F483641
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 855 | 335 | 855 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300053125|Ga0500618_008791|Ga0500618_008791_345_749 |
| Length | 134 |
| Sequence | MRSVKQIESKKIREIRAHSILTQNYFMEISEAQQLVDNWIKTTGIRYFNELTNTAILMEEVGEVARIMARQYGEQSFKKTDTEVNLADEMADVLFVLICLANQTGIDLTEALIKNMDKKSIRDAERHKNNEKLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 10 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 11 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 12 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 123 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 188 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 189 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 192 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 193 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 194 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 195 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 200 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 201 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 203 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 206 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 209 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 210 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 211 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 223 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 224 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 227 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 228 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 229 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 236 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 237 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 238 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 239 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 240 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 241 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 242 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 243 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 244 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 245 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 246 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 247 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 248 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 249 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 250 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 251 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 254 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 255 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 294 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 295 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 296 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 297 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 298 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 299 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 306 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 307 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 308 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 309 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 310 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 311 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 314 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 315 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 316 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 321 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 322 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 323 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 324 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 325 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 328 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 329 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 330 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 331 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 332 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 333 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 334 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 335 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.88 |
| Metatranscriptomes | 0.12 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.02 |
| Nodule | 0 |
| Rhizoplane | 0.94 |
| Rhizosphere | 86.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2255685 | 2162886007 | Bacteria | 19658 |
| 2 | JGI24736J21556_1003173 | 3300001904 | Bacteria | 2864 |
| 3 | JGI24740J21852_10005973 | 3300001979 | Bacteria | 5094 |
| 4 | JGI24740J21852_10022379 | 3300001979 | Bacteria | 2177 |
| 5 | JGI24739J22299_10002187 | 3300001989 | Bacteria | 7508 |
| 6 | JGI24739J22299_10061220 | 3300001989 | Bacteria | 1189 |
| 7 | JGI24737J22298_10000148 | 3300001990 | Bacteria | 21941 |
| 8 | JGI24737J22298_10096935 | 3300001990 | Bacteria | 874 |
| 9 | JGI24735J21928_10000020 | 3300002067 | Bacteria | 108706 |
| 10 | JGI24744J21845_10002386 | 3300002077 | Bacteria | 3832 |
| 11 | JGI24751J29686_10035279 | 3300002459 | Bacteria | 1037 |
| 12 | JGI25162J39368_1000097 | 3300002737 | Bacteria | 96520 |
| 13 | JGI25157J39369_1012814 | 3300002741 | Bacteria | 1063 |
| 14 | JGI25157J39369_1020846 | 3300002741 | Bacteria | 782 |
| 15 | JGI25157J39369_1023041 | 3300002741 | Bacteria | 733 |
| 16 | JGI25152J39213_1000007 | 3300002773 | Bacteria | 156012 |
| 17 | JGI25152J39213_1024763 | 3300002773 | Bacteria | 1003 |
| 18 | JGI25150J39212_1000013 | 3300002774 | Bacteria | 182307 |
| 19 | JGI25151J46595_10000004 | 3300003187 | Bacteria | 494006 |
| 20 | JGI25165J46597_1000733 | 3300003214 | Bacteria | 25678 |
| 21 | JGI25153J46596_10000004 | 3300003215 | Bacteria | 494006 |
| 22 | rootH1_10101964 | 3300003316 | Bacteria | 6396 |
| 23 | rootH1_10188452 | 3300003316 | Bacteria | 1428 |
| 24 | rootH2_10009716 | 3300003320 | Bacteria | 46057 |
| 25 | rootH2_10033863 | 3300003320 | Bacteria | 12920 |
| 26 | rootH2_10326475 | 3300003320 | Bacteria | 2025 |
| 27 | rootL2_10029081 | 3300003322 | Bacteria | 2603 |
| 28 | rootH1_10010071 | 3300003323 | Bacteria | 2317 |
| 29 | rootH1_10025651 | 3300003323 | Bacteria | 11383 |
| 30 | rootH1_10033417 | 3300003323 | Bacteria | 27769 |
| 31 | rootH1_10173204 | 3300003323 | Bacteria | 1265 |
| 32 | rootH1_10306878 | 3300003323 | Bacteria | 2392 |
| 33 | Ga0055536_1000010 | 3300003781 | Bacteria | 304614 |
| 34 | Ga0055530_10001623 | 3300003791 | Bacteria | 16121 |
| 35 | Ga0058863_11194942 | 3300004799 | Bacteria | 631 |
| 36 | Ga0065165_1000242 | 3300005262 | Bacteria | 93564 |
| 37 | Ga0065714_10003722 | 3300005288 | Bacteria | 22816 |
| 38 | Ga0065714_10004493 | 3300005288 | Bacteria | 4884 |
| 39 | Ga0065714_10007828 | 3300005288 | Bacteria | 5370 |
| 40 | Ga0065714_10064539 | 3300005288 | Bacteria | 39775 |
| 41 | Ga0065714_10079275 | 3300005288 | Bacteria | 2529 |
| 42 | Ga0065714_10095945 | 3300005288 | Bacteria | 1773 |
| 43 | Ga0065714_10106485 | 3300005288 | Bacteria | 1547 |
| 44 | Ga0065714_10144326 | 3300005288 | Bacteria | 1149 |
| 45 | Ga0065714_10182988 | 3300005288 | Bacteria | 955 |
| 46 | Ga0065714_10207420 | 3300005288 | Bacteria | 877 |
| 47 | Ga0065714_10288119 | 3300005288 | Bacteria | 703 |
| 48 | Ga0065714_10296100 | 3300005288 | Bacteria | 695 |
| 49 | Ga0065704_10000425 | 3300005289 | Bacteria | 76756 |
| 50 | Ga0065704_10001986 | 3300005289 | Bacteria | 7583 |
| 51 | Ga0065704_10099600 | 3300005289 | Bacteria | 2293 |
| 52 | Ga0065704_10145283 | 3300005289 | Bacteria | 1478 |
| 53 | Ga0065704_10165409 | 3300005289 | Unclassified | 1326 |
| 54 | Ga0065704_10327887 | 3300005289 | Bacteria | 842 |
| 55 | Ga0065704_10330903 | 3300005289 | Bacteria | 838 |
| 56 | Ga0065704_10338441 | 3300005289 | Unclassified | 782 |
| 57 | Ga0065704_10523286 | 3300005289 | Bacteria | 652 |
| 58 | Ga0065712_10013478 | 3300005290 | Bacteria | 2183 |
| 59 | Ga0065712_10179192 | 3300005290 | Bacteria | 1202 |
| 60 | Ga0065715_10407233 | 3300005293 | Bacteria | 874 |
| 61 | Ga0065707_10352364 | 3300005295 | Bacteria | 916 |
| 62 | Ga0070658_10000069 | 3300005327 | Bacteria | 101140 |
| 63 | Ga0070658_10166418 | 3300005327 | Bacteria | 1851 |
| 64 | Ga0070658_10221837 | 3300005327 | Bacteria | 1599 |
| 65 | Ga0070658_10234638 | 3300005327 | Bacteria | 1554 |
| 66 | Ga0070658_10290223 | 3300005327 | Bacteria | 1394 |
| 67 | Ga0070658_10424427 | 3300005327 | Bacteria | 1144 |
| 68 | Ga0070658_10728643 | 3300005327 | Bacteria | 861 |
| 69 | Ga0070658_11217883 | 3300005327 | Bacteria | 654 |
| 70 | Ga0070658_11677479 | 3300005327 | Bacteria | 550 |
| 71 | Ga0070676_10015301 | 3300005328 | Bacteria | 4231 |
| 72 | Ga0070676_11076490 | 3300005328 | Bacteria | 606 |
| 73 | Ga0070683_100047754 | 3300005329 | Bacteria | 3957 |
| 74 | Ga0070683_100341934 | 3300005329 | Bacteria | 1425 |
| 75 | Ga0070683_100609271 | 3300005329 | Bacteria | 1045 |
| 76 | Ga0070690_100634055 | 3300005330 | Unclassified | 814 |
| 77 | Ga0070670_100015918 | 3300005331 | Bacteria | 6454 |
| 78 | Ga0070670_100016570 | 3300005331 | Bacteria | 6325 |
| 79 | Ga0070670_100488402 | 3300005331 | Bacteria | 1094 |
| 80 | Ga0068869_100140331 | 3300005334 | Unclassified | 1865 |
| 81 | Ga0068869_100357028 | 3300005334 | Bacteria | 1192 |
| 82 | Ga0070666_10026579 | 3300005335 | Bacteria | 3784 |
| 83 | Ga0070680_100002384 | 3300005336 | Bacteria | 13903 |
| 84 | Ga0070680_100019054 | 3300005336 | Bacteria | 5433 |
| 85 | Ga0070680_100598402 | 3300005336 | Bacteria | 946 |
| 86 | Ga0070682_100308216 | 3300005337 | Bacteria | 1164 |
| 87 | Ga0070660_100046805 | 3300005339 | Bacteria | 3317 |
| 88 | Ga0070660_100175713 | 3300005339 | Bacteria | 1732 |
| 89 | Ga0070660_100933821 | 3300005339 | Bacteria | 732 |
| 90 | Ga0070660_101009889 | 3300005339 | Bacteria | 703 |
| 91 | Ga0070687_101213750 | 3300005343 | Bacteria | 557 |
| 92 | Ga0070668_100629920 | 3300005347 | Bacteria | 941 |
| 93 | Ga0070669_100028238 | 3300005353 | Bacteria | 4040 |
| 94 | Ga0070675_100907591 | 3300005354 | Bacteria | 807 |
| 95 | Ga0070673_100103439 | 3300005364 | Bacteria | 2350 |
| 96 | Ga0070659_100002120 | 3300005366 | Bacteria | 14126 |
| 97 | Ga0070659_100009288 | 3300005366 | Bacteria | 7220 |
| 98 | Ga0070659_100435418 | 3300005366 | Bacteria | 1110 |
| 99 | Ga0070659_100807152 | 3300005366 | Bacteria | 816 |
| 100 | Ga0070659_100997780 | 3300005366 | Bacteria | 735 |
| 101 | Ga0070667_100585357 | 3300005367 | Bacteria | 1027 |
| 102 | Ga0070667_100834907 | 3300005367 | Bacteria | 856 |
| 103 | Ga0070714_101534491 | 3300005435 | Bacteria | 651 |
| 104 | Ga0070701_10086499 | 3300005438 | Bacteria | 1708 |
| 105 | Ga0070700_100933211 | 3300005441 | Bacteria | 709 |
| 106 | Ga0070663_100000935 | 3300005455 | Bacteria | 15875 |
| 107 | Ga0070663_100013113 | 3300005455 | Bacteria | 5269 |
| 108 | Ga0070663_101341462 | 3300005455 | Unclassified | 632 |
| 109 | Ga0070678_100033628 | 3300005456 | Bacteria | 3562 |
| 110 | Ga0070678_100179802 | 3300005456 | Bacteria | 1730 |
| 111 | Ga0070678_100214102 | 3300005456 | Bacteria | 1598 |
| 112 | Ga0070678_100462079 | 3300005456 | Bacteria | 1114 |
| 113 | Ga0070662_100000186 | 3300005457 | Bacteria | 36051 |
| 114 | Ga0070681_10001937 | 3300005458 | Bacteria | 18677 |
| 115 | Ga0070681_10011702 | 3300005458 | Bacteria | 8692 |
| 116 | Ga0068867_100944440 | 3300005459 | Bacteria | 778 |
| 117 | Ga0068867_101136926 | 3300005459 | Bacteria | 714 |
| 118 | Ga0068867_102382930 | 3300005459 | Bacteria | 503 |
| 119 | Ga0070685_10013893 | 3300005466 | Bacteria | 4259 |
| 120 | Ga0070685_11514227 | 3300005466 | Bacteria | 517 |
| 121 | Ga0070707_102130360 | 3300005468 | Unclassified | 528 |
| 122 | Ga0070698_100004536 | 3300005471 | Bacteria | 15258 |
| 123 | Ga0070698_100025684 | 3300005471 | Bacteria | 6136 |
| 124 | Ga0070698_100047082 | 3300005471 | Bacteria | 4409 |
| 125 | Ga0070699_100544006 | 3300005518 | Bacteria | 1057 |
| 126 | Ga0070679_100022402 | 3300005530 | Bacteria | 6175 |
| 127 | Ga0070679_100045254 | 3300005530 | Bacteria | 4386 |
| 128 | Ga0070679_101368628 | 3300005530 | Unclassified | 654 |
| 129 | Ga0070679_101440123 | 3300005530 | Bacteria | 635 |
| 130 | Ga0070684_100073584 | 3300005535 | Bacteria | 3011 |
| 131 | Ga0070684_100151743 | 3300005535 | Bacteria | 2099 |
| 132 | Ga0068853_100010772 | 3300005539 | Bacteria | 7407 |
| 133 | Ga0068853_100031056 | 3300005539 | Bacteria | 4516 |
| 134 | Ga0068853_100222314 | 3300005539 | Bacteria | 1725 |
| 135 | Ga0068853_100266251 | 3300005539 | Bacteria | 1577 |
| 136 | Ga0068853_100505967 | 3300005539 | Bacteria | 1141 |
| 137 | Ga0070672_100208879 | 3300005543 | Bacteria | 1634 |
| 138 | Ga0070686_100398870 | 3300005544 | Bacteria | 1046 |
| 139 | Ga0070693_100800679 | 3300005547 | Bacteria | 698 |
| 140 | Ga0070665_100000017 | 3300005548 | Bacteria | 448013 |
| 141 | Ga0070704_100128810 | 3300005549 | Bacteria | 1958 |
| 142 | Ga0068855_100000097 | 3300005563 | Bacteria | 106474 |
| 143 | Ga0068855_100002978 | 3300005563 | Bacteria | 20697 |
| 144 | Ga0068855_100004102 | 3300005563 | Bacteria | 17772 |
| 145 | Ga0068855_100004838 | 3300005563 | Bacteria | 16436 |
| 146 | Ga0068855_100010260 | 3300005563 | Bacteria | 11297 |
| 147 | Ga0068855_100069864 | 3300005563 | Bacteria | 4086 |
| 148 | Ga0068855_100142968 | 3300005563 | Bacteria | 2725 |
| 149 | Ga0068855_100205601 | 3300005563 | Bacteria | 2215 |
| 150 | Ga0068855_100395865 | 3300005563 | Bacteria | 1515 |
| 151 | Ga0068855_100565927 | 3300005563 | Bacteria | 1229 |
| 152 | Ga0068855_100584284 | 3300005563 | Bacteria | 1206 |
| 153 | Ga0068855_102044129 | 3300005563 | Bacteria | 578 |
| 154 | Ga0068857_100018843 | 3300005577 | Bacteria | 6057 |
| 155 | Ga0068857_100074969 | 3300005577 | Bacteria | 3015 |
| 156 | Ga0068857_101277532 | 3300005577 | Bacteria | 712 |
| 157 | Ga0068854_100089124 | 3300005578 | Bacteria | 2292 |
| 158 | Ga0068854_100584884 | 3300005578 | Bacteria | 951 |
| 159 | Ga0068854_101467473 | 3300005578 | Bacteria | 618 |
| 160 | Ga0068856_100002033 | 3300005614 | Bacteria | 21029 |
| 161 | Ga0068856_100031710 | 3300005614 | Bacteria | 5172 |
| 162 | Ga0068856_100034453 | 3300005614 | Bacteria | 4959 |
| 163 | Ga0068856_100175072 | 3300005614 | Bacteria | 2158 |
| 164 | Ga0068856_100235576 | 3300005614 | Bacteria | 1846 |
| 165 | Ga0068856_100690324 | 3300005614 | Bacteria | 1041 |
| 166 | Ga0068856_100847530 | 3300005614 | Bacteria | 933 |
| 167 | Ga0068852_100004339 | 3300005616 | Bacteria | 10011 |
| 168 | Ga0068852_100139242 | 3300005616 | Bacteria | 2244 |
| 169 | Ga0068852_100292007 | 3300005616 | Bacteria | 1575 |
| 170 | Ga0068852_100406560 | 3300005616 | Bacteria | 1340 |
| 171 | Ga0068852_100527505 | 3300005616 | Bacteria | 1179 |
| 172 | Ga0068859_100575015 | 3300005617 | Bacteria | 1220 |
| 173 | Ga0068859_100926697 | 3300005617 | Bacteria | 955 |
| 174 | Ga0068864_100275801 | 3300005618 | Bacteria | 1568 |
| 175 | Ga0068866_10172933 | 3300005718 | Bacteria | 1269 |
| 176 | Ga0068861_100641982 | 3300005719 | Bacteria | 980 |
| 177 | Ga0068851_10100792 | 3300005834 | Bacteria | 1532 |
| 178 | Ga0068870_10008407 | 3300005840 | Bacteria | 4642 |
| 179 | Ga0068870_10053771 | 3300005840 | Bacteria | 2140 |
| 180 | Ga0068863_100006021 | 3300005841 | Bacteria | 11896 |
| 181 | Ga0068863_101518848 | 3300005841 | Bacteria | 678 |
| 182 | Ga0068863_102358584 | 3300005841 | Bacteria | 542 |
| 183 | Ga0068858_100088087 | 3300005842 | Bacteria | 2888 |
| 184 | Ga0068860_100203625 | 3300005843 | Bacteria | 1918 |
| 185 | Ga0068860_101052101 | 3300005843 | Bacteria | 833 |
| 186 | Ga0068860_101521787 | 3300005843 | Unclassified | 691 |
| 187 | Ga0068862_101486114 | 3300005844 | Bacteria | 683 |
| 188 | Ga0075364_10900231 | 3300006051 | Bacteria | 602 |
| 189 | Ga0075366_10000677 | 3300006195 | Bacteria | 16110 |
| 190 | Ga0075366_10000881 | 3300006195 | Bacteria | 14502 |
| 191 | Ga0075366_10282480 | 3300006195 | Bacteria | 1014 |
| 192 | Ga0075366_10529193 | 3300006195 | Bacteria | 729 |
| 193 | Ga0075366_10728705 | 3300006195 | Bacteria | 616 |
| 194 | Ga0097621_100000721 | 3300006237 | Bacteria | 23141 |
| 195 | Ga0097621_100135308 | 3300006237 | Bacteria | 2101 |
| 196 | Ga0097621_102421369 | 3300006237 | Bacteria | 502 |
| 197 | Ga0068871_100000286 | 3300006358 | Bacteria | 35207 |
| 198 | Ga0068871_100045860 | 3300006358 | Bacteria | 3519 |
| 199 | Ga0068871_100639105 | 3300006358 | Bacteria | 971 |
| 200 | Ga0068871_100779492 | 3300006358 | Bacteria | 880 |
| 201 | Ga0075428_100027330 | 3300006844 | Bacteria | 6314 |
| 202 | Ga0075430_100072163 | 3300006846 | Bacteria | 2896 |
| 203 | Ga0075431_100212027 | 3300006847 | Bacteria | 1978 |
| 204 | Ga0075429_100000533 | 3300006880 | Bacteria | 28947 |
| 205 | Ga0068865_100001165 | 3300006881 | Bacteria | 15280 |
| 206 | Ga0068865_101162804 | 3300006881 | Bacteria | 682 |
| 207 | Ga0097620_100575011 | 3300006931 | Bacteria | 1220 |
| 208 | Ga0097620_100926802 | 3300006931 | Bacteria | 955 |
| 209 | Ga0105244_10007635 | 3300009036 | Bacteria | 6853 |
| 210 | Ga0105240_10000321 | 3300009093 | Bacteria | 90931 |
| 211 | Ga0105240_10009251 | 3300009093 | Bacteria | 13972 |
| 212 | Ga0105240_10028247 | 3300009093 | Bacteria | 7329 |
| 213 | Ga0105240_10041945 | 3300009093 | Bacteria | 5835 |
| 214 | Ga0105240_10062828 | 3300009093 | Bacteria | 4622 |
| 215 | Ga0105240_10094107 | 3300009093 | Bacteria | 3656 |
| 216 | Ga0105240_10401169 | 3300009093 | Bacteria | 1544 |
| 217 | Ga0105240_10469361 | 3300009093 | Bacteria | 1405 |
| 218 | Ga0105240_10474945 | 3300009093 | Bacteria | 1395 |
| 219 | Ga0105240_10560177 | 3300009093 | Bacteria | 1263 |
| 220 | Ga0105240_10657839 | 3300009093 | Bacteria | 1148 |
| 221 | Ga0105240_10833796 | 3300009093 | Bacteria | 996 |
| 222 | Ga0105240_10860639 | 3300009093 | Bacteria | 978 |
| 223 | Ga0105240_10904277 | 3300009093 | Bacteria | 949 |
| 224 | Ga0105240_11168744 | 3300009093 | Bacteria | 816 |
| 225 | Ga0111539_10156186 | 3300009094 | Unclassified | 2670 |
| 226 | Ga0111539_10410593 | 3300009094 | Bacteria | 1577 |
| 227 | Ga0111539_10578160 | 3300009094 | Bacteria | 1308 |
| 228 | Ga0105247_10546750 | 3300009101 | Bacteria | 851 |
| 229 | Ga0105243_10000009 | 3300009148 | Bacteria | 354419 |
| 230 | Ga0105243_10078741 | 3300009148 | Bacteria | 2684 |
| 231 | Ga0105243_10904777 | 3300009148 | Bacteria | 878 |
| 232 | Ga0105241_10001000 | 3300009174 | Bacteria | 21430 |
| 233 | Ga0105241_10019786 | 3300009174 | Bacteria | 4968 |
| 234 | Ga0105241_10065816 | 3300009174 | Bacteria | 2801 |
| 235 | Ga0105241_10069375 | 3300009174 | Bacteria | 2733 |
| 236 | Ga0105241_10103649 | 3300009174 | Bacteria | 2265 |
| 237 | Ga0105241_10143974 | 3300009174 | Bacteria | 1944 |
| 238 | Ga0105241_10412157 | 3300009174 | Bacteria | 1187 |
| 239 | Ga0105241_10932225 | 3300009174 | Bacteria | 808 |
| 240 | Ga0105241_11255738 | 3300009174 | Bacteria | 704 |
| 241 | Ga0105241_12219969 | 3300009174 | Bacteria | 545 |
| 242 | Ga0105242_10015750 | 3300009176 | Bacteria | 5874 |
| 243 | Ga0105242_10053939 | 3300009176 | Bacteria | 3284 |
| 244 | Ga0105242_10105159 | 3300009176 | Bacteria | 2397 |
| 245 | Ga0105242_10213428 | 3300009176 | Bacteria | 1721 |
| 246 | Ga0105248_10607974 | 3300009177 | Bacteria | 1233 |
| 247 | Ga0105237_10000273 | 3300009545 | Bacteria | 72474 |
| 248 | Ga0105237_10002591 | 3300009545 | Bacteria | 22307 |
| 249 | Ga0105237_10003787 | 3300009545 | Bacteria | 17785 |
| 250 | Ga0105237_10004463 | 3300009545 | Bacteria | 16172 |
| 251 | Ga0105237_10012487 | 3300009545 | Bacteria | 8949 |
| 252 | Ga0105237_10032439 | 3300009545 | Bacteria | 5288 |
| 253 | Ga0105237_10073968 | 3300009545 | Bacteria | 3399 |
| 254 | Ga0105237_10099788 | 3300009545 | Bacteria | 2895 |
| 255 | Ga0105237_10206971 | 3300009545 | Bacteria | 1962 |
| 256 | Ga0105237_10282829 | 3300009545 | Bacteria | 1661 |
| 257 | Ga0105237_10389243 | 3300009545 | Bacteria | 1399 |
| 258 | Ga0105237_10467363 | 3300009545 | Bacteria | 1267 |
| 259 | Ga0105237_10468588 | 3300009545 | Bacteria | 1266 |
| 260 | Ga0105237_11124254 | 3300009545 | Bacteria | 792 |
| 261 | Ga0105237_12437185 | 3300009545 | Bacteria | 533 |
| 262 | Ga0105238_10038734 | 3300009551 | Bacteria | 4840 |
| 263 | Ga0105238_10039673 | 3300009551 | Bacteria | 4774 |
| 264 | Ga0105238_10183376 | 3300009551 | Bacteria | 2070 |
| 265 | Ga0105249_10001688 | 3300009553 | Bacteria | 19361 |
| 266 | Ga0105249_10036731 | 3300009553 | Bacteria | 4445 |
| 267 | Ga0105239_10000014 | 3300010375 | Bacteria | 325391 |
| 268 | Ga0105239_10000017 | 3300010375 | Bacteria | 290760 |
| 269 | Ga0105239_10000821 | 3300010375 | Bacteria | 44186 |
| 270 | Ga0105239_10004179 | 3300010375 | Bacteria | 17344 |
| 271 | Ga0105239_10048085 | 3300010375 | Bacteria | 4677 |
| 272 | Ga0105239_10057768 | 3300010375 | Bacteria | 4256 |
| 273 | Ga0105239_10103179 | 3300010375 | Unclassified | 3156 |
| 274 | Ga0105239_10149651 | 3300010375 | Bacteria | 2605 |
| 275 | Ga0105239_10154879 | 3300010375 | Bacteria | 2559 |
| 276 | Ga0105239_10161839 | 3300010375 | Bacteria | 2501 |
| 277 | Ga0105239_10211873 | 3300010375 | Bacteria | 2172 |
| 278 | Ga0157373_10001836 | 3300013100 | Bacteria | 16168 |
| 279 | Ga0157373_10001854 | 3300013100 | Bacteria | 16054 |
| 280 | Ga0157373_10003628 | 3300013100 | Bacteria | 11658 |
| 281 | Ga0157373_10021879 | 3300013100 | Bacteria | 4640 |
| 282 | Ga0157373_10034944 | 3300013100 | Bacteria | 3610 |
| 283 | Ga0157373_10222196 | 3300013100 | Bacteria | 1333 |
| 284 | Ga0157373_10235937 | 3300013100 | Bacteria | 1292 |
| 285 | Ga0157373_10787083 | 3300013100 | Bacteria | 701 |
| 286 | Ga0157371_10000046 | 3300013102 | Bacteria | 187304 |
| 287 | Ga0157371_10000297 | 3300013102 | Bacteria | 65919 |
| 288 | Ga0157371_10001025 | 3300013102 | Bacteria | 30579 |
| 289 | Ga0157371_10003077 | 3300013102 | Bacteria | 15475 |
| 290 | Ga0157371_10003113 | 3300013102 | Bacteria | 15341 |
| 291 | Ga0157371_10005385 | 3300013102 | Bacteria | 10807 |
| 292 | Ga0157371_10010708 | 3300013102 | Bacteria | 7120 |
| 293 | Ga0157371_10037682 | 3300013102 | Bacteria | 3460 |
| 294 | Ga0157371_10061686 | 3300013102 | Bacteria | 2658 |
| 295 | Ga0157371_10111119 | 3300013102 | Bacteria | 1945 |
| 296 | Ga0157371_10142347 | 3300013102 | Bacteria | 1708 |
| 297 | Ga0157370_10000083 | 3300013104 | Bacteria | 104313 |
| 298 | Ga0157370_10018511 | 3300013104 | Bacteria | 7002 |
| 299 | Ga0157370_10047250 | 3300013104 | Bacteria | 4127 |
| 300 | Ga0157370_10047550 | 3300013104 | Bacteria | 4112 |
| 301 | Ga0157370_10053400 | 3300013104 | Bacteria | 3853 |
| 302 | Ga0157370_10105045 | 3300013104 | Bacteria | 2644 |
| 303 | Ga0157370_10114672 | 3300013104 | Bacteria | 2517 |
| 304 | Ga0157370_10126475 | 3300013104 | Bacteria | 2385 |
| 305 | Ga0157370_10252277 | 3300013104 | Bacteria | 1632 |
| 306 | Ga0157370_10256429 | 3300013104 | Bacteria | 1617 |
| 307 | Ga0157370_10294623 | 3300013104 | Bacteria | 1498 |
| 308 | Ga0157370_10348251 | 3300013104 | Bacteria | 1365 |
| 309 | Ga0157370_10556806 | 3300013104 | Unclassified | 1051 |
| 310 | Ga0157370_10584156 | 3300013104 | Bacteria | 1023 |
| 311 | Ga0157370_10745478 | 3300013104 | Bacteria | 892 |
| 312 | Ga0157370_11025745 | 3300013104 | Bacteria | 746 |
| 313 | Ga0157370_11089540 | 3300013104 | Bacteria | 722 |
| 314 | Ga0157369_10000046 | 3300013105 | Bacteria | 172851 |
| 315 | Ga0157369_10002452 | 3300013105 | Bacteria | 22259 |
| 316 | Ga0157369_10019838 | 3300013105 | Bacteria | 7523 |
| 317 | Ga0157369_10055076 | 3300013105 | Bacteria | 4293 |
| 318 | Ga0157369_10074716 | 3300013105 | Bacteria | 3635 |
| 319 | Ga0157369_10088988 | 3300013105 | Bacteria | 3296 |
| 320 | Ga0157369_10169448 | 3300013105 | Bacteria | 2301 |
| 321 | Ga0157369_12641819 | 3300013105 | Bacteria | 507 |
| 322 | Ga0157374_10000825 | 3300013296 | Bacteria | 27116 |
| 323 | Ga0157374_10037163 | 3300013296 | Bacteria | 4467 |
| 324 | Ga0157374_10127344 | 3300013296 | Bacteria | 2462 |
| 325 | Ga0157374_10160886 | 3300013296 | Bacteria | 2187 |
| 326 | Ga0157374_10164065 | 3300013296 | Bacteria | 2165 |
| 327 | Ga0157374_10378086 | 3300013296 | Bacteria | 1411 |
| 328 | Ga0157374_10723705 | 3300013296 | Bacteria | 1009 |
| 329 | Ga0157374_12291511 | 3300013296 | Bacteria | 567 |
| 330 | Ga0157374_12494883 | 3300013296 | Bacteria | 544 |
| 331 | Ga0157378_10034988 | 3300013297 | Bacteria | 4442 |
| 332 | Ga0157378_10246623 | 3300013297 | Bacteria | 1708 |
| 333 | Ga0157378_10409295 | 3300013297 | Bacteria | 1338 |
| 334 | Ga0157378_10644044 | 3300013297 | Bacteria | 1075 |
| 335 | Ga0157378_11023477 | 3300013297 | Bacteria | 861 |
| 336 | Ga0163162_10000026 | 3300013306 | Bacteria | 178701 |
| 337 | Ga0163162_10000037 | 3300013306 | Bacteria | 138420 |
| 338 | Ga0163162_10072237 | 3300013306 | Bacteria | 3505 |
| 339 | Ga0163162_10081280 | 3300013306 | Bacteria | 3311 |
| 340 | Ga0163162_10191782 | 3300013306 | Bacteria | 2171 |
| 341 | Ga0163162_10470592 | 3300013306 | Bacteria | 1388 |
| 342 | Ga0163162_10608139 | 3300013306 | Bacteria | 1219 |
| 343 | Ga0163162_10801839 | 3300013306 | Bacteria | 1059 |
| 344 | Ga0163162_10803863 | 3300013306 | Bacteria | 1058 |
| 345 | Ga0157372_10000077 | 3300013307 | Bacteria | 102192 |
| 346 | Ga0157372_10001279 | 3300013307 | Bacteria | 27221 |
| 347 | Ga0157372_10002383 | 3300013307 | Bacteria | 20341 |
| 348 | Ga0157372_10002480 | 3300013307 | Bacteria | 19998 |
| 349 | Ga0157372_10004815 | 3300013307 | Bacteria | 14349 |
| 350 | Ga0157372_10084375 | 3300013307 | Bacteria | 3600 |
| 351 | Ga0157372_10126973 | 3300013307 | Bacteria | 2933 |
| 352 | Ga0157372_10326511 | 3300013307 | Bacteria | 1786 |
| 353 | Ga0157372_12191984 | 3300013307 | Bacteria | 635 |
| 354 | Ga0157372_12408021 | 3300013307 | Bacteria | 604 |
| 355 | Ga0157375_10001605 | 3300013308 | Bacteria | 19423 |
| 356 | Ga0157375_10172436 | 3300013308 | Bacteria | 2311 |
| 357 | Ga0157375_10194609 | 3300013308 | Bacteria | 2183 |
| 358 | Ga0157375_10240533 | 3300013308 | Bacteria | 1970 |
| 359 | Ga0157375_10403132 | 3300013308 | Bacteria | 1534 |
| 360 | Ga0157375_11323998 | 3300013308 | Bacteria | 847 |
| 361 | Ga0157375_12077672 | 3300013308 | Bacteria | 676 |
| 362 | Ga0163163_10000202 | 3300014325 | Bacteria | 61701 |
| 363 | Ga0163163_10018012 | 3300014325 | Bacteria | 6597 |
| 364 | Ga0163163_10224910 | 3300014325 | Bacteria | 1925 |
| 365 | Ga0163163_10948654 | 3300014325 | Unclassified | 924 |
| 366 | Ga0157380_10127483 | 3300014326 | Bacteria | 2165 |
| 367 | Ga0157380_10558522 | 3300014326 | Bacteria | 1124 |
| 368 | Ga0157380_12610189 | 3300014326 | Bacteria | 571 |
| 369 | Ga0182008_10000022 | 3300014497 | Bacteria | 207052 |
| 370 | Ga0182008_10000104 | 3300014497 | Bacteria | 65446 |
| 371 | Ga0182008_10000380 | 3300014497 | Bacteria | 34363 |
| 372 | Ga0182008_10144077 | 3300014497 | Bacteria | 1193 |
| 373 | Ga0182008_10648593 | 3300014497 | Bacteria | 598 |
| 374 | Ga0157377_10035480 | 3300014745 | Bacteria | 2736 |
| 375 | Ga0157377_10882636 | 3300014745 | Bacteria | 667 |
| 376 | Ga0157379_10662826 | 3300014968 | Bacteria | 978 |
| 377 | Ga0157379_11882846 | 3300014968 | Bacteria | 589 |
| 378 | Ga0157376_10030698 | 3300014969 | Bacteria | 4295 |
| 379 | Ga0157376_11163166 | 3300014969 | Bacteria | 799 |
| 380 | Ga0157376_12307526 | 3300014969 | Bacteria | 577 |
| 381 | Ga0157376_12744268 | 3300014969 | Bacteria | 532 |
| 382 | Ga0182006_1000132 | 3300015261 | Bacteria | 80500 |
| 383 | Ga0182006_1000229 | 3300015261 | Bacteria | 53391 |
| 384 | Ga0182006_1002331 | 3300015261 | Bacteria | 10444 |
| 385 | Ga0182006_1003205 | 3300015261 | Bacteria | 8510 |
| 386 | Ga0182006_1029102 | 3300015261 | Bacteria | 2240 |
| 387 | Ga0182007_10000009 | 3300015262 | Bacteria | 316298 |
| 388 | Ga0182007_10002891 | 3300015262 | Bacteria | 8349 |
| 389 | Ga0182007_10032142 | 3300015262 | Bacteria | 1784 |
| 390 | Ga0182007_10124433 | 3300015262 | Bacteria | 864 |
| 391 | Ga0183373_1008 | 3300015682 | Bacteria | 255339 |
| 392 | Ga0163161_10000537 | 3300017792 | Bacteria | 30944 |
| 393 | Ga0163161_10000787 | 3300017792 | Bacteria | 24900 |
| 394 | Ga0163161_10000828 | 3300017792 | Bacteria | 24173 |
| 395 | Ga0163161_10000991 | 3300017792 | Bacteria | 21691 |
| 396 | Ga0163161_10002797 | 3300017792 | Bacteria | 12373 |
| 397 | Ga0163161_10087213 | 3300017792 | Bacteria | 2305 |
| 398 | Ga0163161_10118989 | 3300017792 | Bacteria | 1983 |
| 399 | Ga0163161_10212443 | 3300017792 | Bacteria | 1495 |
| 400 | Ga0163161_10246083 | 3300017792 | Bacteria | 1392 |
| 401 | Ga0163161_10507942 | 3300017792 | Bacteria | 982 |
| 402 | Ga0163161_11944884 | 3300017792 | Bacteria | 523 |
| 403 | Ga0213872_10163370 | 3300021361 | Bacteria | 968 |
| 404 | Ga0209563_120252 | 3300025230 | Bacteria | 750 |
| 405 | Ga0207427_100066 | 3300025231 | Bacteria | 165770 |
| 406 | Ga0209437_100010 | 3300025233 | Bacteria | 838447 |
| 407 | Ga0209437_100030 | 3300025233 | Bacteria | 532466 |
| 408 | Ga0207425_1000008 | 3300025245 | Bacteria | 618024 |
| 409 | Ga0209026_1000246 | 3300025250 | Bacteria | 69164 |
| 410 | Ga0209026_1003283 | 3300025250 | Bacteria | 5411 |
| 411 | Ga0209026_1009476 | 3300025250 | Bacteria | 1910 |
| 412 | Ga0209129_1000042 | 3300025258 | Bacteria | 305537 |
| 413 | Ga0209129_1012392 | 3300025258 | Bacteria | 1960 |
| 414 | Ga0209233_1000017 | 3300025261 | Bacteria | 898076 |
| 415 | Ga0209455_1004736 | 3300025272 | Bacteria | 4368 |
| 416 | Ga0209676_1000009 | 3300025292 | Bacteria | 981719 |
| 417 | Ga0209676_1000455 | 3300025292 | Bacteria | 68999 |
| 418 | Ga0209025_1000020 | 3300025294 | Bacteria | 618024 |
| 419 | Ga0209758_1000022 | 3300025297 | Bacteria | 618024 |
| 420 | Ga0209050_1000103 | 3300025298 | Bacteria | 229225 |
| 421 | Ga0209050_1015302 | 3300025298 | Bacteria | 3231 |
| 422 | Ga0207697_10078142 | 3300025315 | Bacteria | 1392 |
| 423 | Ga0207656_10100263 | 3300025321 | Bacteria | 1327 |
| 424 | Ga0207682_10054492 | 3300025893 | Bacteria | 1662 |
| 425 | Ga0207680_10054144 | 3300025903 | Bacteria | 2412 |
| 426 | Ga0207647_10000036 | 3300025904 | Bacteria | 98204 |
| 427 | Ga0207647_10003216 | 3300025904 | Bacteria | 12256 |
| 428 | Ga0207647_10103722 | 3300025904 | Bacteria | 1686 |
| 429 | Ga0207647_10136292 | 3300025904 | Bacteria | 1440 |
| 430 | Ga0207645_10000767 | 3300025907 | Bacteria | 26724 |
| 431 | Ga0207645_10003332 | 3300025907 | Bacteria | 12252 |
| 432 | Ga0207645_10572707 | 3300025907 | Unclassified | 766 |
| 433 | Ga0207643_10026043 | 3300025908 | Bacteria | 3236 |
| 434 | Ga0207705_10000032 | 3300025909 | Bacteria | 224376 |
| 435 | Ga0207705_10001474 | 3300025909 | Bacteria | 18740 |
| 436 | Ga0207705_10188698 | 3300025909 | Bacteria | 1558 |
| 437 | Ga0207705_10225853 | 3300025909 | Bacteria | 1423 |
| 438 | Ga0207705_10267623 | 3300025909 | Bacteria | 1306 |
| 439 | Ga0207705_10505920 | 3300025909 | Bacteria | 938 |
| 440 | Ga0207705_10708500 | 3300025909 | Bacteria | 782 |
| 441 | Ga0207705_10956507 | 3300025909 | Bacteria | 662 |
| 442 | Ga0207654_10001015 | 3300025911 | Bacteria | 15362 |
| 443 | Ga0207654_10002954 | 3300025911 | Bacteria | 8621 |
| 444 | Ga0207654_10034380 | 3300025911 | Bacteria | 2816 |
| 445 | Ga0207654_10060455 | 3300025911 | Bacteria | 2213 |
| 446 | Ga0207654_10062111 | 3300025911 | Bacteria | 2187 |
| 447 | Ga0207654_10322657 | 3300025911 | Bacteria | 1056 |
| 448 | Ga0207707_10008912 | 3300025912 | Bacteria | 8712 |
| 449 | Ga0207707_10068540 | 3300025912 | Bacteria | 3091 |
| 450 | Ga0207695_10000197 | 3300025913 | Bacteria | 168837 |
| 451 | Ga0207695_10002602 | 3300025913 | Bacteria | 26455 |
| 452 | Ga0207695_10010598 | 3300025913 | Bacteria | 11267 |
| 453 | Ga0207695_10030986 | 3300025913 | Bacteria | 5878 |
| 454 | Ga0207695_10108796 | 3300025913 | Bacteria | 2755 |
| 455 | Ga0207695_10170790 | 3300025913 | Bacteria | 2100 |
| 456 | Ga0207695_10340202 | 3300025913 | Bacteria | 1388 |
| 457 | Ga0207695_10408841 | 3300025913 | Bacteria | 1241 |
| 458 | Ga0207695_11204636 | 3300025913 | Bacteria | 637 |
| 459 | Ga0207695_11225707 | 3300025913 | Bacteria | 630 |
| 460 | Ga0207671_10002335 | 3300025914 | Bacteria | 20461 |
| 461 | Ga0207671_10003413 | 3300025914 | Bacteria | 15880 |
| 462 | Ga0207671_10003709 | 3300025914 | Bacteria | 15048 |
| 463 | Ga0207671_10004896 | 3300025914 | Bacteria | 12580 |
| 464 | Ga0207671_10005952 | 3300025914 | Bacteria | 11051 |
| 465 | Ga0207671_10008207 | 3300025914 | Bacteria | 8896 |
| 466 | Ga0207671_10056958 | 3300025914 | Bacteria | 2896 |
| 467 | Ga0207671_10084372 | 3300025914 | Bacteria | 2386 |
| 468 | Ga0207671_10158702 | 3300025914 | Bacteria | 1750 |
| 469 | Ga0207671_10173670 | 3300025914 | Bacteria | 1674 |
| 470 | Ga0207671_10224633 | 3300025914 | Bacteria | 1472 |
| 471 | Ga0207671_11360366 | 3300025914 | Bacteria | 551 |
| 472 | Ga0207671_11415044 | 3300025914 | Bacteria | 539 |
| 473 | Ga0207660_10014016 | 3300025917 | Bacteria | 5261 |
| 474 | Ga0207660_10043586 | 3300025917 | Bacteria | 3153 |
| 475 | Ga0207660_10533826 | 3300025917 | Bacteria | 953 |
| 476 | Ga0207657_10034473 | 3300025919 | Bacteria | 4551 |
| 477 | Ga0207657_10053423 | 3300025919 | Bacteria | 3500 |
| 478 | Ga0207657_10062996 | 3300025919 | Bacteria | 3173 |
| 479 | Ga0207649_11254522 | 3300025920 | Unclassified | 586 |
| 480 | Ga0207652_10001233 | 3300025921 | Bacteria | 22917 |
| 481 | Ga0207652_10015719 | 3300025921 | Bacteria | 6165 |
| 482 | Ga0207652_11252657 | 3300025921 | Bacteria | 644 |
| 483 | Ga0207652_11265697 | 3300025921 | Bacteria | 640 |
| 484 | Ga0207681_10116112 | 3300025923 | Bacteria | 1955 |
| 485 | Ga0207694_10016665 | 3300025924 | Bacteria | 5553 |
| 486 | Ga0207694_10136571 | 3300025924 | Bacteria | 1970 |
| 487 | Ga0207694_10330619 | 3300025924 | Bacteria | 1259 |
| 488 | Ga0207650_10095911 | 3300025925 | Bacteria | 2274 |
| 489 | Ga0207650_10098223 | 3300025925 | Bacteria | 2249 |
| 490 | Ga0207650_10349327 | 3300025925 | Bacteria | 1216 |
| 491 | Ga0207650_10420532 | 3300025925 | Bacteria | 1109 |
| 492 | Ga0207659_10190700 | 3300025926 | Bacteria | 1631 |
| 493 | Ga0207659_10321999 | 3300025926 | Bacteria | 1276 |
| 494 | Ga0207659_10555139 | 3300025926 | Bacteria | 976 |
| 495 | Ga0207644_10040413 | 3300025931 | Bacteria | 3296 |
| 496 | Ga0207644_11152371 | 3300025931 | Unclassified | 652 |
| 497 | Ga0207690_10001817 | 3300025932 | Bacteria | 13092 |
| 498 | Ga0207690_10123456 | 3300025932 | Bacteria | 1885 |
| 499 | Ga0207690_10173588 | 3300025932 | Bacteria | 1617 |
| 500 | Ga0207690_10402879 | 3300025932 | Bacteria | 1091 |
| 501 | Ga0207690_10766008 | 3300025932 | Bacteria | 796 |
| 502 | Ga0207706_10000125 | 3300025933 | Bacteria | 83075 |
| 503 | Ga0207706_10360774 | 3300025933 | Bacteria | 1262 |
| 504 | Ga0207686_10000200 | 3300025934 | Bacteria | 46234 |
| 505 | Ga0207686_10149977 | 3300025934 | Bacteria | 1622 |
| 506 | Ga0207686_10300646 | 3300025934 | Bacteria | 1191 |
| 507 | Ga0207686_11406667 | 3300025934 | Bacteria | 574 |
| 508 | Ga0207686_11582637 | 3300025934 | Bacteria | 541 |
| 509 | Ga0207686_11647555 | 3300025934 | Bacteria | 530 |
| 510 | Ga0207709_10000026 | 3300025935 | Bacteria | 354467 |
| 511 | Ga0207709_10407892 | 3300025935 | Bacteria | 1040 |
| 512 | Ga0207670_10485388 | 3300025936 | Bacteria | 1001 |
| 513 | Ga0207669_10371145 | 3300025937 | Bacteria | 1112 |
| 514 | Ga0207704_10000043 | 3300025938 | Bacteria | 88714 |
| 515 | Ga0207704_10115091 | 3300025938 | Bacteria | 1827 |
| 516 | Ga0207665_11526006 | 3300025939 | Unclassified | 531 |
| 517 | Ga0207691_10013724 | 3300025940 | Bacteria | 7741 |
| 518 | Ga0207691_10072530 | 3300025940 | Bacteria | 3106 |
| 519 | Ga0207691_10210766 | 3300025940 | Bacteria | 1688 |
| 520 | Ga0207689_10035388 | 3300025942 | Bacteria | 4149 |
| 521 | Ga0207689_10106695 | 3300025942 | Unclassified | 2301 |
| 522 | Ga0207689_11751437 | 3300025942 | Bacteria | 514 |
| 523 | Ga0207661_10047813 | 3300025944 | Bacteria | 3398 |
| 524 | Ga0207661_10060953 | 3300025944 | Bacteria | 3047 |
| 525 | Ga0207667_10000630 | 3300025949 | Bacteria | 45583 |
| 526 | Ga0207667_10001087 | 3300025949 | Bacteria | 34483 |
| 527 | Ga0207667_10004753 | 3300025949 | Bacteria | 16611 |
| 528 | Ga0207667_10006745 | 3300025949 | Bacteria | 13859 |
| 529 | Ga0207667_10020244 | 3300025949 | Bacteria | 7404 |
| 530 | Ga0207667_10119173 | 3300025949 | Bacteria | 2720 |
| 531 | Ga0207667_10131630 | 3300025949 | Bacteria | 2577 |
| 532 | Ga0207667_10299638 | 3300025949 | Bacteria | 1642 |
| 533 | Ga0207667_10442623 | 3300025949 | Bacteria | 1321 |
| 534 | Ga0207667_10791521 | 3300025949 | Bacteria | 945 |
| 535 | Ga0207651_10455432 | 3300025960 | Bacteria | 1098 |
| 536 | Ga0207651_11455789 | 3300025960 | Bacteria | 617 |
| 537 | Ga0207712_10000996 | 3300025961 | Bacteria | 20182 |
| 538 | Ga0207640_10302371 | 3300025981 | Bacteria | 1266 |
| 539 | Ga0207640_11340088 | 3300025981 | Bacteria | 640 |
| 540 | Ga0207677_10405520 | 3300026023 | Bacteria | 1157 |
| 541 | Ga0207703_11652650 | 3300026035 | Unclassified | 616 |
| 542 | Ga0207639_10009142 | 3300026041 | Bacteria | 6830 |
| 543 | Ga0207639_10032059 | 3300026041 | Bacteria | 3866 |
| 544 | Ga0207639_10426897 | 3300026041 | Bacteria | 1199 |
| 545 | Ga0207639_10888708 | 3300026041 | Bacteria | 832 |
| 546 | Ga0207639_11333241 | 3300026041 | Bacteria | 673 |
| 547 | Ga0207678_10036233 | 3300026067 | Bacteria | 4294 |
| 548 | Ga0207678_10043031 | 3300026067 | Bacteria | 3909 |
| 549 | Ga0207678_11857996 | 3300026067 | Unclassified | 526 |
| 550 | Ga0207708_10050718 | 3300026075 | Bacteria | 3159 |
| 551 | Ga0207708_10390650 | 3300026075 | Unclassified | 1148 |
| 552 | Ga0207702_10000393 | 3300026078 | Bacteria | 49888 |
| 553 | Ga0207702_10024780 | 3300026078 | Bacteria | 4978 |
| 554 | Ga0207702_10025453 | 3300026078 | Bacteria | 4911 |
| 555 | Ga0207702_10160383 | 3300026078 | Bacteria | 2053 |
| 556 | Ga0207702_10366132 | 3300026078 | Bacteria | 1383 |
| 557 | Ga0207702_10723120 | 3300026078 | Bacteria | 982 |
| 558 | Ga0207702_10983603 | 3300026078 | Bacteria | 837 |
| 559 | Ga0207641_10000921 | 3300026088 | Bacteria | 30349 |
| 560 | Ga0207641_10006712 | 3300026088 | Bacteria | 9643 |
| 561 | Ga0207641_10134800 | 3300026088 | Bacteria | 2221 |
| 562 | Ga0207676_10107576 | 3300026095 | Bacteria | 2326 |
| 563 | Ga0207676_10151573 | 3300026095 | Bacteria | 1997 |
| 564 | Ga0207676_10527523 | 3300026095 | Bacteria | 1125 |
| 565 | Ga0207674_10033030 | 3300026116 | Bacteria | 5422 |
| 566 | Ga0207674_10294529 | 3300026116 | Bacteria | 1571 |
| 567 | Ga0207674_10315315 | 3300026116 | Bacteria | 1513 |
| 568 | Ga0207674_10691179 | 3300026116 | Bacteria | 985 |
| 569 | Ga0207674_11339584 | 3300026116 | Bacteria | 685 |
| 570 | Ga0207675_100415340 | 3300026118 | Bacteria | 1328 |
| 571 | Ga0207683_10045818 | 3300026121 | Bacteria | 3825 |
| 572 | Ga0207683_10245967 | 3300026121 | Bacteria | 1632 |
| 573 | Ga0207698_10004007 | 3300026142 | Bacteria | 8935 |
| 574 | Ga0207698_10261173 | 3300026142 | Bacteria | 1591 |
| 575 | Ga0207698_10370536 | 3300026142 | Bacteria | 1359 |
| 576 | Ga0207698_10618797 | 3300026142 | Bacteria | 1069 |
| 577 | Ga0207698_10991631 | 3300026142 | Bacteria | 850 |
| 578 | Ga0207428_10137447 | 3300027907 | Bacteria | 1868 |
| 579 | Ga0268266_10000037 | 3300028379 | Bacteria | 342368 |
| 580 | Ga0268265_10222960 | 3300028380 | Bacteria | 1651 |
| 581 | Ga0265334_10057213 | 3300028573 | Unclassified | 1478 |
| 582 | Ga0307517_10001881 | 3300028786 | Bacteria | 34355 |
| 583 | Ga0307515_10000790 | 3300028794 | Bacteria | 72891 |
| 584 | Ga0307515_10001565 | 3300028794 | Bacteria | 51101 |
| 585 | Ga0307515_10062818 | 3300028794 | Bacteria | 5235 |
| 586 | Ga0307515_10068910 | 3300028794 | Bacteria | 4849 |
| 587 | Ga0307515_10093363 | 3300028794 | Bacteria | 3732 |
| 588 | Ga0307515_10357702 | 3300028794 | Bacteria | 1103 |
| 589 | Ga0265338_10010649 | 3300028800 | Bacteria | 10749 |
| 590 | Ga0265338_10153395 | 3300028800 | Bacteria | 1787 |
| 591 | Ga0265338_10448333 | 3300028800 | Bacteria | 914 |
| 592 | Ga0265338_10514341 | 3300028800 | Bacteria | 842 |
| 593 | Ga0265324_10169631 | 3300029957 | Unclassified | 741 |
| 594 | Ga0316176_1014596 | 3300030732 | Bacteria | 15075 |
| 595 | Ga0316183_1016718 | 3300030742 | Bacteria | 50913 |
| 596 | Ga0316181_1091070 | 3300030744 | Bacteria | 11978 |
| 597 | Ga0316181_1124067 | 3300030744 | Bacteria | 828 |
| 598 | Ga0316182_1148669 | 3300030745 | Bacteria | 3273 |
| 599 | Ga0265320_10223651 | 3300031240 | Unclassified | 838 |
| 600 | Ga0265327_10083579 | 3300031251 | Bacteria | 1571 |
| 601 | Ga0307509_10011471 | 3300031507 | Bacteria | 10720 |
| 602 | Ga0307509_10373643 | 3300031507 | Bacteria | 1141 |
| 603 | Ga0307408_100000628 | 3300031548 | Bacteria | 29832 |
| 604 | Ga0307408_100001834 | 3300031548 | Bacteria | 15479 |
| 605 | Ga0307408_100016380 | 3300031548 | Bacteria | 4946 |
| 606 | Ga0307408_101940426 | 3300031548 | Bacteria | 565 |
| 607 | Ga0316576_10901982 | 3300031727 | Bacteria | 633 |
| 608 | Ga0316576_11033852 | 3300031727 | Bacteria | 584 |
| 609 | Ga0307516_10573588 | 3300031730 | Bacteria | 782 |
| 610 | Ga0307405_10000016 | 3300031731 | Bacteria | 197180 |
| 611 | Ga0307405_10009259 | 3300031731 | Bacteria | 5040 |
| 612 | Ga0307405_10113301 | 3300031731 | Bacteria | 1841 |
| 613 | Ga0307405_10611843 | 3300031731 | Bacteria | 891 |
| 614 | Ga0307405_11446311 | 3300031731 | Bacteria | 602 |
| 615 | Ga0307413_10905632 | 3300031824 | Unclassified | 749 |
| 616 | Ga0307410_10337270 | 3300031852 | Unclassified | 1201 |
| 617 | Ga0307406_10800139 | 3300031901 | Bacteria | 795 |
| 618 | Ga0307407_10000006 | 3300031903 | Bacteria | 218714 |
| 619 | Ga0307412_10000001 | 3300031911 | Bacteria | 822691 |
| 620 | Ga0307412_10001942 | 3300031911 | Bacteria | 11437 |
| 621 | Ga0307412_10034482 | 3300031911 | Bacteria | 3225 |
| 622 | Ga0307412_10203138 | 3300031911 | Bacteria | 1506 |
| 623 | Ga0307412_10441980 | 3300031911 | Bacteria | 1069 |
| 624 | Ga0307412_10690848 | 3300031911 | Bacteria | 875 |
| 625 | Ga0307412_10943005 | 3300031911 | Bacteria | 759 |
| 626 | Ga0307416_100000032 | 3300032002 | Bacteria | 156777 |
| 627 | Ga0307416_100060854 | 3300032002 | Bacteria | 3078 |
| 628 | Ga0307414_10000268 | 3300032004 | Bacteria | 32688 |
| 629 | Ga0307414_10005701 | 3300032004 | Bacteria | 6877 |
| 630 | Ga0307414_10021383 | 3300032004 | Bacteria | 4058 |
| 631 | Ga0307414_10040328 | 3300032004 | Bacteria | 3153 |
| 632 | Ga0307414_10055952 | 3300032004 | Bacteria | 2764 |
| 633 | Ga0307414_10092095 | 3300032004 | Bacteria | 2255 |
| 634 | Ga0307414_10092129 | 3300032004 | Bacteria | 2255 |
| 635 | Ga0307414_10190811 | 3300032004 | Bacteria | 1658 |
| 636 | Ga0307414_11508851 | 3300032004 | Bacteria | 625 |
| 637 | Ga0307414_11795324 | 3300032004 | Bacteria | 572 |
| 638 | Ga0307414_11881010 | 3300032004 | Bacteria | 558 |
| 639 | Ga0307411_10066871 | 3300032005 | Bacteria | 2416 |
| 640 | Ga0307411_11764727 | 3300032005 | Bacteria | 574 |
| 641 | Ga0307411_11798467 | 3300032005 | Bacteria | 569 |
| 642 | Ga0307415_100221734 | 3300032126 | Bacteria | 1516 |
| 643 | Ga0307507_10000143 | 3300033179 | Bacteria | 124248 |
| 644 | Ga0307510_10000149 | 3300033180 | Bacteria | 58176 |
| 645 | Ga0373941_0109536 | 3300035115 | Bacteria | 972 |
| 646 | Ga0373927_0153063 | 3300035695 | Bacteria | 1510 |
| 647 | Ga0373937_0989888 | 3300036401 | Bacteria | 790 |
| 648 | Ga0316584_0231279 | 3300036712 | Bacteria | 1355 |
| 649 | Ga0373925_1418411 | 3300037068 | Bacteria | 569 |
| 650 | Ga0395899_0000017 | 3300037312 | Bacteria | 440179 |
| 651 | Ga0395899_0000152 | 3300037312 | Bacteria | 105233 |
| 652 | Ga0395899_0003831 | 3300037312 | Bacteria | 11870 |
| 653 | Ga0395899_0277394 | 3300037312 | Bacteria | 1141 |
| 654 | Ga0395900_0000523 | 3300037418 | Bacteria | 54244 |
| 655 | Ga0395900_0005417 | 3300037418 | Bacteria | 13369 |
| 656 | Ga0395900_0005978 | 3300037418 | Bacteria | 12706 |
| 657 | Ga0395900_0105004 | 3300037418 | Bacteria | 2902 |
| 658 | Ga0395900_0163666 | 3300037418 | Unclassified | 2268 |
| 659 | Ga0395900_0240627 | 3300037418 | Bacteria | 1816 |
| 660 | Ga0395900_1915307 | 3300037418 | Bacteria | 503 |
| 661 | Ga0395898_0003563 | 3300037466 | Bacteria | 17360 |
| 662 | Ga0395898_0075703 | 3300037466 | Bacteria | 3251 |
| 663 | Ga0395898_0127076 | 3300037466 | Bacteria | 2442 |
| 664 | Ga0395905_0006175 | 3300037471 | Bacteria | 12096 |
| 665 | Ga0395905_0007055 | 3300037471 | Bacteria | 11229 |
| 666 | Ga0395905_0183951 | 3300037471 | Bacteria | 1962 |
| 667 | Ga0395901_0007492 | 3300038443 | Bacteria | 11024 |
| 668 | Ga0395901_0013621 | 3300038443 | Bacteria | 8268 |
