F483641

General Info

Members Datasets Scaffolds Average Seq Length
855 335 855 109

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_008791|Ga0500618_008791_345_749
Length 134
Sequence MRSVKQIESKKIREIRAHSILTQNYFMEISEAQQLVDNWIKTTGIRYFNELTNTAILMEEVGEVARIMARQYGEQSFKKTDTEVNLADEMADVLFVLICLANQTGIDLTEALIKNMDKKSIRDAERHKNNEKLK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
123 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
126 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
127 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
128 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
129 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
130 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
187 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
191 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
192 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
193 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
194 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
195 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
196 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
200 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
223 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
224 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
227 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
228 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
229 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
230 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
231 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
232 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
233 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
234 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
235 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
236 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
237 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
238 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
239 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
240 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
241 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
242 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
243 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
244 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
247 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
248 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
249 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
250 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
251 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
258 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
259 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
260 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
261 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
262 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
263 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
264 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
265 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
266 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
267 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
268 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
269 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
270 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
271 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
272 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
273 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
274 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
279 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
280 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
281 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
282 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
283 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
284 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
285 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
286 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
287 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
288 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
289 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
290 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
291 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
292 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
293 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
294 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
295 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
296 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
297 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
298 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
299 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
300 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
306 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
307 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
308 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
309 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
310 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
314 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
315 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
316 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
317 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
321 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
322 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
323 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
324 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
325 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
326 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
327 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
328 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
329 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
330 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
331 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
332 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
333 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
334 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
335 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.88
Metatranscriptomes 0.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.02
Nodule 0
Rhizoplane 0.94
Rhizosphere 86.55
Stem 0
Stem Tuber 0
Unclassified 5.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2255685 2162886007 Bacteria 19658
2 JGI24736J21556_1003173 3300001904 Bacteria 2864
3 JGI24740J21852_10005973 3300001979 Bacteria 5094
4 JGI24740J21852_10022379 3300001979 Bacteria 2177
5 JGI24739J22299_10002187 3300001989 Bacteria 7508
6 JGI24739J22299_10061220 3300001989 Bacteria 1189
7 JGI24737J22298_10000148 3300001990 Bacteria 21941
8 JGI24737J22298_10096935 3300001990 Bacteria 874
9 JGI24735J21928_10000020 3300002067 Bacteria 108706
10 JGI24744J21845_10002386 3300002077 Bacteria 3832
11 JGI24751J29686_10035279 3300002459 Bacteria 1037
12 JGI25162J39368_1000097 3300002737 Bacteria 96520
13 JGI25157J39369_1012814 3300002741 Bacteria 1063
14 JGI25157J39369_1020846 3300002741 Bacteria 782
15 JGI25157J39369_1023041 3300002741 Bacteria 733
16 JGI25152J39213_1000007 3300002773 Bacteria 156012
17 JGI25152J39213_1024763 3300002773 Bacteria 1003
18 JGI25150J39212_1000013 3300002774 Bacteria 182307
19 JGI25151J46595_10000004 3300003187 Bacteria 494006
20 JGI25165J46597_1000733 3300003214 Bacteria 25678
21 JGI25153J46596_10000004 3300003215 Bacteria 494006
22 rootH1_10101964 3300003316 Bacteria 6396
23 rootH1_10188452 3300003316 Bacteria 1428
24 rootH2_10009716 3300003320 Bacteria 46057
25 rootH2_10033863 3300003320 Bacteria 12920
26 rootH2_10326475 3300003320 Bacteria 2025
27 rootL2_10029081 3300003322 Bacteria 2603
28 rootH1_10010071 3300003323 Bacteria 2317
29 rootH1_10025651 3300003323 Bacteria 11383
30 rootH1_10033417 3300003323 Bacteria 27769
31 rootH1_10173204 3300003323 Bacteria 1265
32 rootH1_10306878 3300003323 Bacteria 2392
33 Ga0055536_1000010 3300003781 Bacteria 304614
34 Ga0055530_10001623 3300003791 Bacteria 16121
35 Ga0058863_11194942 3300004799 Bacteria 631
36 Ga0065165_1000242 3300005262 Bacteria 93564
37 Ga0065714_10003722 3300005288 Bacteria 22816
38 Ga0065714_10004493 3300005288 Bacteria 4884
39 Ga0065714_10007828 3300005288 Bacteria 5370
40 Ga0065714_10064539 3300005288 Bacteria 39775
41 Ga0065714_10079275 3300005288 Bacteria 2529
42 Ga0065714_10095945 3300005288 Bacteria 1773
43 Ga0065714_10106485 3300005288 Bacteria 1547
44 Ga0065714_10144326 3300005288 Bacteria 1149
45 Ga0065714_10182988 3300005288 Bacteria 955
46 Ga0065714_10207420 3300005288 Bacteria 877
47 Ga0065714_10288119 3300005288 Bacteria 703
48 Ga0065714_10296100 3300005288 Bacteria 695
49 Ga0065704_10000425 3300005289 Bacteria 76756
50 Ga0065704_10001986 3300005289 Bacteria 7583
51 Ga0065704_10099600 3300005289 Bacteria 2293
52 Ga0065704_10145283 3300005289 Bacteria 1478
53 Ga0065704_10165409 3300005289 Unclassified 1326
54 Ga0065704_10327887 3300005289 Bacteria 842
55 Ga0065704_10330903 3300005289 Bacteria 838
56 Ga0065704_10338441 3300005289 Unclassified 782
57 Ga0065704_10523286 3300005289 Bacteria 652
58 Ga0065712_10013478 3300005290 Bacteria 2183
59 Ga0065712_10179192 3300005290 Bacteria 1202
60 Ga0065715_10407233 3300005293 Bacteria 874
61 Ga0065707_10352364 3300005295 Bacteria 916
62 Ga0070658_10000069 3300005327 Bacteria 101140
63 Ga0070658_10166418 3300005327 Bacteria 1851
64 Ga0070658_10221837 3300005327 Bacteria 1599
65 Ga0070658_10234638 3300005327 Bacteria 1554
66 Ga0070658_10290223 3300005327 Bacteria 1394
67 Ga0070658_10424427 3300005327 Bacteria 1144
68 Ga0070658_10728643 3300005327 Bacteria 861
69 Ga0070658_11217883 3300005327 Bacteria 654
70 Ga0070658_11677479 3300005327 Bacteria 550
71 Ga0070676_10015301 3300005328 Bacteria 4231
72 Ga0070676_11076490 3300005328 Bacteria 606
73 Ga0070683_100047754 3300005329 Bacteria 3957
74 Ga0070683_100341934 3300005329 Bacteria 1425
75 Ga0070683_100609271 3300005329 Bacteria 1045
76 Ga0070690_100634055 3300005330 Unclassified 814
77 Ga0070670_100015918 3300005331 Bacteria 6454
78 Ga0070670_100016570 3300005331 Bacteria 6325
79 Ga0070670_100488402 3300005331 Bacteria 1094
80 Ga0068869_100140331 3300005334 Unclassified 1865
81 Ga0068869_100357028 3300005334 Bacteria 1192
82 Ga0070666_10026579 3300005335 Bacteria 3784
83 Ga0070680_100002384 3300005336 Bacteria 13903
84 Ga0070680_100019054 3300005336 Bacteria 5433
85 Ga0070680_100598402 3300005336 Bacteria 946
86 Ga0070682_100308216 3300005337 Bacteria 1164
87 Ga0070660_100046805 3300005339 Bacteria 3317
88 Ga0070660_100175713 3300005339 Bacteria 1732
89 Ga0070660_100933821 3300005339 Bacteria 732
90 Ga0070660_101009889 3300005339 Bacteria 703
91 Ga0070687_101213750 3300005343 Bacteria 557
92 Ga0070668_100629920 3300005347 Bacteria 941
93 Ga0070669_100028238 3300005353 Bacteria 4040
94 Ga0070675_100907591 3300005354 Bacteria 807
95 Ga0070673_100103439 3300005364 Bacteria 2350
96 Ga0070659_100002120 3300005366 Bacteria 14126
97 Ga0070659_100009288 3300005366 Bacteria 7220
98 Ga0070659_100435418 3300005366 Bacteria 1110
99 Ga0070659_100807152 3300005366 Bacteria 816
100 Ga0070659_100997780 3300005366 Bacteria 735
101 Ga0070667_100585357 3300005367 Bacteria 1027
102 Ga0070667_100834907 3300005367 Bacteria 856
103 Ga0070714_101534491 3300005435 Bacteria 651
104 Ga0070701_10086499 3300005438 Bacteria 1708
105 Ga0070700_100933211 3300005441 Bacteria 709
106 Ga0070663_100000935 3300005455 Bacteria 15875
107 Ga0070663_100013113 3300005455 Bacteria 5269
108 Ga0070663_101341462 3300005455 Unclassified 632
109 Ga0070678_100033628 3300005456 Bacteria 3562
110 Ga0070678_100179802 3300005456 Bacteria 1730
111 Ga0070678_100214102 3300005456 Bacteria 1598
112 Ga0070678_100462079 3300005456 Bacteria 1114
113 Ga0070662_100000186 3300005457 Bacteria 36051
114 Ga0070681_10001937 3300005458 Bacteria 18677
115 Ga0070681_10011702 3300005458 Bacteria 8692
116 Ga0068867_100944440 3300005459 Bacteria 778
117 Ga0068867_101136926 3300005459 Bacteria 714
118 Ga0068867_102382930 3300005459 Bacteria 503
119 Ga0070685_10013893 3300005466 Bacteria 4259
120 Ga0070685_11514227 3300005466 Bacteria 517
121 Ga0070707_102130360 3300005468 Unclassified 528
122 Ga0070698_100004536 3300005471 Bacteria 15258
123 Ga0070698_100025684 3300005471 Bacteria 6136
124 Ga0070698_100047082 3300005471 Bacteria 4409
125 Ga0070699_100544006 3300005518 Bacteria 1057
126 Ga0070679_100022402 3300005530 Bacteria 6175
127 Ga0070679_100045254 3300005530 Bacteria 4386
128 Ga0070679_101368628 3300005530 Unclassified 654
129 Ga0070679_101440123 3300005530 Bacteria 635
130 Ga0070684_100073584 3300005535 Bacteria 3011
131 Ga0070684_100151743 3300005535 Bacteria 2099
132 Ga0068853_100010772 3300005539 Bacteria 7407
133 Ga0068853_100031056 3300005539 Bacteria 4516
134 Ga0068853_100222314 3300005539 Bacteria 1725
135 Ga0068853_100266251 3300005539 Bacteria 1577
136 Ga0068853_100505967 3300005539 Bacteria 1141
137 Ga0070672_100208879 3300005543 Bacteria 1634
138 Ga0070686_100398870 3300005544 Bacteria 1046
139 Ga0070693_100800679 3300005547 Bacteria 698
140 Ga0070665_100000017 3300005548 Bacteria 448013
141 Ga0070704_100128810 3300005549 Bacteria 1958
142 Ga0068855_100000097 3300005563 Bacteria 106474
143 Ga0068855_100002978 3300005563 Bacteria 20697
144 Ga0068855_100004102 3300005563 Bacteria 17772
145 Ga0068855_100004838 3300005563 Bacteria 16436
146 Ga0068855_100010260 3300005563 Bacteria 11297
147 Ga0068855_100069864 3300005563 Bacteria 4086
148 Ga0068855_100142968 3300005563 Bacteria 2725
149 Ga0068855_100205601 3300005563 Bacteria 2215
150 Ga0068855_100395865 3300005563 Bacteria 1515
151 Ga0068855_100565927 3300005563 Bacteria 1229
152 Ga0068855_100584284 3300005563 Bacteria 1206
153 Ga0068855_102044129 3300005563 Bacteria 578
154 Ga0068857_100018843 3300005577 Bacteria 6057
155 Ga0068857_100074969 3300005577 Bacteria 3015
156 Ga0068857_101277532 3300005577 Bacteria 712
157 Ga0068854_100089124 3300005578 Bacteria 2292
158 Ga0068854_100584884 3300005578 Bacteria 951
159 Ga0068854_101467473 3300005578 Bacteria 618
160 Ga0068856_100002033 3300005614 Bacteria 21029
161 Ga0068856_100031710 3300005614 Bacteria 5172
162 Ga0068856_100034453 3300005614 Bacteria 4959
163 Ga0068856_100175072 3300005614 Bacteria 2158
164 Ga0068856_100235576 3300005614 Bacteria 1846
165 Ga0068856_100690324 3300005614 Bacteria 1041
166 Ga0068856_100847530 3300005614 Bacteria 933
167 Ga0068852_100004339 3300005616 Bacteria 10011
168 Ga0068852_100139242 3300005616 Bacteria 2244
169 Ga0068852_100292007 3300005616 Bacteria 1575
170 Ga0068852_100406560 3300005616 Bacteria 1340
171 Ga0068852_100527505 3300005616 Bacteria 1179
172 Ga0068859_100575015 3300005617 Bacteria 1220
173 Ga0068859_100926697 3300005617 Bacteria 955
174 Ga0068864_100275801 3300005618 Bacteria 1568
175 Ga0068866_10172933 3300005718 Bacteria 1269
176 Ga0068861_100641982 3300005719 Bacteria 980
177 Ga0068851_10100792 3300005834 Bacteria 1532
178 Ga0068870_10008407 3300005840 Bacteria 4642
179 Ga0068870_10053771 3300005840 Bacteria 2140
180 Ga0068863_100006021 3300005841 Bacteria 11896
181 Ga0068863_101518848 3300005841 Bacteria 678
182 Ga0068863_102358584 3300005841 Bacteria 542
183 Ga0068858_100088087 3300005842 Bacteria 2888
184 Ga0068860_100203625 3300005843 Bacteria 1918
185 Ga0068860_101052101 3300005843 Bacteria 833
186 Ga0068860_101521787 3300005843 Unclassified 691
187 Ga0068862_101486114 3300005844 Bacteria 683
188 Ga0075364_10900231 3300006051 Bacteria 602
189 Ga0075366_10000677 3300006195 Bacteria 16110
190 Ga0075366_10000881 3300006195 Bacteria 14502
191 Ga0075366_10282480 3300006195 Bacteria 1014
192 Ga0075366_10529193 3300006195 Bacteria 729
193 Ga0075366_10728705 3300006195 Bacteria 616
194 Ga0097621_100000721 3300006237 Bacteria 23141
195 Ga0097621_100135308 3300006237 Bacteria 2101
196 Ga0097621_102421369 3300006237 Bacteria 502
197 Ga0068871_100000286 3300006358 Bacteria 35207
198 Ga0068871_100045860 3300006358 Bacteria 3519
199 Ga0068871_100639105 3300006358 Bacteria 971
200 Ga0068871_100779492 3300006358 Bacteria 880
201 Ga0075428_100027330 3300006844 Bacteria 6314
202 Ga0075430_100072163 3300006846 Bacteria 2896
203 Ga0075431_100212027 3300006847 Bacteria 1978
204 Ga0075429_100000533 3300006880 Bacteria 28947
205 Ga0068865_100001165 3300006881 Bacteria 15280
206 Ga0068865_101162804 3300006881 Bacteria 682
207 Ga0097620_100575011 3300006931 Bacteria 1220
208 Ga0097620_100926802 3300006931 Bacteria 955
209 Ga0105244_10007635 3300009036 Bacteria 6853
210 Ga0105240_10000321 3300009093 Bacteria 90931
211 Ga0105240_10009251 3300009093 Bacteria 13972
212 Ga0105240_10028247 3300009093 Bacteria 7329
213 Ga0105240_10041945 3300009093 Bacteria 5835
214 Ga0105240_10062828 3300009093 Bacteria 4622
215 Ga0105240_10094107 3300009093 Bacteria 3656
216 Ga0105240_10401169 3300009093 Bacteria 1544
217 Ga0105240_10469361 3300009093 Bacteria 1405
218 Ga0105240_10474945 3300009093 Bacteria 1395
219 Ga0105240_10560177 3300009093 Bacteria 1263
220 Ga0105240_10657839 3300009093 Bacteria 1148
221 Ga0105240_10833796 3300009093 Bacteria 996
222 Ga0105240_10860639 3300009093 Bacteria 978
223 Ga0105240_10904277 3300009093 Bacteria 949
224 Ga0105240_11168744 3300009093 Bacteria 816
225 Ga0111539_10156186 3300009094 Unclassified 2670
226 Ga0111539_10410593 3300009094 Bacteria 1577
227 Ga0111539_10578160 3300009094 Bacteria 1308
228 Ga0105247_10546750 3300009101 Bacteria 851
229 Ga0105243_10000009 3300009148 Bacteria 354419
230 Ga0105243_10078741 3300009148 Bacteria 2684
231 Ga0105243_10904777 3300009148 Bacteria 878
232 Ga0105241_10001000 3300009174 Bacteria 21430
233 Ga0105241_10019786 3300009174 Bacteria 4968
234 Ga0105241_10065816 3300009174 Bacteria 2801
235 Ga0105241_10069375 3300009174 Bacteria 2733
236 Ga0105241_10103649 3300009174 Bacteria 2265
237 Ga0105241_10143974 3300009174 Bacteria 1944
238 Ga0105241_10412157 3300009174 Bacteria 1187
239 Ga0105241_10932225 3300009174 Bacteria 808
240 Ga0105241_11255738 3300009174 Bacteria 704
241 Ga0105241_12219969 3300009174 Bacteria 545
242 Ga0105242_10015750 3300009176 Bacteria 5874
243 Ga0105242_10053939 3300009176 Bacteria 3284
244 Ga0105242_10105159 3300009176 Bacteria 2397
245 Ga0105242_10213428 3300009176 Bacteria 1721
246 Ga0105248_10607974 3300009177 Bacteria 1233
247 Ga0105237_10000273 3300009545 Bacteria 72474
248 Ga0105237_10002591 3300009545 Bacteria 22307
249 Ga0105237_10003787 3300009545 Bacteria 17785
250 Ga0105237_10004463 3300009545 Bacteria 16172
251 Ga0105237_10012487 3300009545 Bacteria 8949
252 Ga0105237_10032439 3300009545 Bacteria 5288
253 Ga0105237_10073968 3300009545 Bacteria 3399
254 Ga0105237_10099788 3300009545 Bacteria 2895
255 Ga0105237_10206971 3300009545 Bacteria 1962
256 Ga0105237_10282829 3300009545 Bacteria 1661
257 Ga0105237_10389243 3300009545 Bacteria 1399
258 Ga0105237_10467363 3300009545 Bacteria 1267
259 Ga0105237_10468588 3300009545 Bacteria 1266
260 Ga0105237_11124254 3300009545 Bacteria 792
261 Ga0105237_12437185 3300009545 Bacteria 533
262 Ga0105238_10038734 3300009551 Bacteria 4840
263 Ga0105238_10039673 3300009551 Bacteria 4774
264 Ga0105238_10183376 3300009551 Bacteria 2070
265 Ga0105249_10001688 3300009553 Bacteria 19361
266 Ga0105249_10036731 3300009553 Bacteria 4445
267 Ga0105239_10000014 3300010375 Bacteria 325391
268 Ga0105239_10000017 3300010375 Bacteria 290760
269 Ga0105239_10000821 3300010375 Bacteria 44186
270 Ga0105239_10004179 3300010375 Bacteria 17344
271 Ga0105239_10048085 3300010375 Bacteria 4677
272 Ga0105239_10057768 3300010375 Bacteria 4256
273 Ga0105239_10103179 3300010375 Unclassified 3156
274 Ga0105239_10149651 3300010375 Bacteria 2605
275 Ga0105239_10154879 3300010375 Bacteria 2559
276 Ga0105239_10161839 3300010375 Bacteria 2501
277 Ga0105239_10211873 3300010375 Bacteria 2172
278 Ga0157373_10001836 3300013100 Bacteria 16168
279 Ga0157373_10001854 3300013100 Bacteria 16054
280 Ga0157373_10003628 3300013100 Bacteria 11658
281 Ga0157373_10021879 3300013100 Bacteria 4640
282 Ga0157373_10034944 3300013100 Bacteria 3610
283 Ga0157373_10222196 3300013100 Bacteria 1333
284 Ga0157373_10235937 3300013100 Bacteria 1292
285 Ga0157373_10787083 3300013100 Bacteria 701
286 Ga0157371_10000046 3300013102 Bacteria 187304
287 Ga0157371_10000297 3300013102 Bacteria 65919
288 Ga0157371_10001025 3300013102 Bacteria 30579
289 Ga0157371_10003077 3300013102 Bacteria 15475
290 Ga0157371_10003113 3300013102 Bacteria 15341
291 Ga0157371_10005385 3300013102 Bacteria 10807
292 Ga0157371_10010708 3300013102 Bacteria 7120
293 Ga0157371_10037682 3300013102 Bacteria 3460
294 Ga0157371_10061686 3300013102 Bacteria 2658
295 Ga0157371_10111119 3300013102 Bacteria 1945
296 Ga0157371_10142347 3300013102 Bacteria 1708
297 Ga0157370_10000083 3300013104 Bacteria 104313
298 Ga0157370_10018511 3300013104 Bacteria 7002
299 Ga0157370_10047250 3300013104 Bacteria 4127
300 Ga0157370_10047550 3300013104 Bacteria 4112
301 Ga0157370_10053400 3300013104 Bacteria 3853
302 Ga0157370_10105045 3300013104 Bacteria 2644
303 Ga0157370_10114672 3300013104 Bacteria 2517
304 Ga0157370_10126475 3300013104 Bacteria 2385
305 Ga0157370_10252277 3300013104 Bacteria 1632
306 Ga0157370_10256429 3300013104 Bacteria 1617
307 Ga0157370_10294623 3300013104 Bacteria 1498
308 Ga0157370_10348251 3300013104 Bacteria 1365
309 Ga0157370_10556806 3300013104 Unclassified 1051
310 Ga0157370_10584156 3300013104 Bacteria 1023
311 Ga0157370_10745478 3300013104 Bacteria 892
312 Ga0157370_11025745 3300013104 Bacteria 746
313 Ga0157370_11089540 3300013104 Bacteria 722
314 Ga0157369_10000046 3300013105 Bacteria 172851
315 Ga0157369_10002452 3300013105 Bacteria 22259
316 Ga0157369_10019838 3300013105 Bacteria 7523
317 Ga0157369_10055076 3300013105 Bacteria 4293
318 Ga0157369_10074716 3300013105 Bacteria 3635
319 Ga0157369_10088988 3300013105 Bacteria 3296
320 Ga0157369_10169448 3300013105 Bacteria 2301
321 Ga0157369_12641819 3300013105 Bacteria 507
322 Ga0157374_10000825 3300013296 Bacteria 27116
323 Ga0157374_10037163 3300013296 Bacteria 4467
324 Ga0157374_10127344 3300013296 Bacteria 2462
325 Ga0157374_10160886 3300013296 Bacteria 2187
326 Ga0157374_10164065 3300013296 Bacteria 2165
327 Ga0157374_10378086 3300013296 Bacteria 1411
328 Ga0157374_10723705 3300013296 Bacteria 1009
329 Ga0157374_12291511 3300013296 Bacteria 567
330 Ga0157374_12494883 3300013296 Bacteria 544
331 Ga0157378_10034988 3300013297 Bacteria 4442
332 Ga0157378_10246623 3300013297 Bacteria 1708
333 Ga0157378_10409295 3300013297 Bacteria 1338
334 Ga0157378_10644044 3300013297 Bacteria 1075
335 Ga0157378_11023477 3300013297 Bacteria 861
336 Ga0163162_10000026 3300013306 Bacteria 178701
337 Ga0163162_10000037 3300013306 Bacteria 138420
338 Ga0163162_10072237 3300013306 Bacteria 3505
339 Ga0163162_10081280 3300013306 Bacteria 3311
340 Ga0163162_10191782 3300013306 Bacteria 2171
341 Ga0163162_10470592 3300013306 Bacteria 1388
342 Ga0163162_10608139 3300013306 Bacteria 1219
343 Ga0163162_10801839 3300013306 Bacteria 1059
344 Ga0163162_10803863 3300013306 Bacteria 1058
345 Ga0157372_10000077 3300013307 Bacteria 102192
346 Ga0157372_10001279 3300013307 Bacteria 27221
347 Ga0157372_10002383 3300013307 Bacteria 20341
348 Ga0157372_10002480 3300013307 Bacteria 19998
349 Ga0157372_10004815 3300013307 Bacteria 14349
350 Ga0157372_10084375 3300013307 Bacteria 3600
351 Ga0157372_10126973 3300013307 Bacteria 2933
352 Ga0157372_10326511 3300013307 Bacteria 1786
353 Ga0157372_12191984 3300013307 Bacteria 635
354 Ga0157372_12408021 3300013307 Bacteria 604
355 Ga0157375_10001605 3300013308 Bacteria 19423
356 Ga0157375_10172436 3300013308 Bacteria 2311
357 Ga0157375_10194609 3300013308 Bacteria 2183
358 Ga0157375_10240533 3300013308 Bacteria 1970
359 Ga0157375_10403132 3300013308 Bacteria 1534
360 Ga0157375_11323998 3300013308 Bacteria 847
361 Ga0157375_12077672 3300013308 Bacteria 676
362 Ga0163163_10000202 3300014325 Bacteria 61701
363 Ga0163163_10018012 3300014325 Bacteria 6597
364 Ga0163163_10224910 3300014325 Bacteria 1925
365 Ga0163163_10948654 3300014325 Unclassified 924
366 Ga0157380_10127483 3300014326 Bacteria 2165
367 Ga0157380_10558522 3300014326 Bacteria 1124
368 Ga0157380_12610189 3300014326 Bacteria 571
369 Ga0182008_10000022 3300014497 Bacteria 207052
370 Ga0182008_10000104 3300014497 Bacteria 65446
371 Ga0182008_10000380 3300014497 Bacteria 34363
372 Ga0182008_10144077 3300014497 Bacteria 1193
373 Ga0182008_10648593 3300014497 Bacteria 598
374 Ga0157377_10035480 3300014745 Bacteria 2736
375 Ga0157377_10882636 3300014745 Bacteria 667
376 Ga0157379_10662826 3300014968 Bacteria 978
377 Ga0157379_11882846 3300014968 Bacteria 589
378 Ga0157376_10030698 3300014969 Bacteria 4295
379 Ga0157376_11163166 3300014969 Bacteria 799
380 Ga0157376_12307526 3300014969 Bacteria 577
381 Ga0157376_12744268 3300014969 Bacteria 532
382 Ga0182006_1000132 3300015261 Bacteria 80500
383 Ga0182006_1000229 3300015261 Bacteria 53391
384 Ga0182006_1002331 3300015261 Bacteria 10444
385 Ga0182006_1003205 3300015261 Bacteria 8510
386 Ga0182006_1029102 3300015261 Bacteria 2240
387 Ga0182007_10000009 3300015262 Bacteria 316298
388 Ga0182007_10002891 3300015262 Bacteria 8349
389 Ga0182007_10032142 3300015262 Bacteria 1784
390 Ga0182007_10124433 3300015262 Bacteria 864
391 Ga0183373_1008 3300015682 Bacteria 255339
392 Ga0163161_10000537 3300017792 Bacteria 30944
393 Ga0163161_10000787 3300017792 Bacteria 24900
394 Ga0163161_10000828 3300017792 Bacteria 24173
395 Ga0163161_10000991 3300017792 Bacteria 21691
396 Ga0163161_10002797 3300017792 Bacteria 12373
397 Ga0163161_10087213 3300017792 Bacteria 2305
398 Ga0163161_10118989 3300017792 Bacteria 1983
399 Ga0163161_10212443 3300017792 Bacteria 1495
400 Ga0163161_10246083 3300017792 Bacteria 1392
401 Ga0163161_10507942 3300017792 Bacteria 982
402 Ga0163161_11944884 3300017792 Bacteria 523
403 Ga0213872_10163370 3300021361 Bacteria 968
404 Ga0209563_120252 3300025230 Bacteria 750
405 Ga0207427_100066 3300025231 Bacteria 165770
406 Ga0209437_100010 3300025233 Bacteria 838447
407 Ga0209437_100030 3300025233 Bacteria 532466
408 Ga0207425_1000008 3300025245 Bacteria 618024
409 Ga0209026_1000246 3300025250 Bacteria 69164
410 Ga0209026_1003283 3300025250 Bacteria 5411
411 Ga0209026_1009476 3300025250 Bacteria 1910
412 Ga0209129_1000042 3300025258 Bacteria 305537
413 Ga0209129_1012392 3300025258 Bacteria 1960
414 Ga0209233_1000017 3300025261 Bacteria 898076
415 Ga0209455_1004736 3300025272 Bacteria 4368
416 Ga0209676_1000009 3300025292 Bacteria 981719
417 Ga0209676_1000455 3300025292 Bacteria 68999
418 Ga0209025_1000020 3300025294 Bacteria 618024
419 Ga0209758_1000022 3300025297 Bacteria 618024
420 Ga0209050_1000103 3300025298 Bacteria 229225
421 Ga0209050_1015302 3300025298 Bacteria 3231
422 Ga0207697_10078142 3300025315 Bacteria 1392
423 Ga0207656_10100263 3300025321 Bacteria 1327
424 Ga0207682_10054492 3300025893 Bacteria 1662
425 Ga0207680_10054144 3300025903 Bacteria 2412
426 Ga0207647_10000036 3300025904 Bacteria 98204
427 Ga0207647_10003216 3300025904 Bacteria 12256
428 Ga0207647_10103722 3300025904 Bacteria 1686
429 Ga0207647_10136292 3300025904 Bacteria 1440
430 Ga0207645_10000767 3300025907 Bacteria 26724
431 Ga0207645_10003332 3300025907 Bacteria 12252
432 Ga0207645_10572707 3300025907 Unclassified 766
433 Ga0207643_10026043 3300025908 Bacteria 3236
434 Ga0207705_10000032 3300025909 Bacteria 224376
435 Ga0207705_10001474 3300025909 Bacteria 18740
436 Ga0207705_10188698 3300025909 Bacteria 1558
437 Ga0207705_10225853 3300025909 Bacteria 1423
438 Ga0207705_10267623 3300025909 Bacteria 1306
439 Ga0207705_10505920 3300025909 Bacteria 938
440 Ga0207705_10708500 3300025909 Bacteria 782
441 Ga0207705_10956507 3300025909 Bacteria 662
442 Ga0207654_10001015 3300025911 Bacteria 15362
443 Ga0207654_10002954 3300025911 Bacteria 8621
444 Ga0207654_10034380 3300025911 Bacteria 2816
445 Ga0207654_10060455 3300025911 Bacteria 2213
446 Ga0207654_10062111 3300025911 Bacteria 2187
447 Ga0207654_10322657 3300025911 Bacteria 1056
448 Ga0207707_10008912 3300025912 Bacteria 8712
449 Ga0207707_10068540 3300025912 Bacteria 3091
450 Ga0207695_10000197 3300025913 Bacteria 168837
451 Ga0207695_10002602 3300025913 Bacteria 26455
452 Ga0207695_10010598 3300025913 Bacteria 11267
453 Ga0207695_10030986 3300025913 Bacteria 5878
454 Ga0207695_10108796 3300025913 Bacteria 2755
455 Ga0207695_10170790 3300025913 Bacteria 2100
456 Ga0207695_10340202 3300025913 Bacteria 1388
457 Ga0207695_10408841 3300025913 Bacteria 1241
458 Ga0207695_11204636 3300025913 Bacteria 637
459 Ga0207695_11225707 3300025913 Bacteria 630
460 Ga0207671_10002335 3300025914 Bacteria 20461
461 Ga0207671_10003413 3300025914 Bacteria 15880
462 Ga0207671_10003709 3300025914 Bacteria 15048
463 Ga0207671_10004896 3300025914 Bacteria 12580
464 Ga0207671_10005952 3300025914 Bacteria 11051
465 Ga0207671_10008207 3300025914 Bacteria 8896
466 Ga0207671_10056958 3300025914 Bacteria 2896
467 Ga0207671_10084372 3300025914 Bacteria 2386
468 Ga0207671_10158702 3300025914 Bacteria 1750
469 Ga0207671_10173670 3300025914 Bacteria 1674
470 Ga0207671_10224633 3300025914 Bacteria 1472
471 Ga0207671_11360366 3300025914 Bacteria 551
472 Ga0207671_11415044 3300025914 Bacteria 539
473 Ga0207660_10014016 3300025917 Bacteria 5261
474 Ga0207660_10043586 3300025917 Bacteria 3153
475 Ga0207660_10533826 3300025917 Bacteria 953
476 Ga0207657_10034473 3300025919 Bacteria 4551
477 Ga0207657_10053423 3300025919 Bacteria 3500
478 Ga0207657_10062996 3300025919 Bacteria 3173
479 Ga0207649_11254522 3300025920 Unclassified 586
480 Ga0207652_10001233 3300025921 Bacteria 22917
481 Ga0207652_10015719 3300025921 Bacteria 6165
482 Ga0207652_11252657 3300025921 Bacteria 644
483 Ga0207652_11265697 3300025921 Bacteria 640
484 Ga0207681_10116112 3300025923 Bacteria 1955
485 Ga0207694_10016665 3300025924 Bacteria 5553
486 Ga0207694_10136571 3300025924 Bacteria 1970
487 Ga0207694_10330619 3300025924 Bacteria 1259
488 Ga0207650_10095911 3300025925 Bacteria 2274
489 Ga0207650_10098223 3300025925 Bacteria 2249
490 Ga0207650_10349327 3300025925 Bacteria 1216
491 Ga0207650_10420532 3300025925 Bacteria 1109
492 Ga0207659_10190700 3300025926 Bacteria 1631
493 Ga0207659_10321999 3300025926 Bacteria 1276
494 Ga0207659_10555139 3300025926 Bacteria 976
495 Ga0207644_10040413 3300025931 Bacteria 3296
496 Ga0207644_11152371 3300025931 Unclassified 652
497 Ga0207690_10001817 3300025932 Bacteria 13092
498 Ga0207690_10123456 3300025932 Bacteria 1885
499 Ga0207690_10173588 3300025932 Bacteria 1617
500 Ga0207690_10402879 3300025932 Bacteria 1091
501 Ga0207690_10766008 3300025932 Bacteria 796
502 Ga0207706_10000125 3300025933 Bacteria 83075
503 Ga0207706_10360774 3300025933 Bacteria 1262
504 Ga0207686_10000200 3300025934 Bacteria 46234
505 Ga0207686_10149977 3300025934 Bacteria 1622
506 Ga0207686_10300646 3300025934 Bacteria 1191
507 Ga0207686_11406667 3300025934 Bacteria 574
508 Ga0207686_11582637 3300025934 Bacteria 541
509 Ga0207686_11647555 3300025934 Bacteria 530
510 Ga0207709_10000026 3300025935 Bacteria 354467
511 Ga0207709_10407892 3300025935 Bacteria 1040
512 Ga0207670_10485388 3300025936 Bacteria 1001
513 Ga0207669_10371145 3300025937 Bacteria 1112
514 Ga0207704_10000043 3300025938 Bacteria 88714
515 Ga0207704_10115091 3300025938 Bacteria 1827
516 Ga0207665_11526006 3300025939 Unclassified 531
517 Ga0207691_10013724 3300025940 Bacteria 7741
518 Ga0207691_10072530 3300025940 Bacteria 3106
519 Ga0207691_10210766 3300025940 Bacteria 1688
520 Ga0207689_10035388 3300025942 Bacteria 4149
521 Ga0207689_10106695 3300025942 Unclassified 2301
522 Ga0207689_11751437 3300025942 Bacteria 514
523 Ga0207661_10047813 3300025944 Bacteria 3398
524 Ga0207661_10060953 3300025944 Bacteria 3047
525 Ga0207667_10000630 3300025949 Bacteria 45583
526 Ga0207667_10001087 3300025949 Bacteria 34483
527 Ga0207667_10004753 3300025949 Bacteria 16611
528 Ga0207667_10006745 3300025949 Bacteria 13859
529 Ga0207667_10020244 3300025949 Bacteria 7404
530 Ga0207667_10119173 3300025949 Bacteria 2720
531 Ga0207667_10131630 3300025949 Bacteria 2577
532 Ga0207667_10299638 3300025949 Bacteria 1642
533 Ga0207667_10442623 3300025949 Bacteria 1321
534 Ga0207667_10791521 3300025949 Bacteria 945
535 Ga0207651_10455432 3300025960 Bacteria 1098
536 Ga0207651_11455789 3300025960 Bacteria 617
537 Ga0207712_10000996 3300025961 Bacteria 20182
538 Ga0207640_10302371 3300025981 Bacteria 1266
539 Ga0207640_11340088 3300025981 Bacteria 640
540 Ga0207677_10405520 3300026023 Bacteria 1157
541 Ga0207703_11652650 3300026035 Unclassified 616
542 Ga0207639_10009142 3300026041 Bacteria 6830
543 Ga0207639_10032059 3300026041 Bacteria 3866
544 Ga0207639_10426897 3300026041 Bacteria 1199
545 Ga0207639_10888708 3300026041 Bacteria 832
546 Ga0207639_11333241 3300026041 Bacteria 673
547 Ga0207678_10036233 3300026067 Bacteria 4294
548 Ga0207678_10043031 3300026067 Bacteria 3909
549 Ga0207678_11857996 3300026067 Unclassified 526
550 Ga0207708_10050718 3300026075 Bacteria 3159
551 Ga0207708_10390650 3300026075 Unclassified 1148
552 Ga0207702_10000393 3300026078 Bacteria 49888
553 Ga0207702_10024780 3300026078 Bacteria 4978
554 Ga0207702_10025453 3300026078 Bacteria 4911
555 Ga0207702_10160383 3300026078 Bacteria 2053
556 Ga0207702_10366132 3300026078 Bacteria 1383
557 Ga0207702_10723120 3300026078 Bacteria 982
558 Ga0207702_10983603 3300026078 Bacteria 837
559 Ga0207641_10000921 3300026088 Bacteria 30349
560 Ga0207641_10006712 3300026088 Bacteria 9643
561 Ga0207641_10134800 3300026088 Bacteria 2221
562 Ga0207676_10107576 3300026095 Bacteria 2326
563 Ga0207676_10151573 3300026095 Bacteria 1997
564 Ga0207676_10527523 3300026095 Bacteria 1125
565 Ga0207674_10033030 3300026116 Bacteria 5422
566 Ga0207674_10294529 3300026116 Bacteria 1571
567 Ga0207674_10315315 3300026116 Bacteria 1513
568 Ga0207674_10691179 3300026116 Bacteria 985
569 Ga0207674_11339584 3300026116 Bacteria 685
570 Ga0207675_100415340 3300026118 Bacteria 1328
571 Ga0207683_10045818 3300026121 Bacteria 3825
572 Ga0207683_10245967 3300026121 Bacteria 1632
573 Ga0207698_10004007 3300026142 Bacteria 8935
574 Ga0207698_10261173 3300026142 Bacteria 1591
575 Ga0207698_10370536 3300026142 Bacteria 1359
576 Ga0207698_10618797 3300026142 Bacteria 1069
577 Ga0207698_10991631 3300026142 Bacteria 850
578 Ga0207428_10137447 3300027907 Bacteria 1868
579 Ga0268266_10000037 3300028379 Bacteria 342368
580 Ga0268265_10222960 3300028380 Bacteria 1651
581 Ga0265334_10057213 3300028573 Unclassified 1478
582 Ga0307517_10001881 3300028786 Bacteria 34355
583 Ga0307515_10000790 3300028794 Bacteria 72891
584 Ga0307515_10001565 3300028794 Bacteria 51101
585 Ga0307515_10062818 3300028794 Bacteria 5235
586 Ga0307515_10068910 3300028794 Bacteria 4849
587 Ga0307515_10093363 3300028794 Bacteria 3732
588 Ga0307515_10357702 3300028794 Bacteria 1103
589 Ga0265338_10010649 3300028800 Bacteria 10749
590 Ga0265338_10153395 3300028800 Bacteria 1787
591 Ga0265338_10448333 3300028800 Bacteria 914
592 Ga0265338_10514341 3300028800 Bacteria 842
593 Ga0265324_10169631 3300029957 Unclassified 741
594 Ga0316176_1014596 3300030732 Bacteria 15075
595 Ga0316183_1016718 3300030742 Bacteria 50913
596 Ga0316181_1091070 3300030744 Bacteria 11978
597 Ga0316181_1124067 3300030744 Bacteria 828
598 Ga0316182_1148669 3300030745 Bacteria 3273
599 Ga0265320_10223651 3300031240 Unclassified 838
600 Ga0265327_10083579 3300031251 Bacteria 1571
601 Ga0307509_10011471 3300031507 Bacteria 10720
602 Ga0307509_10373643 3300031507 Bacteria 1141
603 Ga0307408_100000628 3300031548 Bacteria 29832
604 Ga0307408_100001834 3300031548 Bacteria 15479
605 Ga0307408_100016380 3300031548 Bacteria 4946
606 Ga0307408_101940426 3300031548 Bacteria 565
607 Ga0316576_10901982 3300031727 Bacteria 633
608 Ga0316576_11033852 3300031727 Bacteria 584
609 Ga0307516_10573588 3300031730 Bacteria 782
610 Ga0307405_10000016 3300031731 Bacteria 197180
611 Ga0307405_10009259 3300031731 Bacteria 5040
612 Ga0307405_10113301 3300031731 Bacteria 1841
613 Ga0307405_10611843 3300031731 Bacteria 891
614 Ga0307405_11446311 3300031731 Bacteria 602
615 Ga0307413_10905632 3300031824 Unclassified 749
616 Ga0307410_10337270 3300031852 Unclassified 1201
617 Ga0307406_10800139 3300031901 Bacteria 795
618 Ga0307407_10000006 3300031903 Bacteria 218714
619 Ga0307412_10000001 3300031911 Bacteria 822691
620 Ga0307412_10001942 3300031911 Bacteria 11437
621 Ga0307412_10034482 3300031911 Bacteria 3225
622 Ga0307412_10203138 3300031911 Bacteria 1506
623 Ga0307412_10441980 3300031911 Bacteria 1069
624 Ga0307412_10690848 3300031911 Bacteria 875
625 Ga0307412_10943005 3300031911 Bacteria 759
626 Ga0307416_100000032 3300032002 Bacteria 156777
627 Ga0307416_100060854 3300032002 Bacteria 3078
628 Ga0307414_10000268 3300032004 Bacteria 32688
629 Ga0307414_10005701 3300032004 Bacteria 6877
630 Ga0307414_10021383 3300032004 Bacteria 4058
631 Ga0307414_10040328 3300032004 Bacteria 3153
632 Ga0307414_10055952 3300032004 Bacteria 2764
633 Ga0307414_10092095 3300032004 Bacteria 2255
634 Ga0307414_10092129 3300032004 Bacteria 2255
635 Ga0307414_10190811 3300032004 Bacteria 1658
636 Ga0307414_11508851 3300032004 Bacteria 625
637 Ga0307414_11795324 3300032004 Bacteria 572
638 Ga0307414_11881010 3300032004 Bacteria 558
639 Ga0307411_10066871 3300032005 Bacteria 2416
640 Ga0307411_11764727 3300032005 Bacteria 574
641 Ga0307411_11798467 3300032005 Bacteria 569
642 Ga0307415_100221734 3300032126 Bacteria 1516
643 Ga0307507_10000143 3300033179 Bacteria 124248
644 Ga0307510_10000149 3300033180 Bacteria 58176
645 Ga0373941_0109536 3300035115 Bacteria 972
646 Ga0373927_0153063 3300035695 Bacteria 1510
647 Ga0373937_0989888 3300036401 Bacteria 790
648 Ga0316584_0231279 3300036712 Bacteria 1355
649 Ga0373925_1418411 3300037068 Bacteria 569
650 Ga0395899_0000017 3300037312 Bacteria 440179
651 Ga0395899_0000152 3300037312 Bacteria 105233
652 Ga0395899_0003831 3300037312 Bacteria 11870
653 Ga0395899_0277394 3300037312 Bacteria 1141
654 Ga0395900_0000523 3300037418 Bacteria 54244
655 Ga0395900_0005417 3300037418 Bacteria 13369
656 Ga0395900_0005978 3300037418 Bacteria 12706
657 Ga0395900_0105004 3300037418 Bacteria 2902
658 Ga0395900_0163666 3300037418 Unclassified 2268
659 Ga0395900_0240627 3300037418 Bacteria 1816
660 Ga0395900_1915307 3300037418 Bacteria 503
661 Ga0395898_0003563 3300037466 Bacteria 17360
662 Ga0395898_0075703 3300037466 Bacteria 3251
663 Ga0395898_0127076 3300037466 Bacteria 2442
664 Ga0395905_0006175 3300037471 Bacteria 12096
665 Ga0395905_0007055 3300037471 Bacteria 11229
666 Ga0395905_0183951 3300037471 Bacteria 1962
667 Ga0395901_0007492 3300038443 Bacteria 11024
668 Ga0395901_0013621 3300038443 Bacteria 8268
669 Ga0395901_0018348 3300038443 Bacteria 7143
670 Ga0395901_0113245 3300038443 Bacteria 2849
671 Ga0400484_43947 3300038725 Bacteria 2058
672 Ga0400483_044221 3300039062 Bacteria 1788
673 Ga0400483_062433 3300039062 Bacteria 2378
674 Ga0400483_112494 3300039062 Unclassified 1136
675 Ga0436365_1929414 3300039437 Bacteria 3775
676 Ga0436361_0569017 3300039447 Bacteria 988
677 Ga0439436_0000241 3300041404 Bacteria 13168
678 Ga0439439_0020088 3300041406 Bacteria 1659
679 Ga0451793_0438499 3300041452 Bacteria 701
680 Ga0451793_0959079 3300041452 Bacteria 586
681 Ga0451793_1840194 3300041452 Bacteria 953
682 Ga0451797_1031175 3300041453 Bacteria 505
683 Ga0451798_1146370 3300041458 Bacteria 652
684 Ga0451800_0026029 3300041459 Bacteria 701
685 Ga0451802_0608812 3300041460 Bacteria 690
686 Ga0451807_2157009 3300041486 Bacteria 854
687 Ga0451835_0814727 3300041492 Bacteria 575
688 Ga0451837_0878129 3300041494 Unclassified 661
689 Ga0451841_1117568 3300041498 Bacteria 518
690 Ga0451841_1304691 3300041498 Unclassified 606
691 Ga0439433_0196967 3300041999 Bacteria 531
692 Ga0439449_0068234 3300042007 Bacteria 1311
693 Ga0439455_0121192 3300042012 Bacteria 733
694 Ga0439457_000013 3300042014 Bacteria 36480
695 Ga0439462_0100615 3300042015 Bacteria 797
696 Ga0450923_011295 3300042125 Bacteria 1603
697 Ga0439435_0074984 3300042436 Bacteria 1007
698 Ga0451577_0901215 3300042876 Unclassified 796
699 Ga0466969_0152231 3300044656 Bacteria 1065
700 Ga0466972_0000263 3300044658 Bacteria 33957
701 Ga0453683_0003606 3300044673 Bacteria 11363
702 Ga0453683_0461515 3300044673 Bacteria 822
703 Ga0466966_0081289 3300044684 Bacteria 2017
704 Ga0466966_1003400 3300044684 Bacteria 504
705 Ga0466961_0082976 3300044693 Bacteria 2027
706 Ga0466961_0333376 3300044693 Bacteria 924
707 Ga0453684_0009201 3300044712 Bacteria 17361
708 Ga0453684_0080844 3300044712 Bacteria 4056
709 Ga0466959_0073994 3300045049 Bacteria 2464
710 Ga0451576_0000008 3300045051 Bacteria 746156
711 Ga0466958_0012340 3300045836 Bacteria 4839
712 Ga0495638_0145207 3300046460 Bacteria 1381
713 Ga0495638_0213000 3300046460 Bacteria 1084
714 Ga0495638_0593081 3300046460 Bacteria 545
715 Ga0495651_0077080 3300046462 Bacteria 2524
716 Ga0495650_0000095 3300046471 Bacteria 218020
717 Ga0495650_0271739 3300046471 Bacteria 572
718 Ga0495650_0335285 3300046471 Bacteria 502
719 Ga0495585_0000057 3300046492 Bacteria 113069
720 Ga0495585_0000648 3300046492 Bacteria 31937
721 Ga0495596_0025532 3300046500 Bacteria 2388
722 Ga0495607_0167770 3300046501 Bacteria 1111
723 Ga0495583_0029680 3300046506 Bacteria 2673
724 Ga0495583_0072998 3300046506 Bacteria 1505
725 Ga0495583_0256669 3300046506 Bacteria 700
726 Ga0495606_0000009 3300046507 Bacteria 306313
727 Ga0495606_0007717 3300046507 Bacteria 9530
728 Ga0495606_0011706 3300046507 Bacteria 7121
729 Ga0495606_0026272 3300046507 Bacteria 4152
730 Ga0495606_0031758 3300046507 Bacteria 3667
731 Ga0495606_0061425 3300046507 Bacteria 2403
732 Ga0495606_0603678 3300046507 Bacteria 538
733 Ga0495610_0000231 3300046512 Bacteria 59540
734 Ga0495610_0000237 3300046512 Bacteria 57952
735 Ga0495610_0001711 3300046512 Bacteria 19236
736 Ga0495610_0149922 3300046512 Bacteria 996
737 Ga0495616_0000733 3300046513 Bacteria 24135
738 Ga0495616_0006705 3300046513 Bacteria 6948
739 Ga0495631_0016934 3300046518 Bacteria 3458
740 Ga0495632_0131408 3300046519 Bacteria 1165
741 Ga0495637_0092864 3300046520 Bacteria 1188
742 Ga0495643_0276495 3300046522 Bacteria 774
743 Ga0495644_0021868 3300046523 Bacteria 2438
744 Ga0495648_0005462 3300046524 Bacteria 10551
745 Ga0495648_0018322 3300046524 Bacteria 4963
746 Ga0495652_0090697 3300046529 Bacteria 2500
747 Ga0495652_0466530 3300046529 Bacteria 881
748 Ga0495652_0541635 3300046529 Bacteria 801
749 Ga0495654_0246215 3300046530 Bacteria 746
750 Ga0495609_0007538 3300046538 Bacteria 5416
751 Ga0495609_0011292 3300046538 Bacteria 4258
752 Ga0495609_0036324 3300046538 Bacteria 2225
753 Ga0495609_0247295 3300046538 Bacteria 735
754 Ga0495633_0000275 3300046558 Bacteria 60032
755 Ga0495633_0006218 3300046558 Bacteria 7130
756 Ga0495633_0203951 3300046558 Bacteria 907
757 Ga0495668_0000017 3300046616 Bacteria 434025
758 Ga0495668_0096233 3300046616 Bacteria 1620
759 Ga0495634_0617640 3300046642 Bacteria 628
760 Ga0495625_0000007 3300046660 Bacteria 565749
761 Ga0495625_0000901 3300046660 Bacteria 39985
762 Ga0495625_0001789 3300046660 Bacteria 24694
763 Ga0495625_0003096 3300046660 Bacteria 16990
764 Ga0495625_0052422 3300046660 Bacteria 2921
765 Ga0495625_0248723 3300046660 Bacteria 1155
766 Ga0495625_0403762 3300046660 Bacteria 853
767 Ga0495661_0000576 3300046665 Bacteria 38166
768 Ga0495661_0004014 3300046665 Bacteria 10726
769 Ga0495661_0063777 3300046665 Bacteria 2177
770 Ga0495661_0209276 3300046665 Bacteria 1016
771 Ga0495661_0343171 3300046665 Bacteria 737
772 Ga0495658_0116785 3300046683 Unclassified 1610
773 Ga0495669_0375434 3300046684 Bacteria 688
774 Ga0495670_0337091 3300046691 Bacteria 811
775 Ga0495671_0026266 3300046692 Bacteria 3020
776 Ga0495649_0000007 3300046694 Bacteria 518037
777 Ga0495649_0582358 3300046694 Bacteria 553
778 Ga0495660_0009750 3300046810 Bacteria 5596
779 Ga0495683_0018342 3300047323 Bacteria 3619
780 Ga0495687_004966 3300047443 Bacteria 8698
781 Ga0495687_007879 3300047443 Bacteria 6195
782 Ga0495687_025474 3300047443 Bacteria 2795
783 Ga0495687_124607 3300047443 Bacteria 923
784 Ga0495677_0017891 3300047445 Unclassified 2569
785 Ga0495685_152589 3300047447 Bacteria 750
786 Ga0495673_0111947 3300047469 Bacteria 1090
787 Ga0495686_0000490 3300047472 Bacteria 58423
788 Ga0495686_0000729 3300047472 Bacteria 44005
789 Ga0495686_0017335 3300047472 Bacteria 4856
790 Ga0495686_0030106 3300047472 Bacteria 3528
791 Ga0495686_0152383 3300047472 Bacteria 1356
792 Ga0495686_0314448 3300047472 Bacteria 860
793 Ga0495602_1118268 3300048088 Bacteria 516
794 Ga0495614_0003480 3300048089 Bacteria 7048
795 Ga0496116_0000752 3300048919 Bacteria 41208
796 Ga0496117_0007456 3300048920 Bacteria 10680
797 Ga0496118_0051861 3300048921 Bacteria 3135
798 Ga0496122_0002421 3300048925 Bacteria 26557
799 Ga0496122_0003438 3300048925 Bacteria 20821
800 Ga0496123_0004076 3300048926 Bacteria 15730
801 Ga0496123_0020394 3300048926 Bacteria 5186
802 Ga0496125_0157196 3300048928 Bacteria 1551
803 Ga0496125_0321761 3300048928 Bacteria 937
804 Ga0495678_003805 3300049459 Bacteria 9099
805 Ga0495678_227887 3300049459 Bacteria 562
806 Ga0495682_0036521 3300049460 Bacteria 1809
807 Ga0501034_0297323 3300049571 Bacteria 1552
808 Ga0501043_0141142 3300049579 Bacteria 1887
809 Ga0501047_0124055 3300049581 Bacteria 2463
810 Ga0501047_0840617 3300049581 Bacteria 732
811 Ga0501048_0079904 3300049582 Bacteria 2308
812 Ga0501202_111142 3300049652 Bacteria 678
813 Ga0501223_001696 3300049663 Bacteria 5042
814 Ga0501223_148475 3300049663 Bacteria 508
815 Ga0501233_096179 3300049668 Bacteria 778
816 Ga0501240_000352 3300049673 Bacteria 3635
817 Ga0501225_0000569 3300049705 Bacteria 11570
818 Ga0501225_0283472 3300049705 Bacteria 556
819 Ga0501241_002026 3300049758 Bacteria 3973
820 Ga0501241_080470 3300049758 Bacteria 677
821 Ga0501035_0622157 3300049822 Bacteria 878
822 Ga0501044_0026588 3300049823 Bacteria 6125
823 nmdc:mga00v17_798549_c1 3300050491 Bacteria 601
824 nmdc:mga0k408_14935_c1 3300050493 Bacteria 1752
825 nmdc:mga0k408_151_c2 3300050493 Bacteria 30883
826 nmdc:mga0k408_54405_c2 3300050493 Bacteria 795
827 nmdc:mga0k408_63_c1 3300050493 Bacteria 52809
828 nmdc:mga0k408_661349_c1 3300050493 Bacteria 614
829 nmdc:mga07m45_671441_c1 3300050496 Bacteria 597
830 nmdc:mga09592_22801_c1 3300050508 Bacteria 5165
831 nmdc:mga0qj67_216843_c1 3300050509 Bacteria 1554
832 nmdc:mga06r32_103002_c1 3300050510 Bacteria 2802
833 nmdc:mga08y16_53088_c1 3300050511 Bacteria 4239
834 Ga0500635_0000719 3300053080 Bacteria 8328
835 Ga0500578_0000010 3300053086 Bacteria 217642
836 Ga0500583_0000064 3300053092 Bacteria 66001
837 Ga0500583_0006250 3300053092 Bacteria 4080
838 Ga0500651_0001193 3300053093 Bacteria 12892
839 Ga0500608_000322 3300053122 Bacteria 18338
840 Ga0500608_004236 3300053122 Bacteria 5524
841 Ga0500618_000033 3300053125 Bacteria 121886
842 Ga0500618_008791 3300053125 Bacteria 2793
843 Ga0500564_198995 3300053138 Bacteria 824
844 Ga0500568_0178919 3300053139 Bacteria 780
845 Ga0500579_227616 3300053143 Bacteria 639
846 Ga0500616_0154423 3300053153 Unclassified 1059
847 Ga0500616_0198835 3300053153 Bacteria 889
848 Ga0500619_181841 3300053154 Bacteria 710
849 Ga0500622_0000417 3300053156 Bacteria 40427
850 Ga0500622_0148758 3300053156 Bacteria 1109
851 Ga0500624_000447 3300053157 Bacteria 12407
852 Ga0500637_0377270 3300053178 Bacteria 745
853 Ga0500611_000019 3300053727 Bacteria 110161
854 Ga0500611_086330 3300053727 Bacteria 791
855 Ga0500587_033546 3300053739 Bacteria 714

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005468 Ga0070707_102130360 Ga0070707_1021303601 107
2 3300042876 Ga0451577_0901215 Ga0451577_0901215_126_452 107
3 3300044712 Ga0453684_0009201 Ga0453684_0009201_9892_10218 107
4 2162886007 SwRhRL2b_contig_2255685 SwRhRL2b_0652.00005760 108
5 3300001904 JGI24736J21556_1003173 JGI24736J21556_10031733 108
6 3300001979 JGI24740J21852_10005973 JGI24740J21852_100059734 108
7 3300001979 JGI24740J21852_10022379 JGI24740J21852_100223792 108
8 3300001989 JGI24739J22299_10002187 JGI24739J22299_100021871 108
9 3300001989 JGI24739J22299_10061220 JGI24739J22299_100612202 108
10 3300001990 JGI24737J22298_10000148 JGI24737J22298_1000014824 108
11 3300001990 JGI24737J22298_10096935 JGI24737J22298_100969351 108
12 3300002067 JGI24735J21928_10000020 JGI24735J21928_1000002036 108
13 3300002077 JGI24744J21845_10002386 JGI24744J21845_100023864 108
14 3300002459 JGI24751J29686_10035279 JGI24751J29686_100352792 108
15 3300002737 JGI25162J39368_1000097 JGI25162J39368_100009773 108
16 3300002741 JGI25157J39369_1012814 JGI25157J39369_10128142 108
17 3300002741 JGI25157J39369_1020846 JGI25157J39369_10208462 108
18 3300002741 JGI25157J39369_1023041 JGI25157J39369_10230411 108
19 3300002773 JGI25152J39213_1000007 JGI25152J39213_100000780 108
20 3300002773 JGI25152J39213_1024763 JGI25152J39213_10247631 108
21 3300002774 JGI25150J39212_1000013 JGI25150J39212_1000013104 108
22 3300003187 JGI25151J46595_10000004 JGI25151J46595_1000000466 108
23 3300003214 JGI25165J46597_1000733 JGI25165J46597_10007337 108
24 3300003215 JGI25153J46596_10000004 JGI25153J46596_1000000466 108
25 3300003316 rootH1_10101964 rootH1_101019645 108
26 3300003316 rootH1_10188452 rootH1_101884522 108
27 3300003320 rootH2_10009716 rootH2_100097169 108
28 3300003320 rootH2_10033863 rootH2_1003386310 108
29 3300003320 rootH2_10326475 rootH2_103264753 108
30 3300003322 rootL2_10029081 rootL2_100290812 108
31 3300003323 rootH1_10010071 rootH1_100100711 108
32 3300003323 rootH1_10025651 rootH1_100256512 108
33 3300003323 rootH1_10033417 rootH1_1003341718 108
34 3300003323 rootH1_10173204 rootH1_101732043 108
35 3300003323 rootH1_10306878 rootH1_103068783 108
36 3300003781 Ga0055536_1000010 Ga0055536_1000010177 108
37 3300003791 Ga0055530_10001623 Ga0055530_100016235 108
38 3300004799 Ga0058863_11194942 Ga0058863_111949422 108
39 3300005262 Ga0065165_1000242 Ga0065165_100024231 108
40 3300005288 Ga0065714_10003722 Ga0065714_1000372212 108
41 3300005288 Ga0065714_10004493 Ga0065714_100044934 108
42 3300005288 Ga0065714_10007828 Ga0065714_100078285 108
43 3300005288 Ga0065714_10064539 Ga0065714_1006453931 108
44 3300005288 Ga0065714_10079275 Ga0065714_100792753 108
45 3300005288 Ga0065714_10095945 Ga0065714_100959453 108
46 3300005288 Ga0065714_10106485 Ga0065714_101064853 108
47 3300005288 Ga0065714_10144326 Ga0065714_101443263 108
48 3300005288 Ga0065714_10182988 Ga0065714_101829882 108
49 3300005288 Ga0065714_10207420 Ga0065714_102074202 108
50 3300005288 Ga0065714_10288119 Ga0065714_102881191 108
51 3300005288 Ga0065714_10296100 Ga0065714_102961002 108
52 3300005289 Ga0065704_10000425 Ga0065704_1000042511 108
53 3300005289 Ga0065704_10001986 Ga0065704_100019864 108
54 3300005289 Ga0065704_10099600 Ga0065704_100996002 108
55 3300005289 Ga0065704_10145283 Ga0065704_101452832 108
56 3300005289 Ga0065704_10165409 Ga0065704_101654092 108
57 3300005289 Ga0065704_10327887 Ga0065704_103278872 108
58 3300005289 Ga0065704_10330903 Ga0065704_103309032 108
59 3300005289 Ga0065704_10338441 Ga0065704_103384412 108
60 3300005289 Ga0065704_10523286 Ga0065704_105232862 108
61 3300005290 Ga0065712_10013478 Ga0065712_100134783 108
62 3300005290 Ga0065712_10179192 Ga0065712_101791922 108
63 3300005293 Ga0065715_10407233 Ga0065715_104072331 108
64 3300005295 Ga0065707_10352364 Ga0065707_103523641 108
65 3300005327 Ga0070658_10000069 Ga0070658_1000006956 108
66 3300005327 Ga0070658_10166418 Ga0070658_101664182 108
67 3300005327 Ga0070658_10221837 Ga0070658_102218373 108
68 3300005327 Ga0070658_10234638 Ga0070658_102346383 108
69 3300005327 Ga0070658_10290223 Ga0070658_102902233 108
70 3300005327 Ga0070658_10424427 Ga0070658_104244272 108
71 3300005327 Ga0070658_10728643 Ga0070658_107286432 108
72 3300005327 Ga0070658_11217883 Ga0070658_112178831 108
73 3300005327 Ga0070658_11677479 Ga0070658_116774791 108
74 3300005328 Ga0070676_10015301 Ga0070676_100153012 108
75 3300005328 Ga0070676_11076490 Ga0070676_110764901 108
76 3300005329 Ga0070683_100047754 Ga0070683_1000477544 108
77 3300005329 Ga0070683_100341934 Ga0070683_1003419342 108
78 3300005329 Ga0070683_100609271 Ga0070683_1006092713 108
79 3300005330 Ga0070690_100634055 Ga0070690_1006340552 108
80 3300005331 Ga0070670_100015918 Ga0070670_1000159183 108
81 3300005331 Ga0070670_100016570 Ga0070670_1000165704 108
82 3300005331 Ga0070670_100488402 Ga0070670_1004884022 108
83 3300005334 Ga0068869_100140331 Ga0068869_1001403313 108
84 3300005334 Ga0068869_100357028 Ga0068869_1003570283 108
85 3300005335 Ga0070666_10026579 Ga0070666_100265792 108
86 3300005336 Ga0070680_100002384 Ga0070680_1000023848 108
87 3300005336 Ga0070680_100019054 Ga0070680_1000190545 108
88 3300005336 Ga0070680_100598402 Ga0070680_1005984022 108
89 3300005337 Ga0070682_100308216 Ga0070682_1003082162 108
90 3300005339 Ga0070660_100046805 Ga0070660_1000468053 108
91 3300005339 Ga0070660_100175713 Ga0070660_1001757131 108
92 3300005339 Ga0070660_100933821 Ga0070660_1009338212 108
93 3300005339 Ga0070660_101009889 Ga0070660_1010098892 108
94 3300005343 Ga0070687_101213750 Ga0070687_1012137501 108
95 3300005347 Ga0070668_100629920 Ga0070668_1006299201 108
96 3300005353 Ga0070669_100028238 Ga0070669_1000282383 108
97 3300005354 Ga0070675_100907591 Ga0070675_1009075911 108
98 3300005364 Ga0070673_100103439 Ga0070673_1001034391 108
99 3300005366 Ga0070659_100002120 Ga0070659_1000021206 108
100 3300005366 Ga0070659_100009288 Ga0070659_1000092887 108
101 3300005366 Ga0070659_100435418 Ga0070659_1004354182 108
102 3300005366 Ga0070659_100807152 Ga0070659_1008071522 108
103 3300005366 Ga0070659_100997780 Ga0070659_1009977802 108
104 3300005367 Ga0070667_100585357 Ga0070667_1005853572 108
105 3300005367 Ga0070667_100834907 Ga0070667_1008349072 108
106 3300005435 Ga0070714_101534491 Ga0070714_1015344912 108
107 3300005438 Ga0070701_10086499 Ga0070701_100864992 108
108 3300005441 Ga0070700_100933211 Ga0070700_1009332112 108
109 3300005455 Ga0070663_100000935 Ga0070663_10000093512 108
110 3300005455 Ga0070663_100013113 Ga0070663_1000131133 108
111 3300005455 Ga0070663_101341462 Ga0070663_1013414621 108
112 3300005456 Ga0070678_100033628 Ga0070678_1000336282 108
113 3300005456 Ga0070678_100179802 Ga0070678_1001798021 108
114 3300005456 Ga0070678_100214102 Ga0070678_1002141023 108
115 3300005456 Ga0070678_100462079 Ga0070678_1004620791 108
116 3300005457 Ga0070662_100000186 Ga0070662_10000018612 108
117 3300005458 Ga0070681_10001937 Ga0070681_1000193713 108
118 3300005458 Ga0070681_10011702 Ga0070681_100117023 108
119 3300005459 Ga0068867_100944440 Ga0068867_1009444401 108
120 3300005459 Ga0068867_101136926 Ga0068867_1011369262 108
121 3300005459 Ga0068867_102382930 Ga0068867_1023829301 108
122 3300005466 Ga0070685_10013893 Ga0070685_100138932 108
123 3300005466 Ga0070685_11514227 Ga0070685_115142272 108
124 3300005471 Ga0070698_100004536 Ga0070698_10000453611 108
125 3300005471 Ga0070698_100025684 Ga0070698_1000256846 108
126 3300005471 Ga0070698_100047082 Ga0070698_1000470825 108
127 3300005518 Ga0070699_100544006 Ga0070699_1005440062 108
128 3300005530 Ga0070679_100022402 Ga0070679_1000224023 108
129 3300005530 Ga0070679_100045254 Ga0070679_1000452543 108
130 3300005530 Ga0070679_101368628 Ga0070679_1013686281 108
131 3300005530 Ga0070679_101440123 Ga0070679_1014401231 108
132 3300005535 Ga0070684_100073584 Ga0070684_1000735844 108
133 3300005535 Ga0070684_100151743 Ga0070684_1001517432 108
134 3300005539 Ga0068853_100010772 Ga0068853_1000107722 108
135 3300005539 Ga0068853_100031056 Ga0068853_1000310561 108
136 3300005539 Ga0068853_100222314 Ga0068853_1002223142 108
137 3300005539 Ga0068853_100266251 Ga0068853_1002662512 108
138 3300005539 Ga0068853_100505967 Ga0068853_1005059673 108
139 3300005543 Ga0070672_100208879 Ga0070672_1002088792 108
140 3300005544 Ga0070686_100398870 Ga0070686_1003988701 108
141 3300005547 Ga0070693_100800679 Ga0070693_1008006791 108
142 3300005548 Ga0070665_100000017 Ga0070665_10000001731 108
143 3300005549 Ga0070704_100128810 Ga0070704_1001288103 108
144 3300005563 Ga0068855_100000097 Ga0068855_10000009799 108
145 3300005563 Ga0068855_100002978 Ga0068855_10000297814 108
146 3300005563 Ga0068855_100004102 Ga0068855_10000410215 108
147 3300005563 Ga0068855_100004838 Ga0068855_1000048383 108
148 3300005563 Ga0068855_100010260 Ga0068855_1000102605 108
149 3300005563 Ga0068855_100069864 Ga0068855_1000698643 108
150 3300005563 Ga0068855_100142968 Ga0068855_1001429683 108
151 3300005563 Ga0068855_100205601 Ga0068855_1002056012 108
152 3300005563 Ga0068855_100395865 Ga0068855_1003958653 108
153 3300005563 Ga0068855_100565927 Ga0068855_1005659273 108
154 3300005563 Ga0068855_100584284 Ga0068855_1005842842 108
155 3300005563 Ga0068855_102044129 Ga0068855_1020441291 108
156 3300005577 Ga0068857_100018843 Ga0068857_1000188433 108
157 3300005577 Ga0068857_100074969 Ga0068857_1000749692 108
158 3300005577 Ga0068857_101277532 Ga0068857_1012775321 108
159 3300005578 Ga0068854_100089124 Ga0068854_1000891243 108
160 3300005578 Ga0068854_100584884 Ga0068854_1005848843 108
161 3300005578 Ga0068854_101467473 Ga0068854_1014674732 108
162 3300005614 Ga0068856_100002033 Ga0068856_1000020337 108
163 3300005614 Ga0068856_100031710 Ga0068856_1000317104 108
164 3300005614 Ga0068856_100034453 Ga0068856_1000344532 108
165 3300005614 Ga0068856_100175072 Ga0068856_1001750722 108
166 3300005614 Ga0068856_100235576 Ga0068856_1002355762 108
167 3300005614 Ga0068856_100690324 Ga0068856_1006903242 108
168 3300005614 Ga0068856_100847530 Ga0068856_1008475301 108
169 3300005616 Ga0068852_100004339 Ga0068852_1000043397 108
170 3300005616 Ga0068852_100139242 Ga0068852_1001392423 108
171 3300005616 Ga0068852_100292007 Ga0068852_1002920073 108
172 3300005616 Ga0068852_100406560 Ga0068852_1004065602 108
173 3300005616 Ga0068852_100527505 Ga0068852_1005275053 108
174 3300005617 Ga0068859_100575015 Ga0068859_1005750153 108
175 3300005617 Ga0068859_100926697 Ga0068859_1009266972 108
176 3300005618 Ga0068864_100275801 Ga0068864_1002758012 108
177 3300005718 Ga0068866_10172933 Ga0068866_101729332 108
178 3300005719 Ga0068861_100641982 Ga0068861_1006419822 108
179 3300005834 Ga0068851_10100792 Ga0068851_101007922 108
180 3300005840 Ga0068870_10008407 Ga0068870_100084072 108
181 3300005840 Ga0068870_10053771 Ga0068870_100537712 108
182 3300005841 Ga0068863_100006021 Ga0068863_1000060218 108
183 3300005841 Ga0068863_101518848 Ga0068863_1015188482 108
184 3300005841 Ga0068863_102358584 Ga0068863_1023585841 108
185 3300005842 Ga0068858_100088087 Ga0068858_1000880871 108
186 3300005843 Ga0068860_100203625 Ga0068860_1002036252 108
187 3300005843 Ga0068860_101052101 Ga0068860_1010521012 108
188 3300005843 Ga0068860_101521787 Ga0068860_1015217871 108
189 3300005844 Ga0068862_101486114 Ga0068862_1014861142 108
190 3300006051 Ga0075364_10900231 Ga0075364_109002311 108
191 3300006195 Ga0075366_10000677 Ga0075366_100006778 108
192 3300006195 Ga0075366_10000881 Ga0075366_1000088112 108
193 3300006195 Ga0075366_10282480 Ga0075366_102824802 108
194 3300006195 Ga0075366_10529193 Ga0075366_105291932 108
195 3300006195 Ga0075366_10728705 Ga0075366_107287051 108
196 3300006237 Ga0097621_100000721 Ga0097621_1000007212 108
197 3300006237 Ga0097621_100135308 Ga0097621_1001353082 108
198 3300006237 Ga0097621_102421369 Ga0097621_1024213691 108
199 3300006358 Ga0068871_100000286 Ga0068871_10000028610 108
200 3300006358 Ga0068871_100045860 Ga0068871_1000458603 108
201 3300006358 Ga0068871_100639105 Ga0068871_1006391052 108
202 3300006358 Ga0068871_100779492 Ga0068871_1007794922 108
203 3300006844 Ga0075428_100027330 Ga0075428_1000273307 108
204 3300006846 Ga0075430_100072163 Ga0075430_1000721634 108
205 3300006847 Ga0075431_100212027 Ga0075431_1002120273 108
206 3300006880 Ga0075429_100000533 Ga0075429_10000053313 108
207 3300006881 Ga0068865_100001165 Ga0068865_1000011659 108
208 3300006881 Ga0068865_101162804 Ga0068865_1011628042 108
209 3300006931 Ga0097620_100575011 Ga0097620_1005750113 108
210 3300006931 Ga0097620_100926802 Ga0097620_1009268022 108
211 3300009036 Ga0105244_10007635 Ga0105244_100076355 108
212 3300009093 Ga0105240_10000321 Ga0105240_1000032179 108
213 3300009093 Ga0105240_10009251 Ga0105240_100092512 108
214 3300009093 Ga0105240_10028247 Ga0105240_100282474 108
215 3300009093 Ga0105240_10041945 Ga0105240_100419452 108
216 3300009093 Ga0105240_10062828 Ga0105240_100628285 108
217 3300009093 Ga0105240_10094107 Ga0105240_100941072 108
218 3300009093 Ga0105240_10401169 Ga0105240_104011692 108
219 3300009093 Ga0105240_10469361 Ga0105240_104693612 108
220 3300009093 Ga0105240_10474945 Ga0105240_104749452 108
221 3300009093 Ga0105240_10560177 Ga0105240_105601772 108
222 3300009093 Ga0105240_10657839 Ga0105240_106578393 108
223 3300009093 Ga0105240_10833796 Ga0105240_108337962 108
224 3300009093 Ga0105240_10860639 Ga0105240_108606392 108
225 3300009093 Ga0105240_10904277 Ga0105240_109042772 108
226 3300009093 Ga0105240_11168744 Ga0105240_111687442 108
227 3300009094 Ga0111539_10156186 Ga0111539_101561863 108
228 3300009094 Ga0111539_10410593 Ga0111539_104105932 108
229 3300009094 Ga0111539_10578160 Ga0111539_105781601 108
230 3300009101 Ga0105247_10546750 Ga0105247_105467502 108
231 3300009148 Ga0105243_10000009 Ga0105243_10000009122 108
232 3300009148 Ga0105243_10078741 Ga0105243_100787413 108
233 3300009148 Ga0105243_10904777 Ga0105243_109047772 108
234 3300009174 Ga0105241_10001000 Ga0105241_100010008 108
235 3300009174 Ga0105241_10019786 Ga0105241_100197863 108
236 3300009174 Ga0105241_10065816 Ga0105241_100658162 108
237 3300009174 Ga0105241_10069375 Ga0105241_100693753 108
238 3300009174 Ga0105241_10103649 Ga0105241_101036492 108
239 3300009174 Ga0105241_10143974 Ga0105241_101439743 108
240 3300009174 Ga0105241_10412157 Ga0105241_104121571 108
241 3300009174 Ga0105241_10932225 Ga0105241_109322252 108
242 3300009174 Ga0105241_11255738 Ga0105241_112557382 108
243 3300009174 Ga0105241_12219969 Ga0105241_122199691 108
244 3300009176 Ga0105242_10015750 Ga0105242_100157505 108
245 3300009176 Ga0105242_10053939 Ga0105242_100539395 108
246 3300009176 Ga0105242_10105159 Ga0105242_101051595 108
247 3300009176 Ga0105242_10213428 Ga0105242_102134283 108
248 3300009177 Ga0105248_10607974 Ga0105248_106079743 108
249 3300009545 Ga0105237_10000273 Ga0105237_1000027313 108
250 3300009545 Ga0105237_10002591 Ga0105237_1000259115 108
251 3300009545 Ga0105237_10003787 Ga0105237_100037871 108
252 3300009545 Ga0105237_10004463 Ga0105237_1000446312 108
253 3300009545 Ga0105237_10012487 Ga0105237_1001248712 108
254 3300009545 Ga0105237_10032439 Ga0105237_100324393 108
255 3300009545 Ga0105237_10073968 Ga0105237_100739683 108
256 3300009545 Ga0105237_10099788 Ga0105237_100997883 108
257 3300009545 Ga0105237_10206971 Ga0105237_102069712 108
258 3300009545 Ga0105237_10282829 Ga0105237_102828292 108
259 3300009545 Ga0105237_10389243 Ga0105237_103892431 108
260 3300009545 Ga0105237_10467363 Ga0105237_104673633 108
261 3300009545 Ga0105237_10468588 Ga0105237_104685882 108
262 3300009545 Ga0105237_11124254 Ga0105237_111242542 108
263 3300009545 Ga0105237_12437185 Ga0105237_124371851 108
264 3300009551 Ga0105238_10038734 Ga0105238_100387345 108
265 3300009551 Ga0105238_10039673 Ga0105238_100396732 108
266 3300009551 Ga0105238_10183376 Ga0105238_101833763 108
267 3300009553 Ga0105249_10001688 Ga0105249_100016889 108
268 3300009553 Ga0105249_10036731 Ga0105249_100367311 108
269 3300010375 Ga0105239_10000014 Ga0105239_10000014127 108
270 3300010375 Ga0105239_10000017 Ga0105239_10000017157 108
271 3300010375 Ga0105239_10000821 Ga0105239_1000082141 108
272 3300010375 Ga0105239_10004179 Ga0105239_1000417913 108
273 3300010375 Ga0105239_10048085 Ga0105239_100480855 108
274 3300010375 Ga0105239_10057768 Ga0105239_100577682 108
275 3300010375 Ga0105239_10103179 Ga0105239_101031794 108
276 3300010375 Ga0105239_10149651 Ga0105239_101496513 108
277 3300010375 Ga0105239_10154879 Ga0105239_101548791 108
278 3300010375 Ga0105239_10161839 Ga0105239_101618393 108
279 3300010375 Ga0105239_10211873 Ga0105239_102118732 108
280 3300013100 Ga0157373_10001836 Ga0157373_1000183613 108
281 3300013100 Ga0157373_10001854 Ga0157373_100018549 108
282 3300013100 Ga0157373_10003628 Ga0157373_100036283 108
283 3300013100 Ga0157373_10021879 Ga0157373_100218792 108
284 3300013100 Ga0157373_10034944 Ga0157373_100349442 108
285 3300013100 Ga0157373_10222196 Ga0157373_102221962 108
286 3300013100 Ga0157373_10235937 Ga0157373_102359372 108
287 3300013100 Ga0157373_10787083 Ga0157373_107870832 108
288 3300013102 Ga0157371_10000046 Ga0157371_1000004635 108
289 3300013102 Ga0157371_10000297 Ga0157371_1000029755 108
290 3300013102 Ga0157371_10001025 Ga0157371_1000102529 108
291 3300013102 Ga0157371_10003077 Ga0157371_1000307714 108
292 3300013102 Ga0157371_10003113 Ga0157371_100031134 108
293 3300013102 Ga0157371_10005385 Ga0157371_1000538510 108
294 3300013102 Ga0157371_10010708 Ga0157371_100107087 108
295 3300013102 Ga0157371_10037682 Ga0157371_100376823 108
296 3300013102 Ga0157371_10061686 Ga0157371_100616862 108
297 3300013102 Ga0157371_10111119 Ga0157371_101111192 108
298 3300013102 Ga0157371_10142347 Ga0157371_101423471 108
299 3300013104 Ga0157370_10000083 Ga0157370_1000008347 108
300 3300013104 Ga0157370_10018511 Ga0157370_100185118 108
301 3300013104 Ga0157370_10047250 Ga0157370_100472504 108
302 3300013104 Ga0157370_10047550 Ga0157370_100475503 108
303 3300013104 Ga0157370_10053400 Ga0157370_100534002 108
304 3300013104 Ga0157370_10105045 Ga0157370_101050453 108
305 3300013104 Ga0157370_10114672 Ga0157370_101146722 108
306 3300013104 Ga0157370_10126475 Ga0157370_101264753 108
307 3300013104 Ga0157370_10252277 Ga0157370_102522772 108
308 3300013104 Ga0157370_10256429 Ga0157370_102564292 108
309 3300013104 Ga0157370_10294623 Ga0157370_102946233 108
310 3300013104 Ga0157370_10348251 Ga0157370_103482512 108
311 3300013104 Ga0157370_10556806 Ga0157370_105568062 108
312 3300013104 Ga0157370_10584156 Ga0157370_105841562 108
313 3300013104 Ga0157370_10745478 Ga0157370_107454782 108
314 3300013104 Ga0157370_11025745 Ga0157370_110257451 108
315 3300013104 Ga0157370_11089540 Ga0157370_110895402 108
316 3300013105 Ga0157369_10000046 Ga0157369_1000004640 108
317 3300013105 Ga0157369_10002452 Ga0157369_1000245210 108
318 3300013105 Ga0157369_10019838 Ga0157369_100198383 108
319 3300013105 Ga0157369_10055076 Ga0157369_100550763 108
320 3300013105 Ga0157369_10074716 Ga0157369_100747162 108
321 3300013105 Ga0157369_10088988 Ga0157369_100889883 108
322 3300013105 Ga0157369_10169448 Ga0157369_101694483 108
323 3300013105 Ga0157369_12641819 Ga0157369_126418191 108
324 3300013296 Ga0157374_10000825 Ga0157374_100008257 108
325 3300013296 Ga0157374_10037163 Ga0157374_100371632 108
326 3300013296 Ga0157374_10127344 Ga0157374_101273443 108
327 3300013296 Ga0157374_10160886 Ga0157374_101608864 108
328 3300013296 Ga0157374_10164065 Ga0157374_101640653 108
329 3300013296 Ga0157374_10378086 Ga0157374_103780862 108
330 3300013296 Ga0157374_10723705 Ga0157374_107237052 108
331 3300013296 Ga0157374_12291511 Ga0157374_122915111 108
332 3300013296 Ga0157374_12494883 Ga0157374_124948832 108
333 3300013297 Ga0157378_10034988 Ga0157378_100349883 108
334 3300013297 Ga0157378_10246623 Ga0157378_102466233 108
335 3300013297 Ga0157378_10409295 Ga0157378_104092952 108
336 3300013297 Ga0157378_10644044 Ga0157378_106440443 108
337 3300013297 Ga0157378_11023477 Ga0157378_110234771 108
338 3300013306 Ga0163162_10000026 Ga0163162_10000026128 108
339 3300013306 Ga0163162_10000037 Ga0163162_1000003769 108
340 3300013306 Ga0163162_10072237 Ga0163162_100722374 108
341 3300013306 Ga0163162_10081280 Ga0163162_100812803 108
342 3300013306 Ga0163162_10191782 Ga0163162_101917822 108
343 3300013306 Ga0163162_10470592 Ga0163162_104705922 108
344 3300013306 Ga0163162_10608139 Ga0163162_106081391 108
345 3300013306 Ga0163162_10801839 Ga0163162_108018392 108
346 3300013306 Ga0163162_10803863 Ga0163162_108038631 108
347 3300013307 Ga0157372_10000077 Ga0157372_1000007782 108
348 3300013307 Ga0157372_10001279 Ga0157372_1000127924 108
349 3300013307 Ga0157372_10002383 Ga0157372_100023833 108
350 3300013307 Ga0157372_10002480 Ga0157372_100024806 108
351 3300013307 Ga0157372_10004815 Ga0157372_1000481514 108
352 3300013307 Ga0157372_10084375 Ga0157372_100843754 108
353 3300013307 Ga0157372_10126973 Ga0157372_101269733 108
354 3300013307 Ga0157372_10326511 Ga0157372_103265112 108
355 3300013307 Ga0157372_12191984 Ga0157372_121919842 108
356 3300013307 Ga0157372_12408021 Ga0157372_124080212 108
357 3300013308 Ga0157375_10001605 Ga0157375_100016059 108
358 3300013308 Ga0157375_10172436 Ga0157375_101724363 108
359 3300013308 Ga0157375_10194609 Ga0157375_101946093 108
360 3300013308 Ga0157375_10240533 Ga0157375_102405333 108
361 3300013308 Ga0157375_10403132 Ga0157375_104031322 108
362 3300013308 Ga0157375_11323998 Ga0157375_113239982 108
363 3300013308 Ga0157375_12077672 Ga0157375_120776722 108
364 3300014325 Ga0163163_10000202 Ga0163163_1000020242 108
365 3300014325 Ga0163163_10018012 Ga0163163_100180124 108
366 3300014325 Ga0163163_10224910 Ga0163163_102249103 108
367 3300014325 Ga0163163_10948654 Ga0163163_109486542 108
368 3300014326 Ga0157380_10127483 Ga0157380_101274835 108
369 3300014326 Ga0157380_10558522 Ga0157380_105585222 108
370 3300014326 Ga0157380_12610189 Ga0157380_126101891 108
371 3300014497 Ga0182008_10000022 Ga0182008_1000002217 108
372 3300014497 Ga0182008_10000104 Ga0182008_1000010450 108
373 3300014497 Ga0182008_10000380 Ga0182008_100003802 108
374 3300014497 Ga0182008_10144077 Ga0182008_101440772 108
375 3300014497 Ga0182008_10648593 Ga0182008_106485931 108
376 3300014745 Ga0157377_10035480 Ga0157377_100354802 108
377 3300014745 Ga0157377_10882636 Ga0157377_108826362 108
378 3300014968 Ga0157379_10662826 Ga0157379_106628262 108
379 3300014968 Ga0157379_11882846 Ga0157379_118828461 108
380 3300014969 Ga0157376_10030698 Ga0157376_100306982 108
381 3300014969 Ga0157376_11163166 Ga0157376_111631662 108
382 3300014969 Ga0157376_12307526 Ga0157376_123075262 108
383 3300014969 Ga0157376_12744268 Ga0157376_127442681 108
384 3300015261 Ga0182006_1000132 Ga0182006_100013229 108
385 3300015261 Ga0182006_1000229 Ga0182006_100022935 108
386 3300015261 Ga0182006_1002331 Ga0182006_10023315 108
387 3300015261 Ga0182006_1003205 Ga0182006_10032055 108
388 3300015261 Ga0182006_1029102 Ga0182006_10291022 108
389 3300015262 Ga0182007_10000009 Ga0182007_10000009170 108
390 3300015262 Ga0182007_10002891 Ga0182007_100028913 108
391 3300015262 Ga0182007_10032142 Ga0182007_100321421 108
392 3300015262 Ga0182007_10124433 Ga0182007_101244331 108
393 3300015682 Ga0183373_1008 Ga0183373_1008206 108
394 3300017792 Ga0163161_10000537 Ga0163161_1000053714 108
395 3300017792 Ga0163161_10000787 Ga0163161_100007878 108
396 3300017792 Ga0163161_10000828 Ga0163161_100008286 108
397 3300017792 Ga0163161_10000991 Ga0163161_1000099113 108
398 3300017792 Ga0163161_10002797 Ga0163161_100027975 108
399 3300017792 Ga0163161_10087213 Ga0163161_100872133 108
400 3300017792 Ga0163161_10118989 Ga0163161_101189894 108
401 3300017792 Ga0163161_10212443 Ga0163161_102124432 108
402 3300017792 Ga0163161_10246083 Ga0163161_102460831 108
403 3300017792 Ga0163161_10507942 Ga0163161_105079422 108
404 3300017792 Ga0163161_11944884 Ga0163161_119448842 108
405 3300021361 Ga0213872_10163370 Ga0213872_101633701 108
406 3300025230 Ga0209563_120252 Ga0209563_1202522 108
407 3300025231 Ga0207427_100066 Ga0207427_10006692 108
408 3300025233 Ga0209437_100010 Ga0209437_100010207 108
409 3300025233 Ga0209437_100030 Ga0209437_10003032 108
410 3300025245 Ga0207425_1000008 Ga0207425_1000008366 108
411 3300025250 Ga0209026_1000246 Ga0209026_100024623 108
412 3300025250 Ga0209026_1003283 Ga0209026_10032834 108
413 3300025250 Ga0209026_1009476 Ga0209026_10094763 108
414 3300025258 Ga0209129_1000042 Ga0209129_1000042101 108
415 3300025258 Ga0209129_1012392 Ga0209129_10123923 108
416 3300025261 Ga0209233_1000017 Ga0209233_1000017220 108
417 3300025272 Ga0209455_1004736 Ga0209455_10047361 108
418 3300025292 Ga0209676_1000009 Ga0209676_1000009700 108
419 3300025292 Ga0209676_1000455 Ga0209676_100045535 108
420 3300025294 Ga0209025_1000020 Ga0209025_1000020366 108
421 3300025297 Ga0209758_1000022 Ga0209758_1000022366 108
422 3300025298 Ga0209050_1000103 Ga0209050_1000103172 108
423 3300025298 Ga0209050_1015302 Ga0209050_10153024 108
424 3300025315 Ga0207697_10078142 Ga0207697_100781421 108
425 3300025321 Ga0207656_10100263 Ga0207656_101002632 108
426 3300025893 Ga0207682_10054492 Ga0207682_100544923 108
427 3300025903 Ga0207680_10054144 Ga0207680_100541442 108
428 3300025904 Ga0207647_10000036 Ga0207647_1000003665 108
429 3300025904 Ga0207647_10003216 Ga0207647_100032169 108
430 3300025904 Ga0207647_10103722 Ga0207647_101037223 108
431 3300025904 Ga0207647_10136292 Ga0207647_101362921 108
432 3300025907 Ga0207645_10000767 Ga0207645_100007672 108
433 3300025907 Ga0207645_10003332 Ga0207645_100033322 108
434 3300025907 Ga0207645_10572707 Ga0207645_105727072 108
435 3300025908 Ga0207643_10026043 Ga0207643_100260434 108
436 3300025909 Ga0207705_10000032 Ga0207705_1000003236 108
437 3300025909 Ga0207705_10001474 Ga0207705_100014744 108
438 3300025909 Ga0207705_10188698 Ga0207705_101886983 108
439 3300025909 Ga0207705_10225853 Ga0207705_102258531 108
440 3300025909 Ga0207705_10267623 Ga0207705_102676232 108
441 3300025909 Ga0207705_10505920 Ga0207705_105059203 108
442 3300025909 Ga0207705_10708500 Ga0207705_107085002 108
443 3300025909 Ga0207705_10956507 Ga0207705_109565072 108
444 3300025911 Ga0207654_10001015 Ga0207654_100010151 108
445 3300025911 Ga0207654_10002954 Ga0207654_100029549 108
446 3300025911 Ga0207654_10034380 Ga0207654_100343802 108
447 3300025911 Ga0207654_10060455 Ga0207654_100604551 108
448 3300025911 Ga0207654_10062111 Ga0207654_100621112 108
449 3300025911 Ga0207654_10322657 Ga0207654_103226572 108
450 3300025912 Ga0207707_10008912 Ga0207707_100089128 108
451 3300025912 Ga0207707_10068540 Ga0207707_100685403 108
452 3300025913 Ga0207695_10000197 Ga0207695_10000197147 108
453 3300025913 Ga0207695_10002602 Ga0207695_100026026 108
454 3300025913 Ga0207695_10010598 Ga0207695_100105989 108
455 3300025913 Ga0207695_10030986 Ga0207695_100309866 108
456 3300025913 Ga0207695_10108796 Ga0207695_101087962 108
457 3300025913 Ga0207695_10170790 Ga0207695_101707902 108
458 3300025913 Ga0207695_10340202 Ga0207695_103402022 108
459 3300025913 Ga0207695_10408841 Ga0207695_104088412 108
460 3300025913 Ga0207695_11204636 Ga0207695_112046362 108
461 3300025913 Ga0207695_11225707 Ga0207695_112257072 108
462 3300025914 Ga0207671_10002335 Ga0207671_1000233520 108
463 3300025914 Ga0207671_10003413 Ga0207671_1000341311 108
464 3300025914 Ga0207671_10003709 Ga0207671_100037097 108
465 3300025914 Ga0207671_10004896 Ga0207671_100048964 108
466 3300025914 Ga0207671_10005952 Ga0207671_100059528 108
467 3300025914 Ga0207671_10008207 Ga0207671_100082073 108
468 3300025914 Ga0207671_10056958 Ga0207671_100569583 108
469 3300025914 Ga0207671_10084372 Ga0207671_100843723 108
470 3300025914 Ga0207671_10158702 Ga0207671_101587022 108
471 3300025914 Ga0207671_10173670 Ga0207671_101736702 108
472 3300025914 Ga0207671_10224633 Ga0207671_102246333 108
473 3300025914 Ga0207671_11360366 Ga0207671_113603661 108
474 3300025914 Ga0207671_11415044 Ga0207671_114150441 108
475 3300025917 Ga0207660_10014016 Ga0207660_100140163 108
476 3300025917 Ga0207660_10043586 Ga0207660_100435861 108
477 3300025917 Ga0207660_10533826 Ga0207660_105338262 108
478 3300025919 Ga0207657_10034473 Ga0207657_100344732 108
479 3300025919 Ga0207657_10053423 Ga0207657_100534231 108
480 3300025919 Ga0207657_10062996 Ga0207657_100629962 108
481 3300025920 Ga0207649_11254522 Ga0207649_112545221 108
482 3300025921 Ga0207652_10001233 Ga0207652_100012337 108
483 3300025921 Ga0207652_10015719 Ga0207652_100157194 108
484 3300025921 Ga0207652_11252657 Ga0207652_112526572 108
485 3300025921 Ga0207652_11265697 Ga0207652_112656971 108
486 3300025923 Ga0207681_10116112 Ga0207681_101161123 108
487 3300025924 Ga0207694_10016665 Ga0207694_100166652 108
488 3300025924 Ga0207694_10136571 Ga0207694_101365712 108
489 3300025924 Ga0207694_10330619 Ga0207694_103306193 108
490 3300025925 Ga0207650_10095911 Ga0207650_100959113 108
491 3300025925 Ga0207650_10098223 Ga0207650_100982232 108
492 3300025925 Ga0207650_10349327 Ga0207650_103493272 108
493 3300025925 Ga0207650_10420532 Ga0207650_104205321 108
494 3300025926 Ga0207659_10190700 Ga0207659_101907002 108
495 3300025926 Ga0207659_10321999 Ga0207659_103219992 108
496 3300025926 Ga0207659_10555139 Ga0207659_105551392 108
497 3300025931 Ga0207644_10040413 Ga0207644_100404133 108
498 3300025931 Ga0207644_11152371 Ga0207644_111523712 108
499 3300025932 Ga0207690_10001817 Ga0207690_100018178 108
500 3300025932 Ga0207690_10123456 Ga0207690_101234563 108
501 3300025932 Ga0207690_10173588 Ga0207690_101735882 108
502 3300025932 Ga0207690_10402879 Ga0207690_104028792 108
503 3300025932 Ga0207690_10766008 Ga0207690_107660081 108
504 3300025933 Ga0207706_10000125 Ga0207706_1000012546 108
505 3300025933 Ga0207706_10360774 Ga0207706_103607741 108
506 3300025934 Ga0207686_10000200 Ga0207686_1000020022 108
507 3300025934 Ga0207686_10149977 Ga0207686_101499773 108
508 3300025934 Ga0207686_10300646 Ga0207686_103006462 108
509 3300025934 Ga0207686_11406667 Ga0207686_114066671 108
510 3300025934 Ga0207686_11582637 Ga0207686_115826371 108
511 3300025934 Ga0207686_11647555 Ga0207686_116475551 108
512 3300025935 Ga0207709_10000026 Ga0207709_10000026123 108
513 3300025935 Ga0207709_10407892 Ga0207709_104078922 108
514 3300025936 Ga0207670_10485388 Ga0207670_104853882 108
515 3300025937 Ga0207669_10371145 Ga0207669_103711452 108
516 3300025938 Ga0207704_10000043 Ga0207704_1000004352 108
517 3300025938 Ga0207704_10115091 Ga0207704_101150912 108
518 3300025939 Ga0207665_11526006 Ga0207665_115260061 108
519 3300025940 Ga0207691_10013724 Ga0207691_1001372410 108
520 3300025940 Ga0207691_10072530 Ga0207691_100725302 108
521 3300025940 Ga0207691_10210766 Ga0207691_102107662 108
522 3300025942 Ga0207689_10035388 Ga0207689_100353882 108
523 3300025942 Ga0207689_10106695 Ga0207689_101066953 108
524 3300025942 Ga0207689_11751437 Ga0207689_117514371 108
525 3300025944 Ga0207661_10047813 Ga0207661_100478134 108
526 3300025944 Ga0207661_10060953 Ga0207661_100609531 108
527 3300025949 Ga0207667_10000630 Ga0207667_1000063021 108
528 3300025949 Ga0207667_10001087 Ga0207667_1000108725 108
529 3300025949 Ga0207667_10004753 Ga0207667_1000475318 108
530 3300025949 Ga0207667_10006745 Ga0207667_100067455 108
531 3300025949 Ga0207667_10020244 Ga0207667_100202442 108
532 3300025949 Ga0207667_10119173 Ga0207667_101191733 108
533 3300025949 Ga0207667_10131630 Ga0207667_101316303 108
534 3300025949 Ga0207667_10299638 Ga0207667_102996382 108
535 3300025949 Ga0207667_10442623 Ga0207667_104426232 108
536 3300025949 Ga0207667_10791521 Ga0207667_107915211 108
537 3300025960 Ga0207651_10455432 Ga0207651_104554321 108
538 3300025960 Ga0207651_11455789 Ga0207651_114557891 108
539 3300025961 Ga0207712_10000996 Ga0207712_1000099610 108
540 3300025981 Ga0207640_10302371 Ga0207640_103023712 108
541 3300025981 Ga0207640_11340088 Ga0207640_113400882 108
542 3300026023 Ga0207677_10405520 Ga0207677_104055201 108
543 3300026035 Ga0207703_11652650 Ga0207703_116526501 108
544 3300026041 Ga0207639_10009142 Ga0207639_100091423 108
545 3300026041 Ga0207639_10032059 Ga0207639_100320594 108
546 3300026041 Ga0207639_10426897 Ga0207639_104268972 108
547 3300026041 Ga0207639_10888708 Ga0207639_108887082 108
548 3300026041 Ga0207639_11333241 Ga0207639_113332411 108
549 3300026067 Ga0207678_10036233 Ga0207678_100362333 108
550 3300026067 Ga0207678_10043031 Ga0207678_100430313 108
551 3300026067 Ga0207678_11857996 Ga0207678_118579961 108
552 3300026075 Ga0207708_10050718 Ga0207708_100507184 108
553 3300026075 Ga0207708_10390650 Ga0207708_103906502 108
554 3300026078 Ga0207702_10000393 Ga0207702_1000039311 108
555 3300026078 Ga0207702_10024780 Ga0207702_100247802 108
556 3300026078 Ga0207702_10025453 Ga0207702_100254533 108
557 3300026078 Ga0207702_10160383 Ga0207702_101603832 108
558 3300026078 Ga0207702_10366132 Ga0207702_103661324 108
559 3300026078 Ga0207702_10723120 Ga0207702_107231201 108
560 3300026078 Ga0207702_10983603 Ga0207702_109836031 108
561 3300026088 Ga0207641_10000921 Ga0207641_1000092115 108
562 3300026088 Ga0207641_10006712 Ga0207641_100067128 108
563 3300026088 Ga0207641_10134800 Ga0207641_101348002 108
564 3300026095 Ga0207676_10107576 Ga0207676_101075762 108
565 3300026095 Ga0207676_10151573 Ga0207676_101515732 108
566 3300026095 Ga0207676_10527523 Ga0207676_105275231 108
567 3300026116 Ga0207674_10033030 Ga0207674_100330304 108
568 3300026116 Ga0207674_10294529 Ga0207674_102945292 108
569 3300026116 Ga0207674_10315315 Ga0207674_103153151 108
570 3300026116 Ga0207674_10691179 Ga0207674_106911792 108
571 3300026116 Ga0207674_11339584 Ga0207674_113395842 108
572 3300026118 Ga0207675_100415340 Ga0207675_1004153401 108
573 3300026121 Ga0207683_10045818 Ga0207683_100458182 108
574 3300026121 Ga0207683_10245967 Ga0207683_102459673 108
575 3300026142 Ga0207698_10004007 Ga0207698_100040076 108
576 3300026142 Ga0207698_10261173 Ga0207698_102611733 108
577 3300026142 Ga0207698_10370536 Ga0207698_103705362 108
578 3300026142 Ga0207698_10618797 Ga0207698_106187972 108
579 3300026142 Ga0207698_10991631 Ga0207698_109916312 108
580 3300027907 Ga0207428_10137447 Ga0207428_101374472 108
581 3300028379 Ga0268266_10000037 Ga0268266_10000037283 108
582 3300028380 Ga0268265_10222960 Ga0268265_102229603 108
583 3300028573 Ga0265334_10057213 Ga0265334_100572132 108
584 3300028786 Ga0307517_10001881 Ga0307517_100018818 108
585 3300028794 Ga0307515_10000790 Ga0307515_1000079079 108
586 3300028794 Ga0307515_10001565 Ga0307515_100015653 108
587 3300028794 Ga0307515_10062818 Ga0307515_100628184 108
588 3300028794 Ga0307515_10068910 Ga0307515_100689102 108
589 3300028794 Ga0307515_10093363 Ga0307515_100933632 108
590 3300028794 Ga0307515_10357702 Ga0307515_103577022 108
591 3300028800 Ga0265338_10010649 Ga0265338_100106499 108
592 3300028800 Ga0265338_10153395 Ga0265338_101533951 108
593 3300028800 Ga0265338_10448333 Ga0265338_104483332 108
594 3300028800 Ga0265338_10514341 Ga0265338_105143412 108
595 3300029957 Ga0265324_10169631 Ga0265324_101696312 108
596 3300030732 Ga0316176_1014596 Ga0316176_10145964 108
597 3300030742 Ga0316183_1016718 Ga0316183_101671845 108
598 3300030744 Ga0316181_1091070 Ga0316181_10910705 108
599 3300030744 Ga0316181_1124067 Ga0316181_11240671 108
600 3300030745 Ga0316182_1148669 Ga0316182_11486692 108
601 3300031240 Ga0265320_10223651 Ga0265320_102236512 108
602 3300031251 Ga0265327_10083579 Ga0265327_100835792 108
603 3300031507 Ga0307509_10011471 Ga0307509_100114715 108
604 3300031507 Ga0307509_10373643 Ga0307509_103736432 108
605 3300031548 Ga0307408_100000628 Ga0307408_10000062820 108
606 3300031548 Ga0307408_100001834 Ga0307408_10000183414 108
607 3300031548 Ga0307408_100016380 Ga0307408_1000163806 108
608 3300031548 Ga0307408_101940426 Ga0307408_1019404262 108
609 3300031727 Ga0316576_10901982 Ga0316576_109019822 108
610 3300031727 Ga0316576_11033852 Ga0316576_110338522 108
611 3300031730 Ga0307516_10573588 Ga0307516_105735882 108
612 3300031731 Ga0307405_10000016 Ga0307405_1000001691 108
613 3300031731 Ga0307405_10009259 Ga0307405_100092593 108
614 3300031731 Ga0307405_10113301 Ga0307405_101133012 108
615 3300031731 Ga0307405_10611843 Ga0307405_106118432 108
616 3300031731 Ga0307405_11446311 Ga0307405_114463112 108
617 3300031824 Ga0307413_10905632 Ga0307413_109056322 108
618 3300031852 Ga0307410_10337270 Ga0307410_103372703 108
619 3300031901 Ga0307406_10800139 Ga0307406_108001392 108
620 3300031903 Ga0307407_10000006 Ga0307407_10000006156 108
621 3300031911 Ga0307412_10000001 Ga0307412_1000000147 108
622 3300031911 Ga0307412_10001942 Ga0307412_100019426 108
623 3300031911 Ga0307412_10034482 Ga0307412_100344824 108
624 3300031911 Ga0307412_10203138 Ga0307412_102031382 108
625 3300031911 Ga0307412_10441980 Ga0307412_104419802 108
626 3300031911 Ga0307412_10690848 Ga0307412_106908482 108
627 3300031911 Ga0307412_10943005 Ga0307412_109430052 108
628 3300032002 Ga0307416_100000032 Ga0307416_10000003266 108
629 3300032002 Ga0307416_100060854 Ga0307416_1000608542 108
630 3300032004 Ga0307414_10000268 Ga0307414_100002683 108
631 3300032004 Ga0307414_10005701 Ga0307414_100057012 108
632 3300032004 Ga0307414_10021383 Ga0307414_100213834 108
633 3300032004 Ga0307414_10040328 Ga0307414_100403283 108
634 3300032004 Ga0307414_10055952 Ga0307414_100559523 108
635 3300032004 Ga0307414_10092095 Ga0307414_100920952 108
636 3300032004 Ga0307414_10092129 Ga0307414_100921294 108
637 3300032004 Ga0307414_10190811 Ga0307414_101908112 108
638 3300032004 Ga0307414_11508851 Ga0307414_115088511 108
639 3300032004 Ga0307414_11795324 Ga0307414_117953242 108
640 3300032004 Ga0307414_11881010 Ga0307414_118810101 108
641 3300032005 Ga0307411_10066871 Ga0307411_100668712 108
642 3300032005 Ga0307411_11764727 Ga0307411_117647271 108
643 3300032005 Ga0307411_11798467 Ga0307411_117984672 108
644 3300032126 Ga0307415_100221734 Ga0307415_1002217342 108
645 3300033179 Ga0307507_10000143 Ga0307507_1000014375 108
646 3300033180 Ga0307510_10000149 Ga0307510_1000014916 108
647 3300035115 Ga0373941_0109536 Ga0373941_0109536_56_382 108
648 3300035695 Ga0373927_0153063 Ga0373927_0153063_36_365 108
649 3300036401 Ga0373937_0989888 Ga0373937_0989888_260_586 108
650 3300036712 Ga0316584_0231279 Ga0316584_0231279_557_901 108
651 3300037068 Ga0373925_1418411 Ga0373925_1418411_22_381 108
652 3300037312 Ga0395899_0000017 Ga0395899_0000017_189471_189797 108
653 3300037312 Ga0395899_0000152 Ga0395899_0000152_90159_90485 108
654 3300037312 Ga0395899_0003831 Ga0395899_0003831_3907_4233 108
655 3300037312 Ga0395899_0277394 Ga0395899_0277394_214_549 108
656 3300037418 Ga0395900_0000523 Ga0395900_0000523_6643_6969 108
657 3300037418 Ga0395900_0005417 Ga0395900_0005417_9966_10292 108
658 3300037418 Ga0395900_0005978 Ga0395900_0005978_9093_9419 108
659 3300037418 Ga0395900_0105004 Ga0395900_0105004_2270_2605 108
660 3300037418 Ga0395900_0163666 Ga0395900_0163666_1926_2252 108
661 3300037418 Ga0395900_0240627 Ga0395900_0240627_1287_1613 108
662 3300037418 Ga0395900_1915307 Ga0395900_1915307_35_361 108
663 3300037466 Ga0395898_0003563 Ga0395898_0003563_9414_9740 108
664 3300037466 Ga0395898_0075703 Ga0395898_0075703_2297_2623 108
665 3300037466 Ga0395898_0127076 Ga0395898_0127076_1324_1659 108
666 3300037471 Ga0395905_0006175 Ga0395905_0006175_10635_10961 108
667 3300037471 Ga0395905_0007055 Ga0395905_0007055_5704_6030 108
668 3300037471 Ga0395905_0183951 Ga0395905_0183951_982_1317 108
669 3300038443 Ga0395901_0007492 Ga0395901_0007492_7206_7532 108
670 3300038443 Ga0395901_0013621 Ga0395901_0013621_2274_2600 108
671 3300038443 Ga0395901_0018348 Ga0395901_0018348_5100_5435 108
672 3300038443 Ga0395901_0113245 Ga0395901_0113245_2346_2672 108
673 3300038725 Ga0400484_43947 Ga0400484_43947_636_977 108
674 3300039062 Ga0400483_044221 Ga0400483_044221_66_395 108
675 3300039062 Ga0400483_062433 Ga0400483_062433_1588_1935 108
676 3300039062 Ga0400483_112494 Ga0400483_112494_555_896 108
677 3300039437 Ga0436365_1929414 Ga0436365_1929414_1622_1972 108
678 3300039447 Ga0436361_0569017 Ga0436361_0569017_566_892 108
679 3300041404 Ga0439436_0000241 Ga0439436_0000241_2426_2755 108
680 3300041406 Ga0439439_0020088 Ga0439439_0020088_898_1227 108
681 3300041452 Ga0451793_0438499 Ga0451793_0438499_44_370 108
682 3300041452 Ga0451793_0959079 Ga0451793_0959079_41_367 108
683 3300041452 Ga0451793_1840194 Ga0451793_1840194_417_743 108
684 3300041453 Ga0451797_1031175 Ga0451797_1031175_53_379 108
685 3300041458 Ga0451798_1146370 Ga0451798_1146370_234_599 108
686 3300041459 Ga0451800_0026029 Ga0451800_0026029_171_500 108
687 3300041460 Ga0451802_0608812 Ga0451802_0608812_217_546 108
688 3300041486 Ga0451807_2157009 Ga0451807_2157009_106_432 108
689 3300041492 Ga0451835_0814727 Ga0451835_0814727_100_429 108
690 3300041494 Ga0451837_0878129 Ga0451837_0878129_27_353 108
691 3300041498 Ga0451841_1117568 Ga0451841_1117568_144_470 108
692 3300041498 Ga0451841_1304691 Ga0451841_1304691_81_407 108
693 3300041999 Ga0439433_0196967 Ga0439433_0196967_17_346 108
694 3300042007 Ga0439449_0068234 Ga0439449_0068234_470_799 108
695 3300042012 Ga0439455_0121192 Ga0439455_0121192_324_650 108
696 3300042014 Ga0439457_000013 Ga0439457_000013_35092_35421 108
697 3300042015 Ga0439462_0100615 Ga0439462_0100615_211_537 108
698 3300042125 Ga0450923_011295 Ga0450923_011295_624_950 108
699 3300042436 Ga0439435_0074984 Ga0439435_0074984_141_485 108
700 3300044656 Ga0466969_0152231 Ga0466969_0152231_614_940 108
701 3300044658 Ga0466972_0000263 Ga0466972_0000263_9747_10076 108
702 3300044673 Ga0453683_0003606 Ga0453683_0003606_5161_5505 108
703 3300044673 Ga0453683_0461515 Ga0453683_0461515_465_791 108
704 3300044684 Ga0466966_0081289 Ga0466966_0081289_1434_1760 108
705 3300044684 Ga0466966_1003400 Ga0466966_1003400_78_404 108
706 3300044693 Ga0466961_0082976 Ga0466961_0082976_1430_1756 108
707 3300044693 Ga0466961_0333376 Ga0466961_0333376_543_869 108
708 3300044712 Ga0453684_0080844 Ga0453684_0080844_1339_1665 108
709 3300045049 Ga0466959_0073994 Ga0466959_0073994_1136_1462 108
710 3300045051 Ga0451576_0000008 Ga0451576_0000008_602811_603155 108
711 3300045836 Ga0466958_0012340 Ga0466958_0012340_749_1075 108
712 3300046460 Ga0495638_0145207 Ga0495638_0145207_879_1205 108
713 3300046460 Ga0495638_0213000 Ga0495638_0213000_202_528 108
714 3300046460 Ga0495638_0593081 Ga0495638_0593081_161_487 108
715 3300046462 Ga0495651_0077080 Ga0495651_0077080_204_530 108
716 3300046471 Ga0495650_0000095 Ga0495650_0000095_6568_6894 108
717 3300046471 Ga0495650_0271739 Ga0495650_0271739_37_435 108
718 3300046471 Ga0495650_0335285 Ga0495650_0335285_142_468 108
719 3300046492 Ga0495585_0000057 Ga0495585_0000057_20091_20417 108
720 3300046492 Ga0495585_0000648 Ga0495585_0000648_11568_11894 108
721 3300046500 Ga0495596_0025532 Ga0495596_0025532_1145_1471 108
722 3300046501 Ga0495607_0167770 Ga0495607_0167770_626_952 108
723 3300046506 Ga0495583_0029680 Ga0495583_0029680_1353_1679 108
724 3300046506 Ga0495583_0072998 Ga0495583_0072998_1096_1422 108
725 3300046506 Ga0495583_0256669 Ga0495583_0256669_208_534 108
726 3300046507 Ga0495606_0000009 Ga0495606_0000009_221393_221719 108
727 3300046507 Ga0495606_0007717 Ga0495606_0007717_4957_5283 108
728 3300046507 Ga0495606_0011706 Ga0495606_0011706_6644_6970 108
729 3300046507 Ga0495606_0026272 Ga0495606_0026272_1457_1783 108
730 3300046507 Ga0495606_0031758 Ga0495606_0031758_2189_2515 108
731 3300046507 Ga0495606_0061425 Ga0495606_0061425_1278_1604 108
732 3300046507 Ga0495606_0603678 Ga0495606_0603678_18_344 108
733 3300046512 Ga0495610_0000231 Ga0495610_0000231_16693_17019 108
734 3300046512 Ga0495610_0000237 Ga0495610_0000237_35100_35426 108
735 3300046512 Ga0495610_0001711 Ga0495610_0001711_2611_2937 108
736 3300046512 Ga0495610_0149922 Ga0495610_0149922_39_365 108
737 3300046513 Ga0495616_0000733 Ga0495616_0000733_16293_16619 108
738 3300046513 Ga0495616_0006705 Ga0495616_0006705_4622_4948 108
739 3300046518 Ga0495631_0016934 Ga0495631_0016934_1336_1662 108
740 3300046519 Ga0495632_0131408 Ga0495632_0131408_446_772 108
741 3300046520 Ga0495637_0092864 Ga0495637_0092864_71_397 108
742 3300046522 Ga0495643_0276495 Ga0495643_0276495_182_511 108
743 3300046523 Ga0495644_0021868 Ga0495644_0021868_1297_1623 108
744 3300046524 Ga0495648_0005462 Ga0495648_0005462_1577_1903 108
745 3300046524 Ga0495648_0018322 Ga0495648_0018322_2333_2659 108
746 3300046529 Ga0495652_0090697 Ga0495652_0090697_1258_1584 108
747 3300046529 Ga0495652_0466530 Ga0495652_0466530_489_815 108
748 3300046529 Ga0495652_0541635 Ga0495652_0541635_152_478 108
749 3300046530 Ga0495654_0246215 Ga0495654_0246215_367_693 108
750 3300046538 Ga0495609_0007538 Ga0495609_0007538_4415_4741 108
751 3300046538 Ga0495609_0011292 Ga0495609_0011292_607_933 108
752 3300046538 Ga0495609_0036324 Ga0495609_0036324_937_1263 108
753 3300046538 Ga0495609_0247295 Ga0495609_0247295_63_389 108
754 3300046558 Ga0495633_0000275 Ga0495633_0000275_17624_17950 108
755 3300046558 Ga0495633_0006218 Ga0495633_0006218_5580_5906 108
756 3300046558 Ga0495633_0203951 Ga0495633_0203951_220_549 108
757 3300046616 Ga0495668_0000017 Ga0495668_0000017_222695_223021 108
758 3300046616 Ga0495668_0096233 Ga0495668_0096233_976_1302 108
759 3300046642 Ga0495634_0617640 Ga0495634_0617640_28_354 108
760 3300046660 Ga0495625_0000007 Ga0495625_0000007_91573_91899 108
761 3300046660 Ga0495625_0000901 Ga0495625_0000901_38011_38337 108
762 3300046660 Ga0495625_0001789 Ga0495625_0001789_22718_23044 108
763 3300046660 Ga0495625_0003096 Ga0495625_0003096_10979_11305 108
764 3300046660 Ga0495625_0052422 Ga0495625_0052422_430_756 108
765 3300046660 Ga0495625_0248723 Ga0495625_0248723_679_1005 108
766 3300046660 Ga0495625_0403762 Ga0495625_0403762_445_771 108
767 3300046665 Ga0495661_0000576 Ga0495661_0000576_9683_10009 108
768 3300046665 Ga0495661_0004014 Ga0495661_0004014_8812_9138 108
769 3300046665 Ga0495661_0063777 Ga0495661_0063777_170_496 108
770 3300046665 Ga0495661_0209276 Ga0495661_0209276_64_390 108
771 3300046665 Ga0495661_0343171 Ga0495661_0343171_379_705 108
772 3300046683 Ga0495658_0116785 Ga0495658_0116785_29_355 108
773 3300046684 Ga0495669_0375434 Ga0495669_0375434_156_482 108
774 3300046691 Ga0495670_0337091 Ga0495670_0337091_244_570 108
775 3300046692 Ga0495671_0026266 Ga0495671_0026266_187_513 108
776 3300046694 Ga0495649_0000007 Ga0495649_0000007_343519_343845 108
777 3300046694 Ga0495649_0582358 Ga0495649_0582358_180_506 108
778 3300046810 Ga0495660_0009750 Ga0495660_0009750_4160_4558 108
779 3300047323 Ga0495683_0018342 Ga0495683_0018342_2415_2741 108
780 3300047443 Ga0495687_004966 Ga0495687_004966_8108_8434 108
781 3300047443 Ga0495687_007879 Ga0495687_007879_4851_5177 108
782 3300047443 Ga0495687_025474 Ga0495687_025474_427_753 108
783 3300047443 Ga0495687_124607 Ga0495687_124607_195_521 108
784 3300047445 Ga0495677_0017891 Ga0495677_0017891_585_911 108
785 3300047447 Ga0495685_152589 Ga0495685_152589_84_410 108
786 3300047469 Ga0495673_0111947 Ga0495673_0111947_726_1052 108
787 3300047472 Ga0495686_0000490 Ga0495686_0000490_45331_45657 108
788 3300047472 Ga0495686_0000729 Ga0495686_0000729_32897_33223 108
789 3300047472 Ga0495686_0017335 Ga0495686_0017335_4086_4412 108
790 3300047472 Ga0495686_0030106 Ga0495686_0030106_249_578 108
791 3300047472 Ga0495686_0152383 Ga0495686_0152383_756_1109 108
792 3300047472 Ga0495686_0314448 Ga0495686_0314448_333_659 108
793 3300048088 Ga0495602_1118268 Ga0495602_1118268_78_404 108
794 3300048089 Ga0495614_0003480 Ga0495614_0003480_5254_5580 108
795 3300048919 Ga0496116_0000752 Ga0496116_0000752_34569_34895 108
796 3300048920 Ga0496117_0007456 Ga0496117_0007456_6260_6586 108
797 3300048921 Ga0496118_0051861 Ga0496118_0051861_557_883 108
798 3300048925 Ga0496122_0002421 Ga0496122_0002421_12222_12548 108
799 3300048925 Ga0496122_0003438 Ga0496122_0003438_1550_1876 108
800 3300048926 Ga0496123_0004076 Ga0496123_0004076_3693_4019 108
801 3300048926 Ga0496123_0020394 Ga0496123_0020394_974_1300 108
802 3300048928 Ga0496125_0157196 Ga0496125_0157196_454_780 108
803 3300048928 Ga0496125_0321761 Ga0496125_0321761_275_601 108
804 3300049459 Ga0495678_003805 Ga0495678_003805_218_544 108
805 3300049459 Ga0495678_227887 Ga0495678_227887_15_341 108
806 3300049460 Ga0495682_0036521 Ga0495682_0036521_779_1105 108
807 3300049571 Ga0501034_0297323 Ga0501034_0297323_1108_1437 108
808 3300049579 Ga0501043_0141142 Ga0501043_0141142_468_797 108
809 3300049581 Ga0501047_0124055 Ga0501047_0124055_1514_1843 108
810 3300049581 Ga0501047_0840617 Ga0501047_0840617_303_632 108
811 3300049582 Ga0501048_0079904 Ga0501048_0079904_611_940 108
812 3300049652 Ga0501202_111142 Ga0501202_111142_187_513 108
813 3300049663 Ga0501223_001696 Ga0501223_001696_1222_1548 108
814 3300049663 Ga0501223_148475 Ga0501223_148475_108_434 108
815 3300049668 Ga0501233_096179 Ga0501233_096179_269_595 108
816 3300049673 Ga0501240_000352 Ga0501240_000352_2702_3028 108
817 3300049705 Ga0501225_0000569 Ga0501225_0000569_7133_7462 108
818 3300049705 Ga0501225_0283472 Ga0501225_0283472_47_373 108
819 3300049758 Ga0501241_002026 Ga0501241_002026_2841_3167 108
820 3300049758 Ga0501241_080470 Ga0501241_080470_83_409 108
821 3300049822 Ga0501035_0622157 Ga0501035_0622157_246_575 108
822 3300049823 Ga0501044_0026588 Ga0501044_0026588_3519_3848 108
823 3300050491 nmdc:mga00v17_798549_c1 nmdc:mga00v17_798549_c1_239_577 108
824 3300050493 nmdc:mga0k408_14935_c1 nmdc:mga0k408_14935_c1_641_970 108
825 3300050493 nmdc:mga0k408_151_c2 nmdc:mga0k408_151_c2_11145_11474 108
826 3300050493 nmdc:mga0k408_54405_c2 nmdc:mga0k408_54405_c2_381_707 108
827 3300050493 nmdc:mga0k408_63_c1 nmdc:mga0k408_63_c1_12249_12575 108
828 3300050493 nmdc:mga0k408_661349_c1 nmdc:mga0k408_661349_c1_227_553 108
829 3300050496 nmdc:mga07m45_671441_c1 nmdc:mga07m45_671441_c1_145_471 108
830 3300050508 nmdc:mga09592_22801_c1 nmdc:mga09592_22801_c1_3565_3909 108
831 3300050509 nmdc:mga0qj67_216843_c1 nmdc:mga0qj67_216843_c1_843_1187 108
832 3300050510 nmdc:mga06r32_103002_c1 nmdc:mga06r32_103002_c1_716_1060 108
833 3300050511 nmdc:mga08y16_53088_c1 nmdc:mga08y16_53088_c1_2138_2464 108
834 3300053080 Ga0500635_0000719 Ga0500635_0000719_1437_1763 108
835 3300053086 Ga0500578_0000010 Ga0500578_0000010_186157_186486 108
836 3300053092 Ga0500583_0000064 Ga0500583_0000064_55882_56211 108
837 3300053092 Ga0500583_0006250 Ga0500583_0006250_3527_3856 108
838 3300053093 Ga0500651_0001193 Ga0500651_0001193_1442_1768 108
839 3300053122 Ga0500608_000322 Ga0500608_000322_13839_14165 108
840 3300053122 Ga0500608_004236 Ga0500608_004236_4722_5048 108
841 3300053125 Ga0500618_000033 Ga0500618_000033_35119_35445 108
842 3300053125 Ga0500618_008791 Ga0500618_008791_345_749 108
843 3300053138 Ga0500564_198995 Ga0500564_198995_276_602 108
844 3300053139 Ga0500568_0178919 Ga0500568_0178919_204_530 108
845 3300053143 Ga0500579_227616 Ga0500579_227616_241_567 108
846 3300053153 Ga0500616_0154423 Ga0500616_0154423_125_454 108
847 3300053153 Ga0500616_0198835 Ga0500616_0198835_202_528 108
848 3300053154 Ga0500619_181841 Ga0500619_181841_149_475 108
849 3300053156 Ga0500622_0000417 Ga0500622_0000417_7570_7902 108
850 3300053156 Ga0500622_0148758 Ga0500622_0148758_398_727 108
851 3300053157 Ga0500624_000447 Ga0500624_000447_10921_11247 108
852 3300053178 Ga0500637_0377270 Ga0500637_0377270_350_679 108
853 3300053727 Ga0500611_000019 Ga0500611_000019_76178_76504 108
854 3300053727 Ga0500611_086330 Ga0500611_086330_150_479 108
855 3300053739 Ga0500587_033546 Ga0500587_033546_82_411 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03819

MazG

MazG nucleotide pyrophosphohydrolase domain

48

127

0.88

PF01503

PRA-PH

Phosphoribosyl-ATP pyrophosphohydrolase

30

120

0.84

PF12643

MazG-like

MazG-like family

44

133

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ie9-assembly1.cif.gz_D crystal structure of the bacillus-conserved mazg protein, a nucleotide pyrophosphohydrolase 0.9196 1 92
5ie9-assembly1.cif.gz_B crystal structure of the bacillus-conserved mazg protein, a nucleotide pyrophosphohydrolase 0.9027 1 92
2gta-assembly1.cif.gz_C crystal structure of the putative pyrophosphatase ypjd from bacillus subtilis. northeast structural genomics consortium target sr428. 0.9021 1 94
5ie9-assembly1.cif.gz_C crystal structure of the bacillus-conserved mazg protein, a nucleotide pyrophosphohydrolase 0.9002 1 92
2gta-assembly1.cif.gz_B crystal structure of the putative pyrophosphatase ypjd from bacillus subtilis. northeast structural genomics consortium target sr428. 0.8754 1 97
ID Description Score Start End Superfamily
5ie9D00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9196 1 92 1.10.287.1080
5ie9B00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9027 1 92 1.10.287.1080
5ie9C00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9002 1 92 1.10.287.1080
2gtaB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.8753 1 88 1.10.287.1080
2gtaA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.8642 1 88 1.10.287.1080
ID Description Score Start End GO Terms
AF-A0A644TAW7-F1-model_v4 NTP pyrophosphohydrolase MazG-like domain-containing protein 0.9603 1 108
AF-A0A7D5RRJ8-F1-model_v4 Nucleotide pyrophosphohydrolase 0.9603 1 99 GO:0016787
AF-A6EBH0-F1-model_v4 NTP pyrophosphohydrolase MazG-like domain-containing protein 0.9601 1 108
AF-A0A352HSZ7-F1-model_v4 Pyrophosphatase 0.9601 1 103
AF-A0A348PT58-F1-model_v4 Pyrophosphatase 0.9586 1 108

Feature Viewer

pLDDT pTM Quality
86.9 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map