F483651

General Info

Members Datasets Scaffolds Average Seq Length
856 418 845 126

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100107244|Ga0070686_1001072443
Length 149
Sequence MRGRLIESLSRANEAVFNRENHMARIAGVDIPRNKKIEVSITYIFGIGAANGMVILKKANVNPSTRVRDLTEEEVGRIREVVDREYRVEGDLRREVQLNIKRLMDIACYRGLRHRKGMPVRGQRTRTNARTRRGRKGQAIGIKKKTAKK

Samples

Sample ID Description Type Environment
1 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
2 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
3 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
4 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
5 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
6 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
7 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
16 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
19 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
112 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
132 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
139 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
140 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
197 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
199 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
200 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
201 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
202 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
203 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
204 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
205 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
206 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
207 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
208 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
209 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
210 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
211 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
212 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
213 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
219 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
220 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
221 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
222 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
223 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
224 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
225 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
231 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
240 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
241 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
242 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
243 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
244 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
245 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
246 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
247 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
248 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
249 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
250 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
251 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
252 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
253 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
254 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
255 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
256 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
257 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
258 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
259 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
260 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
263 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
266 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
271 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
272 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
273 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
274 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
275 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
276 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
277 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
278 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
279 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
280 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
281 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
282 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
286 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
291 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
294 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
295 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
296 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
297 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
298 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
299 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
300 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
301 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
302 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
303 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
304 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
305 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
306 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
307 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
308 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
311 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
312 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
313 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
314 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
339 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
340 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
341 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
342 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
343 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
344 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
345 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
347 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
348 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
349 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
350 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
351 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
352 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
353 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
354 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
355 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
356 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
357 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
358 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
359 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
360 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
361 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
362 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
363 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
364 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
365 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
366 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
367 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
370 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
371 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
372 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
373 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
374 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
375 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
414 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
415 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
416 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
417 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
418 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 78.04
Metatranscriptomes 20.68
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.92
Nodule 0.23
Rhizoplane 3.86
Rhizosphere 88.55
Stem 0
Stem Tuber 0
Unclassified 4.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10005150 3300003203 Bacteria 6068
2 rootH1_10031668 3300003323 Bacteria 5520
3 JGI25407J50210_10009225 3300003373 Bacteria 2495
4 Ga0007417J51691_1058728 3300003544 Bacteria 819
5 Ga0007410J51695_1062137 3300003574 Bacteria 619
6 Ga0007409J51694_1055064 3300003575 Bacteria 1902
7 Ga0007409J51694_1071519 3300003575 Bacteria 539
8 Ga0007429J51699_1100314 3300003579 Bacteria 971
9 Ga0058859_10015336 3300004798 Bacteria 770
10 Ga0058859_11551370 3300004798 Bacteria 789
11 Ga0058859_11778114 3300004798 Bacteria 3341
12 Ga0058863_11594786 3300004799 Bacteria 835
13 Ga0058863_11945250 3300004799 Bacteria 2022
14 Ga0058861_10017791 3300004800 Bacteria 2438
15 Ga0058861_10648189 3300004800 Bacteria 838
16 Ga0058861_11220782 3300004800 Unclassified 1385
17 Ga0058860_10013830 3300004801 Bacteria 594
18 Ga0058860_10205765 3300004801 Bacteria 515
19 Ga0058860_12064927 3300004801 Bacteria 683
20 Ga0058860_12081306 3300004801 Bacteria 702
21 Ga0058862_10088370 3300004803 Bacteria 1230
22 Ga0058862_11852680 3300004803 Bacteria 2461
23 Ga0058862_12088318 3300004803 Bacteria 1428
24 Ga0058862_12231526 3300004803 Bacteria 594
25 Ga0058862_12481273 3300004803 Bacteria 5090
26 Ga0058862_12560532 3300004803 Bacteria 1232
27 Ga0058862_12561774 3300004803 Bacteria 652
28 Ga0058862_12761214 3300004803 Bacteria 991
29 Ga0058862_12854382 3300004803 Bacteria 1077
30 Ga0065704_10324636 3300005289 Bacteria 847
31 Ga0070658_10004878 3300005327 Bacteria 10928
32 Ga0070658_10204966 3300005327 Bacteria 1665
33 Ga0070658_10949111 3300005327 Bacteria 748
34 Ga0070683_100062110 3300005329 Bacteria 3473
35 Ga0070683_100338735 3300005329 Bacteria 1432
36 Ga0070690_100462428 3300005330 Bacteria 943
37 Ga0070690_101257374 3300005330 Bacteria 592
38 Ga0070670_101106232 3300005331 Bacteria 723
39 Ga0070670_101985024 3300005331 Bacteria 536
40 Ga0070677_10046592 3300005333 Bacteria 1734
41 Ga0068869_100007769 3300005334 Bacteria 6879
42 Ga0068869_100394002 3300005334 Bacteria 1137
43 Ga0070666_10033476 3300005335 Bacteria 3400
44 Ga0070666_10313703 3300005335 Bacteria 1118
45 Ga0070666_10717353 3300005335 Bacteria 734
46 Ga0070682_100065359 3300005337 Bacteria 2311
47 Ga0070682_100107622 3300005337 Bacteria 1852
48 Ga0070682_100173119 3300005337 Bacteria 1502
49 Ga0070682_100206362 3300005337 Bacteria 1390
50 Ga0068868_100001063 3300005338 Bacteria 18804
51 Ga0068868_100002784 3300005338 Bacteria 12116
52 Ga0068868_100016636 3300005338 Bacteria 5469
53 Ga0070660_100066916 3300005339 Bacteria 2798
54 Ga0070689_100317127 3300005340 Bacteria 1301
55 Ga0070689_100613530 3300005340 Bacteria 943
56 Ga0070689_100713250 3300005340 Bacteria 877
57 Ga0070691_10009724 3300005341 Bacteria 4387
58 Ga0070691_10190321 3300005341 Bacteria 1073
59 Ga0070691_10267874 3300005341 Bacteria 922
60 Ga0070687_100062007 3300005343 Bacteria 1978
61 Ga0070692_10375941 3300005345 Bacteria 890
62 Ga0070668_100045774 3300005347 Bacteria 3357
63 Ga0070668_100333913 3300005347 Bacteria 1279
64 Ga0070669_100083826 3300005353 Bacteria 2378
65 Ga0070669_101057863 3300005353 Bacteria 698
66 Ga0070675_100173942 3300005354 Bacteria 1858
67 Ga0070675_101556168 3300005354 Bacteria 610
68 Ga0070671_100295611 3300005355 Bacteria 1378
69 Ga0070671_100600657 3300005355 Bacteria 951
70 Ga0070674_100564701 3300005356 Bacteria 957
71 Ga0070674_100628653 3300005356 Bacteria 910
72 Ga0070673_100028802 3300005364 Bacteria 4135
73 Ga0070673_101679540 3300005364 Bacteria 601
74 Ga0070688_101317990 3300005365 Bacteria 583
75 Ga0070667_100014403 3300005367 Bacteria 6534
76 Ga0070667_100447653 3300005367 Bacteria 1180
77 Ga0070667_101111627 3300005367 Bacteria 739
78 Ga0070703_10237895 3300005406 Bacteria 733
79 Ga0070709_10000287 3300005434 Bacteria 32074
80 Ga0070714_100001531 3300005435 Bacteria 16859
81 Ga0070714_100074068 3300005435 Bacteria 2951
82 Ga0070714_100357483 3300005435 Bacteria 1373
83 Ga0070713_100000752 3300005436 Bacteria 20729
84 Ga0070713_100003809 3300005436 Bacteria 9978
85 Ga0070713_102070154 3300005436 Bacteria 552
86 Ga0070705_100030655 3300005440 Bacteria 2971
87 Ga0070705_100140505 3300005440 Bacteria 1588
88 Ga0070694_100732716 3300005444 Bacteria 806
89 Ga0070694_100789697 3300005444 Bacteria 778
90 Ga0070708_100483923 3300005445 Bacteria 1167
91 Ga0070663_100190503 3300005455 Bacteria 1596
92 Ga0070678_100035055 3300005456 Bacteria 3500
93 Ga0070678_100102809 3300005456 Bacteria 2218
94 Ga0070678_102080239 3300005456 Bacteria 538
95 Ga0070678_102361106 3300005456 Bacteria 505
96 Ga0070662_100069527 3300005457 Bacteria 2592
97 Ga0070662_101401841 3300005457 Bacteria 602
98 Ga0070681_10102025 3300005458 Bacteria 2814
99 Ga0068867_100031077 3300005459 Bacteria 3854
100 Ga0068867_100045142 3300005459 Bacteria 3230
101 Ga0068867_100307117 3300005459 Bacteria 1310
102 Ga0068867_100370145 3300005459 Bacteria 1201
103 Ga0070685_10023219 3300005466 Bacteria 3394
104 Ga0070706_100204437 3300005467 Bacteria 1845
105 Ga0070707_100440745 3300005468 Bacteria 1263
106 Ga0070707_100564069 3300005468 Bacteria 1101
107 Ga0070707_100979356 3300005468 Bacteria 811
108 Ga0070699_100180303 3300005518 Bacteria 1874
109 Ga0070699_100266384 3300005518 Bacteria 1533
110 Ga0070679_100208662 3300005530 Bacteria 1918
111 Ga0070679_100246928 3300005530 Bacteria 1741
112 Ga0070684_100012677 3300005535 Bacteria 6763
113 Ga0070684_100379590 3300005535 Bacteria 1302
114 Ga0070684_100387191 3300005535 Bacteria 1288
115 Ga0070684_100545540 3300005535 Bacteria 1076
116 Ga0070697_100082909 3300005536 Bacteria 2644
117 Ga0070697_100249451 3300005536 Bacteria 1518
118 Ga0070697_101174481 3300005536 Bacteria 684
119 Ga0068853_100054623 3300005539 Bacteria 3442
120 Ga0068853_100921056 3300005539 Bacteria 840
121 Ga0068853_100982656 3300005539 Bacteria 812
122 Ga0070672_100164427 3300005543 Bacteria 1843
123 Ga0070672_100390898 3300005543 Bacteria 1191
124 Ga0070672_101192960 3300005543 Bacteria 678
125 Ga0070686_100069104 3300005544 Bacteria 2306
126 Ga0070686_100107244 3300005544 Bacteria 1897
127 Ga0070696_100147544 3300005546 Bacteria 1724
128 Ga0070696_100257079 3300005546 Bacteria 1323
129 Ga0070696_100283047 3300005546 Bacteria 1264
130 Ga0070693_100113168 3300005547 Bacteria 1673
131 Ga0070693_100146860 3300005547 Bacteria 1490
132 Ga0070665_100202700 3300005548 Bacteria 1984
133 Ga0070665_100761615 3300005548 Bacteria 981
134 Ga0070704_100046496 3300005549 Bacteria 3027
135 Ga0070704_101384334 3300005549 Bacteria 645
136 Ga0068855_100374116 3300005563 Bacteria 1565
137 Ga0068855_100383109 3300005563 Bacteria 1544
138 Ga0068857_100008064 3300005577 Bacteria 9085
139 Ga0068857_100342271 3300005577 Bacteria 1384
140 Ga0068857_100862349 3300005577 Bacteria 867
141 Ga0068857_101088557 3300005577 Bacteria 771
142 Ga0068854_100511854 3300005578 Bacteria 1012
143 Ga0068854_100660387 3300005578 Bacteria 899
144 Ga0068856_100038121 3300005614 Bacteria 4717
145 Ga0070702_100010797 3300005615 Bacteria 4515
146 Ga0070702_101304655 3300005615 Bacteria 590
147 Ga0070702_101467705 3300005615 Bacteria 560
148 Ga0068852_102423230 3300005616 Bacteria 545
149 Ga0068859_100058552 3300005617 Bacteria 3881
150 Ga0068859_100068084 3300005617 Bacteria 3595
151 Ga0068859_100674726 3300005617 Bacteria 1125
152 Ga0068859_102124019 3300005617 Bacteria 620
153 Ga0068859_102810840 3300005617 Bacteria 534
154 Ga0068866_10037041 3300005718 Bacteria 2394
155 Ga0068866_10162411 3300005718 Bacteria 1304
156 Ga0068866_10668450 3300005718 Bacteria 709
157 Ga0068861_100416822 3300005719 Bacteria 1196
158 Ga0068861_101521615 3300005719 Bacteria 657
159 Ga0068861_101768534 3300005719 Bacteria 612
160 Ga0068851_10153838 3300005834 Bacteria 1259
161 Ga0068870_10002377 3300005840 Bacteria 7827
162 Ga0068863_100334496 3300005841 Bacteria 1472
163 Ga0068863_100351346 3300005841 Bacteria 1436
164 Ga0068863_100389505 3300005841 Bacteria 1362
165 Ga0068863_100492275 3300005841 Bacteria 1207
166 Ga0068863_101499214 3300005841 Bacteria 683
167 Ga0068860_100043631 3300005843 Bacteria 4277
168 Ga0068860_100089660 3300005843 Bacteria 2928
169 Ga0068862_101048855 3300005844 Bacteria 808
170 Ga0081538_10005557 3300005981 Bacteria 11312
171 Ga0081538_10025517 3300005981 Bacteria 4163
172 Ga0081539_10000072 3300005985 Bacteria 232726
173 Ga0081539_10004359 3300005985 Bacteria 15776
174 Ga0070717_10672712 3300006028 Bacteria 940
175 Ga0070715_10015070 3300006163 Bacteria 2876
176 Ga0070712_100123654 3300006175 Bacteria 1951
177 Ga0075366_10113191 3300006195 Bacteria 1633
178 Ga0075366_10181106 3300006195 Bacteria 1280
179 Ga0097621_100011986 3300006237 Bacteria 6415
180 Ga0097621_100028937 3300006237 Bacteria 4372
181 Ga0097621_100119649 3300006237 Bacteria 2232
182 Ga0097621_101027592 3300006237 Bacteria 772
183 Ga0097621_101121116 3300006237 Bacteria 739
184 Ga0068871_100012756 3300006358 Bacteria 6215
185 Ga0075428_100644896 3300006844 Bacteria 1130
186 Ga0075430_100300743 3300006846 Bacteria 1327
187 Ga0075430_100376334 3300006846 Bacteria 1172
188 Ga0075431_100002441 3300006847 Bacteria 17888
189 Ga0075433_10015274 3300006852 Bacteria 6294
190 Ga0075433_10016739 3300006852 Bacteria 6053
191 Ga0075433_10146799 3300006852 Bacteria 2097
192 Ga0075434_100039407 3300006871 Bacteria 4682
193 Ga0075434_100562457 3300006871 Bacteria 1160
194 Ga0075434_102012433 3300006871 Bacteria 583
195 Ga0075429_100817737 3300006880 Bacteria 816
196 Ga0068865_100067348 3300006881 Bacteria 2529
197 Ga0068865_100103143 3300006881 Bacteria 2091
198 Ga0068865_101432084 3300006881 Bacteria 617
199 Ga0097620_100058548 3300006931 Bacteria 3881
200 Ga0097620_100068093 3300006931 Bacteria 3595
201 Ga0097620_100674757 3300006931 Bacteria 1125
202 Ga0097620_100980998 3300006931 Bacteria 927
203 Ga0097620_102123909 3300006931 Bacteria 620
204 Ga0097620_102811674 3300006931 Bacteria 534
205 Ga0075435_100152699 3300007076 Bacteria 1942
206 Ga0105240_10775736 3300009093 Bacteria 1040
207 Ga0111539_10041238 3300009094 Bacteria 5550
208 Ga0111539_11571081 3300009094 Bacteria 763
209 Ga0105245_10449169 3300009098 Bacteria 1297
210 Ga0114129_10006513 3300009147 Bacteria 16568
211 Ga0114129_10032401 3300009147 Bacteria 7386
212 Ga0114129_10291592 3300009147 Bacteria 2177
213 Ga0114129_10304184 3300009147 Bacteria 2124
214 Ga0114129_10659542 3300009147 Bacteria 1349
215 Ga0114129_11020356 3300009147 Bacteria 1041
216 Ga0114129_11143786 3300009147 Bacteria 972
217 Ga0114129_11739705 3300009147 Bacteria 760
218 Ga0105243_10117314 3300009148 Bacteria 2237
219 Ga0105243_10148900 3300009148 Bacteria 2006
220 Ga0105243_10233304 3300009148 Bacteria 1634
221 Ga0105243_10295437 3300009148 Bacteria 1466
222 Ga0105243_10686561 3300009148 Bacteria 996
223 Ga0105241_10156169 3300009174 Bacteria 1871
224 Ga0105241_11925681 3300009174 Bacteria 580
225 Ga0105242_10011746 3300009176 Bacteria 6736
226 Ga0105242_10045883 3300009176 Bacteria 3543
227 Ga0105242_10360933 3300009176 Bacteria 1345
228 Ga0105242_12762276 3300009176 Bacteria 541
229 Ga0105248_10058121 3300009177 Bacteria 4342
230 Ga0105248_10437935 3300009177 Bacteria 1472
231 Ga0105249_10500340 3300009553 Bacteria 1260
232 Ga0105249_12324716 3300009553 Unclassified 609
233 Ga0105249_12863410 3300009553 Bacteria 554
234 Ga0105239_11333003 3300010375 Bacteria 828
235 Ga0105246_10306561 3300011119 Bacteria 1284
236 Ga0105246_10328381 3300011119 Bacteria 1246
237 Ga0105246_10339176 3300011119 Bacteria 1228
238 Ga0105246_11893922 3300011119 Bacteria 572
239 Ga0157324_1038710 3300012506 Bacteria 574
240 Ga0154010_136519 3300013062 Bacteria 609
241 Ga0157373_10307442 3300013100 Bacteria 1126
242 Ga0157371_10064200 3300013102 Bacteria 2602
243 Ga0157371_10668166 3300013102 Bacteria 776
244 Ga0157370_10289959 3300013104 Bacteria 1511
245 Ga0157370_11230718 3300013104 Bacteria 675
246 Ga0157369_10900785 3300013105 Bacteria 907
247 Ga0157374_10130270 3300013296 Bacteria 2434
248 Ga0157374_10171084 3300013296 Bacteria 2119
249 Ga0157374_11283256 3300013296 Bacteria 754
250 Ga0157378_10005839 3300013297 Bacteria 10791
251 Ga0157378_10094032 3300013297 Bacteria 2729
252 Ga0157378_10250264 3300013297 Bacteria 1696
253 Ga0157378_10643767 3300013297 Bacteria 1075
254 Ga0157378_11455173 3300013297 Bacteria 729
255 Ga0157378_11674727 3300013297 Bacteria 683
256 Ga0163162_10038469 3300013306 Bacteria 4774
257 Ga0163162_10184062 3300013306 Bacteria 2215
258 Ga0163162_10242652 3300013306 Bacteria 1933
259 Ga0163162_10682823 3300013306 Bacteria 1149
260 Ga0163162_12136836 3300013306 Bacteria 642
261 Ga0157372_10160060 3300013307 Bacteria 2602
262 Ga0157372_10226498 3300013307 Bacteria 2167
263 Ga0157372_10233574 3300013307 Bacteria 2132
264 Ga0157372_10689465 3300013307 Bacteria 1189
265 Ga0157372_11449944 3300013307 Bacteria 791
266 Ga0157375_10131733 3300013308 Bacteria 2620
267 Ga0157375_10143967 3300013308 Bacteria 2513
268 Ga0157375_10280603 3300013308 Bacteria 1829
269 Ga0163163_10276709 3300014325 Bacteria 1730
270 Ga0163163_11217941 3300014325 Bacteria 815
271 Ga0163163_11454181 3300014325 Bacteria 747
272 Ga0157380_10004578 3300014326 Bacteria 9601
273 Ga0157380_10082084 3300014326 Bacteria 2638
274 Ga0157380_10350663 3300014326 Bacteria 1381
275 Ga0157380_10960690 3300014326 Bacteria 885
276 Ga0157380_10989690 3300014326 Bacteria 873
277 Ga0157380_11251326 3300014326 Bacteria 788
278 Ga0157380_11465959 3300014326 Bacteria 735
279 Ga0157380_11508863 3300014326 Bacteria 725
280 Ga0157377_10867265 3300014745 Bacteria 672
281 Ga0157377_11093103 3300014745 Bacteria 610
282 Ga0157379_10169789 3300014968 Bacteria 1969
283 Ga0157376_10013099 3300014969 Bacteria 6177
284 Ga0157376_10017026 3300014969 Bacteria 5534
285 Ga0157376_10332507 3300014969 Bacteria 1448
286 Ga0157376_10435455 3300014969 Bacteria 1275
287 Ga0163161_10519792 3300017792 Bacteria 972
288 Ga0197907_10166582 3300020069 Bacteria 1096
289 Ga0197907_10544785 3300020069 Bacteria 1030
290 Ga0197907_10643572 3300020069 Bacteria 2802
291 Ga0197907_10684168 3300020069 Bacteria 1519
292 Ga0197907_11002581 3300020069 Unclassified 1231
293 Ga0197907_11115412 3300020069 Bacteria 941
294 Ga0197907_11171440 3300020069 Bacteria 1091
295 Ga0197907_11244701 3300020069 Bacteria 904
296 Ga0197907_11340891 3300020069 Bacteria 821
297 Ga0197907_11347398 3300020069 Bacteria 853
298 Ga0206356_10029991 3300020070 Unclassified 1925
299 Ga0206356_10387064 3300020070 Bacteria 1484
300 Ga0206356_10393104 3300020070 Bacteria 940
301 Ga0206356_10527780 3300020070 Bacteria 1720
302 Ga0206356_10589241 3300020070 Bacteria 1011
303 Ga0206356_11184870 3300020070 Bacteria 942
304 Ga0206356_11234993 3300020070 Bacteria 1338
305 Ga0206356_11465735 3300020070 Bacteria 1187
306 Ga0206356_11475959 3300020070 Bacteria 1063
307 Ga0206356_11723060 3300020070 Bacteria 1773
308 Ga0206349_1149751 3300020075 Unclassified 1685
309 Ga0206349_1306057 3300020075 Bacteria 610
310 Ga0206349_1416863 3300020075 Bacteria 1123
311 Ga0206349_1428736 3300020075 Bacteria 1353
312 Ga0206349_1451067 3300020075 Bacteria 1016
313 Ga0206349_1547646 3300020075 Bacteria 686
314 Ga0206349_1630809 3300020075 Bacteria 1879
315 Ga0206349_1746519 3300020075 Bacteria 1214
316 Ga0206355_1023074 3300020076 Bacteria 903
317 Ga0206355_1291002 3300020076 Bacteria 616
318 Ga0206355_1525315 3300020076 Bacteria 896
319 Ga0206355_1716015 3300020076 Bacteria 727
320 Ga0206351_10122949 3300020077 Bacteria 957
321 Ga0206351_10168106 3300020077 Bacteria 1466
322 Ga0206351_10458947 3300020077 Bacteria 1663
323 Ga0206351_10693876 3300020077 Bacteria 627
324 Ga0206351_10913767 3300020077 Bacteria 933
325 Ga0206352_10519505 3300020078 Bacteria 568
326 Ga0206352_10603617 3300020078 Bacteria 979
327 Ga0206352_10636518 3300020078 Bacteria 809
328 Ga0206352_10752522 3300020078 Bacteria 1120
329 Ga0206352_11134617 3300020078 Bacteria 1063
330 Ga0206352_11154477 3300020078 Bacteria 502
331 Ga0206352_11339826 3300020078 Bacteria 1720
332 Ga0206350_10235783 3300020080 Bacteria 2202
333 Ga0206350_10358460 3300020080 Bacteria 971
334 Ga0206350_10692694 3300020080 Bacteria 1656
335 Ga0206350_10805923 3300020080 Bacteria 916
336 Ga0206350_11230380 3300020080 Bacteria 564
337 Ga0206350_11476777 3300020080 Bacteria 1178
338 Ga0206350_11522585 3300020080 Bacteria 1616
339 Ga0206354_10365710 3300020081 Unclassified 1385
340 Ga0206354_10736349 3300020081 Bacteria 3446
341 Ga0206354_10803466 3300020081 Bacteria 904
342 Ga0206354_10843853 3300020081 Bacteria 1088
343 Ga0206354_11078476 3300020081 Bacteria 1183
344 Ga0206354_11150211 3300020081 Bacteria 1156
345 Ga0206354_11220093 3300020081 Bacteria 894
346 Ga0206354_11311334 3300020081 Bacteria 947
347 Ga0206354_11618312 3300020081 Bacteria 1103
348 Ga0206353_10011578 3300020082 Bacteria 1750
349 Ga0206353_10034385 3300020082 Bacteria 549
350 Ga0206353_10705318 3300020082 Bacteria 1476
351 Ga0206353_10883225 3300020082 Bacteria 1140
352 Ga0206353_11236968 3300020082 Bacteria 1180
353 Ga0206353_11328929 3300020082 Unclassified 1137
354 Ga0206353_12033233 3300020082 Bacteria 938
355 Ga0154015_1137626 3300020610 Bacteria 621
356 Ga0154015_1210807 3300020610 Bacteria 902
357 Ga0213875_10022465 3300021388 Bacteria 3016
358 Ga0213875_10025319 3300021388 Bacteria 2826
359 Ga0213875_10515005 3300021388 Bacteria 575
360 Ga0213871_10053535 3300021441 Bacteria 1111
361 Ga0224712_10000389 3300022467 Bacteria 8566
362 Ga0224712_10001802 3300022467 Bacteria 5107
363 Ga0224712_10086997 3300022467 Bacteria 1301
364 Ga0224712_10092846 3300022467 Bacteria 1267
365 Ga0224712_10096658 3300022467 Bacteria 1246
366 Ga0224712_10184076 3300022467 Unclassified 942
367 Ga0224712_10471685 3300022467 Bacteria 604
368 Ga0224712_10689410 3300022467 Bacteria 502
369 Ga0207653_10050968 3300025885 Bacteria 1377
370 Ga0207682_10034095 3300025893 Bacteria 2051
371 Ga0207642_10085593 3300025899 Bacteria 1543
372 Ga0207642_10153283 3300025899 Bacteria 1229
373 Ga0207642_10161529 3300025899 Bacteria 1203
374 Ga0207688_10020657 3300025901 Bacteria 3595
375 Ga0207680_10013559 3300025903 Bacteria 4192
376 Ga0207680_10635716 3300025903 Bacteria 764
377 Ga0207685_10030205 3300025905 Bacteria 1927
378 Ga0207699_10000308 3300025906 Bacteria 26108
379 Ga0207645_10000354 3300025907 Bacteria 38157
380 Ga0207645_10005100 3300025907 Bacteria 9614
381 Ga0207643_10005287 3300025908 Bacteria 6908
382 Ga0207705_10380852 3300025909 Bacteria 1090
383 Ga0207705_11169708 3300025909 Bacteria 591
384 Ga0207684_10059589 3300025910 Bacteria 3242
385 Ga0207684_10686332 3300025910 Bacteria 871
386 Ga0207684_10785242 3300025910 Bacteria 806
387 Ga0207654_10197559 3300025911 Bacteria 1322
388 Ga0207707_10037560 3300025912 Bacteria 4233
389 Ga0207707_11065343 3300025912 Bacteria 660
390 Ga0207695_10466604 3300025913 Bacteria 1145
391 Ga0207671_10928472 3300025914 Bacteria 687
392 Ga0207662_10084359 3300025918 Bacteria 1943
393 Ga0207649_11219873 3300025920 Bacteria 594
394 Ga0207652_10196319 3300025921 Bacteria 1816
395 Ga0207652_10343020 3300025921 Bacteria 1348
396 Ga0207652_10416074 3300025921 Bacteria 1212
397 Ga0207646_10007605 3300025922 Bacteria 10977
398 Ga0207646_10343928 3300025922 Bacteria 1348
399 Ga0207646_10661806 3300025922 Bacteria 935
400 Ga0207681_10157824 3300025923 Bacteria 1706
401 Ga0207681_10212848 3300025923 Bacteria 1491
402 Ga0207650_10127944 3300025925 Bacteria 1985
403 Ga0207650_10767795 3300025925 Bacteria 816
404 Ga0207659_10016365 3300025926 Bacteria 4824
405 Ga0207659_10150503 3300025926 Bacteria 1817
406 Ga0207687_10388270 3300025927 Bacteria 1145
407 Ga0207700_10000991 3300025928 Bacteria 16378
408 Ga0207700_10006673 3300025928 Bacteria 6999
409 Ga0207700_11437110 3300025928 Bacteria 613
410 Ga0207664_10003417 3300025929 Bacteria 10582
411 Ga0207664_10020594 3300025929 Bacteria 4891
412 Ga0207644_10273141 3300025931 Bacteria 1355
413 Ga0207644_10395917 3300025931 Bacteria 1128
414 Ga0207706_10108625 3300025933 Bacteria 2441
415 Ga0207706_10145637 3300025933 Bacteria 2084
416 Ga0207686_10038789 3300025934 Bacteria 2885
417 Ga0207686_10065759 3300025934 Bacteria 2313
418 Ga0207686_11424028 3300025934 Bacteria 571
419 Ga0207709_10028863 3300025935 Bacteria 3211
420 Ga0207709_10211916 3300025935 Bacteria 1391
421 Ga0207709_10699968 3300025935 Bacteria 811
422 Ga0207670_11634489 3300025936 Bacteria 548
423 Ga0207669_10010070 3300025937 Bacteria 4537
424 Ga0207669_11698326 3300025937 Bacteria 539
425 Ga0207669_11869443 3300025937 Bacteria 513
426 Ga0207704_10092963 3300025938 Bacteria 1987
427 Ga0207704_10199743 3300025938 Bacteria 1462
428 Ga0207704_10930075 3300025938 Bacteria 732
429 Ga0207665_11165695 3300025939 Bacteria 615
430 Ga0207691_10048624 3300025940 Bacteria 3888
431 Ga0207691_10353298 3300025940 Bacteria 1257
432 Ga0207691_11653908 3300025940 Bacteria 519
433 Ga0207711_10110779 3300025941 Bacteria 2441
434 Ga0207689_10026074 3300025942 Bacteria 4894
435 Ga0207689_10062686 3300025942 Bacteria 3058
436 Ga0207661_10000901 3300025944 Bacteria 19459
437 Ga0207661_10090826 3300025944 Bacteria 2544
438 Ga0207661_10302056 3300025944 Bacteria 1435
439 Ga0207661_10820742 3300025944 Bacteria 856
440 Ga0207661_11921319 3300025944 Bacteria 538
441 Ga0207667_11651317 3300025949 Bacteria 608
442 Ga0207651_10003788 3300025960 Bacteria 7487
443 Ga0207651_10122057 3300025960 Bacteria 1978
444 Ga0207651_11972691 3300025960 Bacteria 525
445 Ga0207712_10152649 3300025961 Bacteria 1786
446 Ga0207640_10012564 3300025981 Bacteria 4827
447 Ga0207640_11581856 3300025981 Bacteria 590
448 Ga0207658_10072055 3300025986 Bacteria 2618
449 Ga0207677_10000955 3300026023 Bacteria 16077
450 Ga0207677_10012528 3300026023 Bacteria 4879
451 Ga0207677_10066707 3300026023 Bacteria 2517
452 Ga0207677_10589414 3300026023 Bacteria 974
453 Ga0207677_10712461 3300026023 Bacteria 891
454 Ga0207678_10221199 3300026067 Bacteria 1621
455 Ga0207678_10520767 3300026067 Bacteria 1038
456 Ga0207678_10936204 3300026067 Bacteria 766
457 Ga0207708_10083471 3300026075 Bacteria 2456
458 Ga0207708_10476064 3300026075 Bacteria 1043
459 Ga0207708_11658662 3300026075 Bacteria 562
460 Ga0207702_10005948 3300026078 Bacteria 10596
461 Ga0207702_10973673 3300026078 Bacteria 841
462 Ga0207702_12383049 3300026078 Bacteria 517
463 Ga0207641_10045565 3300026088 Bacteria 3693
464 Ga0207641_10332071 3300026088 Bacteria 1444
465 Ga0207641_11045234 3300026088 Bacteria 814
466 Ga0207641_11740028 3300026088 Bacteria 625
467 Ga0207648_10000404 3300026089 Bacteria 48036
468 Ga0207648_10032257 3300026089 Bacteria 4626
469 Ga0207648_10032981 3300026089 Bacteria 4569
470 Ga0207648_10350658 3300026089 Bacteria 1330
471 Ga0207648_10419092 3300026089 Bacteria 1215
472 Ga0207674_10003661 3300026116 Bacteria 18744
473 Ga0207674_10116450 3300026116 Bacteria 2643
474 Ga0207674_10160041 3300026116 Bacteria 2206
475 Ga0207675_100124672 3300026118 Bacteria 2439
476 Ga0207675_100562955 3300026118 Bacteria 1140
477 Ga0207675_100793680 3300026118 Bacteria 960
478 Ga0207675_101523636 3300026118 Bacteria 689
479 Ga0207683_10000603 3300026121 Bacteria 33155
480 Ga0207683_10003746 3300026121 Bacteria 13185
481 Ga0207683_10032516 3300026121 Bacteria 4531
482 Ga0207683_10062368 3300026121 Bacteria 3283
483 Ga0207683_11326396 3300026121 Bacteria 666
484 Ga0209966_1040538 3300027695 Bacteria 969
485 Ga0268266_10382418 3300028379 Bacteria 1328
486 Ga0268266_10768529 3300028379 Bacteria 930
487 Ga0268265_10150746 3300028380 Bacteria 1961
488 Ga0268265_10501408 3300028380 Bacteria 1144
489 Ga0268265_10672792 3300028380 Bacteria 997
490 Ga0268264_10090125 3300028381 Bacteria 2642
491 Ga0268264_10652629 3300028381 Bacteria 1041
492 Ga0268264_10870715 3300028381 Bacteria 903
493 Ga0268264_12615061 3300028381 Bacteria 509
494 Ga0311001_1072227 3300029277 Bacteria 597
495 Ga0265760_10101364 3300031090 Bacteria 910
496 Ga0265330_10000095 3300031235 Bacteria 74593
497 Ga0265330_10079062 3300031235 Bacteria 1418
498 Ga0265330_10217746 3300031235 Bacteria 806
499 Ga0265332_10000222 3300031238 Bacteria 45648
500 Ga0265328_10022244 3300031239 Unclassified 2414
501 Ga0265328_10213498 3300031239 Bacteria 734
502 Ga0265320_10085198 3300031240 Bacteria 1471
503 Ga0265325_10383069 3300031241 Bacteria 618
504 Ga0265329_10005084 3300031242 Bacteria 5366
505 Ga0265339_10013550 3300031249 Bacteria 4938
506 Ga0265339_10139822 3300031249 Bacteria 1233
507 Ga0265331_10090337 3300031250 Bacteria 1416
508 Ga0265331_10100609 3300031250 Bacteria 1330
509 Ga0265327_10057516 3300031251 Bacteria 2000
510 Ga0265316_10000450 3300031344 Bacteria 46576
511 Ga0265316_10061578 3300031344 Bacteria 2914
512 Ga0265314_10000076 3300031711 Bacteria 146266
513 Ga0265342_10000759 3300031712 Bacteria 32969
514 Ga0265342_10031591 3300031712 Bacteria 3273
515 Ga0316578_10858856 3300031728 Bacteria 525
516 Ga0307405_10059631 3300031731 Bacteria 2405
517 Ga0307410_11184973 3300031852 Bacteria 665
518 Ga0307407_11545976 3300031903 Bacteria 525
519 Ga0307409_102478970 3300031995 Bacteria 547
520 Ga0307409_102909583 3300031995 Bacteria 506
521 Ga0307416_100197294 3300032002 Bacteria 1905
522 Ga0307416_100938527 3300032002 Bacteria 967
523 Ga0307414_10941371 3300032004 Bacteria 793
524 Ga0307411_12295821 3300032005 Bacteria 507
525 Ga0373944_0256664 3300035089 Bacteria 647
526 Ga0373952_0028057 3300035092 Bacteria 1233
527 Ga0373939_0372785 3300035114 Bacteria 586
528 Ga0373953_0019614 3300035117 Bacteria 2518
529 Ga0373954_0068740 3300035118 Bacteria 1681
530 Ga0373954_0134894 3300035118 Bacteria 1203
531 Ga0373943_0059847 3300035170 Bacteria 1900
532 Ga0373943_0151500 3300035170 Bacteria 1257
533 Ga0373946_0532174 3300035171 Bacteria 605
534 Ga0373955_0038216 3300035172 Bacteria 2557
535 Ga0373955_0381778 3300035172 Bacteria 855
536 Ga0373927_0150719 3300035695 Bacteria 1523
537 Ga0373947_0172282 3300035725 Bacteria 1405
538 Ga0373947_0194384 3300035725 Bacteria 1325
539 Ga0373947_0209826 3300035725 Bacteria 1277
540 Ga0373937_0044920 3300036401 Bacteria 4036
541 Ga0373937_0091557 3300036401 Bacteria 2818
542 Ga0265778_020976 3300036457 Bacteria 807
543 Ga0316582_0006998 3300036647 Bacteria 5976
544 Ga0316584_0154220 3300036712 Bacteria 1709
545 Ga0373925_0908300 3300037068 Bacteria 726
546 Ga0395899_0274789 3300037312 Bacteria 1148
547 Ga0395900_0388831 3300037418 Bacteria 1361
548 Ga0395900_0455995 3300037418 Bacteria 1234
549 Ga0395900_0960706 3300037418 Bacteria 776
550 Ga0395898_0091988 3300037466 Bacteria 2917
551 Ga0395898_1838539 3300037466 Bacteria 526
552 Ga0395905_0103220 3300037471 Bacteria 2677
553 Ga0395905_0204218 3300037471 Bacteria 1852
554 Ga0395905_1052154 3300037471 Bacteria 717
555 Ga0436364_0038835 3300037853 Bacteria 828
556 Ga0436364_0542577 3300037853 Bacteria 1537
557 Ga0436364_0586291 3300037853 Bacteria 97560
558 Ga0436364_0723678 3300037853 Bacteria 629
559 Ga0436364_1015141 3300037853 Bacteria 1109
560 Ga0436364_1062354 3300037853 Bacteria 22499
561 Ga0395901_0247269 3300038443 Bacteria 1859
562 Ga0436361_0744057 3300039447 Bacteria 787
563 Ga0436361_1025560 3300039447 Bacteria 1008
564 Ga0436363_0954681 3300039450 Bacteria 962
565 Ga0436363_1478957 3300039450 Bacteria 918
566 Ga0436362_0046115 3300039453 Bacteria 791
567 Ga0436362_0058043 3300039453 Bacteria 706
568 Ga0436362_0162217 3300039453 Bacteria 1477
569 Ga0439436_0066327 3300041404 Bacteria 1008
570 Ga0451789_0018324 3300041443 Bacteria 770
571 Ga0451789_0548624 3300041443 Bacteria 889
572 Ga0451790_26253 3300041444 Bacteria 580
573 Ga0451794_48340 3300041446 Bacteria 1402
574 Ga0451791_0679889 3300041451 Bacteria 914
575 Ga0451793_0502801 3300041452 Bacteria 529
576 Ga0451797_0168955 3300041453 Bacteria 1147
577 Ga0451795_0256947 3300041456 Bacteria 1219
578 Ga0451800_0119921 3300041459 Bacteria 576
579 Ga0451800_1330059 3300041459 Bacteria 599
580 Ga0451802_1688259 3300041460 Bacteria 662
581 Ga0451835_0366974 3300041492 Bacteria 812
582 Ga0451851_0136488 3300041507 Bacteria 939
583 Ga0451855_1893647 3300041511 Bacteria 569
584 Ga0452268_06279 3300041907 Bacteria 670
585 Ga0451577_0000019 3300042876 Bacteria 506976
586 Ga0451577_0002073 3300042876 Bacteria 24707
587 Ga0451577_0061839 3300042876 Bacteria 3339
588 Ga0451577_0097736 3300042876 Bacteria 2622
589 Ga0451577_0312703 3300042876 Bacteria 1424
590 Ga0451577_0714381 3300042876 Bacteria 907
591 Ga0466972_0002629 3300044658 Bacteria 8898
592 Ga0453683_0000086 3300044673 Bacteria 139689
593 Ga0453683_0000096 3300044673 Bacteria 132402
594 Ga0453683_0119787 3300044673 Bacteria 1657
595 Ga0466965_0001564 3300044683 Bacteria 9313
596 Ga0466965_0601618 3300044683 Bacteria 625
597 Ga0466961_0460957 3300044693 Bacteria 769
598 Ga0466963_0022695 3300044694 Bacteria 3977
599 Ga0466963_0059705 3300044694 Bacteria 2546
600 Ga0453684_0000037 3300044712 Bacteria 709327
601 Ga0453684_0000057 3300044712 Bacteria 506899
602 Ga0453684_0001302 3300044712 Bacteria 74077
603 Ga0453684_0001518 3300044712 Bacteria 65070
604 Ga0453684_0003980 3300044712 Bacteria 32269
605 Ga0453684_0029625 3300044712 Bacteria 7762
606 Ga0453684_0043756 3300044712 Bacteria 6010
607 Ga0453684_0156006 3300044712 Bacteria 2706
608 Ga0453684_0918660 3300044712 Bacteria 936
609 Ga0466968_0002295 3300044735 Bacteria 6986
610 Ga0466968_0562001 3300044735 Bacteria 573
611 Ga0466957_0530902 3300044842 Bacteria 818
612 Ga0466957_0880361 3300044842 Bacteria 639
613 Ga0466960_0002825 3300044901 Bacteria 6581
614 Ga0466960_0394739 3300044901 Bacteria 796
615 Ga0451576_0005300 3300045051 Bacteria 16207
616 Ga0451576_0047121 3300045051 Bacteria 4533
617 Ga0451576_0400054 3300045051 Bacteria 1440
618 Ga0451576_0492818 3300045051 Bacteria 1287
619 Ga0451576_1100021 3300045051 Bacteria 832
620 Ga0466967_0033182 3300045976 Bacteria 4368
621 Ga0466967_1249565 3300045976 Bacteria 740
622 Ga0495592_0537949 3300046454 Bacteria 720
623 Ga0495603_0005689 3300046455 Bacteria 7449
624 Ga0495603_0066314 3300046455 Bacteria 2126
625 Ga0495603_0193439 3300046455 Bacteria 1176
626 Ga0495590_0204008 3300046457 Bacteria 727
627 Ga0495629_0029349 3300046459 Bacteria 3900
628 Ga0495651_0525655 3300046462 Bacteria 754
629 Ga0495580_0904300 3300046472 Bacteria 567
630 Ga0495582_0157785 3300046473 Bacteria 1290
631 Ga0495594_0043083 3300046499 Bacteria 2473
632 Ga0495594_0577990 3300046499 Bacteria 637
633 Ga0495618_0089037 3300046514 Bacteria 1974
634 Ga0495628_0321700 3300046516 Bacteria 1141
635 Ga0495652_0287641 3300046529 Bacteria 1201
636 Ga0495640_0110798 3300046533 Bacteria 1794
637 Ga0495586_0117684 3300046535 Bacteria 1483
638 Ga0495621_0390177 3300046539 Bacteria 589
639 Ga0495633_0022320 3300046558 Bacteria 3152
640 Ga0495634_0205649 3300046642 Bacteria 1221
641 Ga0495635_0060120 3300046663 Bacteria 2612
642 Ga0495599_0156792 3300046678 Bacteria 1408
643 Ga0495647_0008157 3300046681 Bacteria 3520
644 Ga0495658_0012542 3300046683 Bacteria 4297
645 Ga0495658_0161509 3300046683 Bacteria 1382
646 Ga0495613_0098089 3300046689 Bacteria 2118
647 Ga0495624_0087620 3300046690 Bacteria 1923
648 Ga0495624_0426636 3300046690 Bacteria 795
649 Ga0495670_0657067 3300046691 Bacteria 571
650 Ga0495604_0019157 3300047317 Bacteria 5481
651 Ga0495674_0096904 3300047319 Bacteria 2513
652 Ga0495674_0411249 3300047319 Bacteria 1091
653 Ga0495676_0151455 3300047321 Bacteria 1650
654 Ga0495680_0046852 3300047322 Bacteria 3406
655 Ga0495686_0067257 3300047472 Bacteria 2212
656 Ga0495686_0263851 3300047472 Bacteria 963
657 Ga0495602_0189428 3300048088 Bacteria 1579
658 Ga0496100_0015082 3300048903 Bacteria 4506
659 Ga0496101_0001030 3300048904 Bacteria 16441
660 Ga0496102_0003818 3300048905 Bacteria 12741
661 Ga0496103_0032332 3300048906 Bacteria 3193
662 Ga0496104_0013684 3300048907 Bacteria 7314
663 Ga0496104_0347694 3300048907 Bacteria 1396
664 Ga0496105_0027011 3300048908 Bacteria 4685
665 Ga0496105_0156031 3300048908 Bacteria 1874
666 Ga0496105_0551172 3300048908 Bacteria 900
667 Ga0496106_0017141 3300048909 Bacteria 5362
668 Ga0496106_1209888 3300048909 Bacteria 589
669 Ga0496107_0016059 3300048910 Bacteria 5254
670 Ga0496108_0000307 3300048911 Bacteria 42018
671 Ga0496108_0923553 3300048911 Bacteria 748
672 Ga0496109_0272562 3300048912 Bacteria 1595
673 Ga0496110_0019020 3300048913 Bacteria 5773
674 Ga0496110_0119314 3300048913 Bacteria 2375
675 Ga0496111_0008255 3300048914 Bacteria 6885
676 Ga0496112_0005660 3300048915 Bacteria 10852
677 Ga0496112_0689434 3300048915 Bacteria 950
678 Ga0496114_0001853 3300048917 Bacteria 16012
679 Ga0496115_0443443 3300048918 Bacteria 1049
680 Ga0496117_0454488 3300048920 Bacteria 632
681 Ga0496122_0002341 3300048925 Bacteria 27352
682 Ga0496122_0005147 3300048925 Bacteria 15769
683 Ga0496122_0451652 3300048925 Bacteria 637
684 Ga0496123_0002420 3300048926 Bacteria 23276
685 Ga0496123_0009053 3300048926 Bacteria 9023
686 Ga0496126_0174194 3300048929 Bacteria 1831
687 Ga0496126_0264611 3300048929 Bacteria 1429
688 Ga0501306_093030 3300049127 Bacteria 532
689 Ga0501309_012844 3300049129 Bacteria 1108
690 Ga0501310_017694 3300049130 Bacteria 864
691 Ga0501305_047643 3300049161 Bacteria 713
692 Ga0501312_022933 3300049528 Bacteria 938
693 Ga0501316_006507 3300049532 Bacteria 1244
694 Ga0501317_020275 3300049533 Bacteria 895
695 Ga0501317_037362 3300049533 Bacteria 729
696 Ga0501318_062526 3300049534 Bacteria 574
697 Ga0501321_030548 3300049537 Bacteria 718
698 Ga0501032_0415382 3300049569 Bacteria 863
699 Ga0501032_0751895 3300049569 Bacteria 617
700 Ga0501033_0094345 3300049570 Bacteria 2188
701 Ga0501034_0026488 3300049571 Bacteria 5905
702 Ga0501034_0358600 3300049571 Bacteria 1385
703 Ga0501036_0897237 3300049572 Bacteria 728
704 Ga0501037_0164266 3300049573 Bacteria 1581
705 Ga0501038_0370994 3300049574 Bacteria 1112
706 Ga0501040_0074983 3300049576 Bacteria 2338
707 Ga0501040_0645958 3300049576 Bacteria 765
708 Ga0501041_0028164 3300049577 Bacteria 3388
709 Ga0501041_1018482 3300049577 Bacteria 533
710 Ga0501042_0211817 3300049578 Bacteria 1398
711 Ga0501042_0429403 3300049578 Bacteria 958
712 Ga0501043_0509033 3300049579 Bacteria 899
713 Ga0501046_0070815 3300049580 Bacteria 2710
714 Ga0501047_0089702 3300049581 Bacteria 2952
715 Ga0501047_0113384 3300049581 Bacteria 2593
716 Ga0501047_1122111 3300049581 Bacteria 600
717 Ga0501048_0083340 3300049582 Bacteria 2255
718 Ga0501067_0122573 3300049583 Bacteria 1447
719 Ga0501068_0467317 3300049584 Bacteria 817
720 Ga0501072_0205502 3300049588 Bacteria 1570
721 Ga0501072_0650771 3300049588 Bacteria 829
722 Ga0501076_0513765 3300049592 Bacteria 987
723 Ga0501077_0157142 3300049593 Bacteria 1443
724 Ga0501077_0837610 3300049593 Bacteria 591
725 Ga0501081_0386793 3300049743 Bacteria 1034
726 Ga0501081_1422134 3300049743 Bacteria 526
727 Ga0501083_0822689 3300049744 Bacteria 604
728 Ga0501083_1012940 3300049744 Bacteria 540
729 Ga0501035_0046057 3300049822 Bacteria 3923
730 Ga0501044_0043759 3300049823 Bacteria 4650
731 Ga0501044_1015666 3300049823 Bacteria 701
732 nmdc:mga0yw44_290508_c1 3300050492 Bacteria 1094
733 nmdc:mga0k408_107398_c1 3300050493 Bacteria 1649
734 nmdc:mga0k408_232971_c1 3300050493 Bacteria 1099
735 nmdc:mga05p37_1249226_c1 3300050507 Bacteria 762
736 nmdc:mga05p37_1441101_c1 3300050507 Bacteria 690
737 nmdc:mga05p37_17560_c2 3300050507 Bacteria 7255
738 nmdc:mga05p37_178968_c1 3300050507 Bacteria 2581
739 nmdc:mga05p37_382254_c1 3300050507 Bacteria 1649
740 nmdc:mga05p37_892118_c1 3300050507 Bacteria 960
741 nmdc:mga05p37_90847_c1 3300050507 Bacteria 3763
742 nmdc:mga09592_430858_c1 3300050508 Bacteria 1138
743 nmdc:mga0qj67_179171_c1 3300050509 Bacteria 1721
744 nmdc:mga0qj67_349756_c1 3300050509 Bacteria 1195
745 nmdc:mga06r32_2097_c1 3300050510 Bacteria 17859
746 nmdc:mga06r32_580758_c1 3300050510 Bacteria 1093
747 nmdc:mga08y16_124683_c1 3300050511 Bacteria 2679
748 nmdc:mga08y16_180934_c1 3300050511 Bacteria 2189
749 nmdc:mga0n895_1269968_c1 3300050512 Bacteria 708
750 nmdc:mga0n895_1430599_c1 3300050512 Bacteria 659
751 nmdc:mga0n895_1595338_c1 3300050512 Bacteria 617
752 nmdc:mga0n895_54944_c1 3300050512 Bacteria 3918
753 nmdc:mga0rr50_64147_c1 3300050513 Unclassified 2777
754 nmdc:mga0a205_12817_c1 3300050515 Bacteria 7775
755 nmdc:mga0a205_18928_c2 3300050515 Bacteria 1844
756 nmdc:mga0a205_324510_c1 3300050515 Bacteria 1410
757 nmdc:mga0a205_6280_c1 3300050515 Bacteria 10723
758 Ga0495601_0008491 3300053077 Bacteria 6067
759 Ga0495601_0082083 3300053077 Bacteria 2069
760 Ga0495612_0000233 3300053078 Bacteria 23563
761 Ga0495612_0011527 3300053078 Bacteria 3564
762 Ga0495612_0157053 3300053078 Bacteria 992
763 Ga0495655_0159737 3300053083 Bacteria 714
764 Ga0495595_0014251 3300053084 Bacteria 3369
765 Ga0495619_0005474 3300053085 Bacteria 8050
766 Ga0500643_000191 3300053087 Bacteria 58540
767 Ga0500641_0030230 3300053096 Bacteria 2127
768 Ga0500650_0030528 3300053098 Bacteria 2445
769 Ga0500556_0000020 3300053104 Bacteria 185929
770 Ga0500655_048641 3300053133 Bacteria 842
771 Ga0500559_0000164 3300053136 Bacteria 52626
772 Ga0500559_0059520 3300053136 Bacteria 1700
773 Ga0500568_0000038 3300053139 Bacteria 134267
774 Ga0500573_0000014 3300053140 Bacteria 193353
775 Ga0500573_0150176 3300053140 Bacteria 1276
776 Ga0500573_0177679 3300053140 Bacteria 1146
777 Ga0500573_0238339 3300053140 Bacteria 944
778 Ga0500573_0259226 3300053140 Bacteria 891
779 Ga0500573_0269096 3300053140 Bacteria 868
780 Ga0500573_0556814 3300053140 Bacteria 506
781 Ga0500577_0003340 3300053142 Bacteria 4162
782 Ga0500604_0079229 3300053151 Bacteria 1059
783 Ga0500616_0000027 3300053153 Bacteria 441053
784 Ga0500645_005061 3300053730 Bacteria 4927
785 Ga0500645_026457 3300053730 Bacteria 1765
786 Ga0501084_0224652 3300054114 Bacteria 1585
787 Ga0587084_025618 3300059477 Bacteria 916
788 Ga0587093_015913 3300059478 Unclassified 954
789 Ga0587066_002759 3300059490 Bacteria 1982
790 Ga0587070_019064 3300059491 Bacteria 1132
791 Ga0587070_066997 3300059491 Unclassified 757
792 Ga0587073_0026332 3300059492 Bacteria 1164
793 Ga0587073_0062128 3300059492 Bacteria 879
794 Ga0587073_0084010 3300059492 Bacteria 796
795 Ga0587077_003243 3300059493 Bacteria 2028
796 Ga0587077_044456 3300059493 Unclassified 905
797 Ga0587080_016143 3300059503 Bacteria 1175
798 Ga0587080_089312 3300059503 Unclassified 644
799 Ga0587080_177424 3300059503 Bacteria 509
800 Ga0587082_032406 3300059504 Bacteria 918
801 Ga0587083_0015179 3300059505 Bacteria 1340
802 Ga0587083_0186807 3300059505 Bacteria 583
803 Ga0587085_010852 3300059506 Bacteria 1218
804 Ga0587086_049869 3300059507 Unclassified 672
805 Ga0587086_061409 3300059507 Bacteria 627
806 Ga0587088_012963 3300059508 Bacteria 1271
807 Ga0587088_199624 3300059508 Bacteria 510
808 Ga0587089_046604 3300059509 Unclassified 685
809 Ga0587090_073510 3300059510 Unclassified 672
810 Ga0587091_070721 3300059511 Bacteria 763
811 Ga0587091_082987 3300059511 Bacteria 723
812 Ga0587092_006243 3300059512 Bacteria 1501
813 Ga0587092_057007 3300059512 Bacteria 722
814 Ga0587094_025084 3300059513 Bacteria 891
815 Ga0587094_027203 3300059513 Bacteria 867
816 Ga0587094_092591 3300059513 Bacteria 574
817 Ga0587098_009000 3300059604 Bacteria 1075
818 Ga0587098_077054 3300059604 Bacteria 550
819 Ga0587106_042144 3300059605 Bacteria 779
820 Ga0587106_046852 3300059605 Unclassified 754
821 Ga0587125_081286 3300059607 Bacteria 504
822 Ga0587101_084189 3300059623 Bacteria 608
823 Ga0587101_107934 3300059623 Bacteria 562
824 Ga0587113_024120 3300059625 Unclassified 658
825 Ga0587115_037146 3300059626 Unclassified 747
826 Ga0587115_050427 3300059626 Bacteria 675
827 Ga0587128_005709 3300059630 Bacteria 1502
828 Ga0587128_095202 3300059630 Bacteria 616
829 Ga0587130_006248 3300059631 Bacteria 1086
830 Ga0587062_028152 3300059639 Bacteria 844
831 Ga0587067_041105 3300059640 Bacteria 899
832 Ga0587067_103291 3300059640 Unclassified 663
833 Ga0587068_000864 3300059641 Bacteria 3101
834 Ga0587072_006828 3300059643 Bacteria 1753
835 Ga0587075_015641 3300059644 Bacteria 1070
836 Ga0587076_020316 3300059645 Bacteria 1088
837 Ga0587078_006035 3300059646 Bacteria 1306
838 Ga0587100_030992 3300059648 Unclassified 567
839 Ga0587107_024585 3300059652 Unclassified 870
840 Ga0587110_055651 3300059654 Unclassified 538
841 Ga0587114_079291 3300059655 Unclassified 608
842 Ga0587071_014646 3300060344 Bacteria 1366
843 Ga0587111_0075536 3300060346 Bacteria 795
844 Ga0466962_0188423 3300061719 Bacteria 1006
845 Ga0530510_0020217 3300061734 Bacteria 4735

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005468 Ga0070707_100979356 Ga0070707_1009793562 105
2 3300006028 Ga0070717_10672712 Ga0070717_106727122 111
3 3300039450 Ga0436363_1478957 Ga0436363_1478957_62_445 113
4 3300039453 Ga0436362_0162217 Ga0436362_0162217_838_1221 113
5 3300014969 Ga0157376_10017026 Ga0157376_100170264 117
6 3300025922 Ga0207646_10007605 Ga0207646_1000760520 117
7 3300039447 Ga0436361_1025560 Ga0436361_1025560_255_635 117
8 3300039453 Ga0436362_0058043 Ga0436362_0058043_288_668 117
9 3300005338 Ga0068868_100016636 Ga0068868_10001663610 118
10 3300005364 Ga0070673_101679540 Ga0070673_1016795402 118
11 3300005535 Ga0070684_100379590 Ga0070684_1003795903 118
12 3300005617 Ga0068859_102810840 Ga0068859_1028108402 118
13 3300006931 Ga0097620_102811674 Ga0097620_1028116742 118
14 3300049581 Ga0501047_1122111 Ga0501047_1122111_176_556 118
15 3300005459 Ga0068867_100370145 Ga0068867_1003701451 119
16 3300009147 Ga0114129_11143786 Ga0114129_111437862 119
17 3300009148 Ga0105243_10117314 Ga0105243_101173143 119
18 3300009176 Ga0105242_10360933 Ga0105242_103609331 119
19 3300049569 Ga0501032_0415382 Ga0501032_0415382_15_377 119
20 3300005456 Ga0070678_100035055 Ga0070678_1000350553 120
21 3300005718 Ga0068866_10668450 Ga0068866_106684501 120
22 3300006881 Ga0068865_100067348 Ga0068865_1000673482 120
23 3300009176 Ga0105242_10045883 Ga0105242_100458832 120
24 3300011119 Ga0105246_11893922 Ga0105246_118939222 120
25 3300014969 Ga0157376_10013099 Ga0157376_1001309910 120
26 3300025899 Ga0207642_10085593 Ga0207642_100855932 120
27 3300025921 Ga0207652_10416074 Ga0207652_104160742 120
28 3300025934 Ga0207686_10065759 Ga0207686_100657592 120
29 3300025938 Ga0207704_10092963 Ga0207704_100929633 120
30 3300025938 Ga0207704_10930075 Ga0207704_109300751 120
31 3300026023 Ga0207677_10000955 Ga0207677_1000095520 120
32 3300026089 Ga0207648_10032981 Ga0207648_100329817 120
33 3300026121 Ga0207683_10062368 Ga0207683_100623684 120
34 3300035171 Ga0373946_0532174 Ga0373946_0532174_165_527 120
35 3300035172 Ga0373955_0381778 Ga0373955_0381778_271_633 120
36 3300049579 Ga0501043_0509033 Ga0501043_0509033_194_574 120
37 3300059506 Ga0587085_010852 Ga0587085_010852_198_581 120
38 3300059511 Ga0587091_082987 Ga0587091_082987_55_441 120
39 3300005518 Ga0070699_100266384 Ga0070699_1002663843 121
40 3300025960 Ga0207651_11972691 Ga0207651_119726912 121
41 iso_pu_bacteria 2784746763 2785341845 121
42 iso_pu_bacteria 2808606982 2811845077 121
43 iso_pu_bacteria 2862281513 2862287031 121
44 iso_pu_bacteria 2862382967 2862391296 121
45 iso_pu_bacteria 2863404153 2863411532 121
46 iso_pu_bacteria 2929199973 2929200725 121
47 iso_pu_bacteria 2990059506 2990062338 121
48 iso_pu_bacteria 8008558824 8008566581 121
49 iso_pu_bacteria 8008574985 8008577780 121
50 iso_pu_bacteria 8048406513 8048413810 121
51 iso_pu_bacteria 8055909800 8055913942 121
52 3300004801 Ga0058860_10205765 Ga0058860_102057651 122
53 3300005289 Ga0065704_10324636 Ga0065704_103246362 122
54 3300005335 Ga0070666_10717353 Ga0070666_107173531 122
55 3300005337 Ga0070682_100107622 Ga0070682_1001076222 122
56 3300005337 Ga0070682_100206362 Ga0070682_1002063623 122
57 3300005341 Ga0070691_10190321 Ga0070691_101903212 122
58 3300005343 Ga0070687_100062007 Ga0070687_1000620072 122
59 3300005355 Ga0070671_100600657 Ga0070671_1006006571 122
60 3300005367 Ga0070667_100447653 Ga0070667_1004476532 122
61 3300005406 Ga0070703_10237895 Ga0070703_102378951 122
62 3300005440 Ga0070705_100140505 Ga0070705_1001405051 122
63 3300005444 Ga0070694_100789697 Ga0070694_1007896972 122
64 3300005445 Ga0070708_100483923 Ga0070708_1004839231 122
65 3300005455 Ga0070663_100190503 Ga0070663_1001905033 122
66 3300005459 Ga0068867_100307117 Ga0068867_1003071172 122
67 3300005536 Ga0070697_100249451 Ga0070697_1002494512 122
68 3300005539 Ga0068853_100921056 Ga0068853_1009210562 122
69 3300005544 Ga0070686_100069104 Ga0070686_1000691044 122
70 3300005546 Ga0070696_100283047 Ga0070696_1002830471 122
71 3300005547 Ga0070693_100113168 Ga0070693_1001131683 122
72 3300005549 Ga0070704_100046496 Ga0070704_1000464965 122
73 3300005577 Ga0068857_100862349 Ga0068857_1008623492 122
74 3300005615 Ga0070702_100010797 Ga0070702_1000107975 122
75 3300005718 Ga0068866_10037041 Ga0068866_100370412 122
76 3300005719 Ga0068861_101768534 Ga0068861_1017685341 122
77 3300005841 Ga0068863_100492275 Ga0068863_1004922752 122
78 3300005843 Ga0068860_100043631 Ga0068860_1000436316 122
79 3300006163 Ga0070715_10015070 Ga0070715_100150705 122
80 3300006175 Ga0070712_100123654 Ga0070712_1001236543 122
81 3300006237 Ga0097621_100028937 Ga0097621_1000289376 122
82 3300006358 Ga0068871_100012756 Ga0068871_1000127564 122
83 3300006881 Ga0068865_100103143 Ga0068865_1001031432 122
84 3300009098 Ga0105245_10449169 Ga0105245_104491692 122
85 3300009148 Ga0105243_10148900 Ga0105243_101489004 122
86 3300009148 Ga0105243_10233304 Ga0105243_102333041 122
87 3300009174 Ga0105241_10156169 Ga0105241_101561692 122
88 3300009177 Ga0105248_10058121 Ga0105248_100581213 122
89 3300010375 Ga0105239_11333003 Ga0105239_113330032 122
90 3300011119 Ga0105246_10306561 Ga0105246_103065613 122
91 3300013297 Ga0157378_10005839 Ga0157378_1000583913 122
92 3300013308 Ga0157375_10131733 Ga0157375_101317332 122
93 3300014968 Ga0157379_10169789 Ga0157379_101697892 122
94 3300014969 Ga0157376_10435455 Ga0157376_104354552 122
95 3300020069 Ga0197907_11340891 Ga0197907_113408911 122
96 3300020076 Ga0206355_1291002 Ga0206355_12910022 122
97 3300020080 Ga0206350_11230380 Ga0206350_112303802 122
98 3300020081 Ga0206354_11220093 Ga0206354_112200931 122
99 3300025885 Ga0207653_10050968 Ga0207653_100509683 122
100 3300025899 Ga0207642_10153283 Ga0207642_101532831 122
101 3300025903 Ga0207680_10635716 Ga0207680_106357162 122
102 3300025905 Ga0207685_10030205 Ga0207685_100302054 122
103 3300025911 Ga0207654_10197559 Ga0207654_101975592 122
104 3300025931 Ga0207644_10395917 Ga0207644_103959171 122
105 3300025934 Ga0207686_10038789 Ga0207686_100387892 122
106 3300025935 Ga0207709_10028863 Ga0207709_100288634 122
107 3300025937 Ga0207669_10010070 Ga0207669_100100703 122
108 3300025938 Ga0207704_10199743 Ga0207704_101997433 122
109 3300025941 Ga0207711_10110779 Ga0207711_101107794 122
110 3300025986 Ga0207658_10072055 Ga0207658_100720554 122
111 3300026023 Ga0207677_10589414 Ga0207677_105894142 122
112 3300026067 Ga0207678_10221199 Ga0207678_102211991 122
113 3300026089 Ga0207648_10350658 Ga0207648_103506582 122
114 3300026118 Ga0207675_100793680 Ga0207675_1007936801 122
115 3300026121 Ga0207683_10000603 Ga0207683_1000060327 122
116 3300028379 Ga0268266_10382418 Ga0268266_103824183 122
117 3300028381 Ga0268264_10652629 Ga0268264_106526292 122
118 3300031728 Ga0316578_10858856 Ga0316578_108588561 122
119 3300035089 Ga0373944_0256664 Ga0373944_0256664_73_444 122
120 3300035114 Ga0373939_0372785 Ga0373939_0372785_184_555 122
121 3300035170 Ga0373943_0151500 Ga0373943_0151500_300_671 122
122 3300035725 Ga0373947_0194384 Ga0373947_0194384_138_509 122
123 3300037068 Ga0373925_0908300 Ga0373925_0908300_259_630 122
124 3300041511 Ga0451855_1893647 Ga0451855_1893647_65_433 122
125 3300042876 Ga0451577_0002073 Ga0451577_0002073_11216_11584 122
126 3300044683 Ga0466965_0601618 Ga0466965_0601618_91_462 122
127 3300044712 Ga0453684_0001302 Ga0453684_0001302_12007_12375 122
128 3300044712 Ga0453684_0918660 Ga0453684_0918660_19_387 122
129 3300045051 Ga0451576_0400054 Ga0451576_0400054_446_814 122
130 3300046455 Ga0495603_0066314 Ga0495603_0066314_1726_2097 122
131 3300046457 Ga0495590_0204008 Ga0495590_0204008_122_493 122
132 3300046683 Ga0495658_0161509 Ga0495658_0161509_882_1253 122
133 3300048903 Ga0496100_0015082 Ga0496100_0015082_3472_3843 122
134 3300048904 Ga0496101_0001030 Ga0496101_0001030_1360_1731 122
135 3300048905 Ga0496102_0003818 Ga0496102_0003818_6553_6924 122
136 3300048906 Ga0496103_0032332 Ga0496103_0032332_835_1206 122
137 3300048907 Ga0496104_0013684 Ga0496104_0013684_1146_1517 122
138 3300048908 Ga0496105_0027011 Ga0496105_0027011_4088_4459 122
139 3300048909 Ga0496106_0017141 Ga0496106_0017141_416_787 122
140 3300048909 Ga0496106_1209888 Ga0496106_1209888_180_548 122
141 3300048910 Ga0496107_0016059 Ga0496107_0016059_537_908 122
142 3300048911 Ga0496108_0923553 Ga0496108_0923553_144_515 122
143 3300048917 Ga0496114_0001853 Ga0496114_0001853_6576_6947 122
144 3300048918 Ga0496115_0443443 Ga0496115_0443443_187_558 122
145 3300048925 Ga0496122_0451652 Ga0496122_0451652_79_447 122
146 3300049127 Ga0501306_093030 Ga0501306_093030_125_496 122
147 3300049576 Ga0501040_0074983 Ga0501040_0074983_1083_1454 122
148 3300049593 Ga0501077_0157142 Ga0501077_0157142_329_700 122
149 3300049743 Ga0501081_0386793 Ga0501081_0386793_339_710 122
150 3300049744 Ga0501083_1012940 Ga0501083_1012940_100_468 122
151 3300059477 Ga0587084_025618 Ga0587084_025618_434_802 122
152 3300059511 Ga0587091_070721 Ga0587091_070721_278_649 122
153 3300059604 Ga0587098_077054 Ga0587098_077054_128_496 122
154 3300059607 Ga0587125_081286 Ga0587125_081286_86_457 122
155 3300059626 Ga0587115_050427 Ga0587115_050427_142_513 122
156 3300059639 Ga0587062_028152 Ga0587062_028152_406_774 122
157 3300005347 Ga0070668_100333913 Ga0070668_1003339133 123
158 3300005530 Ga0070679_100208662 Ga0070679_1002086623 123
159 3300005535 Ga0070684_100545540 Ga0070684_1005455402 123
160 3300005563 Ga0068855_100374116 Ga0068855_1003741161 123
161 3300005616 Ga0068852_102423230 Ga0068852_1024232301 123
162 3300006195 Ga0075366_10181106 Ga0075366_101811062 123
163 3300007076 Ga0075435_100152699 Ga0075435_1001526993 123
164 3300013104 Ga0157370_10289959 Ga0157370_102899593 123
165 3300013104 Ga0157370_11230718 Ga0157370_112307182 123
166 3300013307 Ga0157372_10233574 Ga0157372_102335743 123
167 3300020070 Ga0206356_10387064 Ga0206356_103870642 123
168 3300020082 Ga0206353_10883225 Ga0206353_108832252 123
169 3300025910 Ga0207684_10686332 Ga0207684_106863322 123
170 3300025921 Ga0207652_10196319 Ga0207652_101963193 123
171 3300025944 Ga0207661_10090826 Ga0207661_100908262 123
172 3300025949 Ga0207667_11651317 Ga0207667_116513171 123
173 3300026078 Ga0207702_10973673 Ga0207702_109736732 123
174 3300044712 Ga0453684_0001518 Ga0453684_0001518_15355_15726 123
175 3300044735 Ga0466968_0562001 Ga0466968_0562001_90_464 123
176 3300048929 Ga0496126_0264611 Ga0496126_0264611_620_991 123
177 3300049577 Ga0501041_0028164 Ga0501041_0028164_2403_2774 123
178 3300049577 Ga0501041_1018482 Ga0501041_1018482_95_520 123
179 3300049578 Ga0501042_0211817 Ga0501042_0211817_724_1095 123
180 3300049578 Ga0501042_0429403 Ga0501042_0429403_180_605 123
181 3300049582 Ga0501048_0083340 Ga0501048_0083340_1529_1900 123
182 3300049584 Ga0501068_0467317 Ga0501068_0467317_339_710 123
183 3300049588 Ga0501072_0650771 Ga0501072_0650771_281_652 123
184 3300050493 nmdc:mga0k408_232971_c1 nmdc:mga0k408_232971_c1_450_821 123
185 3300050513 nmdc:mga0rr50_64147_c1 nmdc:mga0rr50_64147_c1_484_870 123
186 3300054114 Ga0501084_0224652 Ga0501084_0224652_1099_1470 123
187 3300059513 Ga0587094_025084 Ga0587094_025084_405_779 123
188 3300060346 Ga0587111_0075536 Ga0587111_0075536_349_720 123
189 3300061734 Ga0530510_0020217 Ga0530510_0020217_1778_2149 123
190 3300005434 Ga0070709_10000287 Ga0070709_1000028720 124
191 3300005435 Ga0070714_100001531 Ga0070714_1000015314 124
192 3300005435 Ga0070714_100074068 Ga0070714_1000740683 124
193 3300005435 Ga0070714_100357483 Ga0070714_1003574832 124
194 3300005436 Ga0070713_100000752 Ga0070713_10000075212 124
195 3300006846 Ga0075430_100376334 Ga0075430_1003763343 124
196 3300006847 Ga0075431_100002441 Ga0075431_1000024418 124
197 3300006852 Ga0075433_10146799 Ga0075433_101467993 124
198 3300013062 Ga0154010_136519 Ga0154010_1365192 124
199 3300013102 Ga0157371_10064200 Ga0157371_100642004 124
200 3300013307 Ga0157372_11449944 Ga0157372_114499442 124
201 3300014326 Ga0157380_10960690 Ga0157380_109606901 124
202 3300020069 Ga0197907_11244701 Ga0197907_112447011 124
203 3300020070 Ga0206356_11234993 Ga0206356_112349933 124
204 3300020078 Ga0206352_10603617 Ga0206352_106036173 124
205 3300020080 Ga0206350_11522585 Ga0206350_115225853 124
206 3300020081 Ga0206354_11150211 Ga0206354_111502114 124
207 3300020082 Ga0206353_10705318 Ga0206353_107053184 124
208 3300020610 Ga0154015_1210807 Ga0154015_12108072 124
209 3300022467 Ga0224712_10096658 Ga0224712_100966581 124
210 3300025906 Ga0207699_10000308 Ga0207699_1000030811 124
211 3300025912 Ga0207707_11065343 Ga0207707_110653432 124
212 3300025928 Ga0207700_10000991 Ga0207700_1000099116 124
213 3300025929 Ga0207664_10020594 Ga0207664_100205944 124
214 3300025939 Ga0207665_11165695 Ga0207665_111656951 124
215 3300041443 Ga0451789_0018324 Ga0451789_0018324_16_390 124
216 3300041443 Ga0451789_0548624 Ga0451789_0548624_417_791 124
217 3300041444 Ga0451790_26253 Ga0451790_26253_195_569 124
218 3300041446 Ga0451794_48340 Ga0451794_48340_866_1240 124
219 3300041451 Ga0451791_0679889 Ga0451791_0679889_230_604 124
220 3300041452 Ga0451793_0502801 Ga0451793_0502801_16_390 124
221 3300041453 Ga0451797_0168955 Ga0451797_0168955_756_1130 124
222 3300041456 Ga0451795_0256947 Ga0451795_0256947_571_945 124
223 3300041460 Ga0451802_1688259 Ga0451802_1688259_132_506 124
224 3300041507 Ga0451851_0136488 Ga0451851_0136488_298_672 124
225 3300041907 Ga0452268_06279 Ga0452268_06279_242_616 124
226 3300042876 Ga0451577_0097736 Ga0451577_0097736_2147_2521 124
227 3300042876 Ga0451577_0312703 Ga0451577_0312703_596_970 124
228 3300042876 Ga0451577_0714381 Ga0451577_0714381_241_615 124
229 3300044673 Ga0453683_0000086 Ga0453683_0000086_79229_79603 124
230 3300044673 Ga0453683_0000096 Ga0453683_0000096_131991_132365 124
231 3300044673 Ga0453683_0119787 Ga0453683_0119787_901_1275 124
232 3300044693 Ga0466961_0460957 Ga0466961_0460957_154_534 124
233 3300044694 Ga0466963_0022695 Ga0466963_0022695_2371_2748 124
234 3300044694 Ga0466963_0059705 Ga0466963_0059705_925_1302 124
235 3300044712 Ga0453684_0000037 Ga0453684_0000037_418197_418571 124
236 3300044712 Ga0453684_0003980 Ga0453684_0003980_4243_4617 124
237 3300044712 Ga0453684_0029625 Ga0453684_0029625_65_439 124
238 3300044712 Ga0453684_0043756 Ga0453684_0043756_4375_4749 124
239 3300044842 Ga0466957_0530902 Ga0466957_0530902_414_791 124
240 3300045051 Ga0451576_0005300 Ga0451576_0005300_8122_8496 124
241 3300045051 Ga0451576_0047121 Ga0451576_0047121_1355_1729 124
242 3300045051 Ga0451576_0492818 Ga0451576_0492818_772_1146 124
243 3300045976 Ga0466967_0033182 Ga0466967_0033182_3528_3905 124
244 3300049528 Ga0501312_022933 Ga0501312_022933_512_886 124
245 3300049532 Ga0501316_006507 Ga0501316_006507_188_562 124
246 3300049570 Ga0501033_0094345 Ga0501033_0094345_264_638 124
247 3300049571 Ga0501034_0358600 Ga0501034_0358600_921_1295 124
248 3300049573 Ga0501037_0164266 Ga0501037_0164266_1056_1430 124
249 3300049574 Ga0501038_0370994 Ga0501038_0370994_258_632 124
250 3300049580 Ga0501046_0070815 Ga0501046_0070815_2076_2450 124
251 3300049581 Ga0501047_0113384 Ga0501047_0113384_93_467 124
252 3300049583 Ga0501067_0122573 Ga0501067_0122573_419_796 124
253 3300049744 Ga0501083_0822689 Ga0501083_0822689_132_506 124
254 3300049822 Ga0501035_0046057 Ga0501035_0046057_1264_1638 124
255 3300049823 Ga0501044_0043759 Ga0501044_0043759_207_581 124
256 3300050509 nmdc:mga0qj67_349756_c1 nmdc:mga0qj67_349756_c1_640_1062 124
257 3300050510 nmdc:mga06r32_2097_c1 nmdc:mga06r32_2097_c1_5174_5596 124
258 3300050515 nmdc:mga0a205_324510_c1 nmdc:mga0a205_324510_c1_788_1174 124
259 3300053098 Ga0500650_0030528 Ga0500650_0030528_1805_2179 124
260 3300053136 Ga0500559_0000164 Ga0500559_0000164_33382_33756 124
261 3300053136 Ga0500559_0059520 Ga0500559_0059520_621_995 124
262 3300053140 Ga0500573_0000014 Ga0500573_0000014_8691_9065 124
263 3300053140 Ga0500573_0150176 Ga0500573_0150176_639_1013 124
264 3300053140 Ga0500573_0177679 Ga0500573_0177679_673_1047 124
265 3300053140 Ga0500573_0238339 Ga0500573_0238339_161_535 124
266 3300053140 Ga0500573_0259226 Ga0500573_0259226_485_859 124
267 3300053140 Ga0500573_0269096 Ga0500573_0269096_314_688 124
268 3300053140 Ga0500573_0556814 Ga0500573_0556814_74_448 124
269 3300053142 Ga0500577_0003340 Ga0500577_0003340_369_743 124
270 3300053151 Ga0500604_0079229 Ga0500604_0079229_377_751 124
271 3300059492 Ga0587073_0062128 Ga0587073_0062128_156_533 124
272 3300059605 Ga0587106_042144 Ga0587106_042144_145_522 124
273 3300059623 Ga0587101_107934 Ga0587101_107934_125_502 124
274 3300059640 Ga0587067_041105 Ga0587067_041105_475_852 124
275 3300059643 Ga0587072_006828 Ga0587072_006828_401_781 124
276 3300003203 JGI25406J46586_10005150 JGI25406J46586_100051505 125
277 3300003323 rootH1_10031668 rootH1_100316688 125
278 3300003373 JGI25407J50210_10009225 JGI25407J50210_100092254 125
279 3300003544 Ga0007417J51691_1058728 Ga0007417J51691_10587281 125
280 3300003574 Ga0007410J51695_1062137 Ga0007410J51695_10621371 125
281 3300003575 Ga0007409J51694_1055064 Ga0007409J51694_10550642 125
282 3300003575 Ga0007409J51694_1071519 Ga0007409J51694_10715191 125
283 3300003579 Ga0007429J51699_1100314 Ga0007429J51699_11003141 125
284 3300004798 Ga0058859_10015336 Ga0058859_100153361 125
285 3300004798 Ga0058859_11551370 Ga0058859_115513701 125
286 3300004798 Ga0058859_11778114 Ga0058859_117781143 125
287 3300004799 Ga0058863_11594786 Ga0058863_115947862 125
288 3300004799 Ga0058863_11945250 Ga0058863_119452504 125
289 3300004800 Ga0058861_10017791 Ga0058861_100177912 125
290 3300004800 Ga0058861_10648189 Ga0058861_106481891 125
291 3300004800 Ga0058861_11220782 Ga0058861_112207823 125
292 3300004801 Ga0058860_10013830 Ga0058860_100138301 125
293 3300004801 Ga0058860_12064927 Ga0058860_120649271 125
294 3300004801 Ga0058860_12081306 Ga0058860_120813061 125
295 3300004803 Ga0058862_10088370 Ga0058862_100883702 125
296 3300004803 Ga0058862_11852680 Ga0058862_118526803 125
297 3300004803 Ga0058862_12088318 Ga0058862_120883183 125
298 3300004803 Ga0058862_12231526 Ga0058862_122315261 125
299 3300004803 Ga0058862_12481273 Ga0058862_124812735 125
300 3300004803 Ga0058862_12560532 Ga0058862_125605321 125
301 3300004803 Ga0058862_12561774 Ga0058862_125617741 125
302 3300004803 Ga0058862_12761214 Ga0058862_127612142 125
303 3300004803 Ga0058862_12854382 Ga0058862_128543821 125
304 3300005327 Ga0070658_10004878 Ga0070658_100048784 125
305 3300005327 Ga0070658_10204966 Ga0070658_102049662 125
306 3300005327 Ga0070658_10949111 Ga0070658_109491112 125
307 3300005329 Ga0070683_100062110 Ga0070683_1000621104 125
308 3300005329 Ga0070683_100338735 Ga0070683_1003387352 125
309 3300005330 Ga0070690_100462428 Ga0070690_1004624282 125
310 3300005330 Ga0070690_101257374 Ga0070690_1012573741 125
311 3300005331 Ga0070670_101106232 Ga0070670_1011062321 125
312 3300005331 Ga0070670_101985024 Ga0070670_1019850241 125
313 3300005333 Ga0070677_10046592 Ga0070677_100465922 125
314 3300005334 Ga0068869_100007769 Ga0068869_1000077691 125
315 3300005334 Ga0068869_100394002 Ga0068869_1003940021 125
316 3300005335 Ga0070666_10033476 Ga0070666_100334765 125
317 3300005335 Ga0070666_10313703 Ga0070666_103137031 125
318 3300005337 Ga0070682_100065359 Ga0070682_1000653592 125
319 3300005337 Ga0070682_100173119 Ga0070682_1001731192 125
320 3300005338 Ga0068868_100001063 Ga0068868_1000010632 125
321 3300005338 Ga0068868_100002784 Ga0068868_1000027849 125
322 3300005339 Ga0070660_100066916 Ga0070660_1000669161 125
323 3300005340 Ga0070689_100317127 Ga0070689_1003171271 125
324 3300005340 Ga0070689_100613530 Ga0070689_1006135302 125
325 3300005340 Ga0070689_100713250 Ga0070689_1007132501 125
326 3300005341 Ga0070691_10009724 Ga0070691_100097242 125
327 3300005341 Ga0070691_10267874 Ga0070691_102678741 125
328 3300005345 Ga0070692_10375941 Ga0070692_103759411 125
329 3300005347 Ga0070668_100045774 Ga0070668_1000457742 125
330 3300005353 Ga0070669_100083826 Ga0070669_1000838265 125
331 3300005353 Ga0070669_101057863 Ga0070669_1010578631 125
332 3300005354 Ga0070675_100173942 Ga0070675_1001739424 125
333 3300005354 Ga0070675_101556168 Ga0070675_1015561681 125
334 3300005355 Ga0070671_100295611 Ga0070671_1002956112 125
335 3300005356 Ga0070674_100564701 Ga0070674_1005647011 125
336 3300005356 Ga0070674_100628653 Ga0070674_1006286532 125
337 3300005364 Ga0070673_100028802 Ga0070673_1000288025 125
338 3300005365 Ga0070688_101317990 Ga0070688_1013179901 125
339 3300005367 Ga0070667_100014403 Ga0070667_1000144035 125
340 3300005367 Ga0070667_101111627 Ga0070667_1011116271 125
341 3300005436 Ga0070713_100003809 Ga0070713_1000038094 125
342 3300005436 Ga0070713_102070154 Ga0070713_1020701541 125
343 3300005440 Ga0070705_100030655 Ga0070705_1000306552 125
344 3300005444 Ga0070694_100732716 Ga0070694_1007327162 125
345 3300005456 Ga0070678_100102809 Ga0070678_1001028094 125
346 3300005456 Ga0070678_102080239 Ga0070678_1020802391 125
347 3300005456 Ga0070678_102361106 Ga0070678_1023611061 125
348 3300005457 Ga0070662_100069527 Ga0070662_1000695274 125
349 3300005457 Ga0070662_101401841 Ga0070662_1014018412 125
350 3300005458 Ga0070681_10102025 Ga0070681_101020253 125
351 3300005459 Ga0068867_100031077 Ga0068867_1000310775 125
352 3300005459 Ga0068867_100045142 Ga0068867_1000451421 125
353 3300005466 Ga0070685_10023219 Ga0070685_100232192 125
354 3300005467 Ga0070706_100204437 Ga0070706_1002044373 125
355 3300005468 Ga0070707_100440745 Ga0070707_1004407453 125
356 3300005468 Ga0070707_100564069 Ga0070707_1005640692 125
357 3300005518 Ga0070699_100180303 Ga0070699_1001803033 125
358 3300005530 Ga0070679_100246928 Ga0070679_1002469282 125
359 3300005535 Ga0070684_100012677 Ga0070684_1000126773 125
360 3300005535 Ga0070684_100387191 Ga0070684_1003871912 125
361 3300005536 Ga0070697_100082909 Ga0070697_1000829094 125
362 3300005536 Ga0070697_101174481 Ga0070697_1011744811 125
363 3300005539 Ga0068853_100054623 Ga0068853_1000546235 125
364 3300005539 Ga0068853_100982656 Ga0068853_1009826562 125
365 3300005543 Ga0070672_100164427 Ga0070672_1001644274 125
366 3300005543 Ga0070672_100390898 Ga0070672_1003908981 125
367 3300005543 Ga0070672_101192960 Ga0070672_1011929601 125
368 3300005544 Ga0070686_100107244 Ga0070686_1001072443 125
369 3300005546 Ga0070696_100147544 Ga0070696_1001475443 125
370 3300005546 Ga0070696_100257079 Ga0070696_1002570791 125
371 3300005547 Ga0070693_100146860 Ga0070693_1001468603 125
372 3300005548 Ga0070665_100202700 Ga0070665_1002027002 125
373 3300005548 Ga0070665_100761615 Ga0070665_1007616152 125
374 3300005549 Ga0070704_101384334 Ga0070704_1013843341 125
375 3300005563 Ga0068855_100383109 Ga0068855_1003831093 125
376 3300005577 Ga0068857_100008064 Ga0068857_10000806411 125
377 3300005577 Ga0068857_100342271 Ga0068857_1003422713 125
378 3300005577 Ga0068857_101088557 Ga0068857_1010885571 125
379 3300005578 Ga0068854_100511854 Ga0068854_1005118541 125
380 3300005578 Ga0068854_100660387 Ga0068854_1006603871 125
381 3300005614 Ga0068856_100038121 Ga0068856_1000381213 125
382 3300005615 Ga0070702_101304655 Ga0070702_1013046551 125
383 3300005615 Ga0070702_101467705 Ga0070702_1014677051 125
384 3300005617 Ga0068859_100058552 Ga0068859_1000585526 125
385 3300005617 Ga0068859_100068084 Ga0068859_1000680845 125
386 3300005617 Ga0068859_100674726 Ga0068859_1006747262 125
387 3300005617 Ga0068859_102124019 Ga0068859_1021240191 125
388 3300005718 Ga0068866_10162411 Ga0068866_101624111 125
389 3300005719 Ga0068861_100416822 Ga0068861_1004168223 125
390 3300005719 Ga0068861_101521615 Ga0068861_1015216151 125
391 3300005834 Ga0068851_10153838 Ga0068851_101538382 125
392 3300005840 Ga0068870_10002377 Ga0068870_100023775 125
393 3300005841 Ga0068863_100334496 Ga0068863_1003344963 125
394 3300005841 Ga0068863_100351346 Ga0068863_1003513462 125
395 3300005841 Ga0068863_100389505 Ga0068863_1003895053 125
396 3300005841 Ga0068863_101499214 Ga0068863_1014992141 125
397 3300005843 Ga0068860_100089660 Ga0068860_1000896604 125
398 3300005844 Ga0068862_101048855 Ga0068862_1010488551 125
399 3300005981 Ga0081538_10005557 Ga0081538_100055577 125
400 3300005981 Ga0081538_10025517 Ga0081538_100255176 125
401 3300005985 Ga0081539_10000072 Ga0081539_1000007225 125
402 3300005985 Ga0081539_10004359 Ga0081539_1000435927 125
403 3300006195 Ga0075366_10113191 Ga0075366_101131914 125
404 3300006237 Ga0097621_100011986 Ga0097621_1000119866 125
405 3300006237 Ga0097621_100119649 Ga0097621_1001196494 125
406 3300006237 Ga0097621_101027592 Ga0097621_1010275922 125
407 3300006237 Ga0097621_101121116 Ga0097621_1011211162 125
408 3300006844 Ga0075428_100644896 Ga0075428_1006448962 125
409 3300006846 Ga0075430_100300743 Ga0075430_1003007433 125
410 3300006852 Ga0075433_10015274 Ga0075433_100152742 125
411 3300006852 Ga0075433_10016739 Ga0075433_100167391 125
412 3300006871 Ga0075434_100039407 Ga0075434_1000394074 125
413 3300006871 Ga0075434_100562457 Ga0075434_1005624572 125
414 3300006871 Ga0075434_102012433 Ga0075434_1020124332 125
415 3300006880 Ga0075429_100817737 Ga0075429_1008177371 125
416 3300006881 Ga0068865_101432084 Ga0068865_1014320842 125
417 3300006931 Ga0097620_100058548 Ga0097620_1000585483 125
418 3300006931 Ga0097620_100068093 Ga0097620_1000680935 125
419 3300006931 Ga0097620_100674757 Ga0097620_1006747572 125
420 3300006931 Ga0097620_100980998 Ga0097620_1009809982 125
421 3300006931 Ga0097620_102123909 Ga0097620_1021239091 125
422 3300009093 Ga0105240_10775736 Ga0105240_107757362 125
423 3300009094 Ga0111539_10041238 Ga0111539_100412386 125
424 3300009094 Ga0111539_11571081 Ga0111539_115710812 125
425 3300009147 Ga0114129_10006513 Ga0114129_1000651317 125
426 3300009147 Ga0114129_10032401 Ga0114129_1003240113 125
427 3300009147 Ga0114129_10291592 Ga0114129_102915923 125
428 3300009147 Ga0114129_10304184 Ga0114129_103041841 125
429 3300009147 Ga0114129_10659542 Ga0114129_106595421 125
430 3300009147 Ga0114129_11020356 Ga0114129_110203561 125
431 3300009147 Ga0114129_11739705 Ga0114129_117397052 125
432 3300009148 Ga0105243_10295437 Ga0105243_102954372 125
433 3300009148 Ga0105243_10686561 Ga0105243_106865612 125
434 3300009174 Ga0105241_11925681 Ga0105241_119256811 125
435 3300009176 Ga0105242_10011746 Ga0105242_100117464 125
436 3300009176 Ga0105242_12762276 Ga0105242_127622761 125
437 3300009177 Ga0105248_10437935 Ga0105248_104379352 125
438 3300009553 Ga0105249_10500340 Ga0105249_105003403 125
439 3300009553 Ga0105249_12324716 Ga0105249_123247162 125
440 3300009553 Ga0105249_12863410 Ga0105249_128634101 125
441 3300011119 Ga0105246_10328381 Ga0105246_103283812 125
442 3300011119 Ga0105246_10339176 Ga0105246_103391761 125
443 3300012506 Ga0157324_1038710 Ga0157324_10387101 125
444 3300013100 Ga0157373_10307442 Ga0157373_103074421 125
445 3300013102 Ga0157371_10668166 Ga0157371_106681661 125
446 3300013105 Ga0157369_10900785 Ga0157369_109007852 125
447 3300013296 Ga0157374_10130270 Ga0157374_101302704 125
448 3300013296 Ga0157374_10171084 Ga0157374_101710841 125
449 3300013296 Ga0157374_11283256 Ga0157374_112832562 125
450 3300013297 Ga0157378_10094032 Ga0157378_100940323 125
451 3300013297 Ga0157378_10250264 Ga0157378_102502641 125
452 3300013297 Ga0157378_10643767 Ga0157378_106437672 125
453 3300013297 Ga0157378_11455173 Ga0157378_114551731 125
454 3300013297 Ga0157378_11674727 Ga0157378_116747272 125
455 3300013306 Ga0163162_10038469 Ga0163162_100384694 125
456 3300013306 Ga0163162_10184062 Ga0163162_101840621 125
457 3300013306 Ga0163162_10242652 Ga0163162_102426523 125
458 3300013306 Ga0163162_10682823 Ga0163162_106828232 125
459 3300013306 Ga0163162_12136836 Ga0163162_121368361 125
460 3300013307 Ga0157372_10160060 Ga0157372_101600604 125
461 3300013307 Ga0157372_10226498 Ga0157372_102264982 125
462 3300013307 Ga0157372_10689465 Ga0157372_106894653 125
463 3300013308 Ga0157375_10143967 Ga0157375_101439671 125
464 3300013308 Ga0157375_10280603 Ga0157375_102806033 125
465 3300014325 Ga0163163_10276709 Ga0163163_102767093 125
466 3300014325 Ga0163163_11217941 Ga0163163_112179411 125
467 3300014325 Ga0163163_11454181 Ga0163163_114541811 125
468 3300014326 Ga0157380_10004578 Ga0157380_1000457810 125
469 3300014326 Ga0157380_10082084 Ga0157380_100820844 125
470 3300014326 Ga0157380_10350663 Ga0157380_103506632 125
471 3300014326 Ga0157380_10989690 Ga0157380_109896902 125
472 3300014326 Ga0157380_11251326 Ga0157380_112513262 125
473 3300014326 Ga0157380_11465959 Ga0157380_114659592 125
474 3300014326 Ga0157380_11508863 Ga0157380_115088631 125
475 3300014745 Ga0157377_10867265 Ga0157377_108672651 125
476 3300014745 Ga0157377_11093103 Ga0157377_110931031 125
477 3300014969 Ga0157376_10332507 Ga0157376_103325071 125
478 3300017792 Ga0163161_10519792 Ga0163161_105197922 125
479 3300020069 Ga0197907_10166582 Ga0197907_101665823 125
480 3300020069 Ga0197907_10544785 Ga0197907_105447851 125
481 3300020069 Ga0197907_10643572 Ga0197907_106435723 125
482 3300020069 Ga0197907_10684168 Ga0197907_106841681 125
483 3300020069 Ga0197907_11002581 Ga0197907_110025813 125
484 3300020069 Ga0197907_11115412 Ga0197907_111154122 125
485 3300020069 Ga0197907_11171440 Ga0197907_111714402 125
486 3300020069 Ga0197907_11347398 Ga0197907_113473982 125
487 3300020070 Ga0206356_10029991 Ga0206356_100299913 125
488 3300020070 Ga0206356_10393104 Ga0206356_103931042 125
489 3300020070 Ga0206356_10527780 Ga0206356_105277802 125
490 3300020070 Ga0206356_10589241 Ga0206356_105892412 125
491 3300020070 Ga0206356_11184870 Ga0206356_111848702 125
492 3300020070 Ga0206356_11465735 Ga0206356_114657352 125
493 3300020070 Ga0206356_11475959 Ga0206356_114759591 125
494 3300020070 Ga0206356_11723060 Ga0206356_117230601 125
495 3300020075 Ga0206349_1149751 Ga0206349_11497512 125
496 3300020075 Ga0206349_1306057 Ga0206349_13060571 125
497 3300020075 Ga0206349_1416863 Ga0206349_14168633 125
498 3300020075 Ga0206349_1428736 Ga0206349_14287363 125
499 3300020075 Ga0206349_1451067 Ga0206349_14510671 125
500 3300020075 Ga0206349_1547646 Ga0206349_15476461 125
501 3300020075 Ga0206349_1630809 Ga0206349_16308094 125
502 3300020075 Ga0206349_1746519 Ga0206349_17465192 125
503 3300020076 Ga0206355_1023074 Ga0206355_10230743 125
504 3300020076 Ga0206355_1525315 Ga0206355_15253152 125
505 3300020076 Ga0206355_1716015 Ga0206355_17160152 125
506 3300020077 Ga0206351_10122949 Ga0206351_101229492 125
507 3300020077 Ga0206351_10168106 Ga0206351_101681063 125
508 3300020077 Ga0206351_10458947 Ga0206351_104589472 125
509 3300020077 Ga0206351_10693876 Ga0206351_106938761 125
510 3300020077 Ga0206351_10913767 Ga0206351_109137673 125
511 3300020078 Ga0206352_10519505 Ga0206352_105195051 125
512 3300020078 Ga0206352_10636518 Ga0206352_106365182 125
513 3300020078 Ga0206352_10752522 Ga0206352_107525222 125
514 3300020078 Ga0206352_11134617 Ga0206352_111346173 125
515 3300020078 Ga0206352_11154477 Ga0206352_111544771 125
516 3300020078 Ga0206352_11339826 Ga0206352_113398263 125
517 3300020080 Ga0206350_10235783 Ga0206350_102357832 125
518 3300020080 Ga0206350_10358460 Ga0206350_103584602 125
519 3300020080 Ga0206350_10692694 Ga0206350_106926942 125
520 3300020080 Ga0206350_10805923 Ga0206350_108059233 125
521 3300020080 Ga0206350_11476777 Ga0206350_114767773 125
522 3300020081 Ga0206354_10365710 Ga0206354_103657103 125
523 3300020081 Ga0206354_10736349 Ga0206354_107363495 125
524 3300020081 Ga0206354_10803466 Ga0206354_108034662 125
525 3300020081 Ga0206354_10843853 Ga0206354_108438532 125
526 3300020081 Ga0206354_11078476 Ga0206354_110784762 125
527 3300020081 Ga0206354_11311334 Ga0206354_113113342 125
528 3300020081 Ga0206354_11618312 Ga0206354_116183122 125
529 3300020082 Ga0206353_10011578 Ga0206353_100115782 125
530 3300020082 Ga0206353_10034385 Ga0206353_100343851 125
531 3300020082 Ga0206353_11236968 Ga0206353_112369682 125
532 3300020082 Ga0206353_11328929 Ga0206353_113289292 125
533 3300020082 Ga0206353_12033233 Ga0206353_120332333 125
534 3300020610 Ga0154015_1137626 Ga0154015_11376261 125
535 3300021388 Ga0213875_10022465 Ga0213875_100224653 125
536 3300021388 Ga0213875_10025319 Ga0213875_100253194 125
537 3300021388 Ga0213875_10515005 Ga0213875_105150051 125
538 3300021441 Ga0213871_10053535 Ga0213871_100535352 125
539 3300022467 Ga0224712_10000389 Ga0224712_100003892 125
540 3300022467 Ga0224712_10001802 Ga0224712_100018026 125
541 3300022467 Ga0224712_10086997 Ga0224712_100869972 125
542 3300022467 Ga0224712_10092846 Ga0224712_100928463 125
543 3300022467 Ga0224712_10184076 Ga0224712_101840762 125
544 3300022467 Ga0224712_10471685 Ga0224712_104716851 125
545 3300022467 Ga0224712_10689410 Ga0224712_106894101 125
546 3300025893 Ga0207682_10034095 Ga0207682_100340952 125
547 3300025899 Ga0207642_10161529 Ga0207642_101615292 125
548 3300025901 Ga0207688_10020657 Ga0207688_100206575 125
549 3300025903 Ga0207680_10013559 Ga0207680_100135594 125
550 3300025907 Ga0207645_10000354 Ga0207645_1000035418 125
551 3300025907 Ga0207645_10005100 Ga0207645_100051003 125
552 3300025908 Ga0207643_10005287 Ga0207643_100052877 125
553 3300025909 Ga0207705_10380852 Ga0207705_103808521 125
554 3300025909 Ga0207705_11169708 Ga0207705_111697081 125
555 3300025910 Ga0207684_10059589 Ga0207684_100595894 125
556 3300025910 Ga0207684_10785242 Ga0207684_107852421 125
557 3300025912 Ga0207707_10037560 Ga0207707_100375606 125
558 3300025913 Ga0207695_10466604 Ga0207695_104666042 125
559 3300025914 Ga0207671_10928472 Ga0207671_109284721 125
560 3300025918 Ga0207662_10084359 Ga0207662_100843594 125
561 3300025920 Ga0207649_11219873 Ga0207649_112198731 125
562 3300025921 Ga0207652_10343020 Ga0207652_103430203 125
563 3300025922 Ga0207646_10343928 Ga0207646_103439283 125
564 3300025922 Ga0207646_10661806 Ga0207646_106618062 125
565 3300025923 Ga0207681_10157824 Ga0207681_101578243 125
566 3300025923 Ga0207681_10212848 Ga0207681_102128483 125
567 3300025925 Ga0207650_10127944 Ga0207650_101279444 125
568 3300025925 Ga0207650_10767795 Ga0207650_107677952 125
569 3300025926 Ga0207659_10016365 Ga0207659_100163657 125
570 3300025926 Ga0207659_10150503 Ga0207659_101505032 125
571 3300025927 Ga0207687_10388270 Ga0207687_103882703 125
572 3300025928 Ga0207700_10006673 Ga0207700_100066733 125
573 3300025928 Ga0207700_11437110 Ga0207700_114371102 125
574 3300025929 Ga0207664_10003417 Ga0207664_1000341711 125
575 3300025931 Ga0207644_10273141 Ga0207644_102731412 125
576 3300025933 Ga0207706_10108625 Ga0207706_101086254 125
577 3300025933 Ga0207706_10145637 Ga0207706_101456371 125
578 3300025934 Ga0207686_11424028 Ga0207686_114240281 125
579 3300025935 Ga0207709_10211916 Ga0207709_102119162 125
580 3300025935 Ga0207709_10699968 Ga0207709_106999682 125
581 3300025936 Ga0207670_11634489 Ga0207670_116344891 125
582 3300025937 Ga0207669_11698326 Ga0207669_116983261 125
583 3300025937 Ga0207669_11869443 Ga0207669_118694431 125
584 3300025940 Ga0207691_10048624 Ga0207691_100486245 125
585 3300025940 Ga0207691_10353298 Ga0207691_103532983 125
586 3300025940 Ga0207691_11653908 Ga0207691_116539081 125
587 3300025942 Ga0207689_10026074 Ga0207689_100260744 125
588 3300025942 Ga0207689_10062686 Ga0207689_100626864 125
589 3300025944 Ga0207661_10000901 Ga0207661_100009014 125
590 3300025944 Ga0207661_10302056 Ga0207661_103020563 125
591 3300025944 Ga0207661_10820742 Ga0207661_108207422 125
592 3300025944 Ga0207661_11921319 Ga0207661_119213191 125
593 3300025960 Ga0207651_10003788 Ga0207651_100037884 125
594 3300025960 Ga0207651_10122057 Ga0207651_101220573 125
595 3300025961 Ga0207712_10152649 Ga0207712_101526492 125
596 3300025981 Ga0207640_10012564 Ga0207640_100125647 125
597 3300025981 Ga0207640_11581856 Ga0207640_115818561 125
598 3300026023 Ga0207677_10012528 Ga0207677_100125282 125
599 3300026023 Ga0207677_10066707 Ga0207677_100667074 125
600 3300026023 Ga0207677_10712461 Ga0207677_107124612 125
601 3300026067 Ga0207678_10520767 Ga0207678_105207672 125
602 3300026067 Ga0207678_10936204 Ga0207678_109362041 125
603 3300026075 Ga0207708_10083471 Ga0207708_100834711 125
604 3300026075 Ga0207708_10476064 Ga0207708_104760642 125
605 3300026075 Ga0207708_11658662 Ga0207708_116586621 125
606 3300026078 Ga0207702_10005948 Ga0207702_1000594814 125
607 3300026078 Ga0207702_12383049 Ga0207702_123830491 125
608 3300026088 Ga0207641_10045565 Ga0207641_100455654 125
609 3300026088 Ga0207641_10332071 Ga0207641_103320712 125
610 3300026088 Ga0207641_11045234 Ga0207641_110452341 125
611 3300026088 Ga0207641_11740028 Ga0207641_117400281 125
612 3300026089 Ga0207648_10000404 Ga0207648_1000040423 125
613 3300026089 Ga0207648_10032257 Ga0207648_100322572 125
614 3300026089 Ga0207648_10419092 Ga0207648_104190924 125
615 3300026116 Ga0207674_10003661 Ga0207674_1000366129 125
616 3300026116 Ga0207674_10116450 Ga0207674_101164504 125
617 3300026116 Ga0207674_10160041 Ga0207674_101600412 125
618 3300026118 Ga0207675_100124672 Ga0207675_1001246724 125
619 3300026118 Ga0207675_100562955 Ga0207675_1005629552 125
620 3300026118 Ga0207675_101523636 Ga0207675_1015236361 125
621 3300026121 Ga0207683_10003746 Ga0207683_100037462 125
622 3300026121 Ga0207683_10032516 Ga0207683_100325165 125
623 3300026121 Ga0207683_11326396 Ga0207683_113263961 125
624 3300027695 Ga0209966_1040538 Ga0209966_10405383 125
625 3300028379 Ga0268266_10768529 Ga0268266_107685291 125
626 3300028380 Ga0268265_10150746 Ga0268265_101507461 125
627 3300028380 Ga0268265_10501408 Ga0268265_105014081 125
628 3300028380 Ga0268265_10672792 Ga0268265_106727922 125
629 3300028381 Ga0268264_10090125 Ga0268264_100901254 125
630 3300028381 Ga0268264_10870715 Ga0268264_108707152 125
631 3300028381 Ga0268264_12615061 Ga0268264_126150612 125
632 3300029277 Ga0311001_1072227 Ga0311001_10722272 125
633 3300031090 Ga0265760_10101364 Ga0265760_101013642 125
634 3300031235 Ga0265330_10000095 Ga0265330_1000009521 125
635 3300031235 Ga0265330_10079062 Ga0265330_100790622 125
636 3300031235 Ga0265330_10217746 Ga0265330_102177461 125
637 3300031238 Ga0265332_10000222 Ga0265332_1000022227 125
638 3300031239 Ga0265328_10022244 Ga0265328_100222445 125
639 3300031239 Ga0265328_10213498 Ga0265328_102134982 125
640 3300031240 Ga0265320_10085198 Ga0265320_100851982 125
641 3300031241 Ga0265325_10383069 Ga0265325_103830692 125
642 3300031242 Ga0265329_10005084 Ga0265329_100050844 125
643 3300031249 Ga0265339_10013550 Ga0265339_100135505 125
644 3300031249 Ga0265339_10139822 Ga0265339_101398222 125
645 3300031250 Ga0265331_10090337 Ga0265331_100903372 125
646 3300031250 Ga0265331_10100609 Ga0265331_101006092 125
647 3300031251 Ga0265327_10057516 Ga0265327_100575162 125
648 3300031344 Ga0265316_10000450 Ga0265316_1000045021 125
649 3300031344 Ga0265316_10061578 Ga0265316_100615784 125
650 3300031711 Ga0265314_10000076 Ga0265314_10000076113 125
651 3300031712 Ga0265342_10000759 Ga0265342_1000075920 125
652 3300031712 Ga0265342_10031591 Ga0265342_100315913 125
653 3300031731 Ga0307405_10059631 Ga0307405_100596313 125
654 3300031852 Ga0307410_11184973 Ga0307410_111849732 125
655 3300031903 Ga0307407_11545976 Ga0307407_115459761 125
656 3300031995 Ga0307409_102478970 Ga0307409_1024789701 125
657 3300031995 Ga0307409_102909583 Ga0307409_1029095831 125
658 3300032002 Ga0307416_100197294 Ga0307416_1001972941 125
659 3300032002 Ga0307416_100938527 Ga0307416_1009385273 125
660 3300032004 Ga0307414_10941371 Ga0307414_109413713 125
661 3300032005 Ga0307411_12295821 Ga0307411_122958211 125
662 3300035092 Ga0373952_0028057 Ga0373952_0028057_19_402 125
663 3300035117 Ga0373953_0019614 Ga0373953_0019614_1976_2356 125
664 3300035118 Ga0373954_0068740 Ga0373954_0068740_438_821 125
665 3300035118 Ga0373954_0134894 Ga0373954_0134894_118_498 125
666 3300035170 Ga0373943_0059847 Ga0373943_0059847_1316_1696 125
667 3300035172 Ga0373955_0038216 Ga0373955_0038216_1681_2064 125
668 3300035695 Ga0373927_0150719 Ga0373927_0150719_1088_1471 125
669 3300035725 Ga0373947_0172282 Ga0373947_0172282_227_610 125
670 3300035725 Ga0373947_0209826 Ga0373947_0209826_728_1108 125
671 3300036401 Ga0373937_0044920 Ga0373937_0044920_2945_3328 125
672 3300036401 Ga0373937_0091557 Ga0373937_0091557_1453_1833 125
673 3300036457 Ga0265778_020976 Ga0265778_020976_366_773 125
674 3300036647 Ga0316582_0006998 Ga0316582_0006998_4367_4756 125
675 3300036712 Ga0316584_0154220 Ga0316584_0154220_736_1119 125
676 3300037312 Ga0395899_0274789 Ga0395899_0274789_729_1109 125
677 3300037418 Ga0395900_0388831 Ga0395900_0388831_951_1331 125
678 3300037418 Ga0395900_0455995 Ga0395900_0455995_562_942 125
679 3300037418 Ga0395900_0960706 Ga0395900_0960706_223_603 125
680 3300037466 Ga0395898_0091988 Ga0395898_0091988_1367_1747 125
681 3300037466 Ga0395898_1838539 Ga0395898_1838539_134_514 125
682 3300037471 Ga0395905_0103220 Ga0395905_0103220_1164_1544 125
683 3300037471 Ga0395905_0204218 Ga0395905_0204218_1202_1582 125
684 3300037471 Ga0395905_1052154 Ga0395905_1052154_32_421 125
685 3300037853 Ga0436364_0038835 Ga0436364_0038835_69_446 125
686 3300037853 Ga0436364_0542577 Ga0436364_0542577_1088_1465 125
687 3300037853 Ga0436364_0586291 Ga0436364_0586291_12099_12476 125
688 3300037853 Ga0436364_0723678 Ga0436364_0723678_184_567 125
689 3300037853 Ga0436364_1015141 Ga0436364_1015141_236_619 125
690 3300037853 Ga0436364_1062354 Ga0436364_1062354_10865_11242 125
691 3300038443 Ga0395901_0247269 Ga0395901_0247269_712_1092 125
692 3300039447 Ga0436361_0744057 Ga0436361_0744057_204_590 125
693 3300039450 Ga0436363_0954681 Ga0436363_0954681_512_889 125
694 3300039453 Ga0436362_0046115 Ga0436362_0046115_325_702 125
695 3300041404 Ga0439436_0066327 Ga0439436_0066327_606_983 125
696 3300041459 Ga0451800_0119921 Ga0451800_0119921_69_449 125
697 3300041459 Ga0451800_1330059 Ga0451800_1330059_199_576 125
698 3300041492 Ga0451835_0366974 Ga0451835_0366974_310_690 125
699 3300042876 Ga0451577_0000019 Ga0451577_0000019_215964_216350 125
700 3300042876 Ga0451577_0061839 Ga0451577_0061839_2460_2837 125
701 3300044658 Ga0466972_0002629 Ga0466972_0002629_160_543 125
702 3300044683 Ga0466965_0001564 Ga0466965_0001564_7136_7519 125
703 3300044712 Ga0453684_0000057 Ga0453684_0000057_215887_216273 125
704 3300044712 Ga0453684_0156006 Ga0453684_0156006_1312_1689 125
705 3300044735 Ga0466968_0002295 Ga0466968_0002295_5833_6216 125
706 3300044842 Ga0466957_0880361 Ga0466957_0880361_64_441 125
707 3300044901 Ga0466960_0002825 Ga0466960_0002825_2439_2822 125
708 3300044901 Ga0466960_0394739 Ga0466960_0394739_31_411 125
709 3300045051 Ga0451576_1100021 Ga0451576_1100021_191_592 125
710 3300045976 Ga0466967_1249565 Ga0466967_1249565_284_661 125
711 3300046454 Ga0495592_0537949 Ga0495592_0537949_157_537 125
712 3300046455 Ga0495603_0005689 Ga0495603_0005689_5107_5487 125
713 3300046455 Ga0495603_0193439 Ga0495603_0193439_490_867 125
714 3300046459 Ga0495629_0029349 Ga0495629_0029349_2686_3069 125
715 3300046462 Ga0495651_0525655 Ga0495651_0525655_131_514 125
716 3300046472 Ga0495580_0904300 Ga0495580_0904300_66_449 125
717 3300046473 Ga0495582_0157785 Ga0495582_0157785_271_654 125
718 3300046499 Ga0495594_0043083 Ga0495594_0043083_556_936 125
719 3300046499 Ga0495594_0577990 Ga0495594_0577990_169_546 125
720 3300046514 Ga0495618_0089037 Ga0495618_0089037_1483_1866 125
721 3300046516 Ga0495628_0321700 Ga0495628_0321700_710_1090 125
722 3300046529 Ga0495652_0287641 Ga0495652_0287641_249_629 125
723 3300046533 Ga0495640_0110798 Ga0495640_0110798_992_1375 125
724 3300046535 Ga0495586_0117684 Ga0495586_0117684_657_1034 125
725 3300046539 Ga0495621_0390177 Ga0495621_0390177_138_521 125
726 3300046558 Ga0495633_0022320 Ga0495633_0022320_1904_2287 125
727 3300046642 Ga0495634_0205649 Ga0495634_0205649_553_936 125
728 3300046663 Ga0495635_0060120 Ga0495635_0060120_220_603 125
729 3300046678 Ga0495599_0156792 Ga0495599_0156792_669_1052 125
730 3300046681 Ga0495647_0008157 Ga0495647_0008157_2546_2929 125
731 3300046683 Ga0495658_0012542 Ga0495658_0012542_858_1241 125
732 3300046689 Ga0495613_0098089 Ga0495613_0098089_999_1382 125
733 3300046690 Ga0495624_0087620 Ga0495624_0087620_1061_1444 125
734 3300046690 Ga0495624_0426636 Ga0495624_0426636_146_523 125
735 3300046691 Ga0495670_0657067 Ga0495670_0657067_154_537 125
736 3300047317 Ga0495604_0019157 Ga0495604_0019157_648_1031 125
737 3300047319 Ga0495674_0096904 Ga0495674_0096904_1549_1929 125
738 3300047319 Ga0495674_0411249 Ga0495674_0411249_43_426 125
739 3300047321 Ga0495676_0151455 Ga0495676_0151455_641_1021 125
740 3300047322 Ga0495680_0046852 Ga0495680_0046852_416_799 125
741 3300047472 Ga0495686_0067257 Ga0495686_0067257_1457_1837 125
742 3300047472 Ga0495686_0263851 Ga0495686_0263851_204_584 125
743 3300048088 Ga0495602_0189428 Ga0495602_0189428_369_752 125
744 3300048907 Ga0496104_0347694 Ga0496104_0347694_559_939 125
745 3300048908 Ga0496105_0156031 Ga0496105_0156031_929_1309 125
746 3300048908 Ga0496105_0551172 Ga0496105_0551172_167_550 125
747 3300048911 Ga0496108_0000307 Ga0496108_0000307_27222_27605 125
748 3300048912 Ga0496109_0272562 Ga0496109_0272562_835_1215 125
749 3300048913 Ga0496110_0019020 Ga0496110_0019020_3814_4197 125
750 3300048913 Ga0496110_0119314 Ga0496110_0119314_836_1216 125
751 3300048914 Ga0496111_0008255 Ga0496111_0008255_3372_3752 125
752 3300048915 Ga0496112_0005660 Ga0496112_0005660_5900_6280 125
753 3300048915 Ga0496112_0689434 Ga0496112_0689434_410_787 125
754 3300048920 Ga0496117_0454488 Ga0496117_0454488_93_470 125
755 3300048925 Ga0496122_0002341 Ga0496122_0002341_7171_7548 125
756 3300048925 Ga0496122_0005147 Ga0496122_0005147_14955_15335 125
757 3300048926 Ga0496123_0002420 Ga0496123_0002420_11382_11762 125
758 3300048926 Ga0496123_0009053 Ga0496123_0009053_2394_2771 125
759 3300048929 Ga0496126_0174194 Ga0496126_0174194_81_464 125
760 3300049129 Ga0501309_012844 Ga0501309_012844_578_958 125
761 3300049130 Ga0501310_017694 Ga0501310_017694_352_729 125
762 3300049161 Ga0501305_047643 Ga0501305_047643_296_694 125
763 3300049533 Ga0501317_020275 Ga0501317_020275_126_503 125
764 3300049533 Ga0501317_037362 Ga0501317_037362_128_505 125
765 3300049534 Ga0501318_062526 Ga0501318_062526_168_551 125
766 3300049537 Ga0501321_030548 Ga0501321_030548_154_531 125
767 3300049569 Ga0501032_0751895 Ga0501032_0751895_83_463 125
768 3300049571 Ga0501034_0026488 Ga0501034_0026488_1340_1723 125
769 3300049572 Ga0501036_0897237 Ga0501036_0897237_265_648 125
770 3300049576 Ga0501040_0645958 Ga0501040_0645958_342_728 125
771 3300049581 Ga0501047_0089702 Ga0501047_0089702_793_1209 125
772 3300049588 Ga0501072_0205502 Ga0501072_0205502_735_1157 125
773 3300049592 Ga0501076_0513765 Ga0501076_0513765_373_756 125
774 3300049593 Ga0501077_0837610 Ga0501077_0837610_119_502 125
775 3300049743 Ga0501081_1422134 Ga0501081_1422134_39_422 125
776 3300049823 Ga0501044_1015666 Ga0501044_1015666_204_593 125
777 3300050492 nmdc:mga0yw44_290508_c1 nmdc:mga0yw44_290508_c1_225_605 125
778 3300050493 nmdc:mga0k408_107398_c1 nmdc:mga0k408_107398_c1_308_688 125
779 3300050507 nmdc:mga05p37_1249226_c1 nmdc:mga05p37_1249226_c1_56_439 125
780 3300050507 nmdc:mga05p37_1441101_c1 nmdc:mga05p37_1441101_c1_260_637 125
781 3300050507 nmdc:mga05p37_17560_c2 nmdc:mga05p37_17560_c2_5600_5980 125
782 3300050507 nmdc:mga05p37_178968_c1 nmdc:mga05p37_178968_c1_2174_2557 125
783 3300050507 nmdc:mga05p37_382254_c1 nmdc:mga05p37_382254_c1_1042_1425 125
784 3300050507 nmdc:mga05p37_892118_c1 nmdc:mga05p37_892118_c1_323_709 125
785 3300050507 nmdc:mga05p37_90847_c1 nmdc:mga05p37_90847_c1_250_633 125
786 3300050508 nmdc:mga09592_430858_c1 nmdc:mga09592_430858_c1_450_833 125
787 3300050509 nmdc:mga0qj67_179171_c1 nmdc:mga0qj67_179171_c1_1127_1510 125
788 3300050510 nmdc:mga06r32_580758_c1 nmdc:mga06r32_580758_c1_639_1022 125
789 3300050511 nmdc:mga08y16_124683_c1 nmdc:mga08y16_124683_c1_389_772 125
790 3300050511 nmdc:mga08y16_180934_c1 nmdc:mga08y16_180934_c1_11_415 125
791 3300050512 nmdc:mga0n895_1269968_c1 nmdc:mga0n895_1269968_c1_294_677 125
792 3300050512 nmdc:mga0n895_1430599_c1 nmdc:mga0n895_1430599_c1_168_551 125
793 3300050512 nmdc:mga0n895_1595338_c1 nmdc:mga0n895_1595338_c1_14_439 125
794 3300050512 nmdc:mga0n895_54944_c1 nmdc:mga0n895_54944_c1_713_1096 125
795 3300050515 nmdc:mga0a205_12817_c1 nmdc:mga0a205_12817_c1_1801_2184 125
796 3300050515 nmdc:mga0a205_18928_c2 nmdc:mga0a205_18928_c2_511_894 125
797 3300050515 nmdc:mga0a205_6280_c1 nmdc:mga0a205_6280_c1_10108_10533 125
798 3300053077 Ga0495601_0008491 Ga0495601_0008491_4372_4755 125
799 3300053077 Ga0495601_0082083 Ga0495601_0082083_813_1193 125
800 3300053078 Ga0495612_0000233 Ga0495612_0000233_21155_21538 125
801 3300053078 Ga0495612_0011527 Ga0495612_0011527_1604_1984 125
802 3300053078 Ga0495612_0157053 Ga0495612_0157053_271_654 125
803 3300053083 Ga0495655_0159737 Ga0495655_0159737_65_445 125
804 3300053084 Ga0495595_0014251 Ga0495595_0014251_763_1146 125
805 3300053085 Ga0495619_0005474 Ga0495619_0005474_2733_3116 125
806 3300053087 Ga0500643_000191 Ga0500643_000191_54668_55048 125
807 3300053096 Ga0500641_0030230 Ga0500641_0030230_1373_1753 125
808 3300053104 Ga0500556_0000020 Ga0500556_0000020_161998_162378 125
809 3300053133 Ga0500655_048641 Ga0500655_048641_62_442 125
810 3300053139 Ga0500568_0000038 Ga0500568_0000038_40592_40972 125
811 3300053153 Ga0500616_0000027 Ga0500616_0000027_195542_195919 125
812 3300053730 Ga0500645_005061 Ga0500645_005061_1440_1817 125
813 3300053730 Ga0500645_026457 Ga0500645_026457_1110_1490 125
814 3300059478 Ga0587093_015913 Ga0587093_015913_456_839 125
815 3300059490 Ga0587066_002759 Ga0587066_002759_513_896 125
816 3300059491 Ga0587070_019064 Ga0587070_019064_645_1028 125
817 3300059491 Ga0587070_066997 Ga0587070_066997_244_627 125
818 3300059492 Ga0587073_0026332 Ga0587073_0026332_642_1025 125
819 3300059492 Ga0587073_0084010 Ga0587073_0084010_242_625 125
820 3300059493 Ga0587077_003243 Ga0587077_003243_610_990 125
821 3300059493 Ga0587077_044456 Ga0587077_044456_387_770 125
822 3300059503 Ga0587080_016143 Ga0587080_016143_188_571 125
823 3300059503 Ga0587080_089312 Ga0587080_089312_248_631 125
824 3300059503 Ga0587080_177424 Ga0587080_177424_55_432 125
825 3300059504 Ga0587082_032406 Ga0587082_032406_332_715 125
826 3300059505 Ga0587083_0015179 Ga0587083_0015179_458_841 125
827 3300059505 Ga0587083_0186807 Ga0587083_0186807_13_393 125
828 3300059507 Ga0587086_049869 Ga0587086_049869_86_469 125
829 3300059507 Ga0587086_061409 Ga0587086_061409_158_535 125
830 3300059508 Ga0587088_012963 Ga0587088_012963_645_1028 125
831 3300059508 Ga0587088_199624 Ga0587088_199624_87_470 125
832 3300059509 Ga0587089_046604 Ga0587089_046604_149_532 125
833 3300059510 Ga0587090_073510 Ga0587090_073510_111_494 125
834 3300059512 Ga0587092_006243 Ga0587092_006243_638_1021 125
835 3300059512 Ga0587092_057007 Ga0587092_057007_300_677 125
836 3300059513 Ga0587094_027203 Ga0587094_027203_195_572 125
837 3300059513 Ga0587094_092591 Ga0587094_092591_86_469 125
838 3300059604 Ga0587098_009000 Ga0587098_009000_123_506 125
839 3300059605 Ga0587106_046852 Ga0587106_046852_257_640 125
840 3300059623 Ga0587101_084189 Ga0587101_084189_61_438 125
841 3300059625 Ga0587113_024120 Ga0587113_024120_124_507 125
842 3300059626 Ga0587115_037146 Ga0587115_037146_151_534 125
843 3300059630 Ga0587128_005709 Ga0587128_005709_645_1028 125
844 3300059630 Ga0587128_095202 Ga0587128_095202_193_570 125
845 3300059631 Ga0587130_006248 Ga0587130_006248_190_573 125
846 3300059640 Ga0587067_103291 Ga0587067_103291_142_525 125
847 3300059641 Ga0587068_000864 Ga0587068_000864_671_1054 125
848 3300059644 Ga0587075_015641 Ga0587075_015641_546_929 125
849 3300059645 Ga0587076_020316 Ga0587076_020316_458_841 125
850 3300059646 Ga0587078_006035 Ga0587078_006035_528_911 125
851 3300059648 Ga0587100_030992 Ga0587100_030992_14_397 125
852 3300059652 Ga0587107_024585 Ga0587107_024585_391_774 125
853 3300059654 Ga0587110_055651 Ga0587110_055651_97_480 125
854 3300059655 Ga0587114_079291 Ga0587114_079291_144_527 125
855 3300060344 Ga0587071_014646 Ga0587071_014646_607_990 125
856 3300061719 Ga0466962_0188423 Ga0466962_0188423_192_575 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00416

Ribosomal_S13

Ribosomal protein S13/S18

25

131

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zqf-assembly1.cif.gz_DS cryo-em structure of the 90s pre-ribosome from saccharomyces cerevisiae, state dis-b (poly-ala) 0.9593 3 61
6rbd-assembly1.cif.gz_S state 1 of yeast tsr1-tap rps20-deltaloop pre-40s particles 0.9273 3 61
7mqa-assembly1.cif.gz_L3 cryo-em structure of the human ssu processome, state post-a1 0.9239 3 63
8d8l-assembly1.cif.gz_M yeast mitochondrial small subunit assembly intermediate (state 3) 0.9113 1 79
7qv3-assembly1.cif.gz_m bacillus subtilis muts2-collided disome complex (muts2 conf.2; leading 70s) 0.9104 3 95
ID Description Score Start End Superfamily
af_P9WH61_1_72_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9831 1 71 1.10.8.50
af_Q8HCP0_1_71_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9817 1 70 1.10.8.50
af_P54019_1_77_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9702 3 61 1.10.8.50
af_O59772_1_70_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9699 1 70 1.10.8.50
af_Q2FW30_1_70_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9674 1 70 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A833G026-F1-model_v4 30S ribosomal protein S13 1 1 75 GO:0003723
GO:0003735
GO:0005829
GO:0006412
GO:0015935
AF-A0A4Q3GYA9-F1-model_v4 deleted 0.9984 1 75
AF-A0A436DSH1-F1-model_v4 30S ribosomal protein S13 0.9939 1 68 GO:0003723
GO:0003735
GO:0005829
GO:0006412
GO:0015935
AF-A0A661TSX6-F1-model_v4 30S ribosomal protein S13 0.9926 1 83 GO:0003723
GO:0003735
GO:0005829
GO:0006412
GO:0015935
AF-A0A1Q6SSA2-F1-model_v4 30S ribosomal protein S13 0.9908 1 77 GO:0000049
GO:0003735
GO:0005829
GO:0006412
GO:0015935

Feature Viewer

pLDDT pTM Quality
81.95 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map