| 669 | Ga0395901_0018348 | 3300038443 | Bacteria | 7143 |
| 670 | Ga0395901_0113245 | 3300038443 | Bacteria | 2849 |
| 671 | Ga0400484_43947 | 3300038725 | Bacteria | 2058 |
| 672 | Ga0400483_044221 | 3300039062 | Bacteria | 1788 |
| 673 | Ga0400483_062433 | 3300039062 | Bacteria | 2378 |
| 674 | Ga0400483_112494 | 3300039062 | Unclassified | 1136 |
| 675 | Ga0436365_1929414 | 3300039437 | Bacteria | 3775 |
| 676 | Ga0436361_0569017 | 3300039447 | Bacteria | 988 |
| 677 | Ga0439436_0000241 | 3300041404 | Bacteria | 13168 |
| 678 | Ga0439439_0020088 | 3300041406 | Bacteria | 1659 |
| 679 | Ga0451793_0438499 | 3300041452 | Bacteria | 701 |
| 680 | Ga0451793_0959079 | 3300041452 | Bacteria | 586 |
| 681 | Ga0451793_1840194 | 3300041452 | Bacteria | 953 |
| 682 | Ga0451797_1031175 | 3300041453 | Bacteria | 505 |
| 683 | Ga0451798_1146370 | 3300041458 | Bacteria | 652 |
| 684 | Ga0451800_0026029 | 3300041459 | Bacteria | 701 |
| 685 | Ga0451802_0608812 | 3300041460 | Bacteria | 690 |
| 686 | Ga0451807_2157009 | 3300041486 | Bacteria | 854 |
| 687 | Ga0451835_0814727 | 3300041492 | Bacteria | 575 |
| 688 | Ga0451837_0878129 | 3300041494 | Unclassified | 661 |
| 689 | Ga0451841_1117568 | 3300041498 | Bacteria | 518 |
| 690 | Ga0451841_1304691 | 3300041498 | Unclassified | 606 |
| 691 | Ga0439433_0196967 | 3300041999 | Bacteria | 531 |
| 692 | Ga0439449_0068234 | 3300042007 | Bacteria | 1311 |
| 693 | Ga0439455_0121192 | 3300042012 | Bacteria | 733 |
| 694 | Ga0439457_000013 | 3300042014 | Bacteria | 36480 |
| 695 | Ga0439462_0100615 | 3300042015 | Bacteria | 797 |
| 696 | Ga0450923_011295 | 3300042125 | Bacteria | 1603 |
| 697 | Ga0439435_0074984 | 3300042436 | Bacteria | 1007 |
| 698 | Ga0451577_0901215 | 3300042876 | Unclassified | 796 |
| 699 | Ga0466969_0152231 | 3300044656 | Bacteria | 1065 |
| 700 | Ga0466972_0000263 | 3300044658 | Bacteria | 33957 |
| 701 | Ga0453683_0003606 | 3300044673 | Bacteria | 11363 |
| 702 | Ga0453683_0461515 | 3300044673 | Bacteria | 822 |
| 703 | Ga0466966_0081289 | 3300044684 | Bacteria | 2017 |
| 704 | Ga0466966_1003400 | 3300044684 | Bacteria | 504 |
| 705 | Ga0466961_0082976 | 3300044693 | Bacteria | 2027 |
| 706 | Ga0466961_0333376 | 3300044693 | Bacteria | 924 |
| 707 | Ga0453684_0009201 | 3300044712 | Bacteria | 17361 |
| 708 | Ga0453684_0080844 | 3300044712 | Bacteria | 4056 |
| 709 | Ga0466959_0073994 | 3300045049 | Bacteria | 2464 |
| 710 | Ga0451576_0000008 | 3300045051 | Bacteria | 746156 |
| 711 | Ga0466958_0012340 | 3300045836 | Bacteria | 4839 |
| 712 | Ga0495638_0145207 | 3300046460 | Bacteria | 1381 |
| 713 | Ga0495638_0213000 | 3300046460 | Bacteria | 1084 |
| 714 | Ga0495638_0593081 | 3300046460 | Bacteria | 545 |
| 715 | Ga0495651_0077080 | 3300046462 | Bacteria | 2524 |
| 716 | Ga0495650_0000095 | 3300046471 | Bacteria | 218020 |
| 717 | Ga0495650_0271739 | 3300046471 | Bacteria | 572 |
| 718 | Ga0495650_0335285 | 3300046471 | Bacteria | 502 |
| 719 | Ga0495585_0000057 | 3300046492 | Bacteria | 113069 |
| 720 | Ga0495585_0000648 | 3300046492 | Bacteria | 31937 |
| 721 | Ga0495596_0025532 | 3300046500 | Bacteria | 2388 |
| 722 | Ga0495607_0167770 | 3300046501 | Bacteria | 1111 |
| 723 | Ga0495583_0029680 | 3300046506 | Bacteria | 2673 |
| 724 | Ga0495583_0072998 | 3300046506 | Bacteria | 1505 |
| 725 | Ga0495583_0256669 | 3300046506 | Bacteria | 700 |
| 726 | Ga0495606_0000009 | 3300046507 | Bacteria | 306313 |
| 727 | Ga0495606_0007717 | 3300046507 | Bacteria | 9530 |
| 728 | Ga0495606_0011706 | 3300046507 | Bacteria | 7121 |
| 729 | Ga0495606_0026272 | 3300046507 | Bacteria | 4152 |
| 730 | Ga0495606_0031758 | 3300046507 | Bacteria | 3667 |
| 731 | Ga0495606_0061425 | 3300046507 | Bacteria | 2403 |
| 732 | Ga0495606_0603678 | 3300046507 | Bacteria | 538 |
| 733 | Ga0495610_0000231 | 3300046512 | Bacteria | 59540 |
| 734 | Ga0495610_0000237 | 3300046512 | Bacteria | 57952 |
| 735 | Ga0495610_0001711 | 3300046512 | Bacteria | 19236 |
| 736 | Ga0495610_0149922 | 3300046512 | Bacteria | 996 |
| 737 | Ga0495616_0000733 | 3300046513 | Bacteria | 24135 |
| 738 | Ga0495616_0006705 | 3300046513 | Bacteria | 6948 |
| 739 | Ga0495631_0016934 | 3300046518 | Bacteria | 3458 |
| 740 | Ga0495632_0131408 | 3300046519 | Bacteria | 1165 |
| 741 | Ga0495637_0092864 | 3300046520 | Bacteria | 1188 |
| 742 | Ga0495643_0276495 | 3300046522 | Bacteria | 774 |
| 743 | Ga0495644_0021868 | 3300046523 | Bacteria | 2438 |
| 744 | Ga0495648_0005462 | 3300046524 | Bacteria | 10551 |
| 745 | Ga0495648_0018322 | 3300046524 | Bacteria | 4963 |
| 746 | Ga0495652_0090697 | 3300046529 | Bacteria | 2500 |
| 747 | Ga0495652_0466530 | 3300046529 | Bacteria | 881 |
| 748 | Ga0495652_0541635 | 3300046529 | Bacteria | 801 |
| 749 | Ga0495654_0246215 | 3300046530 | Bacteria | 746 |
| 750 | Ga0495609_0007538 | 3300046538 | Bacteria | 5416 |
| 751 | Ga0495609_0011292 | 3300046538 | Bacteria | 4258 |
| 752 | Ga0495609_0036324 | 3300046538 | Bacteria | 2225 |
| 753 | Ga0495609_0247295 | 3300046538 | Bacteria | 735 |
| 754 | Ga0495633_0000275 | 3300046558 | Bacteria | 60032 |
| 755 | Ga0495633_0006218 | 3300046558 | Bacteria | 7130 |
| 756 | Ga0495633_0203951 | 3300046558 | Bacteria | 907 |
| 757 | Ga0495668_0000017 | 3300046616 | Bacteria | 434025 |
| 758 | Ga0495668_0096233 | 3300046616 | Bacteria | 1620 |
| 759 | Ga0495634_0617640 | 3300046642 | Bacteria | 628 |
| 760 | Ga0495625_0000007 | 3300046660 | Bacteria | 565749 |
| 761 | Ga0495625_0000901 | 3300046660 | Bacteria | 39985 |
| 762 | Ga0495625_0001789 | 3300046660 | Bacteria | 24694 |
| 763 | Ga0495625_0003096 | 3300046660 | Bacteria | 16990 |
| 764 | Ga0495625_0052422 | 3300046660 | Bacteria | 2921 |
| 765 | Ga0495625_0248723 | 3300046660 | Bacteria | 1155 |
| 766 | Ga0495625_0403762 | 3300046660 | Bacteria | 853 |
| 767 | Ga0495661_0000576 | 3300046665 | Bacteria | 38166 |
| 768 | Ga0495661_0004014 | 3300046665 | Bacteria | 10726 |
| 769 | Ga0495661_0063777 | 3300046665 | Bacteria | 2177 |
| 770 | Ga0495661_0209276 | 3300046665 | Bacteria | 1016 |
| 771 | Ga0495661_0343171 | 3300046665 | Bacteria | 737 |
| 772 | Ga0495658_0116785 | 3300046683 | Unclassified | 1610 |
| 773 | Ga0495669_0375434 | 3300046684 | Bacteria | 688 |
| 774 | Ga0495670_0337091 | 3300046691 | Bacteria | 811 |
| 775 | Ga0495671_0026266 | 3300046692 | Bacteria | 3020 |
| 776 | Ga0495649_0000007 | 3300046694 | Bacteria | 518037 |
| 777 | Ga0495649_0582358 | 3300046694 | Bacteria | 553 |
| 778 | Ga0495660_0009750 | 3300046810 | Bacteria | 5596 |
| 779 | Ga0495683_0018342 | 3300047323 | Bacteria | 3619 |
| 780 | Ga0495687_004966 | 3300047443 | Bacteria | 8698 |
| 781 | Ga0495687_007879 | 3300047443 | Bacteria | 6195 |
| 782 | Ga0495687_025474 | 3300047443 | Bacteria | 2795 |
| 783 | Ga0495687_124607 | 3300047443 | Bacteria | 923 |
| 784 | Ga0495677_0017891 | 3300047445 | Unclassified | 2569 |
| 785 | Ga0495685_152589 | 3300047447 | Bacteria | 750 |
| 786 | Ga0495673_0111947 | 3300047469 | Bacteria | 1090 |
| 787 | Ga0495686_0000490 | 3300047472 | Bacteria | 58423 |
| 788 | Ga0495686_0000729 | 3300047472 | Bacteria | 44005 |
| 789 | Ga0495686_0017335 | 3300047472 | Bacteria | 4856 |
| 790 | Ga0495686_0030106 | 3300047472 | Bacteria | 3528 |
| 791 | Ga0495686_0152383 | 3300047472 | Bacteria | 1356 |
| 792 | Ga0495686_0314448 | 3300047472 | Bacteria | 860 |
| 793 | Ga0495602_1118268 | 3300048088 | Bacteria | 516 |
| 794 | Ga0495614_0003480 | 3300048089 | Bacteria | 7048 |
| 795 | Ga0496116_0000752 | 3300048919 | Bacteria | 41208 |
| 796 | Ga0496117_0007456 | 3300048920 | Bacteria | 10680 |
| 797 | Ga0496118_0051861 | 3300048921 | Bacteria | 3135 |
| 798 | Ga0496122_0002421 | 3300048925 | Bacteria | 26557 |
| 799 | Ga0496122_0003438 | 3300048925 | Bacteria | 20821 |
| 800 | Ga0496123_0004076 | 3300048926 | Bacteria | 15730 |
| 801 | Ga0496123_0020394 | 3300048926 | Bacteria | 5186 |
| 802 | Ga0496125_0157196 | 3300048928 | Bacteria | 1551 |
| 803 | Ga0496125_0321761 | 3300048928 | Bacteria | 937 |
| 804 | Ga0495678_003805 | 3300049459 | Bacteria | 9099 |
| 805 | Ga0495678_227887 | 3300049459 | Bacteria | 562 |
| 806 | Ga0495682_0036521 | 3300049460 | Bacteria | 1809 |
| 807 | Ga0501034_0297323 | 3300049571 | Bacteria | 1552 |
| 808 | Ga0501043_0141142 | 3300049579 | Bacteria | 1887 |
| 809 | Ga0501047_0124055 | 3300049581 | Bacteria | 2463 |
| 810 | Ga0501047_0840617 | 3300049581 | Bacteria | 732 |
| 811 | Ga0501048_0079904 | 3300049582 | Bacteria | 2308 |
| 812 | Ga0501202_111142 | 3300049652 | Bacteria | 678 |
| 813 | Ga0501223_001696 | 3300049663 | Bacteria | 5042 |
| 814 | Ga0501223_148475 | 3300049663 | Bacteria | 508 |
| 815 | Ga0501233_096179 | 3300049668 | Bacteria | 778 |
| 816 | Ga0501240_000352 | 3300049673 | Bacteria | 3635 |
| 817 | Ga0501225_0000569 | 3300049705 | Bacteria | 11570 |
| 818 | Ga0501225_0283472 | 3300049705 | Bacteria | 556 |
| 819 | Ga0501241_002026 | 3300049758 | Bacteria | 3973 |
| 820 | Ga0501241_080470 | 3300049758 | Bacteria | 677 |
| 821 | Ga0501035_0622157 | 3300049822 | Bacteria | 878 |
| 822 | Ga0501044_0026588 | 3300049823 | Bacteria | 6125 |
| 823 | nmdc:mga00v17_798549_c1 | 3300050491 | Bacteria | 601 |
| 824 | nmdc:mga0k408_14935_c1 | 3300050493 | Bacteria | 1752 |
| 825 | nmdc:mga0k408_151_c2 | 3300050493 | Bacteria | 30883 |
| 826 | nmdc:mga0k408_54405_c2 | 3300050493 | Bacteria | 795 |
| 827 | nmdc:mga0k408_63_c1 | 3300050493 | Bacteria | 52809 |
| 828 | nmdc:mga0k408_661349_c1 | 3300050493 | Bacteria | 614 |
| 829 | nmdc:mga07m45_671441_c1 | 3300050496 | Bacteria | 597 |
| 830 | nmdc:mga09592_22801_c1 | 3300050508 | Bacteria | 5165 |
| 831 | nmdc:mga0qj67_216843_c1 | 3300050509 | Bacteria | 1554 |
| 832 | nmdc:mga06r32_103002_c1 | 3300050510 | Bacteria | 2802 |
| 833 | nmdc:mga08y16_53088_c1 | 3300050511 | Bacteria | 4239 |
| 834 | Ga0500635_0000719 | 3300053080 | Bacteria | 8328 |
| 835 | Ga0500578_0000010 | 3300053086 | Bacteria | 217642 |
| 836 | Ga0500583_0000064 | 3300053092 | Bacteria | 66001 |
| 837 | Ga0500583_0006250 | 3300053092 | Bacteria | 4080 |
| 838 | Ga0500651_0001193 | 3300053093 | Bacteria | 12892 |
| 839 | Ga0500608_000322 | 3300053122 | Bacteria | 18338 |
| 840 | Ga0500608_004236 | 3300053122 | Bacteria | 5524 |
| 841 | Ga0500618_000033 | 3300053125 | Bacteria | 121886 |
| 842 | Ga0500618_008791 | 3300053125 | Bacteria | 2793 |
| 843 | Ga0500564_198995 | 3300053138 | Bacteria | 824 |
| 844 | Ga0500568_0178919 | 3300053139 | Bacteria | 780 |
| 845 | Ga0500579_227616 | 3300053143 | Bacteria | 639 |
| 846 | Ga0500616_0154423 | 3300053153 | Unclassified | 1059 |
| 847 | Ga0500616_0198835 | 3300053153 | Bacteria | 889 |
| 848 | Ga0500619_181841 | 3300053154 | Bacteria | 710 |
| 849 | Ga0500622_0000417 | 3300053156 | Bacteria | 40427 |
| 850 | Ga0500622_0148758 | 3300053156 | Bacteria | 1109 |
| 851 | Ga0500624_000447 | 3300053157 | Bacteria | 12407 |
| 852 | Ga0500637_0377270 | 3300053178 | Bacteria | 745 |
| 853 | Ga0500611_000019 | 3300053727 | Bacteria | 110161 |
| 854 | Ga0500611_086330 | 3300053727 | Bacteria | 791 |
| 855 | Ga0500587_033546 | 3300053739 | Bacteria | 714 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005468 | Ga0070707_102130360 | Ga0070707_1021303601 | 107 |
| 2 | 3300042876 | Ga0451577_0901215 | Ga0451577_0901215_126_452 | 107 |
| 3 | 3300044712 | Ga0453684_0009201 | Ga0453684_0009201_9892_10218 | 107 |
| 4 | 2162886007 | SwRhRL2b_contig_2255685 | SwRhRL2b_0652.00005760 | 108 |
| 5 | 3300001904 | JGI24736J21556_1003173 | JGI24736J21556_10031733 | 108 |
| 6 | 3300001979 | JGI24740J21852_10005973 | JGI24740J21852_100059734 | 108 |
| 7 | 3300001979 | JGI24740J21852_10022379 | JGI24740J21852_100223792 | 108 |
| 8 | 3300001989 | JGI24739J22299_10002187 | JGI24739J22299_100021871 | 108 |
| 9 | 3300001989 | JGI24739J22299_10061220 | JGI24739J22299_100612202 | 108 |
| 10 | 3300001990 | JGI24737J22298_10000148 | JGI24737J22298_1000014824 | 108 |
| 11 | 3300001990 | JGI24737J22298_10096935 | JGI24737J22298_100969351 | 108 |
| 12 | 3300002067 | JGI24735J21928_10000020 | JGI24735J21928_1000002036 | 108 |
| 13 | 3300002077 | JGI24744J21845_10002386 | JGI24744J21845_100023864 | 108 |
| 14 | 3300002459 | JGI24751J29686_10035279 | JGI24751J29686_100352792 | 108 |
| 15 | 3300002737 | JGI25162J39368_1000097 | JGI25162J39368_100009773 | 108 |
| 16 | 3300002741 | JGI25157J39369_1012814 | JGI25157J39369_10128142 | 108 |
| 17 | 3300002741 | JGI25157J39369_1020846 | JGI25157J39369_10208462 | 108 |
| 18 | 3300002741 | JGI25157J39369_1023041 | JGI25157J39369_10230411 | 108 |
| 19 | 3300002773 | JGI25152J39213_1000007 | JGI25152J39213_100000780 | 108 |
| 20 | 3300002773 | JGI25152J39213_1024763 | JGI25152J39213_10247631 | 108 |
| 21 | 3300002774 | JGI25150J39212_1000013 | JGI25150J39212_1000013104 | 108 |
| 22 | 3300003187 | JGI25151J46595_10000004 | JGI25151J46595_1000000466 | 108 |
| 23 | 3300003214 | JGI25165J46597_1000733 | JGI25165J46597_10007337 | 108 |
| 24 | 3300003215 | JGI25153J46596_10000004 | JGI25153J46596_1000000466 | 108 |
| 25 | 3300003316 | rootH1_10101964 | rootH1_101019645 | 108 |
| 26 | 3300003316 | rootH1_10188452 | rootH1_101884522 | 108 |
| 27 | 3300003320 | rootH2_10009716 | rootH2_100097169 | 108 |
| 28 | 3300003320 | rootH2_10033863 | rootH2_1003386310 | 108 |
| 29 | 3300003320 | rootH2_10326475 | rootH2_103264753 | 108 |
| 30 | 3300003322 | rootL2_10029081 | rootL2_100290812 | 108 |
| 31 | 3300003323 | rootH1_10010071 | rootH1_100100711 | 108 |
| 32 | 3300003323 | rootH1_10025651 | rootH1_100256512 | 108 |
| 33 | 3300003323 | rootH1_10033417 | rootH1_1003341718 | 108 |
| 34 | 3300003323 | rootH1_10173204 | rootH1_101732043 | 108 |
| 35 | 3300003323 | rootH1_10306878 | rootH1_103068783 | 108 |
| 36 | 3300003781 | Ga0055536_1000010 | Ga0055536_1000010177 | 108 |
| 37 | 3300003791 | Ga0055530_10001623 | Ga0055530_100016235 | 108 |
| 38 | 3300004799 | Ga0058863_11194942 | Ga0058863_111949422 | 108 |
| 39 | 3300005262 | Ga0065165_1000242 | Ga0065165_100024231 | 108 |
| 40 | 3300005288 | Ga0065714_10003722 | Ga0065714_1000372212 | 108 |
| 41 | 3300005288 | Ga0065714_10004493 | Ga0065714_100044934 | 108 |
| 42 | 3300005288 | Ga0065714_10007828 | Ga0065714_100078285 | 108 |
| 43 | 3300005288 | Ga0065714_10064539 | Ga0065714_1006453931 | 108 |
| 44 | 3300005288 | Ga0065714_10079275 | Ga0065714_100792753 | 108 |
| 45 | 3300005288 | Ga0065714_10095945 | Ga0065714_100959453 | 108 |
| 46 | 3300005288 | Ga0065714_10106485 | Ga0065714_101064853 | 108 |
| 47 | 3300005288 | Ga0065714_10144326 | Ga0065714_101443263 | 108 |
| 48 | 3300005288 | Ga0065714_10182988 | Ga0065714_101829882 | 108 |
| 49 | 3300005288 | Ga0065714_10207420 | Ga0065714_102074202 | 108 |
| 50 | 3300005288 | Ga0065714_10288119 | Ga0065714_102881191 | 108 |
| 51 | 3300005288 | Ga0065714_10296100 | Ga0065714_102961002 | 108 |
| 52 | 3300005289 | Ga0065704_10000425 | Ga0065704_1000042511 | 108 |
| 53 | 3300005289 | Ga0065704_10001986 | Ga0065704_100019864 | 108 |
| 54 | 3300005289 | Ga0065704_10099600 | Ga0065704_100996002 | 108 |
| 55 | 3300005289 | Ga0065704_10145283 | Ga0065704_101452832 | 108 |
| 56 | 3300005289 | Ga0065704_10165409 | Ga0065704_101654092 | 108 |
| 57 | 3300005289 | Ga0065704_10327887 | Ga0065704_103278872 | 108 |
| 58 | 3300005289 | Ga0065704_10330903 | Ga0065704_103309032 | 108 |
| 59 | 3300005289 | Ga0065704_10338441 | Ga0065704_103384412 | 108 |
| 60 | 3300005289 | Ga0065704_10523286 | Ga0065704_105232862 | 108 |
| 61 | 3300005290 | Ga0065712_10013478 | Ga0065712_100134783 | 108 |
| 62 | 3300005290 | Ga0065712_10179192 | Ga0065712_101791922 | 108 |
| 63 | 3300005293 | Ga0065715_10407233 | Ga0065715_104072331 | 108 |
| 64 | 3300005295 | Ga0065707_10352364 | Ga0065707_103523641 | 108 |
| 65 | 3300005327 | Ga0070658_10000069 | Ga0070658_1000006956 | 108 |
| 66 | 3300005327 | Ga0070658_10166418 | Ga0070658_101664182 | 108 |
| 67 | 3300005327 | Ga0070658_10221837 | Ga0070658_102218373 | 108 |
| 68 | 3300005327 | Ga0070658_10234638 | Ga0070658_102346383 | 108 |
| 69 | 3300005327 | Ga0070658_10290223 | Ga0070658_102902233 | 108 |
| 70 | 3300005327 | Ga0070658_10424427 | Ga0070658_104244272 | 108 |
| 71 | 3300005327 | Ga0070658_10728643 | Ga0070658_107286432 | 108 |
| 72 | 3300005327 | Ga0070658_11217883 | Ga0070658_112178831 | 108 |
| 73 | 3300005327 | Ga0070658_11677479 | Ga0070658_116774791 | 108 |
| 74 | 3300005328 | Ga0070676_10015301 | Ga0070676_100153012 | 108 |
| 75 | 3300005328 | Ga0070676_11076490 | Ga0070676_110764901 | 108 |
| 76 | 3300005329 | Ga0070683_100047754 | Ga0070683_1000477544 | 108 |
| 77 | 3300005329 | Ga0070683_100341934 | Ga0070683_1003419342 | 108 |
| 78 | 3300005329 | Ga0070683_100609271 | Ga0070683_1006092713 | 108 |
| 79 | 3300005330 | Ga0070690_100634055 | Ga0070690_1006340552 | 108 |
| 80 | 3300005331 | Ga0070670_100015918 | Ga0070670_1000159183 | 108 |
| 81 | 3300005331 | Ga0070670_100016570 | Ga0070670_1000165704 | 108 |
| 82 | 3300005331 | Ga0070670_100488402 | Ga0070670_1004884022 | 108 |
| 83 | 3300005334 | Ga0068869_100140331 | Ga0068869_1001403313 | 108 |
| 84 | 3300005334 | Ga0068869_100357028 | Ga0068869_1003570283 | 108 |
| 85 | 3300005335 | Ga0070666_10026579 | Ga0070666_100265792 | 108 |
| 86 | 3300005336 | Ga0070680_100002384 | Ga0070680_1000023848 | 108 |
| 87 | 3300005336 | Ga0070680_100019054 | Ga0070680_1000190545 | 108 |
| 88 | 3300005336 | Ga0070680_100598402 | Ga0070680_1005984022 | 108 |
| 89 | 3300005337 | Ga0070682_100308216 | Ga0070682_1003082162 | 108 |
| 90 | 3300005339 | Ga0070660_100046805 | Ga0070660_1000468053 | 108 |
| 91 | 3300005339 | Ga0070660_100175713 | Ga0070660_1001757131 | 108 |
| 92 | 3300005339 | Ga0070660_100933821 | Ga0070660_1009338212 | 108 |
| 93 | 3300005339 | Ga0070660_101009889 | Ga0070660_1010098892 | 108 |
| 94 | 3300005343 | Ga0070687_101213750 | Ga0070687_1012137501 | 108 |
| 95 | 3300005347 | Ga0070668_100629920 | Ga0070668_1006299201 | 108 |
| 96 | 3300005353 | Ga0070669_100028238 | Ga0070669_1000282383 | 108 |
| 97 | 3300005354 | Ga0070675_100907591 | Ga0070675_1009075911 | 108 |
| 98 | 3300005364 | Ga0070673_100103439 | Ga0070673_1001034391 | 108 |
| 99 | 3300005366 | Ga0070659_100002120 | Ga0070659_1000021206 | 108 |
| 100 | 3300005366 | Ga0070659_100009288 | Ga0070659_1000092887 | 108 |
| 101 | 3300005366 | Ga0070659_100435418 | Ga0070659_1004354182 | 108 |
| 102 | 3300005366 | Ga0070659_100807152 | Ga0070659_1008071522 | 108 |
| 103 | 3300005366 | Ga0070659_100997780 | Ga0070659_1009977802 | 108 |
| 104 | 3300005367 | Ga0070667_100585357 | Ga0070667_1005853572 | 108 |
| 105 | 3300005367 | Ga0070667_100834907 | Ga0070667_1008349072 | 108 |
| 106 | 3300005435 | Ga0070714_101534491 | Ga0070714_1015344912 | 108 |
| 107 | 3300005438 | Ga0070701_10086499 | Ga0070701_100864992 | 108 |
| 108 | 3300005441 | Ga0070700_100933211 | Ga0070700_1009332112 | 108 |
| 109 | 3300005455 | Ga0070663_100000935 | Ga0070663_10000093512 | 108 |
| 110 | 3300005455 | Ga0070663_100013113 | Ga0070663_1000131133 | 108 |
| 111 | 3300005455 | Ga0070663_101341462 | Ga0070663_1013414621 | 108 |
| 112 | 3300005456 | Ga0070678_100033628 | Ga0070678_1000336282 | 108 |
| 113 | 3300005456 | Ga0070678_100179802 | Ga0070678_1001798021 | 108 |
| 114 | 3300005456 | Ga0070678_100214102 | Ga0070678_1002141023 | 108 |
| 115 | 3300005456 | Ga0070678_100462079 | Ga0070678_1004620791 | 108 |
| 116 | 3300005457 | Ga0070662_100000186 | Ga0070662_10000018612 | 108 |
| 117 | 3300005458 | Ga0070681_10001937 | Ga0070681_1000193713 | 108 |
| 118 | 3300005458 | Ga0070681_10011702 | Ga0070681_100117023 | 108 |
| 119 | 3300005459 | Ga0068867_100944440 | Ga0068867_1009444401 | 108 |
| 120 | 3300005459 | Ga0068867_101136926 | Ga0068867_1011369262 | 108 |
| 121 | 3300005459 | Ga0068867_102382930 | Ga0068867_1023829301 | 108 |
| 122 | 3300005466 | Ga0070685_10013893 | Ga0070685_100138932 | 108 |
| 123 | 3300005466 | Ga0070685_11514227 | Ga0070685_115142272 | 108 |
| 124 | 3300005471 | Ga0070698_100004536 | Ga0070698_10000453611 | 108 |
| 125 | 3300005471 | Ga0070698_100025684 | Ga0070698_1000256846 | 108 |
| 126 | 3300005471 | Ga0070698_100047082 | Ga0070698_1000470825 | 108 |
| 127 | 3300005518 | Ga0070699_100544006 | Ga0070699_1005440062 | 108 |
| 128 | 3300005530 | Ga0070679_100022402 | Ga0070679_1000224023 | 108 |
| 129 | 3300005530 | Ga0070679_100045254 | Ga0070679_1000452543 | 108 |
| 130 | 3300005530 | Ga0070679_101368628 | Ga0070679_1013686281 | 108 |
| 131 | 3300005530 | Ga0070679_101440123 | Ga0070679_1014401231 | 108 |
| 132 | 3300005535 | Ga0070684_100073584 | Ga0070684_1000735844 | 108 |
| 133 | 3300005535 | Ga0070684_100151743 | Ga0070684_1001517432 | 108 |
| 134 | 3300005539 | Ga0068853_100010772 | Ga0068853_1000107722 | 108 |
| 135 | 3300005539 | Ga0068853_100031056 | Ga0068853_1000310561 | 108 |
| 136 | 3300005539 | Ga0068853_100222314 | Ga0068853_1002223142 | 108 |
| 137 | 3300005539 | Ga0068853_100266251 | Ga0068853_1002662512 | 108 |
| 138 | 3300005539 | Ga0068853_100505967 | Ga0068853_1005059673 | 108 |
| 139 | 3300005543 | Ga0070672_100208879 | Ga0070672_1002088792 | 108 |
| 140 | 3300005544 | Ga0070686_100398870 | Ga0070686_1003988701 | 108 |
| 141 | 3300005547 | Ga0070693_100800679 | Ga0070693_1008006791 | 108 |
| 142 | 3300005548 | Ga0070665_100000017 | Ga0070665_10000001731 | 108 |
| 143 | 3300005549 | Ga0070704_100128810 | Ga0070704_1001288103 | 108 |
| 144 | 3300005563 | Ga0068855_100000097 | Ga0068855_10000009799 | 108 |
| 145 | 3300005563 | Ga0068855_100002978 | Ga0068855_10000297814 | 108 |
| 146 | 3300005563 | Ga0068855_100004102 | Ga0068855_10000410215 | 108 |
| 147 | 3300005563 | Ga0068855_100004838 | Ga0068855_1000048383 | 108 |
| 148 | 3300005563 | Ga0068855_100010260 | Ga0068855_1000102605 | 108 |
| 149 | 3300005563 | Ga0068855_100069864 | Ga0068855_1000698643 | 108 |
| 150 | 3300005563 | Ga0068855_100142968 | Ga0068855_1001429683 | 108 |
| 151 | 3300005563 | Ga0068855_100205601 | Ga0068855_1002056012 | 108 |
| 152 | 3300005563 | Ga0068855_100395865 | Ga0068855_1003958653 | 108 |
| 153 | 3300005563 | Ga0068855_100565927 | Ga0068855_1005659273 | 108 |
| 154 | 3300005563 | Ga0068855_100584284 | Ga0068855_1005842842 | 108 |
| 155 | 3300005563 | Ga0068855_102044129 | Ga0068855_1020441291 | 108 |
| 156 | 3300005577 | Ga0068857_100018843 | Ga0068857_1000188433 | 108 |
| 157 | 3300005577 | Ga0068857_100074969 | Ga0068857_1000749692 | 108 |
| 158 | 3300005577 | Ga0068857_101277532 | Ga0068857_1012775321 | 108 |
| 159 | 3300005578 | Ga0068854_100089124 | Ga0068854_1000891243 | 108 |
| 160 | 3300005578 | Ga0068854_100584884 | Ga0068854_1005848843 | 108 |
| 161 | 3300005578 | Ga0068854_101467473 | Ga0068854_1014674732 | 108 |
| 162 | 3300005614 | Ga0068856_100002033 | Ga0068856_1000020337 | 108 |
| 163 | 3300005614 | Ga0068856_100031710 | Ga0068856_1000317104 | 108 |
| 164 | 3300005614 | Ga0068856_100034453 | Ga0068856_1000344532 | 108 |
| 165 | 3300005614 | Ga0068856_100175072 | Ga0068856_1001750722 | 108 |
| 166 | 3300005614 | Ga0068856_100235576 | Ga0068856_1002355762 | 108 |
| 167 | 3300005614 | Ga0068856_100690324 | Ga0068856_1006903242 | 108 |
| 168 | 3300005614 | Ga0068856_100847530 | Ga0068856_1008475301 | 108 |
| 169 | 3300005616 | Ga0068852_100004339 | Ga0068852_1000043397 | 108 |
| 170 | 3300005616 | Ga0068852_100139242 | Ga0068852_1001392423 | 108 |
| 171 | 3300005616 | Ga0068852_100292007 | Ga0068852_1002920073 | 108 |
| 172 | 3300005616 | Ga0068852_100406560 | Ga0068852_1004065602 | 108 |
| 173 | 3300005616 | Ga0068852_100527505 | Ga0068852_1005275053 | 108 |
| 174 | 3300005617 | Ga0068859_100575015 | Ga0068859_1005750153 | 108 |
| 175 | 3300005617 | Ga0068859_100926697 | Ga0068859_1009266972 | 108 |
| 176 | 3300005618 | Ga0068864_100275801 | Ga0068864_1002758012 | 108 |
| 177 | 3300005718 | Ga0068866_10172933 | Ga0068866_101729332 | 108 |
| 178 | 3300005719 | Ga0068861_100641982 | Ga0068861_1006419822 | 108 |
| 179 | 3300005834 | Ga0068851_10100792 | Ga0068851_101007922 | 108 |
| 180 | 3300005840 | Ga0068870_10008407 | Ga0068870_100084072 | 108 |
| 181 | 3300005840 | Ga0068870_10053771 | Ga0068870_100537712 | 108 |
| 182 | 3300005841 | Ga0068863_100006021 | Ga0068863_1000060218 | 108 |
| 183 | 3300005841 | Ga0068863_101518848 | Ga0068863_1015188482 | 108 |
| 184 | 3300005841 | Ga0068863_102358584 | Ga0068863_1023585841 | 108 |
| 185 | 3300005842 | Ga0068858_100088087 | Ga0068858_1000880871 | 108 |
| 186 | 3300005843 | Ga0068860_100203625 | Ga0068860_1002036252 | 108 |
| 187 | 3300005843 | Ga0068860_101052101 | Ga0068860_1010521012 | 108 |
| 188 | 3300005843 | Ga0068860_101521787 | Ga0068860_1015217871 | 108 |
| 189 | 3300005844 | Ga0068862_101486114 | Ga0068862_1014861142 | 108 |
| 190 | 3300006051 | Ga0075364_10900231 | Ga0075364_109002311 | 108 |
| 191 | 3300006195 | Ga0075366_10000677 | Ga0075366_100006778 | 108 |
| 192 | 3300006195 | Ga0075366_10000881 | Ga0075366_1000088112 | 108 |
| 193 | 3300006195 | Ga0075366_10282480 | Ga0075366_102824802 | 108 |
| 194 | 3300006195 | Ga0075366_10529193 | Ga0075366_105291932 | 108 |
| 195 | 3300006195 | Ga0075366_10728705 | Ga0075366_107287051 | 108 |
| 196 | 3300006237 | Ga0097621_100000721 | Ga0097621_1000007212 | 108 |
| 197 | 3300006237 | Ga0097621_100135308 | Ga0097621_1001353082 | 108 |
| 198 | 3300006237 | Ga0097621_102421369 | Ga0097621_1024213691 | 108 |
| 199 | 3300006358 | Ga0068871_100000286 | Ga0068871_10000028610 | 108 |
| 200 | 3300006358 | Ga0068871_100045860 | Ga0068871_1000458603 | 108 |
| 201 | 3300006358 | Ga0068871_100639105 | Ga0068871_1006391052 | 108 |
| 202 | 3300006358 | Ga0068871_100779492 | Ga0068871_1007794922 | 108 |
| 203 | 3300006844 | Ga0075428_100027330 | Ga0075428_1000273307 | 108 |
| 204 | 3300006846 | Ga0075430_100072163 | Ga0075430_1000721634 | 108 |
| 205 | 3300006847 | Ga0075431_100212027 | Ga0075431_1002120273 | 108 |
| 206 | 3300006880 | Ga0075429_100000533 | Ga0075429_10000053313 | 108 |
| 207 | 3300006881 | Ga0068865_100001165 | Ga0068865_1000011659 | 108 |
| 208 | 3300006881 | Ga0068865_101162804 | Ga0068865_1011628042 | 108 |
| 209 | 3300006931 | Ga0097620_100575011 | Ga0097620_1005750113 | 108 |
| 210 | 3300006931 | Ga0097620_100926802 | Ga0097620_1009268022 | 108 |
| 211 | 3300009036 | Ga0105244_10007635 | Ga0105244_100076355 | 108 |
| 212 | 3300009093 | Ga0105240_10000321 | Ga0105240_1000032179 | 108 |
| 213 | 3300009093 | Ga0105240_10009251 | Ga0105240_100092512 | 108 |
| 214 | 3300009093 | Ga0105240_10028247 | Ga0105240_100282474 | 108 |
| 215 | 3300009093 | Ga0105240_10041945 | Ga0105240_100419452 | 108 |
| 216 | 3300009093 | Ga0105240_10062828 | Ga0105240_100628285 | 108 |
| 217 | 3300009093 | Ga0105240_10094107 | Ga0105240_100941072 | 108 |
| 218 | 3300009093 | Ga0105240_10401169 | Ga0105240_104011692 | 108 |
| 219 | 3300009093 | Ga0105240_10469361 | Ga0105240_104693612 | 108 |
| 220 | 3300009093 | Ga0105240_10474945 | Ga0105240_104749452 | 108 |
| 221 | 3300009093 | Ga0105240_10560177 | Ga0105240_105601772 | 108 |
| 222 | 3300009093 | Ga0105240_10657839 | Ga0105240_106578393 | 108 |
| 223 | 3300009093 | Ga0105240_10833796 | Ga0105240_108337962 | 108 |
| 224 | 3300009093 | Ga0105240_10860639 | Ga0105240_108606392 | 108 |
| 225 | 3300009093 | Ga0105240_10904277 | Ga0105240_109042772 | 108 |
| 226 | 3300009093 | Ga0105240_11168744 | Ga0105240_111687442 | 108 |
| 227 | 3300009094 | Ga0111539_10156186 | Ga0111539_101561863 | 108 |
| 228 | 3300009094 | Ga0111539_10410593 | Ga0111539_104105932 | 108 |
| 229 | 3300009094 | Ga0111539_10578160 | Ga0111539_105781601 | 108 |
| 230 | 3300009101 | Ga0105247_10546750 | Ga0105247_105467502 | 108 |
| 231 | 3300009148 | Ga0105243_10000009 | Ga0105243_10000009122 | 108 |
| 232 | 3300009148 | Ga0105243_10078741 | Ga0105243_100787413 | 108 |
| 233 | 3300009148 | Ga0105243_10904777 | Ga0105243_109047772 | 108 |
| 234 | 3300009174 | Ga0105241_10001000 | Ga0105241_100010008 | 108 |
| 235 | 3300009174 | Ga0105241_10019786 | Ga0105241_100197863 | 108 |
| 236 | 3300009174 | Ga0105241_10065816 | Ga0105241_100658162 | 108 |
| 237 | 3300009174 | Ga0105241_10069375 | Ga0105241_100693753 | 108 |
| 238 | 3300009174 | Ga0105241_10103649 | Ga0105241_101036492 | 108 |
| 239 | 3300009174 | Ga0105241_10143974 | Ga0105241_101439743 | 108 |
| 240 | 3300009174 | Ga0105241_10412157 | Ga0105241_104121571 | 108 |
| 241 | 3300009174 | Ga0105241_10932225 | Ga0105241_109322252 | 108 |
| 242 | 3300009174 | Ga0105241_11255738 | Ga0105241_112557382 | 108 |
| 243 | 3300009174 | Ga0105241_12219969 | Ga0105241_122199691 | 108 |
| 244 | 3300009176 | Ga0105242_10015750 | Ga0105242_100157505 | 108 |
| 245 | 3300009176 | Ga0105242_10053939 | Ga0105242_100539395 | 108 |
| 246 | 3300009176 | Ga0105242_10105159 | Ga0105242_101051595 | 108 |
| 247 | 3300009176 | Ga0105242_10213428 | Ga0105242_102134283 | 108 |
| 248 | 3300009177 | Ga0105248_10607974 | Ga0105248_106079743 | 108 |
| 249 | 3300009545 | Ga0105237_10000273 | Ga0105237_1000027313 | 108 |
| 250 | 3300009545 | Ga0105237_10002591 | Ga0105237_1000259115 | 108 |
| 251 | 3300009545 | Ga0105237_10003787 | Ga0105237_100037871 | 108 |
| 252 | 3300009545 | Ga0105237_10004463 | Ga0105237_1000446312 | 108 |
| 253 | 3300009545 | Ga0105237_10012487 | Ga0105237_1001248712 | 108 |
| 254 | 3300009545 | Ga0105237_10032439 | Ga0105237_100324393 | 108 |
| 255 | 3300009545 | Ga0105237_10073968 | Ga0105237_100739683 | 108 |
| 256 | 3300009545 | Ga0105237_10099788 | Ga0105237_100997883 | 108 |
| 257 | 3300009545 | Ga0105237_10206971 | Ga0105237_102069712 | 108 |
| 258 | 3300009545 | Ga0105237_10282829 | Ga0105237_102828292 | 108 |
| 259 | 3300009545 | Ga0105237_10389243 | Ga0105237_103892431 | 108 |
| 260 | 3300009545 | Ga0105237_10467363 | Ga0105237_104673633 | 108 |
| 261 | 3300009545 | Ga0105237_10468588 | Ga0105237_104685882 | 108 |
| 262 | 3300009545 | Ga0105237_11124254 | Ga0105237_111242542 | 108 |
| 263 | 3300009545 | Ga0105237_12437185 | Ga0105237_124371851 | 108 |
| 264 | 3300009551 | Ga0105238_10038734 | Ga0105238_100387345 | 108 |
| 265 | 3300009551 | Ga0105238_10039673 | Ga0105238_100396732 | 108 |
| 266 | 3300009551 | Ga0105238_10183376 | Ga0105238_101833763 | 108 |
| 267 | 3300009553 | Ga0105249_10001688 | Ga0105249_100016889 | 108 |
| 268 | 3300009553 | Ga0105249_10036731 | Ga0105249_100367311 | 108 |
| 269 | 3300010375 | Ga0105239_10000014 | Ga0105239_10000014127 | 108 |
| 270 | 3300010375 | Ga0105239_10000017 | Ga0105239_10000017157 | 108 |
| 271 | 3300010375 | Ga0105239_10000821 | Ga0105239_1000082141 | 108 |
| 272 | 3300010375 | Ga0105239_10004179 | Ga0105239_1000417913 | 108 |
| 273 | 3300010375 | Ga0105239_10048085 | Ga0105239_100480855 | 108 |
| 274 | 3300010375 | Ga0105239_10057768 | Ga0105239_100577682 | 108 |
| 275 | 3300010375 | Ga0105239_10103179 | Ga0105239_101031794 | 108 |
| 276 | 3300010375 | Ga0105239_10149651 | Ga0105239_101496513 | 108 |
| 277 | 3300010375 | Ga0105239_10154879 | Ga0105239_101548791 | 108 |
| 278 | 3300010375 | Ga0105239_10161839 | Ga0105239_101618393 | 108 |
| 279 | 3300010375 | Ga0105239_10211873 | Ga0105239_102118732 | 108 |
| 280 | 3300013100 | Ga0157373_10001836 | Ga0157373_1000183613 | 108 |
| 281 | 3300013100 | Ga0157373_10001854 | Ga0157373_100018549 | 108 |
| 282 | 3300013100 | Ga0157373_10003628 | Ga0157373_100036283 | 108 |
| 283 | 3300013100 | Ga0157373_10021879 | Ga0157373_100218792 | 108 |
| 284 | 3300013100 | Ga0157373_10034944 | Ga0157373_100349442 | 108 |
| 285 | 3300013100 | Ga0157373_10222196 | Ga0157373_102221962 | 108 |
| 286 | 3300013100 | Ga0157373_10235937 | Ga0157373_102359372 | 108 |
| 287 | 3300013100 | Ga0157373_10787083 | Ga0157373_107870832 | 108 |
| 288 | 3300013102 | Ga0157371_10000046 | Ga0157371_1000004635 | 108 |
| 289 | 3300013102 | Ga0157371_10000297 | Ga0157371_1000029755 | 108 |
| 290 | 3300013102 | Ga0157371_10001025 | Ga0157371_1000102529 | 108 |
| 291 | 3300013102 | Ga0157371_10003077 | Ga0157371_1000307714 | 108 |
| 292 | 3300013102 | Ga0157371_10003113 | Ga0157371_100031134 | 108 |
| 293 | 3300013102 | Ga0157371_10005385 | Ga0157371_1000538510 | 108 |
| 294 | 3300013102 | Ga0157371_10010708 | Ga0157371_100107087 | 108 |
| 295 | 3300013102 | Ga0157371_10037682 | Ga0157371_100376823 | 108 |
| 296 | 3300013102 | Ga0157371_10061686 | Ga0157371_100616862 | 108 |
| 297 | 3300013102 | Ga0157371_10111119 | Ga0157371_101111192 | 108 |
| 298 | 3300013102 | Ga0157371_10142347 | Ga0157371_101423471 | 108 |
| 299 | 3300013104 | Ga0157370_10000083 | Ga0157370_1000008347 | 108 |
| 300 | 3300013104 | Ga0157370_10018511 | Ga0157370_100185118 | 108 |
| 301 | 3300013104 | Ga0157370_10047250 | Ga0157370_100472504 | 108 |
| 302 | 3300013104 | Ga0157370_10047550 | Ga0157370_100475503 | 108 |
| 303 | 3300013104 | Ga0157370_10053400 | Ga0157370_100534002 | 108 |
| 304 | 3300013104 | Ga0157370_10105045 | Ga0157370_101050453 | 108 |
| 305 | 3300013104 | Ga0157370_10114672 | Ga0157370_101146722 | 108 |
| 306 | 3300013104 | Ga0157370_10126475 | Ga0157370_101264753 | 108 |
| 307 | 3300013104 | Ga0157370_10252277 | Ga0157370_102522772 | 108 |
| 308 | 3300013104 | Ga0157370_10256429 | Ga0157370_102564292 | 108 |
| 309 | 3300013104 | Ga0157370_10294623 | Ga0157370_102946233 | 108 |
| 310 | 3300013104 | Ga0157370_10348251 | Ga0157370_103482512 | 108 |
| 311 | 3300013104 | Ga0157370_10556806 | Ga0157370_105568062 | 108 |
| 312 | 3300013104 | Ga0157370_10584156 | Ga0157370_105841562 | 108 |
| 313 | 3300013104 | Ga0157370_10745478 | Ga0157370_107454782 | 108 |
| 314 | 3300013104 | Ga0157370_11025745 | Ga0157370_110257451 | 108 |
| 315 | 3300013104 | Ga0157370_11089540 | Ga0157370_110895402 | 108 |
| 316 | 3300013105 | Ga0157369_10000046 | Ga0157369_1000004640 | 108 |
| 317 | 3300013105 | Ga0157369_10002452 | Ga0157369_1000245210 | 108 |
| 318 | 3300013105 | Ga0157369_10019838 | Ga0157369_100198383 | 108 |
| 319 | 3300013105 | Ga0157369_10055076 | Ga0157369_100550763 | 108 |
| 320 | 3300013105 | Ga0157369_10074716 | Ga0157369_100747162 | 108 |
| 321 | 3300013105 | Ga0157369_10088988 | Ga0157369_100889883 | 108 |
| 322 | 3300013105 | Ga0157369_10169448 | Ga0157369_101694483 | 108 |
| 323 | 3300013105 | Ga0157369_12641819 | Ga0157369_126418191 | 108 |
| 324 | 3300013296 | Ga0157374_10000825 | Ga0157374_100008257 | 108 |
| 325 | 3300013296 | Ga0157374_10037163 | Ga0157374_100371632 | 108 |
| 326 | 3300013296 | Ga0157374_10127344 | Ga0157374_101273443 | 108 |
| 327 | 3300013296 | Ga0157374_10160886 | Ga0157374_101608864 | 108 |
| 328 | 3300013296 | Ga0157374_10164065 | Ga0157374_101640653 | 108 |
| 329 | 3300013296 | Ga0157374_10378086 | Ga0157374_103780862 | 108 |
| 330 | 3300013296 | Ga0157374_10723705 | Ga0157374_107237052 | 108 |
| 331 | 3300013296 | Ga0157374_12291511 | Ga0157374_122915111 | 108 |
| 332 | 3300013296 | Ga0157374_12494883 | Ga0157374_124948832 | 108 |
| 333 | 3300013297 | Ga0157378_10034988 | Ga0157378_100349883 | 108 |
| 334 | 3300013297 | Ga0157378_10246623 | Ga0157378_102466233 | 108 |
| 335 | 3300013297 | Ga0157378_10409295 | Ga0157378_104092952 | 108 |
| 336 | 3300013297 | Ga0157378_10644044 | Ga0157378_106440443 | 108 |
| 337 | 3300013297 | Ga0157378_11023477 | Ga0157378_110234771 | 108 |
| 338 | 3300013306 | Ga0163162_10000026 | Ga0163162_10000026128 | 108 |
| 339 | 3300013306 | Ga0163162_10000037 | Ga0163162_1000003769 | 108 |
| 340 | 3300013306 | Ga0163162_10072237 | Ga0163162_100722374 | 108 |
| 341 | 3300013306 | Ga0163162_10081280 | Ga0163162_100812803 | 108 |
| 342 | 3300013306 | Ga0163162_10191782 | Ga0163162_101917822 | 108 |
| 343 | 3300013306 | Ga0163162_10470592 | Ga0163162_104705922 | 108 |
| 344 | 3300013306 | Ga0163162_10608139 | Ga0163162_106081391 | 108 |
| 345 | 3300013306 | Ga0163162_10801839 | Ga0163162_108018392 | 108 |
| 346 | 3300013306 | Ga0163162_10803863 | Ga0163162_108038631 | 108 |
| 347 | 3300013307 | Ga0157372_10000077 | Ga0157372_1000007782 | 108 |
| 348 | 3300013307 | Ga0157372_10001279 | Ga0157372_1000127924 | 108 |
| 349 | 3300013307 | Ga0157372_10002383 | Ga0157372_100023833 | 108 |
| 350 | 3300013307 | Ga0157372_10002480 | Ga0157372_100024806 | 108 |
| 351 | 3300013307 | Ga0157372_10004815 | Ga0157372_1000481514 | 108 |
| 352 | 3300013307 | Ga0157372_10084375 | Ga0157372_100843754 | 108 |
| 353 | 3300013307 | Ga0157372_10126973 | Ga0157372_101269733 | 108 |
| 354 | 3300013307 | Ga0157372_10326511 | Ga0157372_103265112 | 108 |
| 355 | 3300013307 | Ga0157372_12191984 | Ga0157372_121919842 | 108 |
| 356 | 3300013307 | Ga0157372_12408021 | Ga0157372_124080212 | 108 |
| 357 | 3300013308 | Ga0157375_10001605 | Ga0157375_100016059 | 108 |
| 358 | 3300013308 | Ga0157375_10172436 | Ga0157375_101724363 | 108 |
| 359 | 3300013308 | Ga0157375_10194609 | Ga0157375_101946093 | 108 |
| 360 | 3300013308 | Ga0157375_10240533 | Ga0157375_102405333 | 108 |
| 361 | 3300013308 | Ga0157375_10403132 | Ga0157375_104031322 | 108 |
| 362 | 3300013308 | Ga0157375_11323998 | Ga0157375_113239982 | 108 |
| 363 | 3300013308 | Ga0157375_12077672 | Ga0157375_120776722 | 108 |
| 364 | 3300014325 | Ga0163163_10000202 | Ga0163163_1000020242 | 108 |
| 365 | 3300014325 | Ga0163163_10018012 | Ga0163163_100180124 | 108 |
| 366 | 3300014325 | Ga0163163_10224910 | Ga0163163_102249103 | 108 |
| 367 | 3300014325 | Ga0163163_10948654 | Ga0163163_109486542 | 108 |
| 368 | 3300014326 | Ga0157380_10127483 | Ga0157380_101274835 | 108 |
| 369 | 3300014326 | Ga0157380_10558522 | Ga0157380_105585222 | 108 |
| 370 | 3300014326 | Ga0157380_12610189 | Ga0157380_126101891 | 108 |
| 371 | 3300014497 | Ga0182008_10000022 | Ga0182008_1000002217 | 108 |
| 372 | 3300014497 | Ga0182008_10000104 | Ga0182008_1000010450 | 108 |
| 373 | 3300014497 | Ga0182008_10000380 | Ga0182008_100003802 | 108 |
| 374 | 3300014497 | Ga0182008_10144077 | Ga0182008_101440772 | 108 |
| 375 | 3300014497 | Ga0182008_10648593 | Ga0182008_106485931 | 108 |
| 376 | 3300014745 | Ga0157377_10035480 | Ga0157377_100354802 | 108 |
| 377 | 3300014745 | Ga0157377_10882636 | Ga0157377_108826362 | 108 |
| 378 | 3300014968 | Ga0157379_10662826 | Ga0157379_106628262 | 108 |
| 379 | 3300014968 | Ga0157379_11882846 | Ga0157379_118828461 | 108 |
| 380 | 3300014969 | Ga0157376_10030698 | Ga0157376_100306982 | 108 |
| 381 | 3300014969 | Ga0157376_11163166 | Ga0157376_111631662 | 108 |
| 382 | 3300014969 | Ga0157376_12307526 | Ga0157376_123075262 | 108 |
| 383 | 3300014969 | Ga0157376_12744268 | Ga0157376_127442681 | 108 |
| 384 | 3300015261 | Ga0182006_1000132 | Ga0182006_100013229 | 108 |
| 385 | 3300015261 | Ga0182006_1000229 | Ga0182006_100022935 | 108 |
| 386 | 3300015261 | Ga0182006_1002331 | Ga0182006_10023315 | 108 |
| 387 | 3300015261 | Ga0182006_1003205 | Ga0182006_10032055 | 108 |
| 388 | 3300015261 | Ga0182006_1029102 | Ga0182006_10291022 | 108 |
| 389 | 3300015262 | Ga0182007_10000009 | Ga0182007_10000009170 | 108 |
| 390 | 3300015262 | Ga0182007_10002891 | Ga0182007_100028913 | 108 |
| 391 | 3300015262 | Ga0182007_10032142 | Ga0182007_100321421 | 108 |
| 392 | 3300015262 | Ga0182007_10124433 | Ga0182007_101244331 | 108 |
| 393 | 3300015682 | Ga0183373_1008 | Ga0183373_1008206 | 108 |
| 394 | 3300017792 | Ga0163161_10000537 | Ga0163161_1000053714 | 108 |
| 395 | 3300017792 | Ga0163161_10000787 | Ga0163161_100007878 | 108 |
| 396 | 3300017792 | Ga0163161_10000828 | Ga0163161_100008286 | 108 |
| 397 | 3300017792 | Ga0163161_10000991 | Ga0163161_1000099113 | 108 |
| 398 | 3300017792 | Ga0163161_10002797 | Ga0163161_100027975 | 108 |
| 399 | 3300017792 | Ga0163161_10087213 | Ga0163161_100872133 | 108 |
| 400 | 3300017792 | Ga0163161_10118989 | Ga0163161_101189894 | 108 |
| 401 | 3300017792 | Ga0163161_10212443 | Ga0163161_102124432 | 108 |
| 402 | 3300017792 | Ga0163161_10246083 | Ga0163161_102460831 | 108 |
| 403 | 3300017792 | Ga0163161_10507942 | Ga0163161_105079422 | 108 |
| 404 | 3300017792 | Ga0163161_11944884 | Ga0163161_119448842 | 108 |
| 405 | 3300021361 | Ga0213872_10163370 | Ga0213872_101633701 | 108 |
| 406 | 3300025230 | Ga0209563_120252 | Ga0209563_1202522 | 108 |
| 407 | 3300025231 | Ga0207427_100066 | Ga0207427_10006692 | 108 |
| 408 | 3300025233 | Ga0209437_100010 | Ga0209437_100010207 | 108 |
| 409 | 3300025233 | Ga0209437_100030 | Ga0209437_10003032 | 108 |
| 410 | 3300025245 | Ga0207425_1000008 | Ga0207425_1000008366 | 108 |
| 411 | 3300025250 | Ga0209026_1000246 | Ga0209026_100024623 | 108 |
| 412 | 3300025250 | Ga0209026_1003283 | Ga0209026_10032834 | 108 |
| 413 | 3300025250 | Ga0209026_1009476 | Ga0209026_10094763 | 108 |
| 414 | 3300025258 | Ga0209129_1000042 | Ga0209129_1000042101 | 108 |
| 415 | 3300025258 | Ga0209129_1012392 | Ga0209129_10123923 | 108 |
| 416 | 3300025261 | Ga0209233_1000017 | Ga0209233_1000017220 | 108 |
| 417 | 3300025272 | Ga0209455_1004736 | Ga0209455_10047361 | 108 |
| 418 | 3300025292 | Ga0209676_1000009 | Ga0209676_1000009700 | 108 |
| 419 | 3300025292 | Ga0209676_1000455 | Ga0209676_100045535 | 108 |
| 420 | 3300025294 | Ga0209025_1000020 | Ga0209025_1000020366 | 108 |
| 421 | 3300025297 | Ga0209758_1000022 | Ga0209758_1000022366 | 108 |
| 422 | 3300025298 | Ga0209050_1000103 | Ga0209050_1000103172 | 108 |
| 423 | 3300025298 | Ga0209050_1015302 | Ga0209050_10153024 | 108 |
| 424 | 3300025315 | Ga0207697_10078142 | Ga0207697_100781421 | 108 |
| 425 | 3300025321 | Ga0207656_10100263 | Ga0207656_101002632 | 108 |
| 426 | 3300025893 | Ga0207682_10054492 | Ga0207682_100544923 | 108 |
| 427 | 3300025903 | Ga0207680_10054144 | Ga0207680_100541442 | 108 |
| 428 | 3300025904 | Ga0207647_10000036 | Ga0207647_1000003665 | 108 |
| 429 | 3300025904 | Ga0207647_10003216 | Ga0207647_100032169 | 108 |
| 430 | 3300025904 | Ga0207647_10103722 | Ga0207647_101037223 | 108 |
| 431 | 3300025904 | Ga0207647_10136292 | Ga0207647_101362921 | 108 |
| 432 | 3300025907 | Ga0207645_10000767 | Ga0207645_100007672 | 108 |
| 433 | 3300025907 | Ga0207645_10003332 | Ga0207645_100033322 | 108 |
| 434 | 3300025907 | Ga0207645_10572707 | Ga0207645_105727072 | 108 |
| 435 | 3300025908 | Ga0207643_10026043 | Ga0207643_100260434 | 108 |
| 436 | 3300025909 | Ga0207705_10000032 | Ga0207705_1000003236 | 108 |
| 437 | 3300025909 | Ga0207705_10001474 | Ga0207705_100014744 | 108 |
| 438 | 3300025909 | Ga0207705_10188698 | Ga0207705_101886983 | 108 |
| 439 | 3300025909 | Ga0207705_10225853 | Ga0207705_102258531 | 108 |
| 440 | 3300025909 | Ga0207705_10267623 | Ga0207705_102676232 | 108 |
| 441 | 3300025909 | Ga0207705_10505920 | Ga0207705_105059203 | 108 |
| 442 | 3300025909 | Ga0207705_10708500 | Ga0207705_107085002 | 108 |
| 443 | 3300025909 | Ga0207705_10956507 | Ga0207705_109565072 | 108 |
| 444 | 3300025911 | Ga0207654_10001015 | Ga0207654_100010151 | 108 |
| 445 | 3300025911 | Ga0207654_10002954 | Ga0207654_100029549 | 108 |
| 446 | 3300025911 | Ga0207654_10034380 | Ga0207654_100343802 | 108 |
| 447 | 3300025911 | Ga0207654_10060455 | Ga0207654_100604551 | 108 |
| 448 | 3300025911 | Ga0207654_10062111 | Ga0207654_100621112 | 108 |
| 449 | 3300025911 | Ga0207654_10322657 | Ga0207654_103226572 | 108 |
| 450 | 3300025912 | Ga0207707_10008912 | Ga0207707_100089128 | 108 |
| 451 | 3300025912 | Ga0207707_10068540 | Ga0207707_100685403 | 108 |
| 452 | 3300025913 | Ga0207695_10000197 | Ga0207695_10000197147 | 108 |
| 453 | 3300025913 | Ga0207695_10002602 | Ga0207695_100026026 | 108 |
| 454 | 3300025913 | Ga0207695_10010598 | Ga0207695_100105989 | 108 |
| 455 | 3300025913 | Ga0207695_10030986 | Ga0207695_100309866 | 108 |
| 456 | 3300025913 | Ga0207695_10108796 | Ga0207695_101087962 | 108 |
| 457 | 3300025913 | Ga0207695_10170790 | Ga0207695_101707902 | 108 |
| 458 | 3300025913 | Ga0207695_10340202 | Ga0207695_103402022 | 108 |
| 459 | 3300025913 | Ga0207695_10408841 | Ga0207695_104088412 | 108 |
| 460 | 3300025913 | Ga0207695_11204636 | Ga0207695_112046362 | 108 |
| 461 | 3300025913 | Ga0207695_11225707 | Ga0207695_112257072 | 108 |
| 462 | 3300025914 | Ga0207671_10002335 | Ga0207671_1000233520 | 108 |
| 463 | 3300025914 | Ga0207671_10003413 | Ga0207671_1000341311 | 108 |
| 464 | 3300025914 | Ga0207671_10003709 | Ga0207671_100037097 | 108 |
| 465 | 3300025914 | Ga0207671_10004896 | Ga0207671_100048964 | 108 |
| 466 | 3300025914 | Ga0207671_10005952 | Ga0207671_100059528 | 108 |
| 467 | 3300025914 | Ga0207671_10008207 | Ga0207671_100082073 | 108 |
| 468 | 3300025914 | Ga0207671_10056958 | Ga0207671_100569583 | 108 |
| 469 | 3300025914 | Ga0207671_10084372 | Ga0207671_100843723 | 108 |
| 470 | 3300025914 | Ga0207671_10158702 | Ga0207671_101587022 | 108 |
| 471 | 3300025914 | Ga0207671_10173670 | Ga0207671_101736702 | 108 |
| 472 | 3300025914 | Ga0207671_10224633 | Ga0207671_102246333 | 108 |
| 473 | 3300025914 | Ga0207671_11360366 | Ga0207671_113603661 | 108 |
| 474 | 3300025914 | Ga0207671_11415044 | Ga0207671_114150441 | 108 |
| 475 | 3300025917 | Ga0207660_10014016 | Ga0207660_100140163 | 108 |
| 476 | 3300025917 | Ga0207660_10043586 | Ga0207660_100435861 | 108 |
| 477 | 3300025917 | Ga0207660_10533826 | Ga0207660_105338262 | 108 |
| 478 | 3300025919 | Ga0207657_10034473 | Ga0207657_100344732 | 108 |
| 479 | 3300025919 | Ga0207657_10053423 | Ga0207657_100534231 | 108 |
| 480 | 3300025919 | Ga0207657_10062996 | Ga0207657_100629962 | 108 |
| 481 | 3300025920 | Ga0207649_11254522 | Ga0207649_112545221 | 108 |
| 482 | 3300025921 | Ga0207652_10001233 | Ga0207652_100012337 | 108 |
| 483 | 3300025921 | Ga0207652_10015719 | Ga0207652_100157194 | 108 |
| 484 | 3300025921 | Ga0207652_11252657 | Ga0207652_112526572 | 108 |
| 485 | 3300025921 | Ga0207652_11265697 | Ga0207652_112656971 | 108 |
| 486 | 3300025923 | Ga0207681_10116112 | Ga0207681_101161123 | 108 |
| 487 | 3300025924 | Ga0207694_10016665 | Ga0207694_100166652 | 108 |
| 488 | 3300025924 | Ga0207694_10136571 | Ga0207694_101365712 | 108 |
| 489 | 3300025924 | Ga0207694_10330619 | Ga0207694_103306193 | 108 |
| 490 | 3300025925 | Ga0207650_10095911 | Ga0207650_100959113 | 108 |
| 491 | 3300025925 | Ga0207650_10098223 | Ga0207650_100982232 | 108 |
| 492 | 3300025925 | Ga0207650_10349327 | Ga0207650_103493272 | 108 |
| 493 | 3300025925 | Ga0207650_10420532 | Ga0207650_104205321 | 108 |
| 494 | 3300025926 | Ga0207659_10190700 | Ga0207659_101907002 | 108 |
| 495 | 3300025926 | Ga0207659_10321999 | Ga0207659_103219992 | 108 |
| 496 | 3300025926 | Ga0207659_10555139 | Ga0207659_105551392 | 108 |
| 497 | 3300025931 | Ga0207644_10040413 | Ga0207644_100404133 | 108 |
| 498 | 3300025931 | Ga0207644_11152371 | Ga0207644_111523712 | 108 |
| 499 | 3300025932 | Ga0207690_10001817 | Ga0207690_100018178 | 108 |
| 500 | 3300025932 | Ga0207690_10123456 | Ga0207690_101234563 | 108 |
| 501 | 3300025932 | Ga0207690_10173588 | Ga0207690_101735882 | 108 |
| 502 | 3300025932 | Ga0207690_10402879 | Ga0207690_104028792 | 108 |
| 503 | 3300025932 | Ga0207690_10766008 | Ga0207690_107660081 | 108 |
| 504 | 3300025933 | Ga0207706_10000125 | Ga0207706_1000012546 | 108 |
| 505 | 3300025933 | Ga0207706_10360774 | Ga0207706_103607741 | 108 |
| 506 | 3300025934 | Ga0207686_10000200 | Ga0207686_1000020022 | 108 |
| 507 | 3300025934 | Ga0207686_10149977 | Ga0207686_101499773 | 108 |
| 508 | 3300025934 | Ga0207686_10300646 | Ga0207686_103006462 | 108 |
| 509 | 3300025934 | Ga0207686_11406667 | Ga0207686_114066671 | 108 |
| 510 | 3300025934 | Ga0207686_11582637 | Ga0207686_115826371 | 108 |
| 511 | 3300025934 | Ga0207686_11647555 | Ga0207686_116475551 | 108 |
| 512 | 3300025935 | Ga0207709_10000026 | Ga0207709_10000026123 | 108 |
| 513 | 3300025935 | Ga0207709_10407892 | Ga0207709_104078922 | 108 |
| 514 | 3300025936 | Ga0207670_10485388 | Ga0207670_104853882 | 108 |
| 515 | 3300025937 | Ga0207669_10371145 | Ga0207669_103711452 | 108 |
| 516 | 3300025938 | Ga0207704_10000043 | Ga0207704_1000004352 | 108 |
| 517 | 3300025938 | Ga0207704_10115091 | Ga0207704_101150912 | 108 |
| 518 | 3300025939 | Ga0207665_11526006 | Ga0207665_115260061 | 108 |
| 519 | 3300025940 | Ga0207691_10013724 | Ga0207691_1001372410 | 108 |
| 520 | 3300025940 | Ga0207691_10072530 | Ga0207691_100725302 | 108 |
| 521 | 3300025940 | Ga0207691_10210766 | Ga0207691_102107662 | 108 |
| 522 | 3300025942 | Ga0207689_10035388 | Ga0207689_100353882 | 108 |
| 523 | 3300025942 | Ga0207689_10106695 | Ga0207689_101066953 | 108 |
| 524 | 3300025942 | Ga0207689_11751437 | Ga0207689_117514371 | 108 |
| 525 | 3300025944 | Ga0207661_10047813 | Ga0207661_100478134 | 108 |
| 526 | 3300025944 | Ga0207661_10060953 | Ga0207661_100609531 | 108 |
| 527 | 3300025949 | Ga0207667_10000630 | Ga0207667_1000063021 | 108 |
| 528 | 3300025949 | Ga0207667_10001087 | Ga0207667_1000108725 | 108 |
| 529 | 3300025949 | Ga0207667_10004753 | Ga0207667_1000475318 | 108 |
| 530 | 3300025949 | Ga0207667_10006745 | Ga0207667_100067455 | 108 |
| 531 | 3300025949 | Ga0207667_10020244 | Ga0207667_100202442 | 108 |
| 532 | 3300025949 | Ga0207667_10119173 | Ga0207667_101191733 | 108 |
| 533 | 3300025949 | Ga0207667_10131630 | Ga0207667_101316303 | 108 |
| 534 | 3300025949 | Ga0207667_10299638 | Ga0207667_102996382 | 108 |
| 535 | 3300025949 | Ga0207667_10442623 | Ga0207667_104426232 | 108 |
| 536 | 3300025949 | Ga0207667_10791521 | Ga0207667_107915211 | 108 |
| 537 | 3300025960 | Ga0207651_10455432 | Ga0207651_104554321 | 108 |
| 538 | 3300025960 | Ga0207651_11455789 | Ga0207651_114557891 | 108 |
| 539 | 3300025961 | Ga0207712_10000996 | Ga0207712_1000099610 | 108 |
| 540 | 3300025981 | Ga0207640_10302371 | Ga0207640_103023712 | 108 |
| 541 | 3300025981 | Ga0207640_11340088 | Ga0207640_113400882 | 108 |
| 542 | 3300026023 | Ga0207677_10405520 | Ga0207677_104055201 | 108 |
| 543 | 3300026035 | Ga0207703_11652650 | Ga0207703_116526501 | 108 |
| 544 | 3300026041 | Ga0207639_10009142 | Ga0207639_100091423 | 108 |
| 545 | 3300026041 | Ga0207639_10032059 | Ga0207639_100320594 | 108 |
| 546 | 3300026041 | Ga0207639_10426897 | Ga0207639_104268972 | 108 |
| 547 | 3300026041 | Ga0207639_10888708 | Ga0207639_108887082 | 108 |
| 548 | 3300026041 | Ga0207639_11333241 | Ga0207639_113332411 | 108 |
| 549 | 3300026067 | Ga0207678_10036233 | Ga0207678_100362333 | 108 |
| 550 | 3300026067 | Ga0207678_10043031 | Ga0207678_100430313 | 108 |
| 551 | 3300026067 | Ga0207678_11857996 | Ga0207678_118579961 | 108 |
| 552 | 3300026075 | Ga0207708_10050718 | Ga0207708_100507184 | 108 |
| 553 | 3300026075 | Ga0207708_10390650 | Ga0207708_103906502 | 108 |
| 554 | 3300026078 | Ga0207702_10000393 | Ga0207702_1000039311 | 108 |
| 555 | 3300026078 | Ga0207702_10024780 | Ga0207702_100247802 | 108 |
| 556 | 3300026078 | Ga0207702_10025453 | Ga0207702_100254533 | 108 |
| 557 | 3300026078 | Ga0207702_10160383 | Ga0207702_101603832 | 108 |
| 558 | 3300026078 | Ga0207702_10366132 | Ga0207702_103661324 | 108 |
| 559 | 3300026078 | Ga0207702_10723120 | Ga0207702_107231201 | 108 |
| 560 | 3300026078 | Ga0207702_10983603 | Ga0207702_109836031 | 108 |
| 561 | 3300026088 | Ga0207641_10000921 | Ga0207641_1000092115 | 108 |
| 562 | 3300026088 | Ga0207641_10006712 | Ga0207641_100067128 | 108 |
| 563 | 3300026088 | Ga0207641_10134800 | Ga0207641_101348002 | 108 |
| 564 | 3300026095 | Ga0207676_10107576 | Ga0207676_101075762 | 108 |
| 565 | 3300026095 | Ga0207676_10151573 | Ga0207676_101515732 | 108 |
| 566 | 3300026095 | Ga0207676_10527523 | Ga0207676_105275231 | 108 |
| 567 | 3300026116 | Ga0207674_10033030 | Ga0207674_100330304 | 108 |
| 568 | 3300026116 | Ga0207674_10294529 | Ga0207674_102945292 | 108 |
| 569 | 3300026116 | Ga0207674_10315315 | Ga0207674_103153151 | 108 |
| 570 | 3300026116 | Ga0207674_10691179 | Ga0207674_106911792 | 108 |
| 571 | 3300026116 | Ga0207674_11339584 | Ga0207674_113395842 | 108 |
| 572 | 3300026118 | Ga0207675_100415340 | Ga0207675_1004153401 | 108 |
| 573 | 3300026121 | Ga0207683_10045818 | Ga0207683_100458182 | 108 |
| 574 | 3300026121 | Ga0207683_10245967 | Ga0207683_102459673 | 108 |
| 575 | 3300026142 | Ga0207698_10004007 | Ga0207698_100040076 | 108 |
| 576 | 3300026142 | Ga0207698_10261173 | Ga0207698_102611733 | 108 |
| 577 | 3300026142 | Ga0207698_10370536 | Ga0207698_103705362 | 108 |
| 578 | 3300026142 | Ga0207698_10618797 | Ga0207698_106187972 | 108 |
| 579 | 3300026142 | Ga0207698_10991631 | Ga0207698_109916312 | 108 |
| 580 | 3300027907 | Ga0207428_10137447 | Ga0207428_101374472 | 108 |
| 581 | 3300028379 | Ga0268266_10000037 | Ga0268266_10000037283 | 108 |
| 582 | 3300028380 | Ga0268265_10222960 | Ga0268265_102229603 | 108 |
| 583 | 3300028573 | Ga0265334_10057213 | Ga0265334_100572132 | 108 |
| 584 | 3300028786 | Ga0307517_10001881 | Ga0307517_100018818 | 108 |
| 585 | 3300028794 | Ga0307515_10000790 | Ga0307515_1000079079 | 108 |
| 586 | 3300028794 | Ga0307515_10001565 | Ga0307515_100015653 | 108 |
| 587 | 3300028794 | Ga0307515_10062818 | Ga0307515_100628184 | 108 |
| 588 | 3300028794 | Ga0307515_10068910 | Ga0307515_100689102 | 108 |
| 589 | 3300028794 | Ga0307515_10093363 | Ga0307515_100933632 | 108 |
| 590 | 3300028794 | Ga0307515_10357702 | Ga0307515_103577022 | 108 |
| 591 | 3300028800 | Ga0265338_10010649 | Ga0265338_100106499 | 108 |
| 592 | 3300028800 | Ga0265338_10153395 | Ga0265338_101533951 | 108 |
| 593 | 3300028800 | Ga0265338_10448333 | Ga0265338_104483332 | 108 |
| 594 | 3300028800 | Ga0265338_10514341 | Ga0265338_105143412 | 108 |
| 595 | 3300029957 | Ga0265324_10169631 | Ga0265324_101696312 | 108 |
| 596 | 3300030732 | Ga0316176_1014596 | Ga0316176_10145964 | 108 |
| 597 | 3300030742 | Ga0316183_1016718 | Ga0316183_101671845 | 108 |
| 598 | 3300030744 | Ga0316181_1091070 | Ga0316181_10910705 | 108 |
| 599 | 3300030744 | Ga0316181_1124067 | Ga0316181_11240671 | 108 |
| 600 | 3300030745 | Ga0316182_1148669 | Ga0316182_11486692 | 108 |
| 601 | 3300031240 | Ga0265320_10223651 | Ga0265320_102236512 | 108 |
| 602 | 3300031251 | Ga0265327_10083579 | Ga0265327_100835792 | 108 |
| 603 | 3300031507 | Ga0307509_10011471 | Ga0307509_100114715 | 108 |
| 604 | 3300031507 | Ga0307509_10373643 | Ga0307509_103736432 | 108 |
| 605 | 3300031548 | Ga0307408_100000628 | Ga0307408_10000062820 | 108 |
| 606 | 3300031548 | Ga0307408_100001834 | Ga0307408_10000183414 | 108 |
| 607 | 3300031548 | Ga0307408_100016380 | Ga0307408_1000163806 | 108 |
| 608 | 3300031548 | Ga0307408_101940426 | Ga0307408_1019404262 | 108 |
| 609 | 3300031727 | Ga0316576_10901982 | Ga0316576_109019822 | 108 |
| 610 | 3300031727 | Ga0316576_11033852 | Ga0316576_110338522 | 108 |
| 611 | 3300031730 | Ga0307516_10573588 | Ga0307516_105735882 | 108 |
| 612 | 3300031731 | Ga0307405_10000016 | Ga0307405_1000001691 | 108 |
| 613 | 3300031731 | Ga0307405_10009259 | Ga0307405_100092593 | 108 |
| 614 | 3300031731 | Ga0307405_10113301 | Ga0307405_101133012 | 108 |
| 615 | 3300031731 | Ga0307405_10611843 | Ga0307405_106118432 | 108 |
| 616 | 3300031731 | Ga0307405_11446311 | Ga0307405_114463112 | 108 |
| 617 | 3300031824 | Ga0307413_10905632 | Ga0307413_109056322 | 108 |
| 618 | 3300031852 | Ga0307410_10337270 | Ga0307410_103372703 | 108 |
| 619 | 3300031901 | Ga0307406_10800139 | Ga0307406_108001392 | 108 |
| 620 | 3300031903 | Ga0307407_10000006 | Ga0307407_10000006156 | 108 |
| 621 | 3300031911 | Ga0307412_10000001 | Ga0307412_1000000147 | 108 |
| 622 | 3300031911 | Ga0307412_10001942 | Ga0307412_100019426 | 108 |
| 623 | 3300031911 | Ga0307412_10034482 | Ga0307412_100344824 | 108 |
| 624 | 3300031911 | Ga0307412_10203138 | Ga0307412_102031382 | 108 |
| 625 | 3300031911 | Ga0307412_10441980 | Ga0307412_104419802 | 108 |
| 626 | 3300031911 | Ga0307412_10690848 | Ga0307412_106908482 | 108 |
| 627 | 3300031911 | Ga0307412_10943005 | Ga0307412_109430052 | 108 |
| 628 | 3300032002 | Ga0307416_100000032 | Ga0307416_10000003266 | 108 |
| 629 | 3300032002 | Ga0307416_100060854 | Ga0307416_1000608542 | 108 |
| 630 | 3300032004 | Ga0307414_10000268 | Ga0307414_100002683 | 108 |
| 631 | 3300032004 | Ga0307414_10005701 | Ga0307414_100057012 | 108 |
| 632 | 3300032004 | Ga0307414_10021383 | Ga0307414_100213834 | 108 |
| 633 | 3300032004 | Ga0307414_10040328 | Ga0307414_100403283 | 108 |
| 634 | 3300032004 | Ga0307414_10055952 | Ga0307414_100559523 | 108 |
| 635 | 3300032004 | Ga0307414_10092095 | Ga0307414_100920952 | 108 |
| 636 | 3300032004 | Ga0307414_10092129 | Ga0307414_100921294 | 108 |
| 637 | 3300032004 | Ga0307414_10190811 | Ga0307414_101908112 | 108 |
| 638 | 3300032004 | Ga0307414_11508851 | Ga0307414_115088511 | 108 |
| 639 | 3300032004 | Ga0307414_11795324 | Ga0307414_117953242 | 108 |
| 640 | 3300032004 | Ga0307414_11881010 | Ga0307414_118810101 | 108 |
| 641 | 3300032005 | Ga0307411_10066871 | Ga0307411_100668712 | 108 |
| 642 | 3300032005 | Ga0307411_11764727 | Ga0307411_117647271 | 108 |
| 643 | 3300032005 | Ga0307411_11798467 | Ga0307411_117984672 | 108 |
| 644 | 3300032126 | Ga0307415_100221734 | Ga0307415_1002217342 | 108 |
| 645 | 3300033179 | Ga0307507_10000143 | Ga0307507_1000014375 | 108 |
| 646 | 3300033180 | Ga0307510_10000149 | Ga0307510_1000014916 | 108 |
| 647 | 3300035115 | Ga0373941_0109536 | Ga0373941_0109536_56_382 | 108 |
| 648 | 3300035695 | Ga0373927_0153063 | Ga0373927_0153063_36_365 | 108 |
| 649 | 3300036401 | Ga0373937_0989888 | Ga0373937_0989888_260_586 | 108 |
| 650 | 3300036712 | Ga0316584_0231279 | Ga0316584_0231279_557_901 | 108 |
| 651 | 3300037068 | Ga0373925_1418411 | Ga0373925_1418411_22_381 | 108 |
| 652 | 3300037312 | Ga0395899_0000017 | Ga0395899_0000017_189471_189797 | 108 |
| 653 | 3300037312 | Ga0395899_0000152 | Ga0395899_0000152_90159_90485 | 108 |
| 654 | 3300037312 | Ga0395899_0003831 | Ga0395899_0003831_3907_4233 | 108 |
| 655 | 3300037312 | Ga0395899_0277394 | Ga0395899_0277394_214_549 | 108 |
| 656 | 3300037418 | Ga0395900_0000523 | Ga0395900_0000523_6643_6969 | 108 |
| 657 | 3300037418 | Ga0395900_0005417 | Ga0395900_0005417_9966_10292 | 108 |
| 658 | 3300037418 | Ga0395900_0005978 | Ga0395900_0005978_9093_9419 | 108 |
| 659 | 3300037418 | Ga0395900_0105004 | Ga0395900_0105004_2270_2605 | 108 |
| 660 | 3300037418 | Ga0395900_0163666 | Ga0395900_0163666_1926_2252 | 108 |
| 661 | 3300037418 | Ga0395900_0240627 | Ga0395900_0240627_1287_1613 | 108 |
| 662 | 3300037418 | Ga0395900_1915307 | Ga0395900_1915307_35_361 | 108 |
| 663 | 3300037466 | Ga0395898_0003563 | Ga0395898_0003563_9414_9740 | 108 |
| 664 | 3300037466 | Ga0395898_0075703 | Ga0395898_0075703_2297_2623 | 108 |
| 665 | 3300037466 | Ga0395898_0127076 | Ga0395898_0127076_1324_1659 | 108 |
| 666 | 3300037471 | Ga0395905_0006175 | Ga0395905_0006175_10635_10961 | 108 |
| 667 | 3300037471 | Ga0395905_0007055 | Ga0395905_0007055_5704_6030 | 108 |
| 668 | 3300037471 | Ga0395905_0183951 | Ga0395905_0183951_982_1317 | 108 |
| 669 | 3300038443 | Ga0395901_0007492 | Ga0395901_0007492_7206_7532 | 108 |
| 670 | 3300038443 | Ga0395901_0013621 | Ga0395901_0013621_2274_2600 | 108 |
| 671 | 3300038443 | Ga0395901_0018348 | Ga0395901_0018348_5100_5435 | 108 |
| 672 | 3300038443 | Ga0395901_0113245 | Ga0395901_0113245_2346_2672 | 108 |
| 673 | 3300038725 | Ga0400484_43947 | Ga0400484_43947_636_977 | 108 |
| 674 | 3300039062 | Ga0400483_044221 | Ga0400483_044221_66_395 | 108 |
| 675 | 3300039062 | Ga0400483_062433 | Ga0400483_062433_1588_1935 | 108 |
| 676 | 3300039062 | Ga0400483_112494 | Ga0400483_112494_555_896 | 108 |
| 677 | 3300039437 | Ga0436365_1929414 | Ga0436365_1929414_1622_1972 | 108 |
| 678 | 3300039447 | Ga0436361_0569017 | Ga0436361_0569017_566_892 | 108 |
| 679 | 3300041404 | Ga0439436_0000241 | Ga0439436_0000241_2426_2755 | 108 |
| 680 | 3300041406 | Ga0439439_0020088 | Ga0439439_0020088_898_1227 | 108 |
| 681 | 3300041452 | Ga0451793_0438499 | Ga0451793_0438499_44_370 | 108 |
| 682 | 3300041452 | Ga0451793_0959079 | Ga0451793_0959079_41_367 | 108 |
| 683 | 3300041452 | Ga0451793_1840194 | Ga0451793_1840194_417_743 | 108 |
| 684 | 3300041453 | Ga0451797_1031175 | Ga0451797_1031175_53_379 | 108 |
| 685 | 3300041458 | Ga0451798_1146370 | Ga0451798_1146370_234_599 | 108 |
| 686 | 3300041459 | Ga0451800_0026029 | Ga0451800_0026029_171_500 | 108 |
| 687 | 3300041460 | Ga0451802_0608812 | Ga0451802_0608812_217_546 | 108 |
| 688 | 3300041486 | Ga0451807_2157009 | Ga0451807_2157009_106_432 | 108 |
| 689 | 3300041492 | Ga0451835_0814727 | Ga0451835_0814727_100_429 | 108 |
| 690 | 3300041494 | Ga0451837_0878129 | Ga0451837_0878129_27_353 | 108 |
| 691 | 3300041498 | Ga0451841_1117568 | Ga0451841_1117568_144_470 | 108 |
| 692 | 3300041498 | Ga0451841_1304691 | Ga0451841_1304691_81_407 | 108 |
| 693 | 3300041999 | Ga0439433_0196967 | Ga0439433_0196967_17_346 | 108 |
| 694 | 3300042007 | Ga0439449_0068234 | Ga0439449_0068234_470_799 | 108 |
| 695 | 3300042012 | Ga0439455_0121192 | Ga0439455_0121192_324_650 | 108 |
| 696 | 3300042014 | Ga0439457_000013 | Ga0439457_000013_35092_35421 | 108 |
| 697 | 3300042015 | Ga0439462_0100615 | Ga0439462_0100615_211_537 | 108 |
| 698 | 3300042125 | Ga0450923_011295 | Ga0450923_011295_624_950 | 108 |
| 699 | 3300042436 | Ga0439435_0074984 | Ga0439435_0074984_141_485 | 108 |
| 700 | 3300044656 | Ga0466969_0152231 | Ga0466969_0152231_614_940 | 108 |
| 701 | 3300044658 | Ga0466972_0000263 | Ga0466972_0000263_9747_10076 | 108 |
| 702 | 3300044673 | Ga0453683_0003606 | Ga0453683_0003606_5161_5505 | 108 |
| 703 | 3300044673 | Ga0453683_0461515 | Ga0453683_0461515_465_791 | 108 |
| 704 | 3300044684 | Ga0466966_0081289 | Ga0466966_0081289_1434_1760 | 108 |
| 705 | 3300044684 | Ga0466966_1003400 | Ga0466966_1003400_78_404 | 108 |
| 706 | 3300044693 | Ga0466961_0082976 | Ga0466961_0082976_1430_1756 | 108 |
| 707 | 3300044693 | Ga0466961_0333376 | Ga0466961_0333376_543_869 | 108 |
| 708 | 3300044712 | Ga0453684_0080844 | Ga0453684_0080844_1339_1665 | 108 |
| 709 | 3300045049 | Ga0466959_0073994 | Ga0466959_0073994_1136_1462 | 108 |
| 710 | 3300045051 | Ga0451576_0000008 | Ga0451576_0000008_602811_603155 | 108 |
| 711 | 3300045836 | Ga0466958_0012340 | Ga0466958_0012340_749_1075 | 108 |
| 712 | 3300046460 | Ga0495638_0145207 | Ga0495638_0145207_879_1205 | 108 |
| 713 | 3300046460 | Ga0495638_0213000 | Ga0495638_0213000_202_528 | 108 |
| 714 | 3300046460 | Ga0495638_0593081 | Ga0495638_0593081_161_487 | 108 |
| 715 | 3300046462 | Ga0495651_0077080 | Ga0495651_0077080_204_530 | 108 |
| 716 | 3300046471 | Ga0495650_0000095 | Ga0495650_0000095_6568_6894 | 108 |
| 717 | 3300046471 | Ga0495650_0271739 | Ga0495650_0271739_37_435 | 108 |
| 718 | 3300046471 | Ga0495650_0335285 | Ga0495650_0335285_142_468 | 108 |
| 719 | 3300046492 | Ga0495585_0000057 | Ga0495585_0000057_20091_20417 | 108 |
| 720 | 3300046492 | Ga0495585_0000648 | Ga0495585_0000648_11568_11894 | 108 |
| 721 | 3300046500 | Ga0495596_0025532 | Ga0495596_0025532_1145_1471 | 108 |
| 722 | 3300046501 | Ga0495607_0167770 | Ga0495607_0167770_626_952 | 108 |
| 723 | 3300046506 | Ga0495583_0029680 | Ga0495583_0029680_1353_1679 | 108 |
| 724 | 3300046506 | Ga0495583_0072998 | Ga0495583_0072998_1096_1422 | 108 |
| 725 | 3300046506 | Ga0495583_0256669 | Ga0495583_0256669_208_534 | 108 |
| 726 | 3300046507 | Ga0495606_0000009 | Ga0495606_0000009_221393_221719 | 108 |
| 727 | 3300046507 | Ga0495606_0007717 | Ga0495606_0007717_4957_5283 | 108 |
| 728 | 3300046507 | Ga0495606_0011706 | Ga0495606_0011706_6644_6970 | 108 |
| 729 | 3300046507 | Ga0495606_0026272 | Ga0495606_0026272_1457_1783 | 108 |
| 730 | 3300046507 | Ga0495606_0031758 | Ga0495606_0031758_2189_2515 | 108 |
| 731 | 3300046507 | Ga0495606_0061425 | Ga0495606_0061425_1278_1604 | 108 |
| 732 | 3300046507 | Ga0495606_0603678 | Ga0495606_0603678_18_344 | 108 |
| 733 | 3300046512 | Ga0495610_0000231 | Ga0495610_0000231_16693_17019 | 108 |
| 734 | 3300046512 | Ga0495610_0000237 | Ga0495610_0000237_35100_35426 | 108 |
| 735 | 3300046512 | Ga0495610_0001711 | Ga0495610_0001711_2611_2937 | 108 |
| 736 | 3300046512 | Ga0495610_0149922 | Ga0495610_0149922_39_365 | 108 |
| 737 | 3300046513 | Ga0495616_0000733 | Ga0495616_0000733_16293_16619 | 108 |
| 738 | 3300046513 | Ga0495616_0006705 | Ga0495616_0006705_4622_4948 | 108 |
| 739 | 3300046518 | Ga0495631_0016934 | Ga0495631_0016934_1336_1662 | 108 |
| 740 | 3300046519 | Ga0495632_0131408 | Ga0495632_0131408_446_772 | 108 |
| 741 | 3300046520 | Ga0495637_0092864 | Ga0495637_0092864_71_397 | 108 |
| 742 | 3300046522 | Ga0495643_0276495 | Ga0495643_0276495_182_511 | 108 |
| 743 | 3300046523 | Ga0495644_0021868 | Ga0495644_0021868_1297_1623 | 108 |
| 744 | 3300046524 | Ga0495648_0005462 | Ga0495648_0005462_1577_1903 | 108 |
| 745 | 3300046524 | Ga0495648_0018322 | Ga0495648_0018322_2333_2659 | 108 |
| 746 | 3300046529 | Ga0495652_0090697 | Ga0495652_0090697_1258_1584 | 108 |
| 747 | 3300046529 | Ga0495652_0466530 | Ga0495652_0466530_489_815 | 108 |
| 748 | 3300046529 | Ga0495652_0541635 | Ga0495652_0541635_152_478 | 108 |
| 749 | 3300046530 | Ga0495654_0246215 | Ga0495654_0246215_367_693 | 108 |
| 750 | 3300046538 | Ga0495609_0007538 | Ga0495609_0007538_4415_4741 | 108 |
| 751 | 3300046538 | Ga0495609_0011292 | Ga0495609_0011292_607_933 | 108 |
| 752 | 3300046538 | Ga0495609_0036324 | Ga0495609_0036324_937_1263 | 108 |
| 753 | 3300046538 | Ga0495609_0247295 | Ga0495609_0247295_63_389 | 108 |
| 754 | 3300046558 | Ga0495633_0000275 | Ga0495633_0000275_17624_17950 | 108 |
| 755 | 3300046558 | Ga0495633_0006218 | Ga0495633_0006218_5580_5906 | 108 |
| 756 | 3300046558 | Ga0495633_0203951 | Ga0495633_0203951_220_549 | 108 |
| 757 | 3300046616 | Ga0495668_0000017 | Ga0495668_0000017_222695_223021 | 108 |
| 758 | 3300046616 | Ga0495668_0096233 | Ga0495668_0096233_976_1302 | 108 |
| 759 | 3300046642 | Ga0495634_0617640 | Ga0495634_0617640_28_354 | 108 |
| 760 | 3300046660 | Ga0495625_0000007 | Ga0495625_0000007_91573_91899 | 108 |
| 761 | 3300046660 | Ga0495625_0000901 | Ga0495625_0000901_38011_38337 | 108 |
| 762 | 3300046660 | Ga0495625_0001789 | Ga0495625_0001789_22718_23044 | 108 |
| 763 | 3300046660 | Ga0495625_0003096 | Ga0495625_0003096_10979_11305 | 108 |
| 764 | 3300046660 | Ga0495625_0052422 | Ga0495625_0052422_430_756 | 108 |
| 765 | 3300046660 | Ga0495625_0248723 | Ga0495625_0248723_679_1005 | 108 |
| 766 | 3300046660 | Ga0495625_0403762 | Ga0495625_0403762_445_771 | 108 |
| 767 | 3300046665 | Ga0495661_0000576 | Ga0495661_0000576_9683_10009 | 108 |
| 768 | 3300046665 | Ga0495661_0004014 | Ga0495661_0004014_8812_9138 | 108 |
| 769 | 3300046665 | Ga0495661_0063777 | Ga0495661_0063777_170_496 | 108 |
| 770 | 3300046665 | Ga0495661_0209276 | Ga0495661_0209276_64_390 | 108 |
| 771 | 3300046665 | Ga0495661_0343171 | Ga0495661_0343171_379_705 | 108 |
| 772 | 3300046683 | Ga0495658_0116785 | Ga0495658_0116785_29_355 | 108 |
| 773 | 3300046684 | Ga0495669_0375434 | Ga0495669_0375434_156_482 | 108 |
| 774 | 3300046691 | Ga0495670_0337091 | Ga0495670_0337091_244_570 | 108 |
| 775 | 3300046692 | Ga0495671_0026266 | Ga0495671_0026266_187_513 | 108 |
| 776 | 3300046694 | Ga0495649_0000007 | Ga0495649_0000007_343519_343845 | 108 |
| 777 | 3300046694 | Ga0495649_0582358 | Ga0495649_0582358_180_506 | 108 |
| 778 | 3300046810 | Ga0495660_0009750 | Ga0495660_0009750_4160_4558 | 108 |
| 779 | 3300047323 | Ga0495683_0018342 | Ga0495683_0018342_2415_2741 | 108 |
| 780 | 3300047443 | Ga0495687_004966 | Ga0495687_004966_8108_8434 | 108 |
| 781 | 3300047443 | Ga0495687_007879 | Ga0495687_007879_4851_5177 | 108 |
| 782 | 3300047443 | Ga0495687_025474 | Ga0495687_025474_427_753 | 108 |
| 783 | 3300047443 | Ga0495687_124607 | Ga0495687_124607_195_521 | 108 |
| 784 | 3300047445 | Ga0495677_0017891 | Ga0495677_0017891_585_911 | 108 |
| 785 | 3300047447 | Ga0495685_152589 | Ga0495685_152589_84_410 | 108 |
| 786 | 3300047469 | Ga0495673_0111947 | Ga0495673_0111947_726_1052 | 108 |
| 787 | 3300047472 | Ga0495686_0000490 | Ga0495686_0000490_45331_45657 | 108 |
| 788 | 3300047472 | Ga0495686_0000729 | Ga0495686_0000729_32897_33223 | 108 |
| 789 | 3300047472 | Ga0495686_0017335 | Ga0495686_0017335_4086_4412 | 108 |
| 790 | 3300047472 | Ga0495686_0030106 | Ga0495686_0030106_249_578 | 108 |
| 791 | 3300047472 | Ga0495686_0152383 | Ga0495686_0152383_756_1109 | 108 |
| 792 | 3300047472 | Ga0495686_0314448 | Ga0495686_0314448_333_659 | 108 |
| 793 | 3300048088 | Ga0495602_1118268 | Ga0495602_1118268_78_404 | 108 |
| 794 | 3300048089 | Ga0495614_0003480 | Ga0495614_0003480_5254_5580 | 108 |
| 795 | 3300048919 | Ga0496116_0000752 | Ga0496116_0000752_34569_34895 | 108 |
| 796 | 3300048920 | Ga0496117_0007456 | Ga0496117_0007456_6260_6586 | 108 |
| 797 | 3300048921 | Ga0496118_0051861 | Ga0496118_0051861_557_883 | 108 |
| 798 | 3300048925 | Ga0496122_0002421 | Ga0496122_0002421_12222_12548 | 108 |
| 799 | 3300048925 | Ga0496122_0003438 | Ga0496122_0003438_1550_1876 | 108 |
| 800 | 3300048926 | Ga0496123_0004076 | Ga0496123_0004076_3693_4019 | 108 |
| 801 | 3300048926 | Ga0496123_0020394 | Ga0496123_0020394_974_1300 | 108 |
| 802 | 3300048928 | Ga0496125_0157196 | Ga0496125_0157196_454_780 | 108 |
| 803 | 3300048928 | Ga0496125_0321761 | Ga0496125_0321761_275_601 | 108 |
| 804 | 3300049459 | Ga0495678_003805 | Ga0495678_003805_218_544 | 108 |
| 805 | 3300049459 | Ga0495678_227887 | Ga0495678_227887_15_341 | 108 |
| 806 | 3300049460 | Ga0495682_0036521 | Ga0495682_0036521_779_1105 | 108 |
| 807 | 3300049571 | Ga0501034_0297323 | Ga0501034_0297323_1108_1437 | 108 |
| 808 | 3300049579 | Ga0501043_0141142 | Ga0501043_0141142_468_797 | 108 |
| 809 | 3300049581 | Ga0501047_0124055 | Ga0501047_0124055_1514_1843 | 108 |
| 810 | 3300049581 | Ga0501047_0840617 | Ga0501047_0840617_303_632 | 108 |
| 811 | 3300049582 | Ga0501048_0079904 | Ga0501048_0079904_611_940 | 108 |
| 812 | 3300049652 | Ga0501202_111142 | Ga0501202_111142_187_513 | 108 |
| 813 | 3300049663 | Ga0501223_001696 | Ga0501223_001696_1222_1548 | 108 |
| 814 | 3300049663 | Ga0501223_148475 | Ga0501223_148475_108_434 | 108 |
| 815 | 3300049668 | Ga0501233_096179 | Ga0501233_096179_269_595 | 108 |
| 816 | 3300049673 | Ga0501240_000352 | Ga0501240_000352_2702_3028 | 108 |
| 817 | 3300049705 | Ga0501225_0000569 | Ga0501225_0000569_7133_7462 | 108 |
| 818 | 3300049705 | Ga0501225_0283472 | Ga0501225_0283472_47_373 | 108 |
| 819 | 3300049758 | Ga0501241_002026 | Ga0501241_002026_2841_3167 | 108 |
| 820 | 3300049758 | Ga0501241_080470 | Ga0501241_080470_83_409 | 108 |
| 821 | 3300049822 | Ga0501035_0622157 | Ga0501035_0622157_246_575 | 108 |
| 822 | 3300049823 | Ga0501044_0026588 | Ga0501044_0026588_3519_3848 | 108 |
| 823 | 3300050491 | nmdc:mga00v17_798549_c1 | nmdc:mga00v17_798549_c1_239_577 | 108 |
| 824 | 3300050493 | nmdc:mga0k408_14935_c1 | nmdc:mga0k408_14935_c1_641_970 | 108 |
| 825 | 3300050493 | nmdc:mga0k408_151_c2 | nmdc:mga0k408_151_c2_11145_11474 | 108 |
| 826 | 3300050493 | nmdc:mga0k408_54405_c2 | nmdc:mga0k408_54405_c2_381_707 | 108 |
| 827 | 3300050493 | nmdc:mga0k408_63_c1 | nmdc:mga0k408_63_c1_12249_12575 | 108 |
| 828 | 3300050493 | nmdc:mga0k408_661349_c1 | nmdc:mga0k408_661349_c1_227_553 | 108 |
| 829 | 3300050496 | nmdc:mga07m45_671441_c1 | nmdc:mga07m45_671441_c1_145_471 | 108 |
| 830 | 3300050508 | nmdc:mga09592_22801_c1 | nmdc:mga09592_22801_c1_3565_3909 | 108 |
| 831 | 3300050509 | nmdc:mga0qj67_216843_c1 | nmdc:mga0qj67_216843_c1_843_1187 | 108 |
| 832 | 3300050510 | nmdc:mga06r32_103002_c1 | nmdc:mga06r32_103002_c1_716_1060 | 108 |
| 833 | 3300050511 | nmdc:mga08y16_53088_c1 | nmdc:mga08y16_53088_c1_2138_2464 | 108 |
| 834 | 3300053080 | Ga0500635_0000719 | Ga0500635_0000719_1437_1763 | 108 |
| 835 | 3300053086 | Ga0500578_0000010 | Ga0500578_0000010_186157_186486 | 108 |
| 836 | 3300053092 | Ga0500583_0000064 | Ga0500583_0000064_55882_56211 | 108 |
| 837 | 3300053092 | Ga0500583_0006250 | Ga0500583_0006250_3527_3856 | 108 |
| 838 | 3300053093 | Ga0500651_0001193 | Ga0500651_0001193_1442_1768 | 108 |
| 839 | 3300053122 | Ga0500608_000322 | Ga0500608_000322_13839_14165 | 108 |
| 840 | 3300053122 | Ga0500608_004236 | Ga0500608_004236_4722_5048 | 108 |
| 841 | 3300053125 | Ga0500618_000033 | Ga0500618_000033_35119_35445 | 108 |
| 842 | 3300053125 | Ga0500618_008791 | Ga0500618_008791_345_749 | 108 |
| 843 | 3300053138 | Ga0500564_198995 | Ga0500564_198995_276_602 | 108 |
| 844 | 3300053139 | Ga0500568_0178919 | Ga0500568_0178919_204_530 | 108 |
| 845 | 3300053143 | Ga0500579_227616 | Ga0500579_227616_241_567 | 108 |
| 846 | 3300053153 | Ga0500616_0154423 | Ga0500616_0154423_125_454 | 108 |
| 847 | 3300053153 | Ga0500616_0198835 | Ga0500616_0198835_202_528 | 108 |
| 848 | 3300053154 | Ga0500619_181841 | Ga0500619_181841_149_475 | 108 |
| 849 | 3300053156 | Ga0500622_0000417 | Ga0500622_0000417_7570_7902 | 108 |
| 850 | 3300053156 | Ga0500622_0148758 | Ga0500622_0148758_398_727 | 108 |
| 851 | 3300053157 | Ga0500624_000447 | Ga0500624_000447_10921_11247 | 108 |
| 852 | 3300053178 | Ga0500637_0377270 | Ga0500637_0377270_350_679 | 108 |
| 853 | 3300053727 | Ga0500611_000019 | Ga0500611_000019_76178_76504 | 108 |
| 854 | 3300053727 | Ga0500611_086330 | Ga0500611_086330_150_479 | 108 |
| 855 | 3300053739 | Ga0500587_033546 | Ga0500587_033546_82_411 | 108 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ie9-assembly1.cif.gz_D | crystal structure of the bacillus-conserved mazg protein, a nucleotide pyrophosphohydrolase | 0.9196 | 1 | 92 |
| 5ie9-assembly1.cif.gz_B | crystal structure of the bacillus-conserved mazg protein, a nucleotide pyrophosphohydrolase | 0.9027 | 1 | 92 |
| 2gta-assembly1.cif.gz_C | crystal structure of the putative pyrophosphatase ypjd from bacillus subtilis. northeast structural genomics consortium target sr428. | 0.9021 | 1 | 94 |
| 5ie9-assembly1.cif.gz_C | crystal structure of the bacillus-conserved mazg protein, a nucleotide pyrophosphohydrolase | 0.9002 | 1 | 92 |
| 2gta-assembly1.cif.gz_B | crystal structure of the putative pyrophosphatase ypjd from bacillus subtilis. northeast structural genomics consortium target sr428. | 0.8754 | 1 | 97 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ie9D00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like | 0.9196 | 1 | 92 | 1.10.287.1080 |
| 5ie9B00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like | 0.9027 | 1 | 92 | 1.10.287.1080 |
| 5ie9C00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like | 0.9002 | 1 | 92 | 1.10.287.1080 |
| 2gtaB00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like | 0.8753 | 1 | 88 | 1.10.287.1080 |
| 2gtaA00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like | 0.8642 | 1 | 88 | 1.10.287.1080 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A644TAW7-F1-model_v4 | NTP pyrophosphohydrolase MazG-like domain-containing protein | 0.9603 | 1 | 108 |
|
| AF-A0A7D5RRJ8-F1-model_v4 | Nucleotide pyrophosphohydrolase | 0.9603 | 1 | 99 |
GO:0016787
|
| AF-A6EBH0-F1-model_v4 | NTP pyrophosphohydrolase MazG-like domain-containing protein | 0.9601 | 1 | 108 |
|
| AF-A0A352HSZ7-F1-model_v4 | Pyrophosphatase | 0.9601 | 1 | 103 |
|
| AF-A0A348PT58-F1-model_v4 | Pyrophosphatase | 0.9586 | 1 | 108 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar