bacteria | 1234 |
| 549 | Ga0395900_0960706 | 3300037418 | Bacteria | 776 |
| 550 | Ga0395898_0091988 | 3300037466 | Bacteria | 2917 |
| 551 | Ga0395898_1838539 | 3300037466 | Bacteria | 526 |
| 552 | Ga0395905_0103220 | 3300037471 | Bacteria | 2677 |
| 553 | Ga0395905_0204218 | 3300037471 | Bacteria | 1852 |
| 554 | Ga0395905_1052154 | 3300037471 | Bacteria | 717 |
| 555 | Ga0436364_0038835 | 3300037853 | Bacteria | 828 |
| 556 | Ga0436364_0542577 | 3300037853 | Bacteria | 1537 |
| 557 | Ga0436364_0586291 | 3300037853 | Bacteria | 97560 |
| 558 | Ga0436364_0723678 | 3300037853 | Bacteria | 629 |
| 559 | Ga0436364_1015141 | 3300037853 | Bacteria | 1109 |
| 560 | Ga0436364_1062354 | 3300037853 | Bacteria | 22499 |
| 561 | Ga0395901_0247269 | 3300038443 | Bacteria | 1859 |
| 562 | Ga0436361_0744057 | 3300039447 | Bacteria | 787 |
| 563 | Ga0436361_1025560 | 3300039447 | Bacteria | 1008 |
| 564 | Ga0436363_0954681 | 3300039450 | Bacteria | 962 |
| 565 | Ga0436363_1478957 | 3300039450 | Bacteria | 918 |
| 566 | Ga0436362_0046115 | 3300039453 | Bacteria | 791 |
| 567 | Ga0436362_0058043 | 3300039453 | Bacteria | 706 |
| 568 | Ga0436362_0162217 | 3300039453 | Bacteria | 1477 |
| 569 | Ga0439436_0066327 | 3300041404 | Bacteria | 1008 |
| 570 | Ga0451789_0018324 | 3300041443 | Bacteria | 770 |
| 571 | Ga0451789_0548624 | 3300041443 | Bacteria | 889 |
| 572 | Ga0451790_26253 | 3300041444 | Bacteria | 580 |
| 573 | Ga0451794_48340 | 3300041446 | Bacteria | 1402 |
| 574 | Ga0451791_0679889 | 3300041451 | Bacteria | 914 |
| 575 | Ga0451793_0502801 | 3300041452 | Bacteria | 529 |
| 576 | Ga0451797_0168955 | 3300041453 | Bacteria | 1147 |
| 577 | Ga0451795_0256947 | 3300041456 | Bacteria | 1219 |
| 578 | Ga0451800_0119921 | 3300041459 | Bacteria | 576 |
| 579 | Ga0451800_1330059 | 3300041459 | Bacteria | 599 |
| 580 | Ga0451802_1688259 | 3300041460 | Bacteria | 662 |
| 581 | Ga0451835_0366974 | 3300041492 | Bacteria | 812 |
| 582 | Ga0451851_0136488 | 3300041507 | Bacteria | 939 |
| 583 | Ga0451855_1893647 | 3300041511 | Bacteria | 569 |
| 584 | Ga0452268_06279 | 3300041907 | Bacteria | 670 |
| 585 | Ga0451577_0000019 | 3300042876 | Bacteria | 506976 |
| 586 | Ga0451577_0002073 | 3300042876 | Bacteria | 24707 |
| 587 | Ga0451577_0061839 | 3300042876 | Bacteria | 3339 |
| 588 | Ga0451577_0097736 | 3300042876 | Bacteria | 2622 |
| 589 | Ga0451577_0312703 | 3300042876 | Bacteria | 1424 |
| 590 | Ga0451577_0714381 | 3300042876 | Bacteria | 907 |
| 591 | Ga0466972_0002629 | 3300044658 | Bacteria | 8898 |
| 592 | Ga0453683_0000086 | 3300044673 | Bacteria | 139689 |
| 593 | Ga0453683_0000096 | 3300044673 | Bacteria | 132402 |
| 594 | Ga0453683_0119787 | 3300044673 | Bacteria | 1657 |
| 595 | Ga0466965_0001564 | 3300044683 | Bacteria | 9313 |
| 596 | Ga0466965_0601618 | 3300044683 | Bacteria | 625 |
| 597 | Ga0466961_0460957 | 3300044693 | Bacteria | 769 |
| 598 | Ga0466963_0022695 | 3300044694 | Bacteria | 3977 |
| 599 | Ga0466963_0059705 | 3300044694 | Bacteria | 2546 |
| 600 | Ga0453684_0000037 | 3300044712 | Bacteria | 709327 |
| 601 | Ga0453684_0000057 | 3300044712 | Bacteria | 506899 |
| 602 | Ga0453684_0001302 | 3300044712 | Bacteria | 74077 |
| 603 | Ga0453684_0001518 | 3300044712 | Bacteria | 65070 |
| 604 | Ga0453684_0003980 | 3300044712 | Bacteria | 32269 |
| 605 | Ga0453684_0029625 | 3300044712 | Bacteria | 7762 |
| 606 | Ga0453684_0043756 | 3300044712 | Bacteria | 6010 |
| 607 | Ga0453684_0156006 | 3300044712 | Bacteria | 2706 |
| 608 | Ga0453684_0918660 | 3300044712 | Bacteria | 936 |
| 609 | Ga0466968_0002295 | 3300044735 | Bacteria | 6986 |
| 610 | Ga0466968_0562001 | 3300044735 | Bacteria | 573 |
| 611 | Ga0466957_0530902 | 3300044842 | Bacteria | 818 |
| 612 | Ga0466957_0880361 | 3300044842 | Bacteria | 639 |
| 613 | Ga0466960_0002825 | 3300044901 | Bacteria | 6581 |
| 614 | Ga0466960_0394739 | 3300044901 | Bacteria | 796 |
| 615 | Ga0451576_0005300 | 3300045051 | Bacteria | 16207 |
| 616 | Ga0451576_0047121 | 3300045051 | Bacteria | 4533 |
| 617 | Ga0451576_0400054 | 3300045051 | Bacteria | 1440 |
| 618 | Ga0451576_0492818 | 3300045051 | Bacteria | 1287 |
| 619 | Ga0451576_1100021 | 3300045051 | Bacteria | 832 |
| 620 | Ga0466967_0033182 | 3300045976 | Bacteria | 4368 |
| 621 | Ga0466967_1249565 | 3300045976 | Bacteria | 740 |
| 622 | Ga0495592_0537949 | 3300046454 | Bacteria | 720 |
| 623 | Ga0495603_0005689 | 3300046455 | Bacteria | 7449 |
| 624 | Ga0495603_0066314 | 3300046455 | Bacteria | 2126 |
| 625 | Ga0495603_0193439 | 3300046455 | Bacteria | 1176 |
| 626 | Ga0495590_0204008 | 3300046457 | Bacteria | 727 |
| 627 | Ga0495629_0029349 | 3300046459 | Bacteria | 3900 |
| 628 | Ga0495651_0525655 | 3300046462 | Bacteria | 754 |
| 629 | Ga0495580_0904300 | 3300046472 | Bacteria | 567 |
| 630 | Ga0495582_0157785 | 3300046473 | Bacteria | 1290 |
| 631 | Ga0495594_0043083 | 3300046499 | Bacteria | 2473 |
| 632 | Ga0495594_0577990 | 3300046499 | Bacteria | 637 |
| 633 | Ga0495618_0089037 | 3300046514 | Bacteria | 1974 |
| 634 | Ga0495628_0321700 | 3300046516 | Bacteria | 1141 |
| 635 | Ga0495652_0287641 | 3300046529 | Bacteria | 1201 |
| 636 | Ga0495640_0110798 | 3300046533 | Bacteria | 1794 |
| 637 | Ga0495586_0117684 | 3300046535 | Bacteria | 1483 |
| 638 | Ga0495621_0390177 | 3300046539 | Bacteria | 589 |
| 639 | Ga0495633_0022320 | 3300046558 | Bacteria | 3152 |
| 640 | Ga0495634_0205649 | 3300046642 | Bacteria | 1221 |
| 641 | Ga0495635_0060120 | 3300046663 | Bacteria | 2612 |
| 642 | Ga0495599_0156792 | 3300046678 | Bacteria | 1408 |
| 643 | Ga0495647_0008157 | 3300046681 | Bacteria | 3520 |
| 644 | Ga0495658_0012542 | 3300046683 | Bacteria | 4297 |
| 645 | Ga0495658_0161509 | 3300046683 | Bacteria | 1382 |
| 646 | Ga0495613_0098089 | 3300046689 | Bacteria | 2118 |
| 647 | Ga0495624_0087620 | 3300046690 | Bacteria | 1923 |
| 648 | Ga0495624_0426636 | 3300046690 | Bacteria | 795 |
| 649 | Ga0495670_0657067 | 3300046691 | Bacteria | 571 |
| 650 | Ga0495604_0019157 | 3300047317 | Bacteria | 5481 |
| 651 | Ga0495674_0096904 | 3300047319 | Bacteria | 2513 |
| 652 | Ga0495674_0411249 | 3300047319 | Bacteria | 1091 |
| 653 | Ga0495676_0151455 | 3300047321 | Bacteria | 1650 |
| 654 | Ga0495680_0046852 | 3300047322 | Bacteria | 3406 |
| 655 | Ga0495686_0067257 | 3300047472 | Bacteria | 2212 |
| 656 | Ga0495686_0263851 | 3300047472 | Bacteria | 963 |
| 657 | Ga0495602_0189428 | 3300048088 | Bacteria | 1579 |
| 658 | Ga0496100_0015082 | 3300048903 | Bacteria | 4506 |
| 659 | Ga0496101_0001030 | 3300048904 | Bacteria | 16441 |
| 660 | Ga0496102_0003818 | 3300048905 | Bacteria | 12741 |
| 661 | Ga0496103_0032332 | 3300048906 | Bacteria | 3193 |
| 662 | Ga0496104_0013684 | 3300048907 | Bacteria | 7314 |
| 663 | Ga0496104_0347694 | 3300048907 | Bacteria | 1396 |
| 664 | Ga0496105_0027011 | 3300048908 | Bacteria | 4685 |
| 665 | Ga0496105_0156031 | 3300048908 | Bacteria | 1874 |
| 666 | Ga0496105_0551172 | 3300048908 | Bacteria | 900 |
| 667 | Ga0496106_0017141 | 3300048909 | Bacteria | 5362 |
| 668 | Ga0496106_1209888 | 3300048909 | Bacteria | 589 |
| 669 | Ga0496107_0016059 | 3300048910 | Bacteria | 5254 |
| 670 | Ga0496108_0000307 | 3300048911 | Bacteria | 42018 |
| 671 | Ga0496108_0923553 | 3300048911 | Bacteria | 748 |
| 672 | Ga0496109_0272562 | 3300048912 | Bacteria | 1595 |
| 673 | Ga0496110_0019020 | 3300048913 | Bacteria | 5773 |
| 674 | Ga0496110_0119314 | 3300048913 | Bacteria | 2375 |
| 675 | Ga0496111_0008255 | 3300048914 | Bacteria | 6885 |
| 676 | Ga0496112_0005660 | 3300048915 | Bacteria | 10852 |
| 677 | Ga0496112_0689434 | 3300048915 | Bacteria | 950 |
| 678 | Ga0496114_0001853 | 3300048917 | Bacteria | 16012 |
| 679 | Ga0496115_0443443 | 3300048918 | Bacteria | 1049 |
| 680 | Ga0496117_0454488 | 3300048920 | Bacteria | 632 |
| 681 | Ga0496122_0002341 | 3300048925 | Bacteria | 27352 |
| 682 | Ga0496122_0005147 | 3300048925 | Bacteria | 15769 |
| 683 | Ga0496122_0451652 | 3300048925 | Bacteria | 637 |
| 684 | Ga0496123_0002420 | 3300048926 | Bacteria | 23276 |
| 685 | Ga0496123_0009053 | 3300048926 | Bacteria | 9023 |
| 686 | Ga0496126_0174194 | 3300048929 | Bacteria | 1831 |
| 687 | Ga0496126_0264611 | 3300048929 | Bacteria | 1429 |
| 688 | Ga0501306_093030 | 3300049127 | Bacteria | 532 |
| 689 | Ga0501309_012844 | 3300049129 | Bacteria | 1108 |
| 690 | Ga0501310_017694 | 3300049130 | Bacteria | 864 |
| 691 | Ga0501305_047643 | 3300049161 | Bacteria | 713 |
| 692 | Ga0501312_022933 | 3300049528 | Bacteria | 938 |
| 693 | Ga0501316_006507 | 3300049532 | Bacteria | 1244 |
| 694 | Ga0501317_020275 | 3300049533 | Bacteria | 895 |
| 695 | Ga0501317_037362 | 3300049533 | Bacteria | 729 |
| 696 | Ga0501318_062526 | 3300049534 | Bacteria | 574 |
| 697 | Ga0501321_030548 | 3300049537 | Bacteria | 718 |
| 698 | Ga0501032_0415382 | 3300049569 | Bacteria | 863 |
| 699 | Ga0501032_0751895 | 3300049569 | Bacteria | 617 |
| 700 | Ga0501033_0094345 | 3300049570 | Bacteria | 2188 |
| 701 | Ga0501034_0026488 | 3300049571 | Bacteria | 5905 |
| 702 | Ga0501034_0358600 | 3300049571 | Bacteria | 1385 |
| 703 | Ga0501036_0897237 | 3300049572 | Bacteria | 728 |
| 704 | Ga0501037_0164266 | 3300049573 | Bacteria | 1581 |
| 705 | Ga0501038_0370994 | 3300049574 | Bacteria | 1112 |
| 706 | Ga0501040_0074983 | 3300049576 | Bacteria | 2338 |
| 707 | Ga0501040_0645958 | 3300049576 | Bacteria | 765 |
| 708 | Ga0501041_0028164 | 3300049577 | Bacteria | 3388 |
| 709 | Ga0501041_1018482 | 3300049577 | Bacteria | 533 |
| 710 | Ga0501042_0211817 | 3300049578 | Bacteria | 1398 |
| 711 | Ga0501042_0429403 | 3300049578 | Bacteria | 958 |
| 712 | Ga0501043_0509033 | 3300049579 | Bacteria | 899 |
| 713 | Ga0501046_0070815 | 3300049580 | Bacteria | 2710 |
| 714 | Ga0501047_0089702 | 3300049581 | Bacteria | 2952 |
| 715 | Ga0501047_0113384 | 3300049581 | Bacteria | 2593 |
| 716 | Ga0501047_1122111 | 3300049581 | Bacteria | 600 |
| 717 | Ga0501048_0083340 | 3300049582 | Bacteria | 2255 |
| 718 | Ga0501067_0122573 | 3300049583 | Bacteria | 1447 |
| 719 | Ga0501068_0467317 | 3300049584 | Bacteria | 817 |
| 720 | Ga0501072_0205502 | 3300049588 | Bacteria | 1570 |
| 721 | Ga0501072_0650771 | 3300049588 | Bacteria | 829 |
| 722 | Ga0501076_0513765 | 3300049592 | Bacteria | 987 |
| 723 | Ga0501077_0157142 | 3300049593 | Bacteria | 1443 |
| 724 | Ga0501077_0837610 | 3300049593 | Bacteria | 591 |
| 725 | Ga0501081_0386793 | 3300049743 | Bacteria | 1034 |
| 726 | Ga0501081_1422134 | 3300049743 | Bacteria | 526 |
| 727 | Ga0501083_0822689 | 3300049744 | Bacteria | 604 |
| 728 | Ga0501083_1012940 | 3300049744 | Bacteria | 540 |
| 729 | Ga0501035_0046057 | 3300049822 | Bacteria | 3923 |
| 730 | Ga0501044_0043759 | 3300049823 | Bacteria | 4650 |
| 731 | Ga0501044_1015666 | 3300049823 | Bacteria | 701 |
| 732 | nmdc:mga0yw44_290508_c1 | 3300050492 | Bacteria | 1094 |
| 733 | nmdc:mga0k408_107398_c1 | 3300050493 | Bacteria | 1649 |
| 734 | nmdc:mga0k408_232971_c1 | 3300050493 | Bacteria | 1099 |
| 735 | nmdc:mga05p37_1249226_c1 | 3300050507 | Bacteria | 762 |
| 736 | nmdc:mga05p37_1441101_c1 | 3300050507 | Bacteria | 690 |
| 737 | nmdc:mga05p37_17560_c2 | 3300050507 | Bacteria | 7255 |
| 738 | nmdc:mga05p37_178968_c1 | 3300050507 | Bacteria | 2581 |
| 739 | nmdc:mga05p37_382254_c1 | 3300050507 | Bacteria | 1649 |
| 740 | nmdc:mga05p37_892118_c1 | 3300050507 | Bacteria | 960 |
| 741 | nmdc:mga05p37_90847_c1 | 3300050507 | Bacteria | 3763 |
| 742 | nmdc:mga09592_430858_c1 | 3300050508 | Bacteria | 1138 |
| 743 | nmdc:mga0qj67_179171_c1 | 3300050509 | Bacteria | 1721 |
| 744 | nmdc:mga0qj67_349756_c1 | 3300050509 | Bacteria | 1195 |
| 745 | nmdc:mga06r32_2097_c1 | 3300050510 | Bacteria | 17859 |
| 746 | nmdc:mga06r32_580758_c1 | 3300050510 | Bacteria | 1093 |
| 747 | nmdc:mga08y16_124683_c1 | 3300050511 | Bacteria | 2679 |
| 748 | nmdc:mga08y16_180934_c1 | 3300050511 | Bacteria | 2189 |
| 749 | nmdc:mga0n895_1269968_c1 | 3300050512 | Bacteria | 708 |
| 750 | nmdc:mga0n895_1430599_c1 | 3300050512 | Bacteria | 659 |
| 751 | nmdc:mga0n895_1595338_c1 | 3300050512 | Bacteria | 617 |
| 752 | nmdc:mga0n895_54944_c1 | 3300050512 | Bacteria | 3918 |
| 753 | nmdc:mga0rr50_64147_c1 | 3300050513 | Unclassified | 2777 |
| 754 | nmdc:mga0a205_12817_c1 | 3300050515 | Bacteria | 7775 |
| 755 | nmdc:mga0a205_18928_c2 | 3300050515 | Bacteria | 1844 |
| 756 | nmdc:mga0a205_324510_c1 | 3300050515 | Bacteria | 1410 |
| 757 | nmdc:mga0a205_6280_c1 | 3300050515 | Bacteria | 10723 |
| 758 | Ga0495601_0008491 | 3300053077 | Bacteria | 6067 |
| 759 | Ga0495601_0082083 | 3300053077 | Bacteria | 2069 |
| 760 | Ga0495612_0000233 | 3300053078 | Bacteria | 23563 |
| 761 | Ga0495612_0011527 | 3300053078 | Bacteria | 3564 |
| 762 | Ga0495612_0157053 | 3300053078 | Bacteria | 992 |
| 763 | Ga0495655_0159737 | 3300053083 | Bacteria | 714 |
| 764 | Ga0495595_0014251 | 3300053084 | Bacteria | 3369 |
| 765 | Ga0495619_0005474 | 3300053085 | Bacteria | 8050 |
| 766 | Ga0500643_000191 | 3300053087 | Bacteria | 58540 |
| 767 | Ga0500641_0030230 | 3300053096 | Bacteria | 2127 |
| 768 | Ga0500650_0030528 | 3300053098 | Bacteria | 2445 |
| 769 | Ga0500556_0000020 | 3300053104 | Bacteria | 185929 |
| 770 | Ga0500655_048641 | 3300053133 | Bacteria | 842 |
| 771 | Ga0500559_0000164 | 3300053136 | Bacteria | 52626 |
| 772 | Ga0500559_0059520 | 3300053136 | Bacteria | 1700 |
| 773 | Ga0500568_0000038 | 3300053139 | Bacteria | 134267 |
| 774 | Ga0500573_0000014 | 3300053140 | Bacteria | 193353 |
| 775 | Ga0500573_0150176 | 3300053140 | Bacteria | 1276 |
| 776 | Ga0500573_0177679 | 3300053140 | Bacteria | 1146 |
| 777 | Ga0500573_0238339 | 3300053140 | Bacteria | 944 |
| 778 | Ga0500573_0259226 | 3300053140 | Bacteria | 891 |
| 779 | Ga0500573_0269096 | 3300053140 | Bacteria | 868 |
| 780 | Ga0500573_0556814 | 3300053140 | Bacteria | 506 |
| 781 | Ga0500577_0003340 | 3300053142 | Bacteria | 4162 |
| 782 | Ga0500604_0079229 | 3300053151 | Bacteria | 1059 |
| 783 | Ga0500616_0000027 | 3300053153 | Bacteria | 441053 |
| 784 | Ga0500645_005061 | 3300053730 | Bacteria | 4927 |
| 785 | Ga0500645_026457 | 3300053730 | Bacteria | 1765 |
| 786 | Ga0501084_0224652 | 3300054114 | Bacteria | 1585 |
| 787 | Ga0587084_025618 | 3300059477 | Bacteria | 916 |
| 788 | Ga0587093_015913 | 3300059478 | Unclassified | 954 |
| 789 | Ga0587066_002759 | 3300059490 | Bacteria | 1982 |
| 790 | Ga0587070_019064 | 3300059491 | Bacteria | 1132 |
| 791 | Ga0587070_066997 | 3300059491 | Unclassified | 757 |
| 792 | Ga0587073_0026332 | 3300059492 | Bacteria | 1164 |
| 793 | Ga0587073_0062128 | 3300059492 | Bacteria | 879 |
| 794 | Ga0587073_0084010 | 3300059492 | Bacteria | 796 |
| 795 | Ga0587077_003243 | 3300059493 | Bacteria | 2028 |
| 796 | Ga0587077_044456 | 3300059493 | Unclassified | 905 |
| 797 | Ga0587080_016143 | 3300059503 | Bacteria | 1175 |
| 798 | Ga0587080_089312 | 3300059503 | Unclassified | 644 |
| 799 | Ga0587080_177424 | 3300059503 | Bacteria | 509 |
| 800 | Ga0587082_032406 | 3300059504 | Bacteria | 918 |
| 801 | Ga0587083_0015179 | 3300059505 | Bacteria | 1340 |
| 802 | Ga0587083_0186807 | 3300059505 | Bacteria | 583 |
| 803 | Ga0587085_010852 | 3300059506 | Bacteria | 1218 |
| 804 | Ga0587086_049869 | 3300059507 | Unclassified | 672 |
| 805 | Ga0587086_061409 | 3300059507 | Bacteria | 627 |
| 806 | Ga0587088_012963 | 3300059508 | Bacteria | 1271 |
| 807 | Ga0587088_199624 | 3300059508 | Bacteria | 510 |
| 808 | Ga0587089_046604 | 3300059509 | Unclassified | 685 |
| 809 | Ga0587090_073510 | 3300059510 | Unclassified | 672 |
| 810 | Ga0587091_070721 | 3300059511 | Bacteria | 763 |
| 811 | Ga0587091_082987 | 3300059511 | Bacteria | 723 |
| 812 | Ga0587092_006243 | 3300059512 | Bacteria | 1501 |
| 813 | Ga0587092_057007 | 3300059512 | Bacteria | 722 |
| 814 | Ga0587094_025084 | 3300059513 | Bacteria | 891 |
| 815 | Ga0587094_027203 | 3300059513 | Bacteria | 867 |
| 816 | Ga0587094_092591 | 3300059513 | Bacteria | 574 |
| 817 | Ga0587098_009000 | 3300059604 | Bacteria | 1075 |
| 818 | Ga0587098_077054 | 3300059604 | Bacteria | 550 |
| 819 | Ga0587106_042144 | 3300059605 | Bacteria | 779 |
| 820 | Ga0587106_046852 | 3300059605 | Unclassified | 754 |
| 821 | Ga0587125_081286 | 3300059607 | Bacteria | 504 |
| 822 | Ga0587101_084189 | 3300059623 | Bacteria | 608 |
| 823 | Ga0587101_107934 | 3300059623 | Bacteria | 562 |
| 824 | Ga0587113_024120 | 3300059625 | Unclassified | 658 |
| 825 | Ga0587115_037146 | 3300059626 | Unclassified | 747 |
| 826 | Ga0587115_050427 | 3300059626 | Bacteria | 675 |
| 827 | Ga0587128_005709 | 3300059630 | Bacteria | 1502 |
| 828 | Ga0587128_095202 | 3300059630 | Bacteria | 616 |
| 829 | Ga0587130_006248 | 3300059631 | Bacteria | 1086 |
| 830 | Ga0587062_028152 | 3300059639 | Bacteria | 844 |
| 831 | Ga0587067_041105 | 3300059640 | Bacteria | 899 |
| 832 | Ga0587067_103291 | 3300059640 | Unclassified | 663 |
| 833 | Ga0587068_000864 | 3300059641 | Bacteria | 3101 |
| 834 | Ga0587072_006828 | 3300059643 | Bacteria | 1753 |
| 835 | Ga0587075_015641 | 3300059644 | Bacteria | 1070 |
| 836 | Ga0587076_020316 | 3300059645 | Bacteria | 1088 |
| 837 | Ga0587078_006035 | 3300059646 | Bacteria | 1306 |
| 838 | Ga0587100_030992 | 3300059648 | Unclassified | 567 |
| 839 | Ga0587107_024585 | 3300059652 | Unclassified | 870 |
| 840 | Ga0587110_055651 | 3300059654 | Unclassified | 538 |
| 841 | Ga0587114_079291 | 3300059655 | Unclassified | 608 |
| 842 | Ga0587071_014646 | 3300060344 | Bacteria | 1366 |
| 843 | Ga0587111_0075536 | 3300060346 | Bacteria | 795 |
| 844 | Ga0466962_0188423 | 3300061719 | Bacteria | 1006 |
| 845 | Ga0530510_0020217 | 3300061734 | Bacteria | 4735 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005468 | Ga0070707_100979356 | Ga0070707_1009793562 | 105 |
| 2 | 3300006028 | Ga0070717_10672712 | Ga0070717_106727122 | 111 |
| 3 | 3300039450 | Ga0436363_1478957 | Ga0436363_1478957_62_445 | 113 |
| 4 | 3300039453 | Ga0436362_0162217 | Ga0436362_0162217_838_1221 | 113 |
| 5 | 3300014969 | Ga0157376_10017026 | Ga0157376_100170264 | 117 |
| 6 | 3300025922 | Ga0207646_10007605 | Ga0207646_1000760520 | 117 |
| 7 | 3300039447 | Ga0436361_1025560 | Ga0436361_1025560_255_635 | 117 |
| 8 | 3300039453 | Ga0436362_0058043 | Ga0436362_0058043_288_668 | 117 |
| 9 | 3300005338 | Ga0068868_100016636 | Ga0068868_10001663610 | 118 |
| 10 | 3300005364 | Ga0070673_101679540 | Ga0070673_1016795402 | 118 |
| 11 | 3300005535 | Ga0070684_100379590 | Ga0070684_1003795903 | 118 |
| 12 | 3300005617 | Ga0068859_102810840 | Ga0068859_1028108402 | 118 |
| 13 | 3300006931 | Ga0097620_102811674 | Ga0097620_1028116742 | 118 |
| 14 | 3300049581 | Ga0501047_1122111 | Ga0501047_1122111_176_556 | 118 |
| 15 | 3300005459 | Ga0068867_100370145 | Ga0068867_1003701451 | 119 |
| 16 | 3300009147 | Ga0114129_11143786 | Ga0114129_111437862 | 119 |
| 17 | 3300009148 | Ga0105243_10117314 | Ga0105243_101173143 | 119 |
| 18 | 3300009176 | Ga0105242_10360933 | Ga0105242_103609331 | 119 |
| 19 | 3300049569 | Ga0501032_0415382 | Ga0501032_0415382_15_377 | 119 |
| 20 | 3300005456 | Ga0070678_100035055 | Ga0070678_1000350553 | 120 |
| 21 | 3300005718 | Ga0068866_10668450 | Ga0068866_106684501 | 120 |
| 22 | 3300006881 | Ga0068865_100067348 | Ga0068865_1000673482 | 120 |
| 23 | 3300009176 | Ga0105242_10045883 | Ga0105242_100458832 | 120 |
| 24 | 3300011119 | Ga0105246_11893922 | Ga0105246_118939222 | 120 |
| 25 | 3300014969 | Ga0157376_10013099 | Ga0157376_1001309910 | 120 |
| 26 | 3300025899 | Ga0207642_10085593 | Ga0207642_100855932 | 120 |
| 27 | 3300025921 | Ga0207652_10416074 | Ga0207652_104160742 | 120 |
| 28 | 3300025934 | Ga0207686_10065759 | Ga0207686_100657592 | 120 |
| 29 | 3300025938 | Ga0207704_10092963 | Ga0207704_100929633 | 120 |
| 30 | 3300025938 | Ga0207704_10930075 | Ga0207704_109300751 | 120 |
| 31 | 3300026023 | Ga0207677_10000955 | Ga0207677_1000095520 | 120 |
| 32 | 3300026089 | Ga0207648_10032981 | Ga0207648_100329817 | 120 |
| 33 | 3300026121 | Ga0207683_10062368 | Ga0207683_100623684 | 120 |
| 34 | 3300035171 | Ga0373946_0532174 | Ga0373946_0532174_165_527 | 120 |
| 35 | 3300035172 | Ga0373955_0381778 | Ga0373955_0381778_271_633 | 120 |
| 36 | 3300049579 | Ga0501043_0509033 | Ga0501043_0509033_194_574 | 120 |
| 37 | 3300059506 | Ga0587085_010852 | Ga0587085_010852_198_581 | 120 |
| 38 | 3300059511 | Ga0587091_082987 | Ga0587091_082987_55_441 | 120 |
| 39 | 3300005518 | Ga0070699_100266384 | Ga0070699_1002663843 | 121 |
| 40 | 3300025960 | Ga0207651_11972691 | Ga0207651_119726912 | 121 |
| 41 | iso_pu_bacteria | 2784746763 | 2785341845 | 121 |
| 42 | iso_pu_bacteria | 2808606982 | 2811845077 | 121 |
| 43 | iso_pu_bacteria | 2862281513 | 2862287031 | 121 |
| 44 | iso_pu_bacteria | 2862382967 | 2862391296 | 121 |
| 45 | iso_pu_bacteria | 2863404153 | 2863411532 | 121 |
| 46 | iso_pu_bacteria | 2929199973 | 2929200725 | 121 |
| 47 | iso_pu_bacteria | 2990059506 | 2990062338 | 121 |
| 48 | iso_pu_bacteria | 8008558824 | 8008566581 | 121 |
| 49 | iso_pu_bacteria | 8008574985 | 8008577780 | 121 |
| 50 | iso_pu_bacteria | 8048406513 | 8048413810 | 121 |
| 51 | iso_pu_bacteria | 8055909800 | 8055913942 | 121 |
| 52 | 3300004801 | Ga0058860_10205765 | Ga0058860_102057651 | 122 |
| 53 | 3300005289 | Ga0065704_10324636 | Ga0065704_103246362 | 122 |
| 54 | 3300005335 | Ga0070666_10717353 | Ga0070666_107173531 | 122 |
| 55 | 3300005337 | Ga0070682_100107622 | Ga0070682_1001076222 | 122 |
| 56 | 3300005337 | Ga0070682_100206362 | Ga0070682_1002063623 | 122 |
| 57 | 3300005341 | Ga0070691_10190321 | Ga0070691_101903212 | 122 |
| 58 | 3300005343 | Ga0070687_100062007 | Ga0070687_1000620072 | 122 |
| 59 | 3300005355 | Ga0070671_100600657 | Ga0070671_1006006571 | 122 |
| 60 | 3300005367 | Ga0070667_100447653 | Ga0070667_1004476532 | 122 |
| 61 | 3300005406 | Ga0070703_10237895 | Ga0070703_102378951 | 122 |
| 62 | 3300005440 | Ga0070705_100140505 | Ga0070705_1001405051 | 122 |
| 63 | 3300005444 | Ga0070694_100789697 | Ga0070694_1007896972 | 122 |
| 64 | 3300005445 | Ga0070708_100483923 | Ga0070708_1004839231 | 122 |
| 65 | 3300005455 | Ga0070663_100190503 | Ga0070663_1001905033 | 122 |
| 66 | 3300005459 | Ga0068867_100307117 | Ga0068867_1003071172 | 122 |
| 67 | 3300005536 | Ga0070697_100249451 | Ga0070697_1002494512 | 122 |
| 68 | 3300005539 | Ga0068853_100921056 | Ga0068853_1009210562 | 122 |
| 69 | 3300005544 | Ga0070686_100069104 | Ga0070686_1000691044 | 122 |
| 70 | 3300005546 | Ga0070696_100283047 | Ga0070696_1002830471 | 122 |
| 71 | 3300005547 | Ga0070693_100113168 | Ga0070693_1001131683 | 122 |
| 72 | 3300005549 | Ga0070704_100046496 | Ga0070704_1000464965 | 122 |
| 73 | 3300005577 | Ga0068857_100862349 | Ga0068857_1008623492 | 122 |
| 74 | 3300005615 | Ga0070702_100010797 | Ga0070702_1000107975 | 122 |
| 75 | 3300005718 | Ga0068866_10037041 | Ga0068866_100370412 | 122 |
| 76 | 3300005719 | Ga0068861_101768534 | Ga0068861_1017685341 | 122 |
| 77 | 3300005841 | Ga0068863_100492275 | Ga0068863_1004922752 | 122 |
| 78 | 3300005843 | Ga0068860_100043631 | Ga0068860_1000436316 | 122 |
| 79 | 3300006163 | Ga0070715_10015070 | Ga0070715_100150705 | 122 |
| 80 | 3300006175 | Ga0070712_100123654 | Ga0070712_1001236543 | 122 |
| 81 | 3300006237 | Ga0097621_100028937 | Ga0097621_1000289376 | 122 |
| 82 | 3300006358 | Ga0068871_100012756 | Ga0068871_1000127564 | 122 |
| 83 | 3300006881 | Ga0068865_100103143 | Ga0068865_1001031432 | 122 |
| 84 | 3300009098 | Ga0105245_10449169 | Ga0105245_104491692 | 122 |
| 85 | 3300009148 | Ga0105243_10148900 | Ga0105243_101489004 | 122 |
| 86 | 3300009148 | Ga0105243_10233304 | Ga0105243_102333041 | 122 |
| 87 | 3300009174 | Ga0105241_10156169 | Ga0105241_101561692 | 122 |
| 88 | 3300009177 | Ga0105248_10058121 | Ga0105248_100581213 | 122 |
| 89 | 3300010375 | Ga0105239_11333003 | Ga0105239_113330032 | 122 |
| 90 | 3300011119 | Ga0105246_10306561 | Ga0105246_103065613 | 122 |
| 91 | 3300013297 | Ga0157378_10005839 | Ga0157378_1000583913 | 122 |
| 92 | 3300013308 | Ga0157375_10131733 | Ga0157375_101317332 | 122 |
| 93 | 3300014968 | Ga0157379_10169789 | Ga0157379_101697892 | 122 |
| 94 | 3300014969 | Ga0157376_10435455 | Ga0157376_104354552 | 122 |
| 95 | 3300020069 | Ga0197907_11340891 | Ga0197907_113408911 | 122 |
| 96 | 3300020076 | Ga0206355_1291002 | Ga0206355_12910022 | 122 |
| 97 | 3300020080 | Ga0206350_11230380 | Ga0206350_112303802 | 122 |
| 98 | 3300020081 | Ga0206354_11220093 | Ga0206354_112200931 | 122 |
| 99 | 3300025885 | Ga0207653_10050968 | Ga0207653_100509683 | 122 |
| 100 | 3300025899 | Ga0207642_10153283 | Ga0207642_101532831 | 122 |
| 101 | 3300025903 | Ga0207680_10635716 | Ga0207680_106357162 | 122 |
| 102 | 3300025905 | Ga0207685_10030205 | Ga0207685_100302054 | 122 |
| 103 | 3300025911 | Ga0207654_10197559 | Ga0207654_101975592 | 122 |
| 104 | 3300025931 | Ga0207644_10395917 | Ga0207644_103959171 | 122 |
| 105 | 3300025934 | Ga0207686_10038789 | Ga0207686_100387892 | 122 |
| 106 | 3300025935 | Ga0207709_10028863 | Ga0207709_100288634 | 122 |
| 107 | 3300025937 | Ga0207669_10010070 | Ga0207669_100100703 | 122 |
| 108 | 3300025938 | Ga0207704_10199743 | Ga0207704_101997433 | 122 |
| 109 | 3300025941 | Ga0207711_10110779 | Ga0207711_101107794 | 122 |
| 110 | 3300025986 | Ga0207658_10072055 | Ga0207658_100720554 | 122 |
| 111 | 3300026023 | Ga0207677_10589414 | Ga0207677_105894142 | 122 |
| 112 | 3300026067 | Ga0207678_10221199 | Ga0207678_102211991 | 122 |
| 113 | 3300026089 | Ga0207648_10350658 | Ga0207648_103506582 | 122 |
| 114 | 3300026118 | Ga0207675_100793680 | Ga0207675_1007936801 | 122 |
| 115 | 3300026121 | Ga0207683_10000603 | Ga0207683_1000060327 | 122 |
| 116 | 3300028379 | Ga0268266_10382418 | Ga0268266_103824183 | 122 |
| 117 | 3300028381 | Ga0268264_10652629 | Ga0268264_106526292 | 122 |
| 118 | 3300031728 | Ga0316578_10858856 | Ga0316578_108588561 | 122 |
| 119 | 3300035089 | Ga0373944_0256664 | Ga0373944_0256664_73_444 | 122 |
| 120 | 3300035114 | Ga0373939_0372785 | Ga0373939_0372785_184_555 | 122 |
| 121 | 3300035170 | Ga0373943_0151500 | Ga0373943_0151500_300_671 | 122 |
| 122 | 3300035725 | Ga0373947_0194384 | Ga0373947_0194384_138_509 | 122 |
| 123 | 3300037068 | Ga0373925_0908300 | Ga0373925_0908300_259_630 | 122 |
| 124 | 3300041511 | Ga0451855_1893647 | Ga0451855_1893647_65_433 | 122 |
| 125 | 3300042876 | Ga0451577_0002073 | Ga0451577_0002073_11216_11584 | 122 |
| 126 | 3300044683 | Ga0466965_0601618 | Ga0466965_0601618_91_462 | 122 |
| 127 | 3300044712 | Ga0453684_0001302 | Ga0453684_0001302_12007_12375 | 122 |
| 128 | 3300044712 | Ga0453684_0918660 | Ga0453684_0918660_19_387 | 122 |
| 129 | 3300045051 | Ga0451576_0400054 | Ga0451576_0400054_446_814 | 122 |
| 130 | 3300046455 | Ga0495603_0066314 | Ga0495603_0066314_1726_2097 | 122 |
| 131 | 3300046457 | Ga0495590_0204008 | Ga0495590_0204008_122_493 | 122 |
| 132 | 3300046683 | Ga0495658_0161509 | Ga0495658_0161509_882_1253 | 122 |
| 133 | 3300048903 | Ga0496100_0015082 | Ga0496100_0015082_3472_3843 | 122 |
| 134 | 3300048904 | Ga0496101_0001030 | Ga0496101_0001030_1360_1731 | 122 |
| 135 | 3300048905 | Ga0496102_0003818 | Ga0496102_0003818_6553_6924 | 122 |
| 136 | 3300048906 | Ga0496103_0032332 | Ga0496103_0032332_835_1206 | 122 |
| 137 | 3300048907 | Ga0496104_0013684 | Ga0496104_0013684_1146_1517 | 122 |
| 138 | 3300048908 | Ga0496105_0027011 | Ga0496105_0027011_4088_4459 | 122 |
| 139 | 3300048909 | Ga0496106_0017141 | Ga0496106_0017141_416_787 | 122 |
| 140 | 3300048909 | Ga0496106_1209888 | Ga0496106_1209888_180_548 | 122 |
| 141 | 3300048910 | Ga0496107_0016059 | Ga0496107_0016059_537_908 | 122 |
| 142 | 3300048911 | Ga0496108_0923553 | Ga0496108_0923553_144_515 | 122 |
| 143 | 3300048917 | Ga0496114_0001853 | Ga0496114_0001853_6576_6947 | 122 |
| 144 | 3300048918 | Ga0496115_0443443 | Ga0496115_0443443_187_558 | 122 |
| 145 | 3300048925 | Ga0496122_0451652 | Ga0496122_0451652_79_447 | 122 |
| 146 | 3300049127 | Ga0501306_093030 | Ga0501306_093030_125_496 | 122 |
| 147 | 3300049576 | Ga0501040_0074983 | Ga0501040_0074983_1083_1454 | 122 |
| 148 | 3300049593 | Ga0501077_0157142 | Ga0501077_0157142_329_700 | 122 |
| 149 | 3300049743 | Ga0501081_0386793 | Ga0501081_0386793_339_710 | 122 |
| 150 | 3300049744 | Ga0501083_1012940 | Ga0501083_1012940_100_468 | 122 |
| 151 | 3300059477 | Ga0587084_025618 | Ga0587084_025618_434_802 | 122 |
| 152 | 3300059511 | Ga0587091_070721 | Ga0587091_070721_278_649 | 122 |
| 153 | 3300059604 | Ga0587098_077054 | Ga0587098_077054_128_496 | 122 |
| 154 | 3300059607 | Ga0587125_081286 | Ga0587125_081286_86_457 | 122 |
| 155 | 3300059626 | Ga0587115_050427 | Ga0587115_050427_142_513 | 122 |
| 156 | 3300059639 | Ga0587062_028152 | Ga0587062_028152_406_774 | 122 |
| 157 | 3300005347 | Ga0070668_100333913 | Ga0070668_1003339133 | 123 |
| 158 | 3300005530 | Ga0070679_100208662 | Ga0070679_1002086623 | 123 |
| 159 | 3300005535 | Ga0070684_100545540 | Ga0070684_1005455402 | 123 |
| 160 | 3300005563 | Ga0068855_100374116 | Ga0068855_1003741161 | 123 |
| 161 | 3300005616 | Ga0068852_102423230 | Ga0068852_1024232301 | 123 |
| 162 | 3300006195 | Ga0075366_10181106 | Ga0075366_101811062 | 123 |
| 163 | 3300007076 | Ga0075435_100152699 | Ga0075435_1001526993 | 123 |
| 164 | 3300013104 | Ga0157370_10289959 | Ga0157370_102899593 | 123 |
| 165 | 3300013104 | Ga0157370_11230718 | Ga0157370_112307182 | 123 |
| 166 | 3300013307 | Ga0157372_10233574 | Ga0157372_102335743 | 123 |
| 167 | 3300020070 | Ga0206356_10387064 | Ga0206356_103870642 | 123 |
| 168 | 3300020082 | Ga0206353_10883225 | Ga0206353_108832252 | 123 |
| 169 | 3300025910 | Ga0207684_10686332 | Ga0207684_106863322 | 123 |
| 170 | 3300025921 | Ga0207652_10196319 | Ga0207652_101963193 | 123 |
| 171 | 3300025944 | Ga0207661_10090826 | Ga0207661_100908262 | 123 |
| 172 | 3300025949 | Ga0207667_11651317 | Ga0207667_116513171 | 123 |
| 173 | 3300026078 | Ga0207702_10973673 | Ga0207702_109736732 | 123 |
| 174 | 3300044712 | Ga0453684_0001518 | Ga0453684_0001518_15355_15726 | 123 |
| 175 | 3300044735 | Ga0466968_0562001 | Ga0466968_0562001_90_464 | 123 |
| 176 | 3300048929 | Ga0496126_0264611 | Ga0496126_0264611_620_991 | 123 |
| 177 | 3300049577 | Ga0501041_0028164 | Ga0501041_0028164_2403_2774 | 123 |
| 178 | 3300049577 | Ga0501041_1018482 | Ga0501041_1018482_95_520 | 123 |
| 179 | 3300049578 | Ga0501042_0211817 | Ga0501042_0211817_724_1095 | 123 |
| 180 | 3300049578 | Ga0501042_0429403 | Ga0501042_0429403_180_605 | 123 |
| 181 | 3300049582 | Ga0501048_0083340 | Ga0501048_0083340_1529_1900 | 123 |
| 182 | 3300049584 | Ga0501068_0467317 | Ga0501068_0467317_339_710 | 123 |
| 183 | 3300049588 | Ga0501072_0650771 | Ga0501072_0650771_281_652 | 123 |
| 184 | 3300050493 | nmdc:mga0k408_232971_c1 | nmdc:mga0k408_232971_c1_450_821 | 123 |
| 185 | 3300050513 | nmdc:mga0rr50_64147_c1 | nmdc:mga0rr50_64147_c1_484_870 | 123 |
| 186 | 3300054114 | Ga0501084_0224652 | Ga0501084_0224652_1099_1470 | 123 |
| 187 | 3300059513 | Ga0587094_025084 | Ga0587094_025084_405_779 | 123 |
| 188 | 3300060346 | Ga0587111_0075536 | Ga0587111_0075536_349_720 | 123 |
| 189 | 3300061734 | Ga0530510_0020217 | Ga0530510_0020217_1778_2149 | 123 |
| 190 | 3300005434 | Ga0070709_10000287 | Ga0070709_1000028720 | 124 |
| 191 | 3300005435 | Ga0070714_100001531 | Ga0070714_1000015314 | 124 |
| 192 | 3300005435 | Ga0070714_100074068 | Ga0070714_1000740683 | 124 |
| 193 | 3300005435 | Ga0070714_100357483 | Ga0070714_1003574832 | 124 |
| 194 | 3300005436 | Ga0070713_100000752 | Ga0070713_10000075212 | 124 |
| 195 | 3300006846 | Ga0075430_100376334 | Ga0075430_1003763343 | 124 |
| 196 | 3300006847 | Ga0075431_100002441 | Ga0075431_1000024418 | 124 |
| 197 | 3300006852 | Ga0075433_10146799 | Ga0075433_101467993 | 124 |
| 198 | 3300013062 | Ga0154010_136519 | Ga0154010_1365192 | 124 |
| 199 | 3300013102 | Ga0157371_10064200 | Ga0157371_100642004 | 124 |
| 200 | 3300013307 | Ga0157372_11449944 | Ga0157372_114499442 | 124 |
| 201 | 3300014326 | Ga0157380_10960690 | Ga0157380_109606901 | 124 |
| 202 | 3300020069 | Ga0197907_11244701 | Ga0197907_112447011 | 124 |
| 203 | 3300020070 | Ga0206356_11234993 | Ga0206356_112349933 | 124 |
| 204 | 3300020078 | Ga0206352_10603617 | Ga0206352_106036173 | 124 |
| 205 | 3300020080 | Ga0206350_11522585 | Ga0206350_115225853 | 124 |
| 206 | 3300020081 | Ga0206354_11150211 | Ga0206354_111502114 | 124 |
| 207 | 3300020082 | Ga0206353_10705318 | Ga0206353_107053184 | 124 |
| 208 | 3300020610 | Ga0154015_1210807 | Ga0154015_12108072 | 124 |
| 209 | 3300022467 | Ga0224712_10096658 | Ga0224712_100966581 | 124 |
| 210 | 3300025906 | Ga0207699_10000308 | Ga0207699_1000030811 | 124 |
| 211 | 3300025912 | Ga0207707_11065343 | Ga0207707_110653432 | 124 |
| 212 | 3300025928 | Ga0207700_10000991 | Ga0207700_1000099116 | 124 |
| 213 | 3300025929 | Ga0207664_10020594 | Ga0207664_100205944 | 124 |
| 214 | 3300025939 | Ga0207665_11165695 | Ga0207665_111656951 | 124 |
| 215 | 3300041443 | Ga0451789_0018324 | Ga0451789_0018324_16_390 | 124 |
| 216 | 3300041443 | Ga0451789_0548624 | Ga0451789_0548624_417_791 | 124 |
| 217 | 3300041444 | Ga0451790_26253 | Ga0451790_26253_195_569 | 124 |
| 218 | 3300041446 | Ga0451794_48340 | Ga0451794_48340_866_1240 | 124 |
| 219 | 3300041451 | Ga0451791_0679889 | Ga0451791_0679889_230_604 | 124 |
| 220 | 3300041452 | Ga0451793_0502801 | Ga0451793_0502801_16_390 | 124 |
| 221 | 3300041453 | Ga0451797_0168955 | Ga0451797_0168955_756_1130 | 124 |
| 222 | 3300041456 | Ga0451795_0256947 | Ga0451795_0256947_571_945 | 124 |
| 223 | 3300041460 | Ga0451802_1688259 | Ga0451802_1688259_132_506 | 124 |
| 224 | 3300041507 | Ga0451851_0136488 | Ga0451851_0136488_298_672 | 124 |
| 225 | 3300041907 | Ga0452268_06279 | Ga0452268_06279_242_616 | 124 |
| 226 | 3300042876 | Ga0451577_0097736 | Ga0451577_0097736_2147_2521 | 124 |
| 227 | 3300042876 | Ga0451577_0312703 | Ga0451577_0312703_596_970 | 124 |
| 228 | 3300042876 | Ga0451577_0714381 | Ga0451577_0714381_241_615 | 124 |
| 229 | 3300044673 | Ga0453683_0000086 | Ga0453683_0000086_79229_79603 | 124 |
| 230 | 3300044673 | Ga0453683_0000096 | Ga0453683_0000096_131991_132365 | 124 |
| 231 | 3300044673 | Ga0453683_0119787 | Ga0453683_0119787_901_1275 | 124 |
| 232 | 3300044693 | Ga0466961_0460957 | Ga0466961_0460957_154_534 | 124 |
| 233 | 3300044694 | Ga0466963_0022695 | Ga0466963_0022695_2371_2748 | 124 |
| 234 | 3300044694 | Ga0466963_0059705 | Ga0466963_0059705_925_1302 | 124 |
| 235 | 3300044712 | Ga0453684_0000037 | Ga0453684_0000037_418197_418571 | 124 |
| 236 | 3300044712 | Ga0453684_0003980 | Ga0453684_0003980_4243_4617 | 124 |
| 237 | 3300044712 | Ga0453684_0029625 | Ga0453684_0029625_65_439 | 124 |
| 238 | 3300044712 | Ga0453684_0043756 | Ga0453684_0043756_4375_4749 | 124 |
| 239 | 3300044842 | Ga0466957_0530902 | Ga0466957_0530902_414_791 | 124 |
| 240 | 3300045051 | Ga0451576_0005300 | Ga0451576_0005300_8122_8496 | 124 |
| 241 | 3300045051 | Ga0451576_0047121 | Ga0451576_0047121_1355_1729 | 124 |
| 242 | 3300045051 | Ga0451576_0492818 | Ga0451576_0492818_772_1146 | 124 |
| 243 | 3300045976 | Ga0466967_0033182 | Ga0466967_0033182_3528_3905 | 124 |
| 244 | 3300049528 | Ga0501312_022933 | Ga0501312_022933_512_886 | 124 |
| 245 | 3300049532 | Ga0501316_006507 | Ga0501316_006507_188_562 | 124 |
| 246 | 3300049570 | Ga0501033_0094345 | Ga0501033_0094345_264_638 | 124 |
| 247 | 3300049571 | Ga0501034_0358600 | Ga0501034_0358600_921_1295 | 124 |
| 248 | 3300049573 | Ga0501037_0164266 | Ga0501037_0164266_1056_1430 | 124 |
| 249 | 3300049574 | Ga0501038_0370994 | Ga0501038_0370994_258_632 | 124 |
| 250 | 3300049580 | Ga0501046_0070815 | Ga0501046_0070815_2076_2450 | 124 |
| 251 | 3300049581 | Ga0501047_0113384 | Ga0501047_0113384_93_467 | 124 |
| 252 | 3300049583 | Ga0501067_0122573 | Ga0501067_0122573_419_796 | 124 |
| 253 | 3300049744 | Ga0501083_0822689 | Ga0501083_0822689_132_506 | 124 |
| 254 | 3300049822 | Ga0501035_0046057 | Ga0501035_0046057_1264_1638 | 124 |
| 255 | 3300049823 | Ga0501044_0043759 | Ga0501044_0043759_207_581 | 124 |
| 256 | 3300050509 | nmdc:mga0qj67_349756_c1 | nmdc:mga0qj67_349756_c1_640_1062 | 124 |
| 257 | 3300050510 | nmdc:mga06r32_2097_c1 | nmdc:mga06r32_2097_c1_5174_5596 | 124 |
| 258 | 3300050515 | nmdc:mga0a205_324510_c1 | nmdc:mga0a205_324510_c1_788_1174 | 124 |
| 259 | 3300053098 | Ga0500650_0030528 | Ga0500650_0030528_1805_2179 | 124 |
| 260 | 3300053136 | Ga0500559_0000164 | Ga0500559_0000164_33382_33756 | 124 |
| 261 | 3300053136 | Ga0500559_0059520 | Ga0500559_0059520_621_995 | 124 |
| 262 | 3300053140 | Ga0500573_0000014 | Ga0500573_0000014_8691_9065 | 124 |
| 263 | 3300053140 | Ga0500573_0150176 | Ga0500573_0150176_639_1013 | 124 |
| 264 | 3300053140 | Ga0500573_0177679 | Ga0500573_0177679_673_1047 | 124 |
| 265 | 3300053140 | Ga0500573_0238339 | Ga0500573_0238339_161_535 | 124 |
| 266 | 3300053140 | Ga0500573_0259226 | Ga0500573_0259226_485_859 | 124 |
| 267 | 3300053140 | Ga0500573_0269096 | Ga0500573_0269096_314_688 | 124 |
| 268 | 3300053140 | Ga0500573_0556814 | Ga0500573_0556814_74_448 | 124 |
| 269 | 3300053142 | Ga0500577_0003340 | Ga0500577_0003340_369_743 | 124 |
| 270 | 3300053151 | Ga0500604_0079229 | Ga0500604_0079229_377_751 | 124 |
| 271 | 3300059492 | Ga0587073_0062128 | Ga0587073_0062128_156_533 | 124 |
| 272 | 3300059605 | Ga0587106_042144 | Ga0587106_042144_145_522 | 124 |
| 273 | 3300059623 | Ga0587101_107934 | Ga0587101_107934_125_502 | 124 |
| 274 | 3300059640 | Ga0587067_041105 | Ga0587067_041105_475_852 | 124 |
| 275 | 3300059643 | Ga0587072_006828 | Ga0587072_006828_401_781 | 124 |
| 276 | 3300003203 | JGI25406J46586_10005150 | JGI25406J46586_100051505 | 125 |
| 277 | 3300003323 | rootH1_10031668 | rootH1_100316688 | 125 |
| 278 | 3300003373 | JGI25407J50210_10009225 | JGI25407J50210_100092254 | 125 |
| 279 | 3300003544 | Ga0007417J51691_1058728 | Ga0007417J51691_10587281 | 125 |
| 280 | 3300003574 | Ga0007410J51695_1062137 | Ga0007410J51695_10621371 | 125 |
| 281 | 3300003575 | Ga0007409J51694_1055064 | Ga0007409J51694_10550642 | 125 |
| 282 | 3300003575 | Ga0007409J51694_1071519 | Ga0007409J51694_10715191 | 125 |
| 283 | 3300003579 | Ga0007429J51699_1100314 | Ga0007429J51699_11003141 | 125 |
| 284 | 3300004798 | Ga0058859_10015336 | Ga0058859_100153361 | 125 |
| 285 | 3300004798 | Ga0058859_11551370 | Ga0058859_115513701 | 125 |
| 286 | 3300004798 | Ga0058859_11778114 | Ga0058859_117781143 | 125 |
| 287 | 3300004799 | Ga0058863_11594786 | Ga0058863_115947862 | 125 |
| 288 | 3300004799 | Ga0058863_11945250 | Ga0058863_119452504 | 125 |
| 289 | 3300004800 | Ga0058861_10017791 | Ga0058861_100177912 | 125 |
| 290 | 3300004800 | Ga0058861_10648189 | Ga0058861_106481891 | 125 |
| 291 | 3300004800 | Ga0058861_11220782 | Ga0058861_112207823 | 125 |
| 292 | 3300004801 | Ga0058860_10013830 | Ga0058860_100138301 | 125 |
| 293 | 3300004801 | Ga0058860_12064927 | Ga0058860_120649271 | 125 |
| 294 | 3300004801 | Ga0058860_12081306 | Ga0058860_120813061 | 125 |
| 295 | 3300004803 | Ga0058862_10088370 | Ga0058862_100883702 | 125 |
| 296 | 3300004803 | Ga0058862_11852680 | Ga0058862_118526803 | 125 |
| 297 | 3300004803 | Ga0058862_12088318 | Ga0058862_120883183 | 125 |
| 298 | 3300004803 | Ga0058862_12231526 | Ga0058862_122315261 | 125 |
| 299 | 3300004803 | Ga0058862_12481273 | Ga0058862_124812735 | 125 |
| 300 | 3300004803 | Ga0058862_12560532 | Ga0058862_125605321 | 125 |
| 301 | 3300004803 | Ga0058862_12561774 | Ga0058862_125617741 | 125 |
| 302 | 3300004803 | Ga0058862_12761214 | Ga0058862_127612142 | 125 |
| 303 | 3300004803 | Ga0058862_12854382 | Ga0058862_128543821 | 125 |
| 304 | 3300005327 | Ga0070658_10004878 | Ga0070658_100048784 | 125 |
| 305 | 3300005327 | Ga0070658_10204966 | Ga0070658_102049662 | 125 |
| 306 | 3300005327 | Ga0070658_10949111 | Ga0070658_109491112 | 125 |
| 307 | 3300005329 | Ga0070683_100062110 | Ga0070683_1000621104 | 125 |
| 308 | 3300005329 | Ga0070683_100338735 | Ga0070683_1003387352 | 125 |
| 309 | 3300005330 | Ga0070690_100462428 | Ga0070690_1004624282 | 125 |
| 310 | 3300005330 | Ga0070690_101257374 | Ga0070690_1012573741 | 125 |
| 311 | 3300005331 | Ga0070670_101106232 | Ga0070670_1011062321 | 125 |
| 312 | 3300005331 | Ga0070670_101985024 | Ga0070670_1019850241 | 125 |
| 313 | 3300005333 | Ga0070677_10046592 | Ga0070677_100465922 | 125 |
| 314 | 3300005334 | Ga0068869_100007769 | Ga0068869_1000077691 | 125 |
| 315 | 3300005334 | Ga0068869_100394002 | Ga0068869_1003940021 | 125 |
| 316 | 3300005335 | Ga0070666_10033476 | Ga0070666_100334765 | 125 |
| 317 | 3300005335 | Ga0070666_10313703 | Ga0070666_103137031 | 125 |
| 318 | 3300005337 | Ga0070682_100065359 | Ga0070682_1000653592 | 125 |
| 319 | 3300005337 | Ga0070682_100173119 | Ga0070682_1001731192 | 125 |
| 320 | 3300005338 | Ga0068868_100001063 | Ga0068868_1000010632 | 125 |
| 321 | 3300005338 | Ga0068868_100002784 | Ga0068868_1000027849 | 125 |
| 322 | 3300005339 | Ga0070660_100066916 | Ga0070660_1000669161 | 125 |
| 323 | 3300005340 | Ga0070689_100317127 | Ga0070689_1003171271 | 125 |
| 324 | 3300005340 | Ga0070689_100613530 | Ga0070689_1006135302 | 125 |
| 325 | 3300005340 | Ga0070689_100713250 | Ga0070689_1007132501 | 125 |
| 326 | 3300005341 | Ga0070691_10009724 | Ga0070691_100097242 | 125 |
| 327 | 3300005341 | Ga0070691_10267874 | Ga0070691_102678741 | 125 |
| 328 | 3300005345 | Ga0070692_10375941 | Ga0070692_103759411 | 125 |
| 329 | 3300005347 | Ga0070668_100045774 | Ga0070668_1000457742 | 125 |
| 330 | 3300005353 | Ga0070669_100083826 | Ga0070669_1000838265 | 125 |
| 331 | 3300005353 | Ga0070669_101057863 | Ga0070669_1010578631 | 125 |
| 332 | 3300005354 | Ga0070675_100173942 | Ga0070675_1001739424 | 125 |
| 333 | 3300005354 | Ga0070675_101556168 | Ga0070675_1015561681 | 125 |
| 334 | 3300005355 | Ga0070671_100295611 | Ga0070671_1002956112 | 125 |
| 335 | 3300005356 | Ga0070674_100564701 | Ga0070674_1005647011 | 125 |
| 336 | 3300005356 | Ga0070674_100628653 | Ga0070674_1006286532 | 125 |
| 337 | 3300005364 | Ga0070673_100028802 | Ga0070673_1000288025 | 125 |
| 338 | 3300005365 | Ga0070688_101317990 | Ga0070688_1013179901 | 125 |
| 339 | 3300005367 | Ga0070667_100014403 | Ga0070667_1000144035 | 125 |
| 340 | 3300005367 | Ga0070667_101111627 | Ga0070667_1011116271 | 125 |
| 341 | 3300005436 | Ga0070713_100003809 | Ga0070713_1000038094 | 125 |
| 342 | 3300005436 | Ga0070713_102070154 | Ga0070713_1020701541 | 125 |
| 343 | 3300005440 | Ga0070705_100030655 | Ga0070705_1000306552 | 125 |
| 344 | 3300005444 | Ga0070694_100732716 | Ga0070694_1007327162 | 125 |
| 345 | 3300005456 | Ga0070678_100102809 | Ga0070678_1001028094 | 125 |
| 346 | 3300005456 | Ga0070678_102080239 | Ga0070678_1020802391 | 125 |
| 347 | 3300005456 | Ga0070678_102361106 | Ga0070678_1023611061 | 125 |
| 348 | 3300005457 | Ga0070662_100069527 | Ga0070662_1000695274 | 125 |
| 349 | 3300005457 | Ga0070662_101401841 | Ga0070662_1014018412 | 125 |
| 350 | 3300005458 | Ga0070681_10102025 | Ga0070681_101020253 | 125 |
| 351 | 3300005459 | Ga0068867_100031077 | Ga0068867_1000310775 | 125 |
| 352 | 3300005459 | Ga0068867_100045142 | Ga0068867_1000451421 | 125 |
| 353 | 3300005466 | Ga0070685_10023219 | Ga0070685_100232192 | 125 |
| 354 | 3300005467 | Ga0070706_100204437 | Ga0070706_1002044373 | 125 |
| 355 | 3300005468 | Ga0070707_100440745 | Ga0070707_1004407453 | 125 |
| 356 | 3300005468 | Ga0070707_100564069 | Ga0070707_1005640692 | 125 |
| 357 | 3300005518 | Ga0070699_100180303 | Ga0070699_1001803033 | 125 |
| 358 | 3300005530 | Ga0070679_100246928 | Ga0070679_1002469282 | 125 |
| 359 | 3300005535 | Ga0070684_100012677 | Ga0070684_1000126773 | 125 |
| 360 | 3300005535 | Ga0070684_100387191 | Ga0070684_1003871912 | 125 |
| 361 | 3300005536 | Ga0070697_100082909 | Ga0070697_1000829094 | 125 |
| 362 | 3300005536 | Ga0070697_101174481 | Ga0070697_1011744811 | 125 |
| 363 | 3300005539 | Ga0068853_100054623 | Ga0068853_1000546235 | 125 |
| 364 | 3300005539 | Ga0068853_100982656 | Ga0068853_1009826562 | 125 |
| 365 | 3300005543 | Ga0070672_100164427 | Ga0070672_1001644274 | 125 |
| 366 | 3300005543 | Ga0070672_100390898 | Ga0070672_1003908981 | 125 |
| 367 | 3300005543 | Ga0070672_101192960 | Ga0070672_1011929601 | 125 |
| 368 | 3300005544 | Ga0070686_100107244 | Ga0070686_1001072443 | 125 |
| 369 | 3300005546 | Ga0070696_100147544 | Ga0070696_1001475443 | 125 |
| 370 | 3300005546 | Ga0070696_100257079 | Ga0070696_1002570791 | 125 |
| 371 | 3300005547 | Ga0070693_100146860 | Ga0070693_1001468603 | 125 |
| 372 | 3300005548 | Ga0070665_100202700 | Ga0070665_1002027002 | 125 |
| 373 | 3300005548 | Ga0070665_100761615 | Ga0070665_1007616152 | 125 |
| 374 | 3300005549 | Ga0070704_101384334 | Ga0070704_1013843341 | 125 |
| 375 | 3300005563 | Ga0068855_100383109 | Ga0068855_1003831093 | 125 |
| 376 | 3300005577 | Ga0068857_100008064 | Ga0068857_10000806411 | 125 |
| 377 | 3300005577 | Ga0068857_100342271 | Ga0068857_1003422713 | 125 |
| 378 | 3300005577 | Ga0068857_101088557 | Ga0068857_1010885571 | 125 |
| 379 | 3300005578 | Ga0068854_100511854 | Ga0068854_1005118541 | 125 |
| 380 | 3300005578 | Ga0068854_100660387 | Ga0068854_1006603871 | 125 |
| 381 | 3300005614 | Ga0068856_100038121 | Ga0068856_1000381213 | 125 |
| 382 | 3300005615 | Ga0070702_101304655 | Ga0070702_1013046551 | 125 |
| 383 | 3300005615 | Ga0070702_101467705 | Ga0070702_1014677051 | 125 |
| 384 | 3300005617 | Ga0068859_100058552 | Ga0068859_1000585526 | 125 |
| 385 | 3300005617 | Ga0068859_100068084 | Ga0068859_1000680845 | 125 |
| 386 | 3300005617 | Ga0068859_100674726 | Ga0068859_1006747262 | 125 |
| 387 | 3300005617 | Ga0068859_102124019 | Ga0068859_1021240191 | 125 |
| 388 | 3300005718 | Ga0068866_10162411 | Ga0068866_101624111 | 125 |
| 389 | 3300005719 | Ga0068861_100416822 | Ga0068861_1004168223 | 125 |
| 390 | 3300005719 | Ga0068861_101521615 | Ga0068861_1015216151 | 125 |
| 391 | 3300005834 | Ga0068851_10153838 | Ga0068851_101538382 | 125 |
| 392 | 3300005840 | Ga0068870_10002377 | Ga0068870_100023775 | 125 |
| 393 | 3300005841 | Ga0068863_100334496 | Ga0068863_1003344963 | 125 |
| 394 | 3300005841 | Ga0068863_100351346 | Ga0068863_1003513462 | 125 |
| 395 | 3300005841 | Ga0068863_100389505 | Ga0068863_1003895053 | 125 |
| 396 | 3300005841 | Ga0068863_101499214 | Ga0068863_1014992141 | 125 |
| 397 | 3300005843 | Ga0068860_100089660 | Ga0068860_1000896604 | 125 |
| 398 | 3300005844 | Ga0068862_101048855 | Ga0068862_1010488551 | 125 |
| 399 | 3300005981 | Ga0081538_10005557 | Ga0081538_100055577 | 125 |
| 400 | 3300005981 | Ga0081538_10025517 | Ga0081538_100255176 | 125 |
| 401 | 3300005985 | Ga0081539_10000072 | Ga0081539_1000007225 | 125 |
| 402 | 3300005985 | Ga0081539_10004359 | Ga0081539_1000435927 | 125 |
| 403 | 3300006195 | Ga0075366_10113191 | Ga0075366_101131914 | 125 |
| 404 | 3300006237 | Ga0097621_100011986 | Ga0097621_1000119866 | 125 |
| 405 | 3300006237 | Ga0097621_100119649 | Ga0097621_1001196494 | 125 |
| 406 | 3300006237 | Ga0097621_101027592 | Ga0097621_1010275922 | 125 |
| 407 | 3300006237 | Ga0097621_101121116 | Ga0097621_1011211162 | 125 |
| 408 | 3300006844 | Ga0075428_100644896 | Ga0075428_1006448962 | 125 |
| 409 | 3300006846 | Ga0075430_100300743 | Ga0075430_1003007433 | 125 |
| 410 | 3300006852 | Ga0075433_10015274 | Ga0075433_100152742 | 125 |
| 411 | 3300006852 | Ga0075433_10016739 | Ga0075433_100167391 | 125 |
| 412 | 3300006871 | Ga0075434_100039407 | Ga0075434_1000394074 | 125 |
| 413 | 3300006871 | Ga0075434_100562457 | Ga0075434_1005624572 | 125 |
| 414 | 3300006871 | Ga0075434_102012433 | Ga0075434_1020124332 | 125 |
| 415 | 3300006880 | Ga0075429_100817737 | Ga0075429_1008177371 | 125 |
| 416 | 3300006881 | Ga0068865_101432084 | Ga0068865_1014320842 | 125 |
| 417 | 3300006931 | Ga0097620_100058548 | Ga0097620_1000585483 | 125 |
| 418 | 3300006931 | Ga0097620_100068093 | Ga0097620_1000680935 | 125 |
| 419 | 3300006931 | Ga0097620_100674757 | Ga0097620_1006747572 | 125 |
| 420 | 3300006931 | Ga0097620_100980998 | Ga0097620_1009809982 | 125 |
| 421 | 3300006931 | Ga0097620_102123909 | Ga0097620_1021239091 | 125 |
| 422 | 3300009093 | Ga0105240_10775736 | Ga0105240_107757362 | 125 |
| 423 | 3300009094 | Ga0111539_10041238 | Ga0111539_100412386 | 125 |
| 424 | 3300009094 | Ga0111539_11571081 | Ga0111539_115710812 | 125 |
| 425 | 3300009147 | Ga0114129_10006513 | Ga0114129_1000651317 | 125 |
| 426 | 3300009147 | Ga0114129_10032401 | Ga0114129_1003240113 | 125 |
| 427 | 3300009147 | Ga0114129_10291592 | Ga0114129_102915923 | 125 |
| 428 | 3300009147 | Ga0114129_10304184 | Ga0114129_103041841 | 125 |
| 429 | 3300009147 | Ga0114129_10659542 | Ga0114129_106595421 | 125 |
| 430 | 3300009147 | Ga0114129_11020356 | Ga0114129_110203561 | 125 |
| 431 | 3300009147 | Ga0114129_11739705 | Ga0114129_117397052 | 125 |
| 432 | 3300009148 | Ga0105243_10295437 | Ga0105243_102954372 | 125 |
| 433 | 3300009148 | Ga0105243_10686561 | Ga0105243_106865612 | 125 |
| 434 | 3300009174 | Ga0105241_11925681 | Ga0105241_119256811 | 125 |
| 435 | 3300009176 | Ga0105242_10011746 | Ga0105242_100117464 | 125 |
| 436 | 3300009176 | Ga0105242_12762276 | Ga0105242_127622761 | 125 |
| 437 | 3300009177 | Ga0105248_10437935 | Ga0105248_104379352 | 125 |
| 438 | 3300009553 | Ga0105249_10500340 | Ga0105249_105003403 | 125 |
| 439 | 3300009553 | Ga0105249_12324716 | Ga0105249_123247162 | 125 |
| 440 | 3300009553 | Ga0105249_12863410 | Ga0105249_128634101 | 125 |
| 441 | 3300011119 | Ga0105246_10328381 | Ga0105246_103283812 | 125 |
| 442 | 3300011119 | Ga0105246_10339176 | Ga0105246_103391761 | 125 |
| 443 | 3300012506 | Ga0157324_1038710 | Ga0157324_10387101 | 125 |
| 444 | 3300013100 | Ga0157373_10307442 | Ga0157373_103074421 | 125 |
| 445 | 3300013102 | Ga0157371_10668166 | Ga0157371_106681661 | 125 |
| 446 | 3300013105 | Ga0157369_10900785 | Ga0157369_109007852 | 125 |
| 447 | 3300013296 | Ga0157374_10130270 | Ga0157374_101302704 | 125 |
| 448 | 3300013296 | Ga0157374_10171084 | Ga0157374_101710841 | 125 |
| 449 | 3300013296 | Ga0157374_11283256 | Ga0157374_112832562 | 125 |
| 450 | 3300013297 | Ga0157378_10094032 | Ga0157378_100940323 | 125 |
| 451 | 3300013297 | Ga0157378_10250264 | Ga0157378_102502641 | 125 |
| 452 | 3300013297 | Ga0157378_10643767 | Ga0157378_106437672 | 125 |
| 453 | 3300013297 | Ga0157378_11455173 | Ga0157378_114551731 | 125 |
| 454 | 3300013297 | Ga0157378_11674727 | Ga0157378_116747272 | 125 |
| 455 | 3300013306 | Ga0163162_10038469 | Ga0163162_100384694 | 125 |
| 456 | 3300013306 | Ga0163162_10184062 | Ga0163162_101840621 | 125 |
| 457 | 3300013306 | Ga0163162_10242652 | Ga0163162_102426523 | 125 |
| 458 | 3300013306 | Ga0163162_10682823 | Ga0163162_106828232 | 125 |
| 459 | 3300013306 | Ga0163162_12136836 | Ga0163162_121368361 | 125 |
| 460 | 3300013307 | Ga0157372_10160060 | Ga0157372_101600604 | 125 |
| 461 | 3300013307 | Ga0157372_10226498 | Ga0157372_102264982 | 125 |
| 462 | 3300013307 | Ga0157372_10689465 | Ga0157372_106894653 | 125 |
| 463 | 3300013308 | Ga0157375_10143967 | Ga0157375_101439671 | 125 |
| 464 | 3300013308 | Ga0157375_10280603 | Ga0157375_102806033 | 125 |
| 465 | 3300014325 | Ga0163163_10276709 | Ga0163163_102767093 | 125 |
| 466 | 3300014325 | Ga0163163_11217941 | Ga0163163_112179411 | 125 |
| 467 | 3300014325 | Ga0163163_11454181 | Ga0163163_114541811 | 125 |
| 468 | 3300014326 | Ga0157380_10004578 | Ga0157380_1000457810 | 125 |
| 469 | 3300014326 | Ga0157380_10082084 | Ga0157380_100820844 | 125 |
| 470 | 3300014326 | Ga0157380_10350663 | Ga0157380_103506632 | 125 |
| 471 | 3300014326 | Ga0157380_10989690 | Ga0157380_109896902 | 125 |
| 472 | 3300014326 | Ga0157380_11251326 | Ga0157380_112513262 | 125 |
| 473 | 3300014326 | Ga0157380_11465959 | Ga0157380_114659592 | 125 |
| 474 | 3300014326 | Ga0157380_11508863 | Ga0157380_115088631 | 125 |
| 475 | 3300014745 | Ga0157377_10867265 | Ga0157377_108672651 | 125 |
| 476 | 3300014745 | Ga0157377_11093103 | Ga0157377_110931031 | 125 |
| 477 | 3300014969 | Ga0157376_10332507 | Ga0157376_103325071 | 125 |
| 478 | 3300017792 | Ga0163161_10519792 | Ga0163161_105197922 | 125 |
| 479 | 3300020069 | Ga0197907_10166582 | Ga0197907_101665823 | 125 |
| 480 | 3300020069 | Ga0197907_10544785 | Ga0197907_105447851 | 125 |
| 481 | 3300020069 | Ga0197907_10643572 | Ga0197907_106435723 | 125 |
| 482 | 3300020069 | Ga0197907_10684168 | Ga0197907_106841681 | 125 |
| 483 | 3300020069 | Ga0197907_11002581 | Ga0197907_110025813 | 125 |
| 484 | 3300020069 | Ga0197907_11115412 | Ga0197907_111154122 | 125 |
| 485 | 3300020069 | Ga0197907_11171440 | Ga0197907_111714402 | 125 |
| 486 | 3300020069 | Ga0197907_11347398 | Ga0197907_113473982 | 125 |
| 487 | 3300020070 | Ga0206356_10029991 | Ga0206356_100299913 | 125 |
| 488 | 3300020070 | Ga0206356_10393104 | Ga0206356_103931042 | 125 |
| 489 | 3300020070 | Ga0206356_10527780 | Ga0206356_105277802 | 125 |
| 490 | 3300020070 | Ga0206356_10589241 | Ga0206356_105892412 | 125 |
| 491 | 3300020070 | Ga0206356_11184870 | Ga0206356_111848702 | 125 |
| 492 | 3300020070 | Ga0206356_11465735 | Ga0206356_114657352 | 125 |
| 493 | 3300020070 | Ga0206356_11475959 | Ga0206356_114759591 | 125 |
| 494 | 3300020070 | Ga0206356_11723060 | Ga0206356_117230601 | 125 |
| 495 | 3300020075 | Ga0206349_1149751 | Ga0206349_11497512 | 125 |
| 496 | 3300020075 | Ga0206349_1306057 | Ga0206349_13060571 | 125 |
| 497 | 3300020075 | Ga0206349_1416863 | Ga0206349_14168633 | 125 |
| 498 | 3300020075 | Ga0206349_1428736 | Ga0206349_14287363 | 125 |
| 499 | 3300020075 | Ga0206349_1451067 | Ga0206349_14510671 | 125 |
| 500 | 3300020075 | Ga0206349_1547646 | Ga0206349_15476461 | 125 |
| 501 | 3300020075 | Ga0206349_1630809 | Ga0206349_16308094 | 125 |
| 502 | 3300020075 | Ga0206349_1746519 | Ga0206349_17465192 | 125 |
| 503 | 3300020076 | Ga0206355_1023074 | Ga0206355_10230743 | 125 |
| 504 | 3300020076 | Ga0206355_1525315 | Ga0206355_15253152 | 125 |
| 505 | 3300020076 | Ga0206355_1716015 | Ga0206355_17160152 | 125 |
| 506 | 3300020077 | Ga0206351_10122949 | Ga0206351_101229492 | 125 |
| 507 | 3300020077 | Ga0206351_10168106 | Ga0206351_101681063 | 125 |
| 508 | 3300020077 | Ga0206351_10458947 | Ga0206351_104589472 | 125 |
| 509 | 3300020077 | Ga0206351_10693876 | Ga0206351_106938761 | 125 |
| 510 | 3300020077 | Ga0206351_10913767 | Ga0206351_109137673 | 125 |
| 511 | 3300020078 | Ga0206352_10519505 | Ga0206352_105195051 | 125 |
| 512 | 3300020078 | Ga0206352_10636518 | Ga0206352_106365182 | 125 |
| 513 | 3300020078 | Ga0206352_10752522 | Ga0206352_107525222 | 125 |
| 514 | 3300020078 | Ga0206352_11134617 | Ga0206352_111346173 | 125 |
| 515 | 3300020078 | Ga0206352_11154477 | Ga0206352_111544771 | 125 |
| 516 | 3300020078 | Ga0206352_11339826 | Ga0206352_113398263 | 125 |
| 517 | 3300020080 | Ga0206350_10235783 | Ga0206350_102357832 | 125 |
| 518 | 3300020080 | Ga0206350_10358460 | Ga0206350_103584602 | 125 |
| 519 | 3300020080 | Ga0206350_10692694 | Ga0206350_106926942 | 125 |
| 520 | 3300020080 | Ga0206350_10805923 | Ga0206350_108059233 | 125 |
| 521 | 3300020080 | Ga0206350_11476777 | Ga0206350_114767773 | 125 |
| 522 | 3300020081 | Ga0206354_10365710 | Ga0206354_103657103 | 125 |
| 523 | 3300020081 | Ga0206354_10736349 | Ga0206354_107363495 | 125 |
| 524 | 3300020081 | Ga0206354_10803466 | Ga0206354_108034662 | 125 |
| 525 | 3300020081 | Ga0206354_10843853 | Ga0206354_108438532 | 125 |
| 526 | 3300020081 | Ga0206354_11078476 | Ga0206354_110784762 | 125 |
| 527 | 3300020081 | Ga0206354_11311334 | Ga0206354_113113342 | 125 |
| 528 | 3300020081 | Ga0206354_11618312 | Ga0206354_116183122 | 125 |
| 529 | 3300020082 | Ga0206353_10011578 | Ga0206353_100115782 | 125 |
| 530 | 3300020082 | Ga0206353_10034385 | Ga0206353_100343851 | 125 |
| 531 | 3300020082 | Ga0206353_11236968 | Ga0206353_112369682 | 125 |
| 532 | 3300020082 | Ga0206353_11328929 | Ga0206353_113289292 | 125 |
| 533 | 3300020082 | Ga0206353_12033233 | Ga0206353_120332333 | 125 |
| 534 | 3300020610 | Ga0154015_1137626 | Ga0154015_11376261 | 125 |
| 535 | 3300021388 | Ga0213875_10022465 | Ga0213875_100224653 | 125 |
| 536 | 3300021388 | Ga0213875_10025319 | Ga0213875_100253194 | 125 |
| 537 | 3300021388 | Ga0213875_10515005 | Ga0213875_105150051 | 125 |
| 538 | 3300021441 | Ga0213871_10053535 | Ga0213871_100535352 | 125 |
| 539 | 3300022467 | Ga0224712_10000389 | Ga0224712_100003892 | 125 |
| 540 | 3300022467 | Ga0224712_10001802 | Ga0224712_100018026 | 125 |
| 541 | 3300022467 | Ga0224712_10086997 | Ga0224712_100869972 | 125 |
| 542 | 3300022467 | Ga0224712_10092846 | Ga0224712_100928463 | 125 |
| 543 | 3300022467 | Ga0224712_10184076 | Ga0224712_101840762 | 125 |
| 544 | 3300022467 | Ga0224712_10471685 | Ga0224712_104716851 | 125 |
| 545 | 3300022467 | Ga0224712_10689410 | Ga0224712_106894101 | 125 |
| 546 | 3300025893 | Ga0207682_10034095 | Ga0207682_100340952 | 125 |
| 547 | 3300025899 | Ga0207642_10161529 | Ga0207642_101615292 | 125 |
| 548 | 3300025901 | Ga0207688_10020657 | Ga0207688_100206575 | 125 |
| 549 | 3300025903 | Ga0207680_10013559 | Ga0207680_100135594 | 125 |
| 550 | 3300025907 | Ga0207645_10000354 | Ga0207645_1000035418 | 125 |
| 551 | 3300025907 | Ga0207645_10005100 | Ga0207645_100051003 | 125 |
| 552 | 3300025908 | Ga0207643_10005287 | Ga0207643_100052877 | 125 |
| 553 | 3300025909 | Ga0207705_10380852 | Ga0207705_103808521 | 125 |
| 554 | 3300025909 | Ga0207705_11169708 | Ga0207705_111697081 | 125 |
| 555 | 3300025910 | Ga0207684_10059589 | Ga0207684_100595894 | 125 |
| 556 | 3300025910 | Ga0207684_10785242 | Ga0207684_107852421 | 125 |
| 557 | 3300025912 | Ga0207707_10037560 | Ga0207707_100375606 | 125 |
| 558 | 3300025913 | Ga0207695_10466604 | Ga0207695_104666042 | 125 |
| 559 | 3300025914 | Ga0207671_10928472 | Ga0207671_109284721 | 125 |
| 560 | 3300025918 | Ga0207662_10084359 | Ga0207662_100843594 | 125 |
| 561 | 3300025920 | Ga0207649_11219873 | Ga0207649_112198731 | 125 |
| 562 | 3300025921 | Ga0207652_10343020 | Ga0207652_103430203 | 125 |
| 563 | 3300025922 | Ga0207646_10343928 | Ga0207646_103439283 | 125 |
| 564 | 3300025922 | Ga0207646_10661806 | Ga0207646_106618062 | 125 |
| 565 | 3300025923 | Ga0207681_10157824 | Ga0207681_101578243 | 125 |
| 566 | 3300025923 | Ga0207681_10212848 | Ga0207681_102128483 | 125 |
| 567 | 3300025925 | Ga0207650_10127944 | Ga0207650_101279444 | 125 |
| 568 | 3300025925 | Ga0207650_10767795 | Ga0207650_107677952 | 125 |
| 569 | 3300025926 | Ga0207659_10016365 | Ga0207659_100163657 | 125 |
| 570 | 3300025926 | Ga0207659_10150503 | Ga0207659_101505032 | 125 |
| 571 | 3300025927 | Ga0207687_10388270 | Ga0207687_103882703 | 125 |
| 572 | 3300025928 | Ga0207700_10006673 | Ga0207700_100066733 | 125 |
| 573 | 3300025928 | Ga0207700_11437110 | Ga0207700_114371102 | 125 |
| 574 | 3300025929 | Ga0207664_10003417 | Ga0207664_1000341711 | 125 |
| 575 | 3300025931 | Ga0207644_10273141 | Ga0207644_102731412 | 125 |
| 576 | 3300025933 | Ga0207706_10108625 | Ga0207706_101086254 | 125 |
| 577 | 3300025933 | Ga0207706_10145637 | Ga0207706_101456371 | 125 |
| 578 | 3300025934 | Ga0207686_11424028 | Ga0207686_114240281 | 125 |
| 579 | 3300025935 | Ga0207709_10211916 | Ga0207709_102119162 | 125 |
| 580 | 3300025935 | Ga0207709_10699968 | Ga0207709_106999682 | 125 |
| 581 | 3300025936 | Ga0207670_11634489 | Ga0207670_116344891 | 125 |
| 582 | 3300025937 | Ga0207669_11698326 | Ga0207669_116983261 | 125 |
| 583 | 3300025937 | Ga0207669_11869443 | Ga0207669_118694431 | 125 |
| 584 | 3300025940 | Ga0207691_10048624 | Ga0207691_100486245 | 125 |
| 585 | 3300025940 | Ga0207691_10353298 | Ga0207691_103532983 | 125 |
| 586 | 3300025940 | Ga0207691_11653908 | Ga0207691_116539081 | 125 |
| 587 | 3300025942 | Ga0207689_10026074 | Ga0207689_100260744 | 125 |
| 588 | 3300025942 | Ga0207689_10062686 | Ga0207689_100626864 | 125 |
| 589 | 3300025944 | Ga0207661_10000901 | Ga0207661_100009014 | 125 |
| 590 | 3300025944 | Ga0207661_10302056 | Ga0207661_103020563 | 125 |
| 591 | 3300025944 | Ga0207661_10820742 | Ga0207661_108207422 | 125 |
| 592 | 3300025944 | Ga0207661_11921319 | Ga0207661_119213191 | 125 |
| 593 | 3300025960 | Ga0207651_10003788 | Ga0207651_100037884 | 125 |
| 594 | 3300025960 | Ga0207651_10122057 | Ga0207651_101220573 | 125 |
| 595 | 3300025961 | Ga0207712_10152649 | Ga0207712_101526492 | 125 |
| 596 | 3300025981 | Ga0207640_10012564 | Ga0207640_100125647 | 125 |
| 597 | 3300025981 | Ga0207640_11581856 | Ga0207640_115818561 | 125 |
| 598 | 3300026023 | Ga0207677_10012528 | Ga0207677_100125282 | 125 |
| 599 | 3300026023 | Ga0207677_10066707 | Ga0207677_100667074 | 125 |
| 600 | 3300026023 | Ga0207677_10712461 | Ga0207677_107124612 | 125 |
| 601 | 3300026067 | Ga0207678_10520767 | Ga0207678_105207672 | 125 |
| 602 | 3300026067 | Ga0207678_10936204 | Ga0207678_109362041 | 125 |
| 603 | 3300026075 | Ga0207708_10083471 | Ga0207708_100834711 | 125 |
| 604 | 3300026075 | Ga0207708_10476064 | Ga0207708_104760642 | 125 |
| 605 | 3300026075 | Ga0207708_11658662 | Ga0207708_116586621 | 125 |
| 606 | 3300026078 | Ga0207702_10005948 | Ga0207702_1000594814 | 125 |
| 607 | 3300026078 | Ga0207702_12383049 | Ga0207702_123830491 | 125 |
| 608 | 3300026088 | Ga0207641_10045565 | Ga0207641_100455654 | 125 |
| 609 | 3300026088 | Ga0207641_10332071 | Ga0207641_103320712 | 125 |
| 610 | 3300026088 | Ga0207641_11045234 | Ga0207641_110452341 | 125 |
| 611 | 3300026088 | Ga0207641_11740028 | Ga0207641_117400281 | 125 |
| 612 | 3300026089 | Ga0207648_10000404 | Ga0207648_1000040423 | 125 |
| 613 | 3300026089 | Ga0207648_10032257 | Ga0207648_100322572 | 125 |
| 614 | 3300026089 | Ga0207648_10419092 | Ga0207648_104190924 | 125 |
| 615 | 3300026116 | Ga0207674_10003661 | Ga0207674_1000366129 | 125 |
| 616 | 3300026116 | Ga0207674_10116450 | Ga0207674_101164504 | 125 |
| 617 | 3300026116 | Ga0207674_10160041 | Ga0207674_101600412 | 125 |
| 618 | 3300026118 | Ga0207675_100124672 | Ga0207675_1001246724 | 125 |
| 619 | 3300026118 | Ga0207675_100562955 | Ga0207675_1005629552 | 125 |
| 620 | 3300026118 | Ga0207675_101523636 | Ga0207675_1015236361 | 125 |
| 621 | 3300026121 | Ga0207683_10003746 | Ga0207683_100037462 | 125 |
| 622 | 3300026121 | Ga0207683_10032516 | Ga0207683_100325165 | 125 |
| 623 | 3300026121 | Ga0207683_11326396 | Ga0207683_113263961 | 125 |
| 624 | 3300027695 | Ga0209966_1040538 | Ga0209966_10405383 | 125 |
| 625 | 3300028379 | Ga0268266_10768529 | Ga0268266_107685291 | 125 |
| 626 | 3300028380 | Ga0268265_10150746 | Ga0268265_101507461 | 125 |
| 627 | 3300028380 | Ga0268265_10501408 | Ga0268265_105014081 | 125 |
| 628 | 3300028380 | Ga0268265_10672792 | Ga0268265_106727922 | 125 |
| 629 | 3300028381 | Ga0268264_10090125 | Ga0268264_100901254 | 125 |
| 630 | 3300028381 | Ga0268264_10870715 | Ga0268264_108707152 | 125 |
| 631 | 3300028381 | Ga0268264_12615061 | Ga0268264_126150612 | 125 |
| 632 | 3300029277 | Ga0311001_1072227 | Ga0311001_10722272 | 125 |
| 633 | 3300031090 | Ga0265760_10101364 | Ga0265760_101013642 | 125 |
| 634 | 3300031235 | Ga0265330_10000095 | Ga0265330_1000009521 | 125 |
| 635 | 3300031235 | Ga0265330_10079062 | Ga0265330_100790622 | 125 |
| 636 | 3300031235 | Ga0265330_10217746 | Ga0265330_102177461 | 125 |
| 637 | 3300031238 | Ga0265332_10000222 | Ga0265332_1000022227 | 125 |
| 638 | 3300031239 | Ga0265328_10022244 | Ga0265328_100222445 | 125 |
| 639 | 3300031239 | Ga0265328_10213498 | Ga0265328_102134982 | 125 |
| 640 | 3300031240 | Ga0265320_10085198 | Ga0265320_100851982 | 125 |
| 641 | 3300031241 | Ga0265325_10383069 | Ga0265325_103830692 | 125 |
| 642 | 3300031242 | Ga0265329_10005084 | Ga0265329_100050844 | 125 |
| 643 | 3300031249 | Ga0265339_10013550 | Ga0265339_100135505 | 125 |
| 644 | 3300031249 | Ga0265339_10139822 | Ga0265339_101398222 | 125 |
| 645 | 3300031250 | Ga0265331_10090337 | Ga0265331_100903372 | 125 |
| 646 | 3300031250 | Ga0265331_10100609 | Ga0265331_101006092 | 125 |
| 647 | 3300031251 | Ga0265327_10057516 | Ga0265327_100575162 | 125 |
| 648 | 3300031344 | Ga0265316_10000450 | Ga0265316_1000045021 | 125 |
| 649 | 3300031344 | Ga0265316_10061578 | Ga0265316_100615784 | 125 |
| 650 | 3300031711 | Ga0265314_10000076 | Ga0265314_10000076113 | 125 |
| 651 | 3300031712 | Ga0265342_10000759 | Ga0265342_1000075920 | 125 |
| 652 | 3300031712 | Ga0265342_10031591 | Ga0265342_100315913 | 125 |
| 653 | 3300031731 | Ga0307405_10059631 | Ga0307405_100596313 | 125 |
| 654 | 3300031852 | Ga0307410_11184973 | Ga0307410_111849732 | 125 |
| 655 | 3300031903 | Ga0307407_11545976 | Ga0307407_115459761 | 125 |
| 656 | 3300031995 | Ga0307409_102478970 | Ga0307409_1024789701 | 125 |
| 657 | 3300031995 | Ga0307409_102909583 | Ga0307409_1029095831 | 125 |
| 658 | 3300032002 | Ga0307416_100197294 | Ga0307416_1001972941 | 125 |
| 659 | 3300032002 | Ga0307416_100938527 | Ga0307416_1009385273 | 125 |
| 660 | 3300032004 | Ga0307414_10941371 | Ga0307414_109413713 | 125 |
| 661 | 3300032005 | Ga0307411_12295821 | Ga0307411_122958211 | 125 |
| 662 | 3300035092 | Ga0373952_0028057 | Ga0373952_0028057_19_402 | 125 |
| 663 | 3300035117 | Ga0373953_0019614 | Ga0373953_0019614_1976_2356 | 125 |
| 664 | 3300035118 | Ga0373954_0068740 | Ga0373954_0068740_438_821 | 125 |
| 665 | 3300035118 | Ga0373954_0134894 | Ga0373954_0134894_118_498 | 125 |
| 666 | 3300035170 | Ga0373943_0059847 | Ga0373943_0059847_1316_1696 | 125 |
| 667 | 3300035172 | Ga0373955_0038216 | Ga0373955_0038216_1681_2064 | 125 |
| 668 | 3300035695 | Ga0373927_0150719 | Ga0373927_0150719_1088_1471 | 125 |
| 669 | 3300035725 | Ga0373947_0172282 | Ga0373947_0172282_227_610 | 125 |
| 670 | 3300035725 | Ga0373947_0209826 | Ga0373947_0209826_728_1108 | 125 |
| 671 | 3300036401 | Ga0373937_0044920 | Ga0373937_0044920_2945_3328 | 125 |
| 672 | 3300036401 | Ga0373937_0091557 | Ga0373937_0091557_1453_1833 | 125 |
| 673 | 3300036457 | Ga0265778_020976 | Ga0265778_020976_366_773 | 125 |
| 674 | 3300036647 | Ga0316582_0006998 | Ga0316582_0006998_4367_4756 | 125 |
| 675 | 3300036712 | Ga0316584_0154220 | Ga0316584_0154220_736_1119 | 125 |
| 676 | 3300037312 | Ga0395899_0274789 | Ga0395899_0274789_729_1109 | 125 |
| 677 | 3300037418 | Ga0395900_0388831 | Ga0395900_0388831_951_1331 | 125 |
| 678 | 3300037418 | Ga0395900_0455995 | Ga0395900_0455995_562_942 | 125 |
| 679 | 3300037418 | Ga0395900_0960706 | Ga0395900_0960706_223_603 | 125 |
| 680 | 3300037466 | Ga0395898_0091988 | Ga0395898_0091988_1367_1747 | 125 |
| 681 | 3300037466 | Ga0395898_1838539 | Ga0395898_1838539_134_514 | 125 |
| 682 | 3300037471 | Ga0395905_0103220 | Ga0395905_0103220_1164_1544 | 125 |
| 683 | 3300037471 | Ga0395905_0204218 | Ga0395905_0204218_1202_1582 | 125 |
| 684 | 3300037471 | Ga0395905_1052154 | Ga0395905_1052154_32_421 | 125 |
| 685 | 3300037853 | Ga0436364_0038835 | Ga0436364_0038835_69_446 | 125 |
| 686 | 3300037853 | Ga0436364_0542577 | Ga0436364_0542577_1088_1465 | 125 |
| 687 | 3300037853 | Ga0436364_0586291 | Ga0436364_0586291_12099_12476 | 125 |
| 688 | 3300037853 | Ga0436364_0723678 | Ga0436364_0723678_184_567 | 125 |
| 689 | 3300037853 | Ga0436364_1015141 | Ga0436364_1015141_236_619 | 125 |
| 690 | 3300037853 | Ga0436364_1062354 | Ga0436364_1062354_10865_11242 | 125 |
| 691 | 3300038443 | Ga0395901_0247269 | Ga0395901_0247269_712_1092 | 125 |
| 692 | 3300039447 | Ga0436361_0744057 | Ga0436361_0744057_204_590 | 125 |
| 693 | 3300039450 | Ga0436363_0954681 | Ga0436363_0954681_512_889 | 125 |
| 694 | 3300039453 | Ga0436362_0046115 | Ga0436362_0046115_325_702 | 125 |
| 695 | 3300041404 | Ga0439436_0066327 | Ga0439436_0066327_606_983 | 125 |
| 696 | 3300041459 | Ga0451800_0119921 | Ga0451800_0119921_69_449 | 125 |
| 697 | 3300041459 | Ga0451800_1330059 | Ga0451800_1330059_199_576 | 125 |
| 698 | 3300041492 | Ga0451835_0366974 | Ga0451835_0366974_310_690 | 125 |
| 699 | 3300042876 | Ga0451577_0000019 | Ga0451577_0000019_215964_216350 | 125 |
| 700 | 3300042876 | Ga0451577_0061839 | Ga0451577_0061839_2460_2837 | 125 |
| 701 | 3300044658 | Ga0466972_0002629 | Ga0466972_0002629_160_543 | 125 |
| 702 | 3300044683 | Ga0466965_0001564 | Ga0466965_0001564_7136_7519 | 125 |
| 703 | 3300044712 | Ga0453684_0000057 | Ga0453684_0000057_215887_216273 | 125 |
| 704 | 3300044712 | Ga0453684_0156006 | Ga0453684_0156006_1312_1689 | 125 |
| 705 | 3300044735 | Ga0466968_0002295 | Ga0466968_0002295_5833_6216 | 125 |
| 706 | 3300044842 | Ga0466957_0880361 | Ga0466957_0880361_64_441 | 125 |
| 707 | 3300044901 | Ga0466960_0002825 | Ga0466960_0002825_2439_2822 | 125 |
| 708 | 3300044901 | Ga0466960_0394739 | Ga0466960_0394739_31_411 | 125 |
| 709 | 3300045051 | Ga0451576_1100021 | Ga0451576_1100021_191_592 | 125 |
| 710 | 3300045976 | Ga0466967_1249565 | Ga0466967_1249565_284_661 | 125 |
| 711 | 3300046454 | Ga0495592_0537949 | Ga0495592_0537949_157_537 | 125 |
| 712 | 3300046455 | Ga0495603_0005689 | Ga0495603_0005689_5107_5487 | 125 |
| 713 | 3300046455 | Ga0495603_0193439 | Ga0495603_0193439_490_867 | 125 |
| 714 | 3300046459 | Ga0495629_0029349 | Ga0495629_0029349_2686_3069 | 125 |
| 715 | 3300046462 | Ga0495651_0525655 | Ga0495651_0525655_131_514 | 125 |
| 716 | 3300046472 | Ga0495580_0904300 | Ga0495580_0904300_66_449 | 125 |
| 717 | 3300046473 | Ga0495582_0157785 | Ga0495582_0157785_271_654 | 125 |
| 718 | 3300046499 | Ga0495594_0043083 | Ga0495594_0043083_556_936 | 125 |
| 719 | 3300046499 | Ga0495594_0577990 | Ga0495594_0577990_169_546 | 125 |
| 720 | 3300046514 | Ga0495618_0089037 | Ga0495618_0089037_1483_1866 | 125 |
| 721 | 3300046516 | Ga0495628_0321700 | Ga0495628_0321700_710_1090 | 125 |
| 722 | 3300046529 | Ga0495652_0287641 | Ga0495652_0287641_249_629 | 125 |
| 723 | 3300046533 | Ga0495640_0110798 | Ga0495640_0110798_992_1375 | 125 |
| 724 | 3300046535 | Ga0495586_0117684 | Ga0495586_0117684_657_1034 | 125 |
| 725 | 3300046539 | Ga0495621_0390177 | Ga0495621_0390177_138_521 | 125 |
| 726 | 3300046558 | Ga0495633_0022320 | Ga0495633_0022320_1904_2287 | 125 |
| 727 | 3300046642 | Ga0495634_0205649 | Ga0495634_0205649_553_936 | 125 |
| 728 | 3300046663 | Ga0495635_0060120 | Ga0495635_0060120_220_603 | 125 |
| 729 | 3300046678 | Ga0495599_0156792 | Ga0495599_0156792_669_1052 | 125 |
| 730 | 3300046681 | Ga0495647_0008157 | Ga0495647_0008157_2546_2929 | 125 |
| 731 | 3300046683 | Ga0495658_0012542 | Ga0495658_0012542_858_1241 | 125 |
| 732 | 3300046689 | Ga0495613_0098089 | Ga0495613_0098089_999_1382 | 125 |
| 733 | 3300046690 | Ga0495624_0087620 | Ga0495624_0087620_1061_1444 | 125 |
| 734 | 3300046690 | Ga0495624_0426636 | Ga0495624_0426636_146_523 | 125 |
| 735 | 3300046691 | Ga0495670_0657067 | Ga0495670_0657067_154_537 | 125 |
| 736 | 3300047317 | Ga0495604_0019157 | Ga0495604_0019157_648_1031 | 125 |
| 737 | 3300047319 | Ga0495674_0096904 | Ga0495674_0096904_1549_1929 | 125 |
| 738 | 3300047319 | Ga0495674_0411249 | Ga0495674_0411249_43_426 | 125 |
| 739 | 3300047321 | Ga0495676_0151455 | Ga0495676_0151455_641_1021 | 125 |
| 740 | 3300047322 | Ga0495680_0046852 | Ga0495680_0046852_416_799 | 125 |
| 741 | 3300047472 | Ga0495686_0067257 | Ga0495686_0067257_1457_1837 | 125 |
| 742 | 3300047472 | Ga0495686_0263851 | Ga0495686_0263851_204_584 | 125 |
| 743 | 3300048088 | Ga0495602_0189428 | Ga0495602_0189428_369_752 | 125 |
| 744 | 3300048907 | Ga0496104_0347694 | Ga0496104_0347694_559_939 | 125 |
| 745 | 3300048908 | Ga0496105_0156031 | Ga0496105_0156031_929_1309 | 125 |
| 746 | 3300048908 | Ga0496105_0551172 | Ga0496105_0551172_167_550 | 125 |
| 747 | 3300048911 | Ga0496108_0000307 | Ga0496108_0000307_27222_27605 | 125 |
| 748 | 3300048912 | Ga0496109_0272562 | Ga0496109_0272562_835_1215 | 125 |
| 749 | 3300048913 | Ga0496110_0019020 | Ga0496110_0019020_3814_4197 | 125 |
| 750 | 3300048913 | Ga0496110_0119314 | Ga0496110_0119314_836_1216 | 125 |
| 751 | 3300048914 | Ga0496111_0008255 | Ga0496111_0008255_3372_3752 | 125 |
| 752 | 3300048915 | Ga0496112_0005660 | Ga0496112_0005660_5900_6280 | 125 |
| 753 | 3300048915 | Ga0496112_0689434 | Ga0496112_0689434_410_787 | 125 |
| 754 | 3300048920 | Ga0496117_0454488 | Ga0496117_0454488_93_470 | 125 |
| 755 | 3300048925 | Ga0496122_0002341 | Ga0496122_0002341_7171_7548 | 125 |
| 756 | 3300048925 | Ga0496122_0005147 | Ga0496122_0005147_14955_15335 | 125 |
| 757 | 3300048926 | Ga0496123_0002420 | Ga0496123_0002420_11382_11762 | 125 |
| 758 | 3300048926 | Ga0496123_0009053 | Ga0496123_0009053_2394_2771 | 125 |
| 759 | 3300048929 | Ga0496126_0174194 | Ga0496126_0174194_81_464 | 125 |
| 760 | 3300049129 | Ga0501309_012844 | Ga0501309_012844_578_958 | 125 |
| 761 | 3300049130 | Ga0501310_017694 | Ga0501310_017694_352_729 | 125 |
| 762 | 3300049161 | Ga0501305_047643 | Ga0501305_047643_296_694 | 125 |
| 763 | 3300049533 | Ga0501317_020275 | Ga0501317_020275_126_503 | 125 |
| 764 | 3300049533 | Ga0501317_037362 | Ga0501317_037362_128_505 | 125 |
| 765 | 3300049534 | Ga0501318_062526 | Ga0501318_062526_168_551 | 125 |
| 766 | 3300049537 | Ga0501321_030548 | Ga0501321_030548_154_531 | 125 |
| 767 | 3300049569 | Ga0501032_0751895 | Ga0501032_0751895_83_463 | 125 |
| 768 | 3300049571 | Ga0501034_0026488 | Ga0501034_0026488_1340_1723 | 125 |
| 769 | 3300049572 | Ga0501036_0897237 | Ga0501036_0897237_265_648 | 125 |
| 770 | 3300049576 | Ga0501040_0645958 | Ga0501040_0645958_342_728 | 125 |
| 771 | 3300049581 | Ga0501047_0089702 | Ga0501047_0089702_793_1209 | 125 |
| 772 | 3300049588 | Ga0501072_0205502 | Ga0501072_0205502_735_1157 | 125 |
| 773 | 3300049592 | Ga0501076_0513765 | Ga0501076_0513765_373_756 | 125 |
| 774 | 3300049593 | Ga0501077_0837610 | Ga0501077_0837610_119_502 | 125 |
| 775 | 3300049743 | Ga0501081_1422134 | Ga0501081_1422134_39_422 | 125 |
| 776 | 3300049823 | Ga0501044_1015666 | Ga0501044_1015666_204_593 | 125 |
| 777 | 3300050492 | nmdc:mga0yw44_290508_c1 | nmdc:mga0yw44_290508_c1_225_605 | 125 |
| 778 | 3300050493 | nmdc:mga0k408_107398_c1 | nmdc:mga0k408_107398_c1_308_688 | 125 |
| 779 | 3300050507 | nmdc:mga05p37_1249226_c1 | nmdc:mga05p37_1249226_c1_56_439 | 125 |
| 780 | 3300050507 | nmdc:mga05p37_1441101_c1 | nmdc:mga05p37_1441101_c1_260_637 | 125 |
| 781 | 3300050507 | nmdc:mga05p37_17560_c2 | nmdc:mga05p37_17560_c2_5600_5980 | 125 |
| 782 | 3300050507 | nmdc:mga05p37_178968_c1 | nmdc:mga05p37_178968_c1_2174_2557 | 125 |
| 783 | 3300050507 | nmdc:mga05p37_382254_c1 | nmdc:mga05p37_382254_c1_1042_1425 | 125 |
| 784 | 3300050507 | nmdc:mga05p37_892118_c1 | nmdc:mga05p37_892118_c1_323_709 | 125 |
| 785 | 3300050507 | nmdc:mga05p37_90847_c1 | nmdc:mga05p37_90847_c1_250_633 | 125 |
| 786 | 3300050508 | nmdc:mga09592_430858_c1 | nmdc:mga09592_430858_c1_450_833 | 125 |
| 787 | 3300050509 | nmdc:mga0qj67_179171_c1 | nmdc:mga0qj67_179171_c1_1127_1510 | 125 |
| 788 | 3300050510 | nmdc:mga06r32_580758_c1 | nmdc:mga06r32_580758_c1_639_1022 | 125 |
| 789 | 3300050511 | nmdc:mga08y16_124683_c1 | nmdc:mga08y16_124683_c1_389_772 | 125 |
| 790 | 3300050511 | nmdc:mga08y16_180934_c1 | nmdc:mga08y16_180934_c1_11_415 | 125 |
| 791 | 3300050512 | nmdc:mga0n895_1269968_c1 | nmdc:mga0n895_1269968_c1_294_677 | 125 |
| 792 | 3300050512 | nmdc:mga0n895_1430599_c1 | nmdc:mga0n895_1430599_c1_168_551 | 125 |
| 793 | 3300050512 | nmdc:mga0n895_1595338_c1 | nmdc:mga0n895_1595338_c1_14_439 | 125 |
| 794 | 3300050512 | nmdc:mga0n895_54944_c1 | nmdc:mga0n895_54944_c1_713_1096 | 125 |
| 795 | 3300050515 | nmdc:mga0a205_12817_c1 | nmdc:mga0a205_12817_c1_1801_2184 | 125 |
| 796 | 3300050515 | nmdc:mga0a205_18928_c2 | nmdc:mga0a205_18928_c2_511_894 | 125 |
| 797 | 3300050515 | nmdc:mga0a205_6280_c1 | nmdc:mga0a205_6280_c1_10108_10533 | 125 |
| 798 | 3300053077 | Ga0495601_0008491 | Ga0495601_0008491_4372_4755 | 125 |
| 799 | 3300053077 | Ga0495601_0082083 | Ga0495601_0082083_813_1193 | 125 |
| 800 | 3300053078 | Ga0495612_0000233 | Ga0495612_0000233_21155_21538 | 125 |
| 801 | 3300053078 | Ga0495612_0011527 | Ga0495612_0011527_1604_1984 | 125 |
| 802 | 3300053078 | Ga0495612_0157053 | Ga0495612_0157053_271_654 | 125 |
| 803 | 3300053083 | Ga0495655_0159737 | Ga0495655_0159737_65_445 | 125 |
| 804 | 3300053084 | Ga0495595_0014251 | Ga0495595_0014251_763_1146 | 125 |
| 805 | 3300053085 | Ga0495619_0005474 | Ga0495619_0005474_2733_3116 | 125 |
| 806 | 3300053087 | Ga0500643_000191 | Ga0500643_000191_54668_55048 | 125 |
| 807 | 3300053096 | Ga0500641_0030230 | Ga0500641_0030230_1373_1753 | 125 |
| 808 | 3300053104 | Ga0500556_0000020 | Ga0500556_0000020_161998_162378 | 125 |
| 809 | 3300053133 | Ga0500655_048641 | Ga0500655_048641_62_442 | 125 |
| 810 | 3300053139 | Ga0500568_0000038 | Ga0500568_0000038_40592_40972 | 125 |
| 811 | 3300053153 | Ga0500616_0000027 | Ga0500616_0000027_195542_195919 | 125 |
| 812 | 3300053730 | Ga0500645_005061 | Ga0500645_005061_1440_1817 | 125 |
| 813 | 3300053730 | Ga0500645_026457 | Ga0500645_026457_1110_1490 | 125 |
| 814 | 3300059478 | Ga0587093_015913 | Ga0587093_015913_456_839 | 125 |
| 815 | 3300059490 | Ga0587066_002759 | Ga0587066_002759_513_896 | 125 |
| 816 | 3300059491 | Ga0587070_019064 | Ga0587070_019064_645_1028 | 125 |
| 817 | 3300059491 | Ga0587070_066997 | Ga0587070_066997_244_627 | 125 |
| 818 | 3300059492 | Ga0587073_0026332 | Ga0587073_0026332_642_1025 | 125 |
| 819 | 3300059492 | Ga0587073_0084010 | Ga0587073_0084010_242_625 | 125 |
| 820 | 3300059493 | Ga0587077_003243 | Ga0587077_003243_610_990 | 125 |
| 821 | 3300059493 | Ga0587077_044456 | Ga0587077_044456_387_770 | 125 |
| 822 | 3300059503 | Ga0587080_016143 | Ga0587080_016143_188_571 | 125 |
| 823 | 3300059503 | Ga0587080_089312 | Ga0587080_089312_248_631 | 125 |
| 824 | 3300059503 | Ga0587080_177424 | Ga0587080_177424_55_432 | 125 |
| 825 | 3300059504 | Ga0587082_032406 | Ga0587082_032406_332_715 | 125 |
| 826 | 3300059505 | Ga0587083_0015179 | Ga0587083_0015179_458_841 | 125 |
| 827 | 3300059505 | Ga0587083_0186807 | Ga0587083_0186807_13_393 | 125 |
| 828 | 3300059507 | Ga0587086_049869 | Ga0587086_049869_86_469 | 125 |
| 829 | 3300059507 | Ga0587086_061409 | Ga0587086_061409_158_535 | 125 |
| 830 | 3300059508 | Ga0587088_012963 | Ga0587088_012963_645_1028 | 125 |
| 831 | 3300059508 | Ga0587088_199624 | Ga0587088_199624_87_470 | 125 |
| 832 | 3300059509 | Ga0587089_046604 | Ga0587089_046604_149_532 | 125 |
| 833 | 3300059510 | Ga0587090_073510 | Ga0587090_073510_111_494 | 125 |
| 834 | 3300059512 | Ga0587092_006243 | Ga0587092_006243_638_1021 | 125 |
| 835 | 3300059512 | Ga0587092_057007 | Ga0587092_057007_300_677 | 125 |
| 836 | 3300059513 | Ga0587094_027203 | Ga0587094_027203_195_572 | 125 |
| 837 | 3300059513 | Ga0587094_092591 | Ga0587094_092591_86_469 | 125 |
| 838 | 3300059604 | Ga0587098_009000 | Ga0587098_009000_123_506 | 125 |
| 839 | 3300059605 | Ga0587106_046852 | Ga0587106_046852_257_640 | 125 |
| 840 | 3300059623 | Ga0587101_084189 | Ga0587101_084189_61_438 | 125 |
| 841 | 3300059625 | Ga0587113_024120 | Ga0587113_024120_124_507 | 125 |
| 842 | 3300059626 | Ga0587115_037146 | Ga0587115_037146_151_534 | 125 |
| 843 | 3300059630 | Ga0587128_005709 | Ga0587128_005709_645_1028 | 125 |
| 844 | 3300059630 | Ga0587128_095202 | Ga0587128_095202_193_570 | 125 |
| 845 | 3300059631 | Ga0587130_006248 | Ga0587130_006248_190_573 | 125 |
| 846 | 3300059640 | Ga0587067_103291 | Ga0587067_103291_142_525 | 125 |
| 847 | 3300059641 | Ga0587068_000864 | Ga0587068_000864_671_1054 | 125 |
| 848 | 3300059644 | Ga0587075_015641 | Ga0587075_015641_546_929 | 125 |
| 849 | 3300059645 | Ga0587076_020316 | Ga0587076_020316_458_841 | 125 |
| 850 | 3300059646 | Ga0587078_006035 | Ga0587078_006035_528_911 | 125 |
| 851 | 3300059648 | Ga0587100_030992 | Ga0587100_030992_14_397 | 125 |
| 852 | 3300059652 | Ga0587107_024585 | Ga0587107_024585_391_774 | 125 |
| 853 | 3300059654 | Ga0587110_055651 | Ga0587110_055651_97_480 | 125 |
| 854 | 3300059655 | Ga0587114_079291 | Ga0587114_079291_144_527 | 125 |
| 855 | 3300060344 | Ga0587071_014646 | Ga0587071_014646_607_990 | 125 |
| 856 | 3300061719 | Ga0466962_0188423 | Ga0466962_0188423_192_575 | 125 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6zqf-assembly1.cif.gz_DS | cryo-em structure of the 90s pre-ribosome from saccharomyces cerevisiae, state dis-b (poly-ala) | 0.9593 | 3 | 61 |
| 6rbd-assembly1.cif.gz_S | state 1 of yeast tsr1-tap rps20-deltaloop pre-40s particles | 0.9273 | 3 | 61 |
| 7mqa-assembly1.cif.gz_L3 | cryo-em structure of the human ssu processome, state post-a1 | 0.9239 | 3 | 63 |
| 8d8l-assembly1.cif.gz_M | yeast mitochondrial small subunit assembly intermediate (state 3) | 0.9113 | 1 | 79 |
| 7qv3-assembly1.cif.gz_m | bacillus subtilis muts2-collided disome complex (muts2 conf.2; leading 70s) | 0.9104 | 3 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WH61_1_72_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9831 | 1 | 71 | 1.10.8.50 |
| af_Q8HCP0_1_71_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9817 | 1 | 70 | 1.10.8.50 |
| af_P54019_1_77_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9702 | 3 | 61 | 1.10.8.50 |
| af_O59772_1_70_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9699 | 1 | 70 | 1.10.8.50 |
| af_Q2FW30_1_70_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9674 | 1 | 70 | 1.10.8.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A833G026-F1-model_v4 | 30S ribosomal protein S13 | 1 | 1 | 75 |
GO:0003723
GO:0003735 GO:0005829 GO:0006412 GO:0015935 |
| AF-A0A4Q3GYA9-F1-model_v4 | deleted | 0.9984 | 1 | 75 |
|
| AF-A0A436DSH1-F1-model_v4 | 30S ribosomal protein S13 | 0.9939 | 1 | 68 |
GO:0003723
GO:0003735 GO:0005829 GO:0006412 GO:0015935 |
| AF-A0A661TSX6-F1-model_v4 | 30S ribosomal protein S13 | 0.9926 | 1 | 83 |
GO:0003723
GO:0003735 GO:0005829 GO:0006412 GO:0015935 |
| AF-A0A1Q6SSA2-F1-model_v4 | 30S ribosomal protein S13 | 0.9908 | 1 | 77 |
GO:0000049
GO:0003735 GO:0005829 GO:0006412 GO:0015935 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar