F483639

General Info

Members Datasets Scaffolds Average Seq Length
855 281 855 347

Family's Representative Sequence

Representative Sequence 3300049707|Ga0501234_005759|Ga0501234_005759_668_1660
Length 330
Sequence MTLEPRRKLRIIVLVHEDLVPPDSLNGLSDKEKQEVKTEFDVTSTLKKMGHDVYPVGLYNHLNAIGDALLEHKPHIAFNLLEEFHGYPLYDQHVVSYLELMKQAYTGCNPRGLTLAHDKALTKMILSYHRLLVPNFAVFPMNRKVKRPMRLKFPLLASIVYDDEKLAQRVEFIHRQNKTAAIAEQYIKGREIYVGVIGNQNIQTYAPWELVMEKLPEGAENIATLKVKWDPTYQEKVGVKTRAAELTPDQHKTLERLSKRIYRYLFLSGYARLDYRMTEEGQFYLLEANPNPQIAHNEDFADSAEHSGVAYDQLLQKIITVGLNYAGRSI

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
183 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
184 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
185 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
186 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
195 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
196 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
202 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
221 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
222 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
223 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
224 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
225 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
226 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
239 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
240 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
241 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
242 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
243 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
244 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
245 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
246 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
247 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
248 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
249 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
250 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
251 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
252 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
253 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
254 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
255 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
256 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
257 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
263 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
267 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 0.94
Rhizosphere 98.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_3391401 2162886006 Unclassified 1286
2 SwRhRL2b_contig_151632 2162886007 Bacteria 2872
3 CNAas_1000548 3300000532 Unclassified 3640
4 JGI24034J14986_100245 3300001432 Unclassified 2984
5 JGI24748J21848_1000010 3300002074 Bacteria 166979
6 JGI24034J26672_10000001 3300002239 Bacteria 1118280
7 JGI24751J29686_10000040 3300002459 Bacteria 79191
8 JGI25406J46586_10003181 3300003203 Bacteria 7725
9 Ga0065714_10064546 3300005288 Bacteria 38244
10 Ga0065704_10010886 3300005289 Unclassified 2500
11 Ga0065704_10097714 3300005289 Bacteria 2360
12 Ga0065704_10103121 3300005289 Bacteria 2182
13 Ga0065704_10168649 3300005289 Unclassified 1306
14 Ga0065712_10000133 3300005290 Bacteria 66806
15 Ga0065712_10001895 3300005290 Bacteria 5133
16 Ga0065712_10007455 3300005290 Bacteria 4869
17 Ga0065712_10073016 3300005290 Bacteria 4532
18 Ga0065712_10076531 3300005290 Bacteria 3643
19 Ga0065712_10087944 3300005290 Bacteria 2547
20 Ga0065712_10089765 3300005290 Bacteria 2454
21 Ga0065715_10002297 3300005293 Bacteria 5711
22 Ga0065715_10011249 3300005293 Bacteria 2928
23 Ga0065715_10092350 3300005293 Bacteria 5171
24 Ga0065715_10129064 3300005293 Bacteria 2053
25 Ga0065715_10143265 3300005293 Unclassified 1822
26 Ga0065715_10161837 3300005293 Bacteria 1622
27 Ga0065707_10001920 3300005295 Bacteria 13690
28 Ga0065707_10002307 3300005295 Bacteria 4744
29 Ga0065707_10002866 3300005295 Bacteria 6149
30 Ga0065707_10085619 3300005295 Bacteria 6017
31 Ga0065707_10092600 3300005295 Bacteria 3746
32 Ga0065707_10127137 3300005295 Bacteria 1990
33 Ga0070676_10029027 3300005328 Bacteria 3144
34 Ga0070676_10099075 3300005328 Bacteria 1798
35 Ga0070690_100001019 3300005330 Bacteria 14317
36 Ga0070690_100002855 3300005330 Bacteria 9321
37 Ga0070690_100003648 3300005330 Bacteria 8474
38 Ga0070690_100009806 3300005330 Bacteria 5557
39 Ga0070690_100056793 3300005330 Bacteria 2511
40 Ga0070690_100056979 3300005330 Bacteria 2507
41 Ga0070670_100000225 3300005331 Bacteria 52142
42 Ga0070670_100001528 3300005331 Bacteria 18634
43 Ga0070670_100007289 3300005331 Bacteria 9380
44 Ga0070670_100024832 3300005331 Bacteria 5155
45 Ga0070670_100042661 3300005331 Bacteria 3900
46 Ga0070670_100253666 3300005331 Unclassified 1533
47 Ga0070670_100286235 3300005331 Bacteria 1439
48 Ga0070677_10098780 3300005333 Unclassified 1283
49 Ga0068869_100003372 3300005334 Bacteria 9754
50 Ga0068869_100003484 3300005334 Bacteria 9628
51 Ga0068869_100011119 3300005334 Bacteria 5896
52 Ga0068869_100013921 3300005334 Bacteria 5363
53 Ga0068869_100021791 3300005334 Bacteria 4410
54 Ga0068869_100074618 3300005334 Unclassified 2517
55 Ga0068869_100237150 3300005334 Bacteria 1452
56 Ga0070666_10068892 3300005335 Bacteria 2405
57 Ga0070666_10074489 3300005335 Bacteria 2314
58 Ga0070680_100002583 3300005336 Bacteria 13399
59 Ga0070680_100013103 3300005336 Bacteria 6453
60 Ga0070680_100069302 3300005336 Unclassified 2896
61 Ga0070680_100226082 3300005336 Unclassified 1580
62 Ga0070682_100000687 3300005337 Bacteria 20450
63 Ga0070682_100007382 3300005337 Bacteria 6202
64 Ga0068868_100000238 3300005338 Bacteria 37158
65 Ga0068868_100024174 3300005338 Bacteria 4607
66 Ga0068868_100108009 3300005338 Bacteria 2258
67 Ga0070687_100000989 3300005343 Bacteria 9692
68 Ga0070687_100102570 3300005343 Bacteria 1605
69 Ga0070687_100108426 3300005343 Bacteria 1567
70 Ga0070661_100008110 3300005344 Bacteria 7247
71 Ga0070692_10075052 3300005345 Bacteria 1810
72 Ga0070668_100098853 3300005347 Unclassified 2310
73 Ga0070669_100004916 3300005353 Bacteria 9654
74 Ga0070669_100007320 3300005353 Bacteria 7917
75 Ga0070669_100013652 3300005353 Archaea 5774
76 Ga0070675_100011584 3300005354 Bacteria 6906
77 Ga0070675_100017185 3300005354 Bacteria 5750
78 Ga0070675_100024762 3300005354 Bacteria 4807
79 Ga0070675_100136949 3300005354 Unclassified 2090
80 Ga0070671_100011918 3300005355 Bacteria 6993
81 Ga0070671_100022400 3300005355 Bacteria 5159
82 Ga0070671_100107639 3300005355 Unclassified 2341
83 Ga0070673_100000896 3300005364 Bacteria 16813
84 Ga0070673_100033143 3300005364 Bacteria 3896
85 Ga0070673_100050859 3300005364 Unclassified 3242
86 Ga0070673_100074151 3300005364 Unclassified 2742
87 Ga0070673_100313755 3300005364 Bacteria 1384
88 Ga0070688_100006011 3300005365 Bacteria 6438
89 Ga0070667_100001127 3300005367 Bacteria 24353
90 Ga0070667_100004875 3300005367 Bacteria 11235
91 Ga0070667_100045643 3300005367 Unclassified 3685
92 Ga0070667_100241267 3300005367 Bacteria 1614
93 Ga0070703_10000015 3300005406 Bacteria 87420
94 Ga0070703_10009549 3300005406 Bacteria 2736
95 Ga0070709_10209482 3300005434 Bacteria 1385
96 Ga0070705_100010194 3300005440 Bacteria 4695
97 Ga0070705_100177537 3300005440 Bacteria 1439
98 Ga0070700_100000090 3300005441 Bacteria 61626
99 Ga0070700_100005323 3300005441 Bacteria 6803
100 Ga0070700_100028118 3300005441 Unclassified 3341
101 Ga0070700_100031845 3300005441 Bacteria 3164
102 Ga0070700_100060745 3300005441 Bacteria 2383
103 Ga0070700_100095453 3300005441 Unclassified 1949
104 Ga0070694_100008789 3300005444 Bacteria 6189
105 Ga0070694_100020401 3300005444 Unclassified 4224
106 Ga0070694_100042190 3300005444 Bacteria 3047
107 Ga0070694_100047898 3300005444 Bacteria 2874
108 Ga0070694_100049593 3300005444 Bacteria 2828
109 Ga0070694_100068366 3300005444 Bacteria 2441
110 Ga0070694_100118232 3300005444 Bacteria 1898
111 Ga0070694_100185259 3300005444 Bacteria 1542
112 Ga0070694_100237321 3300005444 Bacteria 1374
113 Ga0070708_100040287 3300005445 Bacteria 4091
114 Ga0070708_100094887 3300005445 Bacteria 2722
115 Ga0070708_100105189 3300005445 Unclassified 2589
116 Ga0070678_100153822 3300005456 Bacteria 1856
117 Ga0070678_100164643 3300005456 Unclassified 1800
118 Ga0070681_10000011 3300005458 Bacteria 139059
119 Ga0070681_10001243 3300005458 Bacteria 22166
120 Ga0070681_10035918 3300005458 Bacteria 4978
121 Ga0070681_10074750 3300005458 Bacteria 3349
122 Ga0068867_100085490 3300005459 Bacteria 2385
123 Ga0068867_100108447 3300005459 Bacteria 2130
124 Ga0068867_100154358 3300005459 Bacteria 1806
125 Ga0070685_10005103 3300005466 Bacteria 6655
126 Ga0070685_10010181 3300005466 Bacteria 4881
127 Ga0070685_10057830 3300005466 Bacteria 2258
128 Ga0070685_10107919 3300005466 Bacteria 1710
129 Ga0070706_100000312 3300005467 Bacteria 59056
130 Ga0070706_100001884 3300005467 Bacteria 21660
131 Ga0070706_100033422 3300005467 Bacteria 4747
132 Ga0070706_100045247 3300005467 Bacteria 4066
133 Ga0070706_100079320 3300005467 Bacteria 3039
134 Ga0070706_100268017 3300005467 Unclassified 1594
135 Ga0070706_100507618 3300005467 Unclassified 1122
136 Ga0070707_100000612 3300005468 Bacteria 35823
137 Ga0070707_100004557 3300005468 Bacteria 12978
138 Ga0070707_100014740 3300005468 Bacteria 7328
139 Ga0070707_100046596 3300005468 Bacteria 4149
140 Ga0070707_100080009 3300005468 Bacteria 3154
141 Ga0070707_100215335 3300005468 Unclassified 1872
142 Ga0070707_100227929 3300005468 Bacteria 1814
143 Ga0070707_100414052 3300005468 Unclassified 1308
144 Ga0070707_100423219 3300005468 Unclassified 1292
145 Ga0070698_100000398 3300005471 Bacteria 45901
146 Ga0070698_100007201 3300005471 Bacteria 12051
147 Ga0070698_100009908 3300005471 Bacteria 10189
148 Ga0070698_100016433 3300005471 Bacteria 7809
149 Ga0070698_100047297 3300005471 Bacteria 4398
150 Ga0070698_100124185 3300005471 Bacteria 2538
151 Ga0070698_100193495 3300005471 Bacteria 1971
152 Ga0070699_100003914 3300005518 Bacteria 13152
153 Ga0070699_100006392 3300005518 Bacteria 10264
154 Ga0070699_100301548 3300005518 Bacteria 1437
155 Ga0070679_100000013 3300005530 Bacteria 151602
156 Ga0070679_100170168 3300005530 Bacteria 2151
157 Ga0070679_100347636 3300005530 Bacteria 1431
158 Ga0070697_100001655 3300005536 Bacteria 16982
159 Ga0070697_100010463 3300005536 Bacteria 7241
160 Ga0070697_100033785 3300005536 Bacteria 4122
161 Ga0070697_100334660 3300005536 Bacteria 1306
162 Ga0070672_100000998 3300005543 Bacteria 17126
163 Ga0070672_100005650 3300005543 Bacteria 8322
164 Ga0070672_100008730 3300005543 Bacteria 6957
165 Ga0070686_100011105 3300005544 Bacteria 5102
166 Ga0070686_100011736 3300005544 Unclassified 4977
167 Ga0070686_100030967 3300005544 Unclassified 3267
168 Ga0070686_100040560 3300005544 Bacteria 2905
169 Ga0070686_100061035 3300005544 Unclassified 2435
170 Ga0070686_100093818 3300005544 Bacteria 2013
171 Ga0070686_100252088 3300005544 Unclassified 1290
172 Ga0070695_100046494 3300005545 Bacteria 2769
173 Ga0070695_100065565 3300005545 Unclassified 2365
174 Ga0070695_100088274 3300005545 Bacteria 2064
175 Ga0070695_100215278 3300005545 Unclassified 1381
176 Ga0070696_100004652 3300005546 Bacteria 9164
177 Ga0070696_100013630 3300005546 Bacteria 5456
178 Ga0070696_100077786 3300005546 Bacteria 2345
179 Ga0070696_100264924 3300005546 Unclassified 1304
180 Ga0070696_100305668 3300005546 Bacteria 1219
181 Ga0070693_100035033 3300005547 Bacteria 2781
182 Ga0070693_100137513 3300005547 Unclassified 1534
183 Ga0070693_100170796 3300005547 Bacteria 1392
184 Ga0070665_100155992 3300005548 Bacteria 2285
185 Ga0070704_100023962 3300005549 Unclassified 3997
186 Ga0070704_100055081 3300005549 Unclassified 2818
187 Ga0070704_100085418 3300005549 Bacteria 2335
188 Ga0068855_100352150 3300005563 Bacteria 1622
189 Ga0070664_100001082 3300005564 Bacteria 21465
190 Ga0068857_100034429 3300005577 Unclassified 4481
191 Ga0068857_100042876 3300005577 Bacteria 4014
192 Ga0068857_100169286 3300005577 Unclassified 1985
193 Ga0068857_100276358 3300005577 Unclassified 1544
194 Ga0068854_100045673 3300005578 Bacteria 3116
195 Ga0068854_100104550 3300005578 Unclassified 2127
196 Ga0068856_100009499 3300005614 Bacteria 9444
197 Ga0068856_100108545 3300005614 Bacteria 2771
198 Ga0070702_100042468 3300005615 Bacteria 2557
199 Ga0070702_100116499 3300005615 Unclassified 1666
200 Ga0070702_100125938 3300005615 Unclassified 1611
201 Ga0070702_100204413 3300005615 Bacteria 1310
202 Ga0068859_100003569 3300005617 Bacteria 15854
203 Ga0068859_100011838 3300005617 Bacteria 8762
204 Ga0068859_100022679 3300005617 Bacteria 6294
205 Ga0068859_100071051 3300005617 Bacteria 3516
206 Ga0068859_100140866 3300005617 Unclassified 2485
207 Ga0068859_100535048 3300005617 Unclassified 1266
208 Ga0068859_100589112 3300005617 Bacteria 1205
209 Ga0068864_100000368 3300005618 Bacteria 39343
210 Ga0068864_100007568 3300005618 Bacteria 8949
211 Ga0068864_100026211 3300005618 Unclassified 4915
212 Ga0068864_100031869 3300005618 Bacteria 4475
213 Ga0068864_100081234 3300005618 Bacteria 2841
214 Ga0068864_100253631 3300005618 Bacteria 1634
215 Ga0068866_10013594 3300005718 Bacteria 3577
216 Ga0068866_10028189 3300005718 Bacteria 2673
217 Ga0068861_100052526 3300005719 Bacteria 3098
218 Ga0068861_100093034 3300005719 Bacteria 2383
219 Ga0068861_100125676 3300005719 Bacteria 2074
220 Ga0068861_100369880 3300005719 Bacteria 1263
221 Ga0068851_10017649 3300005834 Bacteria 3430
222 Ga0068870_10007877 3300005840 Bacteria 4765
223 Ga0068863_100022102 3300005841 Bacteria 6073
224 Ga0068863_100024162 3300005841 Bacteria 5798
225 Ga0068863_100031683 3300005841 Bacteria 5044
226 Ga0068863_100123402 3300005841 Unclassified 2471
227 Ga0068863_100313715 3300005841 Bacteria 1522
228 Ga0068858_100000005 3300005842 Bacteria 305830
229 Ga0068858_100011012 3300005842 Bacteria 8547
230 Ga0068858_100037873 3300005842 Bacteria 4472
231 Ga0068858_100077372 3300005842 Unclassified 3091
232 Ga0068858_100102209 3300005842 Unclassified 2674
233 Ga0068858_100163243 3300005842 Bacteria 2098
234 Ga0068858_100170144 3300005842 Unclassified 2054
235 Ga0068860_100029077 3300005843 Bacteria 5315
236 Ga0068860_100036110 3300005843 Bacteria 4737
237 Ga0068860_100058473 3300005843 Unclassified 3665
238 Ga0068860_100215538 3300005843 Bacteria 1863
239 Ga0068860_100298300 3300005843 Bacteria 1578
240 Ga0068862_100043156 3300005844 Unclassified 3844
241 Ga0068862_100057909 3300005844 Bacteria 3324
242 Ga0068862_100115396 3300005844 Bacteria 2361
243 Ga0068862_100123737 3300005844 Bacteria 2282
244 Ga0068862_100149272 3300005844 Unclassified 2080
245 Ga0081455_10002043 3300005937 Bacteria 24122
246 Ga0081539_10002465 3300005985 Bacteria 26058
247 Ga0081539_10003882 3300005985 Bacteria 17449
248 Ga0070715_10000024 3300006163 Bacteria 110647
249 Ga0070716_100000046 3300006173 Bacteria 49780
250 Ga0097621_100005896 3300006237 Bacteria 8659
251 Ga0097621_100088971 3300006237 Bacteria 2581
252 Ga0097621_100121494 3300006237 Unclassified 2215
253 Ga0068871_100010565 3300006358 Bacteria 6744
254 Ga0068871_100033822 3300006358 Unclassified 4050
255 Ga0068871_100059286 3300006358 Bacteria 3118
256 Ga0068871_100101761 3300006358 Bacteria 2408
257 Ga0068871_100259361 3300006358 Bacteria 1516
258 Ga0075428_100036992 3300006844 Bacteria 5375
259 Ga0075428_100060654 3300006844 Bacteria 4142
260 Ga0075428_100073725 3300006844 Unclassified 3728
261 Ga0075428_100088917 3300006844 Unclassified 3369
262 Ga0075428_100093182 3300006844 Bacteria 3284
263 Ga0075428_100142765 3300006844 Bacteria 2603
264 Ga0075428_100148334 3300006844 Bacteria 2549
265 Ga0075428_100227044 3300006844 Unclassified 2015
266 Ga0075428_100233906 3300006844 Bacteria 1983
267 Ga0075428_100468093 3300006844 Bacteria 1349
268 Ga0075430_100022303 3300006846 Bacteria 5385
269 Ga0075430_100122287 3300006846 Bacteria 2170
270 Ga0075430_100146038 3300006846 Bacteria 1970
271 Ga0075430_100277763 3300006846 Unclassified 1386
272 Ga0075431_100071017 3300006847 Bacteria 3592
273 Ga0075431_100085225 3300006847 Bacteria 3261
274 Ga0075431_100158080 3300006847 Bacteria 2331
275 Ga0075431_100200862 3300006847 Bacteria 2040
276 Ga0075433_10005017 3300006852 Bacteria 10369
277 Ga0075433_10010069 3300006852 Bacteria 7577
278 Ga0075433_10020245 3300006852 Bacteria 5559
279 Ga0075433_10022933 3300006852 Bacteria 5247
280 Ga0075433_10067080 3300006852 Bacteria 3149
281 Ga0075433_10140455 3300006852 Unclassified 2147
282 Ga0075433_10146272 3300006852 Bacteria 2101
283 Ga0075433_10148412 3300006852 Unclassified 2085
284 Ga0075433_10160634 3300006852 Bacteria 2000
285 Ga0075434_100007920 3300006871 Bacteria 9849
286 Ga0075434_100009798 3300006871 Bacteria 8960
287 Ga0075434_100038179 3300006871 Bacteria 4757
288 Ga0075434_100057816 3300006871 Unclassified 3854
289 Ga0075434_100081914 3300006871 Bacteria 3224
290 Ga0075434_100206019 3300006871 Bacteria 1987
291 Ga0075434_100218216 3300006871 Unclassified 1927
292 Ga0075434_100383243 3300006871 Bacteria 1427
293 Ga0075429_100006227 3300006880 Bacteria 10326
294 Ga0075429_100037564 3300006880 Unclassified 4216
295 Ga0075429_100104035 3300006880 Bacteria 2479
296 Ga0068865_100018706 3300006881 Unclassified 4474
297 Ga0075436_100000002 3300006914 Bacteria 475522
298 Ga0075436_100220550 3300006914 Unclassified 1346
299 Ga0097620_100003568 3300006931 Bacteria 15854
300 Ga0097620_100011838 3300006931 Bacteria 8762
301 Ga0097620_100022678 3300006931 Bacteria 6294
302 Ga0097620_100071052 3300006931 Bacteria 3516
303 Ga0097620_100140870 3300006931 Unclassified 2485
304 Ga0097620_100535108 3300006931 Unclassified 1266
305 Ga0097620_100589138 3300006931 Bacteria 1205
306 Ga0075435_100000687 3300007076 Bacteria 20986
307 Ga0075435_100019273 3300007076 Bacteria 5207
308 Ga0075435_100329251 3300007076 Unclassified 1308
309 Ga0099794_10001085 3300007265 Bacteria 9307
310 Ga0099794_10114755 3300007265 Bacteria 1352
311 Ga0105240_10113858 3300009093 Unclassified 3268
312 Ga0105240_10351415 3300009093 Bacteria 1672
313 Ga0111539_10009788 3300009094 Bacteria 12100
314 Ga0111539_10013017 3300009094 Bacteria 10410
315 Ga0111539_10022812 3300009094 Bacteria 7688
316 Ga0111539_10024520 3300009094 Bacteria 7399
317 Ga0111539_10074668 3300009094 Bacteria 3995
318 Ga0111539_10116124 3300009094 Bacteria 3138
319 Ga0111539_10162591 3300009094 Bacteria 2611
320 Ga0111539_10268686 3300009094 Bacteria 1985
321 Ga0111539_10387075 3300009094 Bacteria 1628
322 Ga0111539_10594079 3300009094 Unclassified 1289
323 Ga0105245_10038382 3300009098 Bacteria 4261
324 Ga0105245_10043122 3300009098 Bacteria 4025
325 Ga0105247_10000002 3300009101 Bacteria 724587
326 Ga0105247_10045574 3300009101 Unclassified 2691
327 Ga0105247_10127938 3300009101 Unclassified 1653
328 Ga0105247_10148934 3300009101 Bacteria 1540
329 Ga0114129_10004880 3300009147 Bacteria 18921
330 Ga0114129_10011151 3300009147 Bacteria 12812
331 Ga0114129_10016316 3300009147 Bacteria 10572
332 Ga0114129_10017644 3300009147 Bacteria 10162
333 Ga0114129_10019919 3300009147 Bacteria 9548
334 Ga0114129_10024266 3300009147 Bacteria 8591
335 Ga0114129_10025796 3300009147 Bacteria 8324
336 Ga0114129_10033829 3300009147 Bacteria 7220
337 Ga0114129_10071082 3300009147 Bacteria 4852
338 Ga0114129_10108595 3300009147 Unclassified 3830
339 Ga0114129_10214249 3300009147 Unclassified 2602
340 Ga0114129_10263292 3300009147 Unclassified 2310
341 Ga0114129_10263548 3300009147 Bacteria 2308
342 Ga0114129_10282140 3300009147 Bacteria 2219
343 Ga0114129_10311223 3300009147 Bacteria 2096
344 Ga0114129_10313216 3300009147 Unclassified 2088
345 Ga0114129_10349888 3300009147 Unclassified 1958
346 Ga0114129_10350214 3300009147 Bacteria 1957
347 Ga0114129_10518574 3300009147 Unclassified 1554
348 Ga0114129_10738617 3300009147 Bacteria 1261
349 Ga0114129_10893761 3300009147 Unclassified 1126
350 Ga0105243_10001062 3300009148 Bacteria 25128
351 Ga0105243_10001709 3300009148 Bacteria 18920
352 Ga0105243_10082410 3300009148 Unclassified 2629
353 Ga0105243_10132597 3300009148 Unclassified 2116
354 Ga0105243_10134602 3300009148 Bacteria 2101
355 Ga0105243_10224225 3300009148 Bacteria 1663
356 Ga0105241_10028687 3300009174 Bacteria 4148
357 Ga0105241_10049962 3300009174 Bacteria 3187
358 Ga0105241_10093200 3300009174 Bacteria 2380
359 Ga0105241_10199120 3300009174 Unclassified 1672
360 Ga0105241_10293093 3300009174 Bacteria 1394
361 Ga0105242_10000301 3300009176 Bacteria 39312
362 Ga0105242_10000554 3300009176 Bacteria 29570
363 Ga0105242_10001732 3300009176 Bacteria 17229
364 Ga0105242_10017871 3300009176 Bacteria 5535
365 Ga0105242_10038649 3300009176 Bacteria 3839
366 Ga0105242_10053256 3300009176 Bacteria 3304
367 Ga0105242_10176157 3300009176 Bacteria 1883
368 Ga0105248_10001606 3300009177 Bacteria 25125
369 Ga0105248_10011136 3300009177 Bacteria 9924
370 Ga0105248_10050265 3300009177 Bacteria 4675
371 Ga0105248_10098295 3300009177 Bacteria 3297
372 Ga0105248_10099896 3300009177 Bacteria 3270
373 Ga0105248_10225484 3300009177 Unclassified 2109
374 Ga0105248_10380932 3300009177 Unclassified 1588
375 Ga0105248_10385952 3300009177 Bacteria 1577
376 Ga0105248_10662622 3300009177 Unclassified 1177
377 Ga0105237_10006126 3300009545 Bacteria 13445
378 Ga0105237_10016051 3300009545 Bacteria 7788
379 Ga0105237_10105556 3300009545 Unclassified 2808
380 Ga0105238_10001168 3300009551 Bacteria 26434
381 Ga0105238_10230856 3300009551 Bacteria 1827
382 Ga0105249_10000030 3300009553 Bacteria 221992
383 Ga0105249_10006291 3300009553 Bacteria 10315
384 Ga0105249_10030403 3300009553 Unclassified 4882
385 Ga0105249_10089815 3300009553 Bacteria 2871
386 Ga0105249_10099715 3300009553 Bacteria 2730
387 Ga0105249_10153102 3300009553 Bacteria 2222
388 Ga0105249_10153223 3300009553 Bacteria 2221
389 Ga0105239_10065865 3300010375 Bacteria 3980
390 Ga0105239_10103817 3300010375 Bacteria 3146
391 Ga0105239_10143785 3300010375 Unclassified 2659
392 Ga0105239_10411349 3300010375 Bacteria 1532
393 Ga0105246_10037155 3300011119 Unclassified 3267
394 Ga0157373_10074399 3300013100 Bacteria 2396
395 Ga0157374_10042212 3300013296 Bacteria 4206
396 Ga0157374_10062419 3300013296 Bacteria 3492
397 Ga0157374_10154521 3300013296 Bacteria 2232
398 Ga0157378_10000003 3300013297 Bacteria 203725
399 Ga0157378_10002351 3300013297 Bacteria 16810
400 Ga0157378_10005802 3300013297 Bacteria 10820
401 Ga0157378_10031425 3300013297 Unclassified 4690
402 Ga0157378_10034039 3300013297 Bacteria 4507
403 Ga0157378_10063132 3300013297 Bacteria 3309
404 Ga0157378_10071168 3300013297 Bacteria 3123
405 Ga0157378_10116415 3300013297 Bacteria 2458
406 Ga0157378_10124653 3300013297 Bacteria 2379
407 Ga0157378_10155581 3300013297 Bacteria 2134
408 Ga0157378_10167178 3300013297 Bacteria 2061
409 Ga0157378_10170340 3300013297 Unclassified 2042
410 Ga0157378_10183894 3300013297 Unclassified 1967
411 Ga0157378_10247742 3300013297 Unclassified 1705
412 Ga0157378_10360115 3300013297 Bacteria 1423
413 Ga0157378_10380608 3300013297 Bacteria 1386
414 Ga0163162_10000002 3300013306 Bacteria 717331
415 Ga0163162_10006565 3300013306 Bacteria 11271
416 Ga0163162_10008494 3300013306 Bacteria 10018
417 Ga0163162_10163488 3300013306 Bacteria 2349
418 Ga0163162_10230964 3300013306 Unclassified 1981
419 Ga0163162_10259802 3300013306 Unclassified 1868
420 Ga0157372_10053737 3300013307 Unclassified 4491
421 Ga0157372_10082066 3300013307 Unclassified 3649
422 Ga0157372_10157572 3300013307 Bacteria 2623
423 Ga0157375_10000538 3300013308 Bacteria 33986
424 Ga0157375_10003637 3300013308 Bacteria 13372
425 Ga0157375_10020780 3300013308 Bacteria 6008
426 Ga0157375_10032365 3300013308 Bacteria 4959
427 Ga0157375_10086496 3300013308 Unclassified 3185
428 Ga0157375_10242517 3300013308 Unclassified 1962
429 Ga0157375_10260123 3300013308 Bacteria 1897
430 Ga0157375_10282936 3300013308 Unclassified 1821
431 Ga0157375_10769435 3300013308 Bacteria 1113
432 Ga0163163_10002212 3300014325 Bacteria 16356
433 Ga0163163_10013520 3300014325 Bacteria 7480
434 Ga0163163_10017600 3300014325 Bacteria 6669
435 Ga0163163_10056721 3300014325 Bacteria 3871
436 Ga0163163_10080372 3300014325 Bacteria 3260
437 Ga0163163_10089429 3300014325 Bacteria 3091
438 Ga0163163_10110201 3300014325 Bacteria 2781
439 Ga0163163_10146106 3300014325 Bacteria 2408
440 Ga0163163_10152334 3300014325 Unclassified 2356
441 Ga0163163_10224435 3300014325 Bacteria 1927
442 Ga0157380_10007603 3300014326 Bacteria 7702
443 Ga0157380_10008560 3300014326 Bacteria 7315
444 Ga0157380_10025709 3300014326 Unclassified 4467
445 Ga0157380_10028077 3300014326 Bacteria 4286
446 Ga0157380_10028790 3300014326 Bacteria 4240
447 Ga0157380_10088238 3300014326 Unclassified 2551
448 Ga0157380_10225930 3300014326 Unclassified 1678
449 Ga0157380_10311359 3300014326 Bacteria 1455
450 Ga0157380_10338539 3300014326 Unclassified 1402
451 Ga0157377_10015473 3300014745 Unclassified 3905
452 Ga0157377_10025132 3300014745 Bacteria 3174
453 Ga0157379_10030607 3300014968 Unclassified 4792
454 Ga0157379_10072728 3300014968 Bacteria 3077
455 Ga0157379_10102346 3300014968 Unclassified 2571
456 Ga0157379_10114648 3300014968 Bacteria 2422
457 Ga0157379_10233713 3300014968 Bacteria 1667
458 Ga0157376_10050631 3300014969 Bacteria 3446
459 Ga0157376_10195392 3300014969 Unclassified 1858
460 Ga0157376_10320878 3300014969 Bacteria 1473
461 Ga0163161_10023713 3300017792 Bacteria 4330
462 Ga0163161_10049428 3300017792 Unclassified 3039
463 Ga0163161_10162238 3300017792 Unclassified 1704
464 Ga0207672_1000317 3300025223 Bacteria 6457
465 Ga0207656_10000196 3300025321 Bacteria 21638
466 Ga0207653_10000007 3300025885 Bacteria 198873
467 Ga0207653_10004823 3300025885 Bacteria 4218
468 Ga0207642_10003129 3300025899 Bacteria 5187
469 Ga0207642_10071003 3300025899 Bacteria 1657
470 Ga0207710_10000002 3300025900 Bacteria 1251998
471 Ga0207680_10031052 3300025903 Unclassified 3023
472 Ga0207647_10001379 3300025904 Bacteria 18664
473 Ga0207685_10000018 3300025905 Bacteria 145715
474 Ga0207645_10076169 3300025907 Unclassified 2148
475 Ga0207643_10048303 3300025908 Bacteria 2410
476 Ga0207643_10059562 3300025908 Bacteria 2178
477 Ga0207684_10000448 3300025910 Bacteria 54372
478 Ga0207684_10010854 3300025910 Bacteria 7993
479 Ga0207684_10012695 3300025910 Bacteria 7314
480 Ga0207684_10043729 3300025910 Bacteria 3798
481 Ga0207684_10111029 3300025910 Bacteria 2347
482 Ga0207654_10154231 3300025911 Bacteria 1477
483 Ga0207654_10190921 3300025911 Unclassified 1342
484 Ga0207707_10000004 3300025912 Bacteria 391281
485 Ga0207707_10016248 3300025912 Bacteria 6492
486 Ga0207707_10017642 3300025912 Bacteria 6226
487 Ga0207695_10460580 3300025913 Unclassified 1154
488 Ga0207671_10004405 3300025914 Bacteria 13490
489 Ga0207671_10074856 3300025914 Unclassified 2531
490 Ga0207660_10188717 3300025917 Bacteria 1604
491 Ga0207662_10002083 3300025918 Bacteria 9930
492 Ga0207662_10033491 3300025918 Bacteria 2995
493 Ga0207662_10074213 3300025918 Unclassified 2064
494 Ga0207649_10026095 3300025920 Unclassified 3414
495 Ga0207652_10001059 3300025921 Bacteria 25028
496 Ga0207652_10305100 3300025921 Bacteria 1437
497 Ga0207646_10001205 3300025922 Bacteria 32528
498 Ga0207646_10002372 3300025922 Bacteria 22266
499 Ga0207646_10014963 3300025922 Bacteria 7347
500 Ga0207646_10030456 3300025922 Bacteria 4891
501 Ga0207646_10035462 3300025922 Bacteria 4505
502 Ga0207646_10054762 3300025922 Bacteria 3567
503 Ga0207646_10118038 3300025922 Bacteria 2383
504 Ga0207646_10300274 3300025922 Bacteria 1451
505 Ga0207681_10006524 3300025923 Bacteria 7158
506 Ga0207681_10022001 3300025923 Bacteria 4061
507 Ga0207681_10036958 3300025923 Unclassified 3225
508 Ga0207694_10022763 3300025924 Bacteria 4753
509 Ga0207650_10000001 3300025925 Bacteria 1545726
510 Ga0207650_10001416 3300025925 Bacteria 17284
511 Ga0207650_10004340 3300025925 Bacteria 9686
512 Ga0207650_10028463 3300025925 Bacteria 4007
513 Ga0207650_10078783 3300025925 Bacteria 2494
514 Ga0207650_10116732 3300025925 Bacteria 2073
515 Ga0207650_10362002 3300025925 Unclassified 1195
516 Ga0207659_10020047 3300025926 Bacteria 4413
517 Ga0207659_10022526 3300025926 Bacteria 4194
518 Ga0207659_10056814 3300025926 Bacteria 2804
519 Ga0207644_10004396 3300025931 Bacteria 9141
520 Ga0207690_10062743 3300025932 Bacteria 2531
521 Ga0207690_10098613 3300025932 Bacteria 2081
522 Ga0207706_10029341 3300025933 Bacteria 4910
523 Ga0207706_10032899 3300025933 Bacteria 4613
524 Ga0207686_10000018 3300025934 Bacteria 189717
525 Ga0207686_10000021 3300025934 Bacteria 181793
526 Ga0207686_10000132 3300025934 Bacteria 58994
527 Ga0207686_10000436 3300025934 Bacteria 28156
528 Ga0207686_10018600 3300025934 Bacteria 3936
529 Ga0207686_10041054 3300025934 Bacteria 2818
530 Ga0207686_10114877 3300025934 Bacteria 1822
531 Ga0207709_10000069 3300025935 Bacteria 183367
532 Ga0207709_10002653 3300025935 Bacteria 11110
533 Ga0207709_10022298 3300025935 Bacteria 3591
534 Ga0207709_10059971 3300025935 Bacteria 2370
535 Ga0207670_10012844 3300025936 Bacteria 4915
536 Ga0207670_10014914 3300025936 Bacteria 4628
537 Ga0207670_10021386 3300025936 Bacteria 3991
538 Ga0207669_10212328 3300025937 Unclassified 1414
539 Ga0207665_10000131 3300025939 Bacteria 49773
540 Ga0207691_10001245 3300025940 Bacteria 25434
541 Ga0207691_10002279 3300025940 Bacteria 18787
542 Ga0207691_10010424 3300025940 Bacteria 8917
543 Ga0207711_10004416 3300025941 Bacteria 11989
544 Ga0207711_10011189 3300025941 Bacteria 7456
545 Ga0207711_10022392 3300025941 Bacteria 5283
546 Ga0207711_10063758 3300025941 Unclassified 3182
547 Ga0207711_10139037 3300025941 Unclassified 2184
548 Ga0207711_10404686 3300025941 Bacteria 1268
549 Ga0207689_10005406 3300025942 Bacteria 11431
550 Ga0207689_10007654 3300025942 Bacteria 9461
551 Ga0207689_10011776 3300025942 Bacteria 7494
552 Ga0207689_10011850 3300025942 Bacteria 7468
553 Ga0207689_10027730 3300025942 Bacteria 4740
554 Ga0207689_10031336 3300025942 Unclassified 4428
555 Ga0207689_10066328 3300025942 Bacteria 2968
556 Ga0207689_10144968 3300025942 Unclassified 1957
557 Ga0207679_10004427 3300025945 Bacteria 8748
558 Ga0207667_10325146 3300025949 Bacteria 1570
559 Ga0207651_10000598 3300025960 Bacteria 15206
560 Ga0207651_10021160 3300025960 Bacteria 3946
561 Ga0207651_10022272 3300025960 Bacteria 3870
562 Ga0207651_10028764 3300025960 Unclassified 3511
563 Ga0207651_10031957 3300025960 Bacteria 3373
564 Ga0207651_10142771 3300025960 Bacteria 1852
565 Ga0207651_10281958 3300025960 Bacteria 1374
566 Ga0207712_10000041 3300025961 Bacteria 180000
567 Ga0207712_10005221 3300025961 Bacteria 8213
568 Ga0207712_10018531 3300025961 Unclassified 4536
569 Ga0207712_10021573 3300025961 Bacteria 4230
570 Ga0207712_10094557 3300025961 Bacteria 2208
571 Ga0207712_10196191 3300025961 Unclassified 1597
572 Ga0207668_10097433 3300025972 Unclassified 2176
573 Ga0207640_10029548 3300025981 Bacteria 3366
574 Ga0207640_10216403 3300025981 Unclassified 1463
575 Ga0207658_10008335 3300025986 Bacteria 7059
576 Ga0207658_10037469 3300025986 Bacteria 3485
577 Ga0207658_10050118 3300025986 Unclassified 3071
578 Ga0207677_10000835 3300026023 Bacteria 17599
579 Ga0207703_10000150 3300026035 Bacteria 80047
580 Ga0207703_10014535 3300026035 Bacteria 6141
581 Ga0207703_10034451 3300026035 Unclassified 4017
582 Ga0207703_10059248 3300026035 Bacteria 3127
583 Ga0207703_10061887 3300026035 Unclassified 3066
584 Ga0207703_10106749 3300026035 Bacteria 2382
585 Ga0207703_10140243 3300026035 Unclassified 2097
586 Ga0207639_10040254 3300026041 Bacteria 3487
587 Ga0207639_10168606 3300026041 Bacteria 1852
588 Ga0207708_10000095 3300026075 Bacteria 67730
589 Ga0207708_10017022 3300026075 Bacteria 5472
590 Ga0207708_10025165 3300026075 Bacteria 4501
591 Ga0207708_10034363 3300026075 Unclassified 3857
592 Ga0207708_10045435 3300026075 Bacteria 3347
593 Ga0207708_10069850 3300026075 Unclassified 2689
594 Ga0207708_10080496 3300026075 Bacteria 2503
595 Ga0207708_10132620 3300026075 Unclassified 1949
596 Ga0207708_10309700 3300026075 Bacteria 1286
597 Ga0207702_10068633 3300026078 Unclassified 3046
598 Ga0207702_10086489 3300026078 Bacteria 2734
599 Ga0207641_10008925 3300026088 Bacteria 8283
600 Ga0207641_10027252 3300026088 Unclassified 4719
601 Ga0207641_10032816 3300026088 Bacteria 4312
602 Ga0207641_10072291 3300026088 Unclassified 2970
603 Ga0207641_10088979 3300026088 Unclassified 2698
604 Ga0207641_10317464 3300026088 Unclassified 1476
605 Ga0207648_10006724 3300026089 Bacteria 11406
606 Ga0207648_10060104 3300026089 Bacteria 3314
607 Ga0207648_10075163 3300026089 Bacteria 2946
608 Ga0207676_10001257 3300026095 Bacteria 18846
609 Ga0207676_10018214 3300026095 Bacteria 5101
610 Ga0207676_10022540 3300026095 Bacteria 4631
611 Ga0207676_10064738 3300026095 Bacteria 2908
612 Ga0207676_10101294 3300026095 Bacteria 2388
613 Ga0207676_10105658 3300026095 Bacteria 2344
614 Ga0207676_10128477 3300026095 Bacteria 2151
615 Ga0207676_10266820 3300026095 Unclassified 1548
616 Ga0207674_10021048 3300026116 Bacteria 7034
617 Ga0207674_10327410 3300026116 Unclassified 1482
618 Ga0207675_100001831 3300026118 Bacteria 21313
619 Ga0207675_100009031 3300026118 Bacteria 9351
620 Ga0207675_100024454 3300026118 Bacteria 5616
621 Ga0207675_100038652 3300026118 Bacteria 4453
622 Ga0207675_100120881 3300026118 Unclassified 2478
623 Ga0207675_100128388 3300026118 Unclassified 2403
624 Ga0207675_100195054 3300026118 Unclassified 1944
625 Ga0207675_100224028 3300026118 Bacteria 1812
626 Ga0207675_100224666 3300026118 Unclassified 1810
627 Ga0207683_10013365 3300026121 Bacteria 7001
628 Ga0207683_10184508 3300026121 Bacteria 1892
629 Ga0207698_10134961 3300026142 Unclassified 2116
630 Ga0207428_10001203 3300027907 Bacteria 27741
631 Ga0207428_10001442 3300027907 Bacteria 24974
632 Ga0207428_10011524 3300027907 Bacteria 7810
633 Ga0207428_10064220 3300027907 Bacteria 2899
634 Ga0207428_10089947 3300027907 Bacteria 2385
635 Ga0268265_10011947 3300028380 Bacteria 5875
636 Ga0268265_10038475 3300028380 Bacteria 3519
637 Ga0268265_10076377 3300028380 Bacteria 2628
638 Ga0268265_10323921 3300028380 Unclassified 1397
639 Ga0268264_10011660 3300028381 Bacteria 7248
640 Ga0268264_10014775 3300028381 Bacteria 6413
641 Ga0268264_10041380 3300028381 Bacteria 3812
642 Ga0268264_10043041 3300028381 Unclassified 3740
643 Ga0268264_10130668 3300028381 Bacteria 2225
644 Ga0268264_10287206 3300028381 Bacteria 1543
645 Ga0307408_100037461 3300031548 Unclassified 3416
646 Ga0307405_10033272 3300031731 Unclassified 3056
647 Ga0307405_10041484 3300031731 Bacteria 2795
648 Ga0307405_10147957 3300031731 Unclassified 1648
649 Ga0307405_10223262 3300031731 Unclassified 1384
650 Ga0307413_10004115 3300031824 Bacteria 6267
651 Ga0307410_10108672 3300031852 Bacteria 2003
652 Ga0307406_10010553 3300031901 Bacteria 5214
653 Ga0307412_10003977 3300031911 Bacteria 8234
654 Ga0307416_100073421 3300032002 Unclassified 2852
655 Ga0307416_100083873 3300032002 Unclassified 2705
656 Ga0307414_10008840 3300032004 Bacteria 5746
657 Ga0307414_10054988 3300032004 Bacteria 2785
658 Ga0307411_10143586 3300032005 Bacteria 1763
659 Ga0307415_100006325 3300032126 Bacteria 6373
660 Ga0307415_100107945 3300032126 Bacteria 2058
661 Ga0373930_0025405 3300034816 Unclassified 1189
662 Ga0373940_0019778 3300035088 Bacteria 1704
663 Ga0373951_0001697 3300035091 Bacteria 5754
664 Ga0373932_0025122 3300035112 Bacteria 1610
665 Ga0373953_0034045 3300035117 Bacteria 1996
666 Ga0373955_0082553 3300035172 Bacteria 1819
667 Ga0373961_0031650 3300035241 Bacteria 1479
668 Ga0373937_0004612 3300036401 Bacteria 11701
669 Ga0373937_0037580 3300036401 Bacteria 4413
670 Ga0395899_0140889 3300037312 Bacteria 1716
671 Ga0395900_0110968 3300037418 Bacteria 2817
672 Ga0395898_0239729 3300037466 Bacteria 1730
673 Ga0395901_0041444 3300038443 Bacteria 4772
674 Ga0439455_0015200 3300042012 Bacteria 1767
675 Ga0439458_0004057 3300042157 Unclassified 3379
676 Ga0439434_0014184 3300042435 Bacteria 2371
677 Ga0453683_0009301 3300044673 Bacteria 6568
678 Ga0453683_0022885 3300044673 Bacteria 3984
679 Ga0453684_0293472 3300044712 Bacteria 1850
680 Ga0451576_0140839 3300045051 Bacteria 2515
681 Ga0451576_0390179 3300045051 Bacteria 1459
682 Ga0495592_0002030 3300046454 Bacteria 14250
683 Ga0495610_0078973 3300046512 Bacteria 1516
684 Ga0495663_0000880 3300046525 Bacteria 10119
685 Ga0495598_0000239 3300046537 Bacteria 9795
686 Ga0495621_0001254 3300046539 Bacteria 6549
687 Ga0495621_0079195 3300046539 Unclassified 1223
688 Ga0495667_0001527 3300046559 Bacteria 15310
689 Ga0495634_0069819 3300046642 Unclassified 2317
690 Ga0495634_0188231 3300046642 Unclassified 1289
691 Ga0495657_0013716 3300046675 Bacteria 5969
692 Ga0495613_0167917 3300046689 Bacteria 1558
693 Ga0495636_0016131 3300047318 Bacteria 2981
694 Ga0495674_0041641 3300047319 Unclassified 4102
695 Ga0495674_0377534 3300047319 Bacteria 1147
696 Ga0495672_0039395 3300047320 Bacteria 2873
697 Ga0495675_0183057 3300047444 Bacteria 1282
698 Ga0495684_0121397 3300047471 Bacteria 1968
699 Ga0496102_0057261 3300048905 Unclassified 3558
700 Ga0496104_0070865 3300048907 Unclassified 3315
701 Ga0496104_0419800 3300048907 Unclassified 1250
702 Ga0496106_0000917 3300048909 Bacteria 21420
703 Ga0496106_0116263 3300048909 Bacteria 2086
704 Ga0496109_0000100 3300048912 Bacteria 89897
705 Ga0496110_0080365 3300048913 Bacteria 2905
706 Ga0496112_0199145 3300048915 Unclassified 1963
707 Ga0501290_004638 3300049513 Unclassified 1714
708 Ga0501291_000669 3300049514 Unclassified 3914
709 Ga0501291_004861 3300049514 Bacteria 1731
710 Ga0501294_003243 3300049517 Unclassified 1533
711 Ga0501295_002663 3300049518 Unclassified 2077
712 Ga0501296_000210 3300049519 Bacteria 6106
713 Ga0501298_000163 3300049521 Bacteria 8191
714 Ga0501299_002847 3300049522 Unclassified 2445
715 Ga0501299_025947 3300049522 Unclassified 1103
716 Ga0501031_0074082 3300049568 Bacteria 2217
717 Ga0501038_0001767 3300049574 Bacteria 20103
718 Ga0501038_0123813 3300049574 Unclassified 2129
719 Ga0501040_0035568 3300049576 Bacteria 3378
720 Ga0501040_0143311 3300049576 Unclassified 1684
721 Ga0501042_0031245 3300049578 Unclassified 3768
722 Ga0501048_0022363 3300049582 Unclassified 4625
723 Ga0501069_0028851 3300049585 Bacteria 3044
724 Ga0501071_0135778 3300049587 Bacteria 1830
725 Ga0501071_0169772 3300049587 Unclassified 1633
726 Ga0501071_0254963 3300049587 Bacteria 1324
727 Ga0501074_0210810 3300049590 Unclassified 1384
728 Ga0501075_0017112 3300049591 Bacteria 5233
729 Ga0501075_0109007 3300049591 Unclassified 2105
730 Ga0501076_0017789 3300049592 Bacteria 5404
731 Ga0501077_0019173 3300049593 Bacteria 4326
732 Ga0501077_0074146 3300049593 Bacteria 2156
733 Ga0501077_0157717 3300049593 Unclassified 1441
734 Ga0501201_001839 3300049651 Unclassified 1961
735 Ga0501202_004235 3300049652 Bacteria 2507
736 Ga0501202_005133 3300049652 Unclassified 2315
737 Ga0501202_008338 3300049652 Unclassified 1887
738 Ga0501202_009628 3300049652 Unclassified 1780
739 Ga0501214_003010 3300049659 Unclassified 1461
740 Ga0501216_007946 3300049660 Unclassified 1659
741 Ga0501216_010322 3300049660 Unclassified 1500
742 Ga0501217_001192 3300049661 Unclassified 4789
743 Ga0501217_004996 3300049661 Bacteria 2754
744 Ga0501217_010431 3300049661 Unclassified 2035
745 Ga0501223_009610 3300049663 Unclassified 1955
746 Ga0501224_002898 3300049664 Unclassified 2368
747 Ga0501224_005567 3300049664 Unclassified 1808
748 Ga0501227_001143 3300049665 Bacteria 5930
749 Ga0501230_006353 3300049667 Unclassified 1711
750 Ga0501233_004523 3300049668 Bacteria 2552
751 Ga0501233_005470 3300049668 Bacteria 2359
752 Ga0501233_023023 3300049668 Unclassified 1350
753 Ga0501235_002482 3300049669 Unclassified 3975
754 Ga0501235_004920 3300049669 Bacteria 2895
755 Ga0501247_005845 3300049677 Bacteria 1380
756 Ga0501249_008964 3300049679 Unclassified 2079
757 Ga0501257_020979 3300049686 Unclassified 1538
758 Ga0501259_005583 3300049688 Unclassified 1995
759 Ga0501221_010656 3300049704 Unclassified 1637
760 Ga0501225_0002541 3300049705 Bacteria 5629
761 Ga0501225_0003934 3300049705 Unclassified 4447
762 Ga0501229_003244 3300049706 Bacteria 1942
763 Ga0501234_000552 3300049707 Bacteria 5710
764 Ga0501234_003877 3300049707 Unclassified 2353
765 Ga0501234_005759 3300049707 Bacteria 1936
766 Ga0501245_005395 3300049708 Unclassified 1770
767 Ga0501079_0012525 3300049741 Bacteria 6473
768 Ga0501079_0029871 3300049741 Bacteria 4187
769 Ga0501080_0011951 3300049742 Bacteria 7953
770 Ga0501081_0021201 3300049743 Unclassified 4337
771 Ga0501083_0101595 3300049744 Bacteria 1896
772 Ga0501280_006674 3300049776 Unclassified 1623
773 Ga0501283_000161 3300049779 Bacteria 8519
774 Ga0501035_0158318 3300049822 Bacteria 1962
775 Ga0501045_0028872 3300049824 Bacteria 4004
776 Ga0501212_002182 3300049851 Bacteria 2334
777 Ga0501212_006849 3300049851 Unclassified 1547
778 Ga0501212_007525 3300049851 Unclassified 1495
779 Ga0501226_002206 3300049853 Unclassified 2403
780 nmdc:mga05p37_11175_c1 3300050507 Bacteria 10670
781 nmdc:mga05p37_168018_c1 3300050507 Bacteria 2676
782 nmdc:mga05p37_190569_c1 3300050507 Unclassified 2490
783 nmdc:mga05p37_190944_c1 3300050507 Unclassified 2487
784 nmdc:mga05p37_196143_c1 3300050507 Unclassified 2448
785 nmdc:mga05p37_2065_c1 3300050507 Bacteria 23410
786 nmdc:mga05p37_268162_c1 3300050507 Bacteria 2041
787 nmdc:mga05p37_27884_c1 3300050507 Bacteria 6880
788 nmdc:mga05p37_29589_c1 3300050507 Bacteria 6683
789 nmdc:mga05p37_425245_c1 3300050507 Unclassified 1545
790 nmdc:mga05p37_431137_c1 3300050507 Bacteria 1532
791 nmdc:mga05p37_444794_c1 3300050507 Unclassified 1502
792 nmdc:mga05p37_458728_c1 3300050507 Unclassified 1473
793 nmdc:mga05p37_459465_c1 3300050507 Bacteria 1472
794 nmdc:mga05p37_581721_c1 3300050507 Unclassified 1268
795 nmdc:mga05p37_59162_c1 3300050507 Bacteria 4719
796 nmdc:mga05p37_601327_c1 3300050507 Unclassified 1241
797 nmdc:mga09592_396881_c1 3300050508 Bacteria 1192
798 nmdc:mga09592_59549_c1 3300050508 Bacteria 3228
799 nmdc:mga09592_91985_c1 3300050508 Unclassified 2593
800 nmdc:mga0qj67_213361_c1 3300050509 Bacteria 1567
801 nmdc:mga0qj67_248169_c1 3300050509 Unclassified 1444
802 nmdc:mga0qj67_409014_c1 3300050509 Bacteria 1094
803 nmdc:mga06r32_210121_c1 3300050510 Bacteria 1934
804 nmdc:mga06r32_258155_c1 3300050510 Bacteria 1730
805 nmdc:mga06r32_265875_c1 3300050510 Unclassified 1702
806 nmdc:mga06r32_32760_c1 3300050510 Bacteria 4893
807 nmdc:mga06r32_49762_c1 3300050510 Bacteria 4009
808 nmdc:mga06r32_58304_c1 3300050510 Bacteria 3711
809 nmdc:mga08y16_125568_c1 3300050511 Unclassified 2669
810 nmdc:mga08y16_14312_c1 3300050511 Bacteria 8350
811 nmdc:mga08y16_155187_c1 3300050511 Unclassified 2379
812 nmdc:mga08y16_16214_c1 3300050511 Bacteria 7834
813 nmdc:mga08y16_165676_c1 3300050511 Bacteria 2296
814 nmdc:mga08y16_184618_c1 3300050511 Unclassified 2165
815 nmdc:mga08y16_2321_c1 3300050511 Bacteria 19497
816 nmdc:mga08y16_256643_c1 3300050511 Bacteria 1806
817 nmdc:mga08y16_31610_c1 3300050511 Bacteria 5567
818 nmdc:mga08y16_368229_c1 3300050511 Bacteria 1474
819 nmdc:mga08y16_46273_c1 3300050511 Bacteria 4555
820 nmdc:mga08y16_49419_c1 3300050511 Unclassified 4402
821 nmdc:mga0n895_106710_c1 3300050512 Unclassified 2814
822 nmdc:mga0n895_108010_c1 3300050512 Bacteria 2797
823 nmdc:mga0n895_23514_c1 3300050512 Bacteria 5793
824 nmdc:mga0n895_37099_c1 3300050512 Unclassified 4712
825 nmdc:mga0n895_45511_c1 3300050512 Unclassified 4282
826 nmdc:mga0n895_46685_c1 3300050512 Bacteria 4232
827 nmdc:mga0n895_57260_c1 3300050512 Bacteria 3841
828 nmdc:mga0n895_69017_c1 3300050512 Bacteria 3501
829 nmdc:mga0n895_7573_c1 3300050512 Bacteria 9333
830 nmdc:mga0rr50_178557_c1 3300050513 Bacteria 1734
831 nmdc:mga0rr50_202617_c1 3300050513 Unclassified 1631
832 nmdc:mga0rr50_377_c1 3300050513 Bacteria 24435
833 nmdc:mga08x19_9_c1 3300050514 Bacteria 418852
834 nmdc:mga0a205_138065_c1 3300050515 Unclassified 2338
835 nmdc:mga0a205_157987_c1 3300050515 Bacteria 2165
836 nmdc:mga0a205_18848_c1 3300050515 Bacteria 6496
837 nmdc:mga0a205_19414_c1 3300050515 Bacteria 6407
838 nmdc:mga0a205_220917_c1 3300050515 Bacteria 1780
839 nmdc:mga0a205_314794_c1 3300050515 Bacteria 1437
840 nmdc:mga0a205_34453_c1 3300050515 Unclassified 4857
841 nmdc:mga0a205_35775_c1 3300050515 Bacteria 4769
842 nmdc:mga0a205_46989_c1 3300050515 Bacteria 4164
843 nmdc:mga0a205_4815_c1 3300050515 Bacteria 12133
844 nmdc:mga0a205_499_c1 3300050515 Bacteria 30757
845 Ga0495619_0027387 3300053085 Bacteria 3670
846 Ga0500641_0022760 3300053096 Bacteria 2404
847 Ga0501084_0013070 3300054114 Bacteria 6869
848 Ga0501084_0034662 3300054114 Unclassified 4220
849 Ga0501084_0072377 3300054114 Unclassified 2887
850 Ga0501084_0281474 3300054114 Unclassified 1404
851 Ga0501082_0015213 3300060353 Bacteria 6630
852 Ga0501082_0036111 3300060353 Bacteria 4258
853 Ga0501082_0231460 3300060353 Unclassified 1608
854 Ga0530510_0053621 3300061734 Bacteria 2914
855 Ga0530510_0198060 3300061734 Bacteria 1491

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006871 Ga0075434_100057816 Ga0075434_1000578162 311
2 3300014969 Ga0157376_10320878 Ga0157376_103208781 313
3 3300005468 Ga0070707_100004557 Ga0070707_1000045579 316
4 3300025922 Ga0207646_10002372 Ga0207646_1000237210 316
5 3300050512 nmdc:mga0n895_45511_c1 nmdc:mga0n895_45511_c1_348_1358 316
6 3300049518 Ga0501295_002663 Ga0501295_002663_18_995 322
7 3300005293 Ga0065715_10161837 Ga0065715_101618372 323
8 3300006844 Ga0075428_100073725 Ga0075428_1000737252 323
9 3300006847 Ga0075431_100158080 Ga0075431_1001580802 323
10 3300006871 Ga0075434_100009798 Ga0075434_1000097985 323
11 3300006880 Ga0075429_100104035 Ga0075429_1001040353 323
12 3300007076 Ga0075435_100019273 Ga0075435_1000192734 323
13 3300009147 Ga0114129_10282140 Ga0114129_102821402 323
14 3300026118 Ga0207675_100128388 Ga0207675_1001283882 323
15 3300050507 nmdc:mga05p37_27884_c1 nmdc:mga05p37_27884_c1_5875_6861 323
16 3300050507 nmdc:mga05p37_431137_c1 nmdc:mga05p37_431137_c1_226_1212 323
17 3300050507 nmdc:mga05p37_459465_c1 nmdc:mga05p37_459465_c1_273_1259 323
18 3300050510 nmdc:mga06r32_258155_c1 nmdc:mga06r32_258155_c1_409_1395 323
19 3300050511 nmdc:mga08y16_155187_c1 nmdc:mga08y16_155187_c1_1056_2048 323
20 3300050512 nmdc:mga0n895_23514_c1 nmdc:mga0n895_23514_c1_627_1628 323
21 3300050512 nmdc:mga0n895_57260_c1 nmdc:mga0n895_57260_c1_1174_2160 323
22 3300005295 Ga0065707_10085619 Ga0065707_100856193 324
23 3300006846 Ga0075430_100146038 Ga0075430_1001460382 324
24 3300049707 Ga0501234_005759 Ga0501234_005759_668_1660 327
25 3300005549 Ga0070704_100023962 Ga0070704_1000239623 328
26 3300005937 Ga0081455_10002043 Ga0081455_100020434 328
27 3300006871 Ga0075434_100206019 Ga0075434_1002060192 328
28 3300007076 Ga0075435_100329251 Ga0075435_1003292512 328
29 3300009147 Ga0114129_10263292 Ga0114129_102632921 328
30 3300027907 Ga0207428_10011524 Ga0207428_100115242 328
31 3300046539 Ga0495621_0079195 Ga0495621_0079195_215_1213 328
32 3300048912 Ga0496109_0000100 Ga0496109_0000100_24508_25500 328
33 3300049587 Ga0501071_0254963 Ga0501071_0254963_313_1302 328
34 3300049593 Ga0501077_0074146 Ga0501077_0074146_1053_2048 328
35 3300050507 nmdc:mga05p37_581721_c1 nmdc:mga05p37_581721_c1_132_1121 328
36 3300050510 nmdc:mga06r32_49762_c1 nmdc:mga06r32_49762_c1_2686_3681 328
37 3300050511 nmdc:mga08y16_16214_c1 nmdc:mga08y16_16214_c1_2528_3523 328
38 3300050515 nmdc:mga0a205_138065_c1 nmdc:mga0a205_138065_c1_1244_2239 328
39 3300006871 Ga0075434_100383243 Ga0075434_1003832431 329
40 3300005290 Ga0065712_10087944 Ga0065712_100879443 330
41 3300005290 Ga0065712_10089765 Ga0065712_100897652 330
42 3300005335 Ga0070666_10074489 Ga0070666_100744891 330
43 3300005466 Ga0070685_10057830 Ga0070685_100578301 330
44 3300005618 Ga0068864_100031869 Ga0068864_1000318693 330
45 3300005843 Ga0068860_100036110 Ga0068860_1000361104 330
46 3300005843 Ga0068860_100215538 Ga0068860_1002155383 330
47 3300005844 Ga0068862_100123737 Ga0068862_1001237373 330
48 3300006358 Ga0068871_100101761 Ga0068871_1001017613 330
49 3300014326 Ga0157380_10028077 Ga0157380_100280775 330
50 3300025908 Ga0207643_10059562 Ga0207643_100595622 330
51 3300025926 Ga0207659_10022526 Ga0207659_100225262 330
52 3300025940 Ga0207691_10010424 Ga0207691_100104244 330
53 3300025941 Ga0207711_10011189 Ga0207711_100111894 330
54 3300025961 Ga0207712_10094557 Ga0207712_100945572 330
55 3300026095 Ga0207676_10101294 Ga0207676_101012942 330
56 3300028380 Ga0268265_10076377 Ga0268265_100763772 330
57 3300035088 Ga0373940_0019778 Ga0373940_0019778_32_1036 330
58 3300035241 Ga0373961_0031650 Ga0373961_0031650_442_1446 330
59 3300050509 nmdc:mga0qj67_409014_c1 nmdc:mga0qj67_409014_c1_80_1075 330
60 3300050511 nmdc:mga08y16_31610_c1 nmdc:mga08y16_31610_c1_2905_3915 330
61 3300042435 Ga0439434_0014184 Ga0439434_0014184_811_1809 331
62 3300048907 Ga0496104_0419800 Ga0496104_0419800_136_1146 331
63 3300025911 Ga0207654_10190921 Ga0207654_101909212 332
64 3300025960 Ga0207651_10022272 Ga0207651_100222724 332
65 3300025981 Ga0207640_10216403 Ga0207640_102164031 332
66 3300050513 nmdc:mga0rr50_178557_c1 nmdc:mga0rr50_178557_c1_512_1510 332
67 3300005289 Ga0065704_10168649 Ga0065704_101686491 333
68 3300006880 Ga0075429_100006227 Ga0075429_1000062273 333
69 3300027907 Ga0207428_10001442 Ga0207428_100014423 333
70 3300050510 nmdc:mga06r32_58304_c1 nmdc:mga06r32_58304_c1_2068_3081 333
71 3300013297 Ga0157378_10380608 Ga0157378_103806082 334
72 3300053096 Ga0500641_0022760 Ga0500641_0022760_222_1232 334
73 3300009147 Ga0114129_10313216 Ga0114129_103132162 338
74 3300050511 nmdc:mga08y16_368229_c1 nmdc:mga08y16_368229_c1_248_1300 338
75 3300050509 nmdc:mga0qj67_248169_c1 nmdc:mga0qj67_248169_c1_317_1375 339
76 3300000532 CNAas_1000548 CNAas_10005481 341
77 3300005288 Ga0065714_10064546 Ga0065714_1006454619 341
78 3300005289 Ga0065704_10010886 Ga0065704_100108862 341
79 3300005289 Ga0065704_10097714 Ga0065704_100977141 341
80 3300005290 Ga0065712_10000133 Ga0065712_1000013342 341
81 3300005290 Ga0065712_10001895 Ga0065712_100018955 341
82 3300005290 Ga0065712_10076531 Ga0065712_100765312 341
83 3300005293 Ga0065715_10002297 Ga0065715_100022976 341
84 3300005293 Ga0065715_10011249 Ga0065715_100112492 341
85 3300005293 Ga0065715_10129064 Ga0065715_101290641 341
86 3300005293 Ga0065715_10143265 Ga0065715_101432652 341
87 3300005295 Ga0065707_10002866 Ga0065707_100028666 341
88 3300005295 Ga0065707_10127137 Ga0065707_101271372 341
89 3300005328 Ga0070676_10029027 Ga0070676_100290274 341
90 3300005328 Ga0070676_10099075 Ga0070676_100990751 341
91 3300005330 Ga0070690_100003648 Ga0070690_10000364810 341
92 3300005330 Ga0070690_100009806 Ga0070690_1000098064 341
93 3300005331 Ga0070670_100042661 Ga0070670_1000426612 341
94 3300005334 Ga0068869_100003372 Ga0068869_10000337211 341
95 3300005334 Ga0068869_100011119 Ga0068869_1000111195 341
96 3300005334 Ga0068869_100074618 Ga0068869_1000746182 341
97 3300005335 Ga0070666_10068892 Ga0070666_100688923 341
98 3300005336 Ga0070680_100002583 Ga0070680_1000025839 341
99 3300005336 Ga0070680_100013103 Ga0070680_1000131032 341
100 3300005336 Ga0070680_100069302 Ga0070680_1000693022 341
101 3300005338 Ga0068868_100108009 Ga0068868_1001080092 341
102 3300005343 Ga0070687_100000989 Ga0070687_10000098910 341
103 3300005343 Ga0070687_100108426 Ga0070687_1001084262 341
104 3300005345 Ga0070692_10075052 Ga0070692_100750521 341
105 3300005353 Ga0070669_100007320 Ga0070669_1000073203 341
106 3300005354 Ga0070675_100136949 Ga0070675_1001369492 341
107 3300005355 Ga0070671_100011918 Ga0070671_1000119185 341
108 3300005355 Ga0070671_100107639 Ga0070671_1001076392 341
109 3300005364 Ga0070673_100074151 Ga0070673_1000741515 341
110 3300005364 Ga0070673_100313755 Ga0070673_1003137552 341
111 3300005367 Ga0070667_100045643 Ga0070667_1000456433 341
112 3300005367 Ga0070667_100241267 Ga0070667_1002412671 341
113 3300005406 Ga0070703_10009549 Ga0070703_100095492 341
114 3300005440 Ga0070705_100010194 Ga0070705_1000101946 341
115 3300005440 Ga0070705_100177537 Ga0070705_1001775372 341
116 3300005441 Ga0070700_100000090 Ga0070700_10000009027 341
117 3300005441 Ga0070700_100028118 Ga0070700_1000281181 341
118 3300005441 Ga0070700_100031845 Ga0070700_1000318452 341
119 3300005441 Ga0070700_100060745 Ga0070700_1000607451 341
120 3300005444 Ga0070694_100020401 Ga0070694_1000204016 341
121 3300005444 Ga0070694_100047898 Ga0070694_1000478983 341
122 3300005444 Ga0070694_100068366 Ga0070694_1000683662 341
123 3300005444 Ga0070694_100118232 Ga0070694_1001182322 341
124 3300005456 Ga0070678_100153822 Ga0070678_1001538222 341
125 3300005458 Ga0070681_10000011 Ga0070681_1000001113 341
126 3300005458 Ga0070681_10001243 Ga0070681_100012438 341
127 3300005458 Ga0070681_10035918 Ga0070681_100359182 341
128 3300005458 Ga0070681_10074750 Ga0070681_100747502 341
129 3300005459 Ga0068867_100085490 Ga0068867_1000854902 341
130 3300005459 Ga0068867_100154358 Ga0068867_1001543581 341
131 3300005466 Ga0070685_10010181 Ga0070685_100101817 341
132 3300005467 Ga0070706_100000312 Ga0070706_10000031219 341
133 3300005467 Ga0070706_100033422 Ga0070706_1000334223 341
134 3300005468 Ga0070707_100215335 Ga0070707_1002153352 341
135 3300005468 Ga0070707_100414052 Ga0070707_1004140522 341
136 3300005518 Ga0070699_100006392 Ga0070699_1000063925 341
137 3300005530 Ga0070679_100000013 Ga0070679_10000001354 341
138 3300005530 Ga0070679_100170168 Ga0070679_1001701681 341
139 3300005543 Ga0070672_100008730 Ga0070672_1000087306 341
140 3300005544 Ga0070686_100030967 Ga0070686_1000309673 341
141 3300005544 Ga0070686_100252088 Ga0070686_1002520881 341
142 3300005546 Ga0070696_100004652 Ga0070696_1000046525 341
143 3300005547 Ga0070693_100035033 Ga0070693_1000350332 341
144 3300005547 Ga0070693_100137513 Ga0070693_1001375131 341
145 3300005547 Ga0070693_100170796 Ga0070693_1001707961 341
146 3300005563 Ga0068855_100352150 Ga0068855_1003521501 341
147 3300005577 Ga0068857_100034429 Ga0068857_1000344292 341
148 3300005577 Ga0068857_100042876 Ga0068857_1000428763 341
149 3300005578 Ga0068854_100045673 Ga0068854_1000456732 341
150 3300005614 Ga0068856_100009499 Ga0068856_1000094992 341
151 3300005614 Ga0068856_100108545 Ga0068856_1001085451 341
152 3300005615 Ga0070702_100116499 Ga0070702_1001164992 341
153 3300005615 Ga0070702_100125938 Ga0070702_1001259381 341
154 3300005617 Ga0068859_100022679 Ga0068859_1000226794 341
155 3300005617 Ga0068859_100071051 Ga0068859_1000710513 341
156 3300005618 Ga0068864_100007568 Ga0068864_10000756812 341
157 3300005618 Ga0068864_100081234 Ga0068864_1000812343 341
158 3300005718 Ga0068866_10028189 Ga0068866_100281892 341
159 3300005719 Ga0068861_100125676 Ga0068861_1001256762 341
160 3300005834 Ga0068851_10017649 Ga0068851_100176493 341
161 3300005840 Ga0068870_10007877 Ga0068870_100078774 341
162 3300005841 Ga0068863_100123402 Ga0068863_1001234022 341
163 3300005841 Ga0068863_100313715 Ga0068863_1003137151 341
164 3300005842 Ga0068858_100077372 Ga0068858_1000773722 341
165 3300005842 Ga0068858_100170144 Ga0068858_1001701441 341
166 3300005843 Ga0068860_100029077 Ga0068860_1000290773 341
167 3300005843 Ga0068860_100058473 Ga0068860_1000584734 341
168 3300005844 Ga0068862_100043156 Ga0068862_1000431563 341
169 3300005844 Ga0068862_100057909 Ga0068862_1000579092 341
170 3300005844 Ga0068862_100115396 Ga0068862_1001153962 341
171 3300005985 Ga0081539_10003882 Ga0081539_100038827 341
172 3300006237 Ga0097621_100005896 Ga0097621_1000058962 341
173 3300006358 Ga0068871_100010565 Ga0068871_1000105656 341
174 3300006358 Ga0068871_100033822 Ga0068871_1000338222 341
175 3300006844 Ga0075428_100148334 Ga0075428_1001483342 341
176 3300006844 Ga0075428_100227044 Ga0075428_1002270441 341
177 3300006846 Ga0075430_100022303 Ga0075430_1000223035 341
178 3300006852 Ga0075433_10067080 Ga0075433_100670804 341
179 3300006852 Ga0075433_10148412 Ga0075433_101484122 341
180 3300006871 Ga0075434_100007920 Ga0075434_1000079203 341
181 3300006871 Ga0075434_100218216 Ga0075434_1002182161 341
182 3300006881 Ga0068865_100018706 Ga0068865_1000187064 341
183 3300006914 Ga0075436_100220550 Ga0075436_1002205501 341
184 3300006931 Ga0097620_100022678 Ga0097620_1000226784 341
185 3300006931 Ga0097620_100071052 Ga0097620_1000710523 341
186 3300009093 Ga0105240_10113858 Ga0105240_101138582 341
187 3300009093 Ga0105240_10351415 Ga0105240_103514151 341
188 3300009094 Ga0111539_10013017 Ga0111539_1001301710 341
189 3300009094 Ga0111539_10116124 Ga0111539_101161242 341
190 3300009094 Ga0111539_10162591 Ga0111539_101625911 341
191 3300009094 Ga0111539_10268686 Ga0111539_102686861 341
192 3300009094 Ga0111539_10387075 Ga0111539_103870751 341
193 3300009094 Ga0111539_10594079 Ga0111539_105940791 341
194 3300009098 Ga0105245_10043122 Ga0105245_100431224 341
195 3300009101 Ga0105247_10148934 Ga0105247_101489341 341
196 3300009147 Ga0114129_10016316 Ga0114129_1001631612 341
197 3300009147 Ga0114129_10017644 Ga0114129_100176445 341
198 3300009147 Ga0114129_10033829 Ga0114129_100338293 341
199 3300009147 Ga0114129_10071082 Ga0114129_100710823 341
200 3300009147 Ga0114129_10350214 Ga0114129_103502142 341
201 3300009147 Ga0114129_10738617 Ga0114129_107386171 341
202 3300009147 Ga0114129_10893761 Ga0114129_108937611 341
203 3300009148 Ga0105243_10134602 Ga0105243_101346021 341
204 3300009174 Ga0105241_10028687 Ga0105241_100286873 341
205 3300009174 Ga0105241_10093200 Ga0105241_100932001 341
206 3300009176 Ga0105242_10001732 Ga0105242_1000173211 341
207 3300009177 Ga0105248_10011136 Ga0105248_100111367 341
208 3300009177 Ga0105248_10099896 Ga0105248_100998965 341
209 3300009177 Ga0105248_10225484 Ga0105248_102254842 341
210 3300009177 Ga0105248_10385952 Ga0105248_103859522 341
211 3300009177 Ga0105248_10662622 Ga0105248_106626221 341
212 3300009545 Ga0105237_10006126 Ga0105237_100061268 341
213 3300009545 Ga0105237_10016051 Ga0105237_100160514 341
214 3300009545 Ga0105237_10105556 Ga0105237_101055563 341
215 3300009553 Ga0105249_10030403 Ga0105249_100304032 341
216 3300009553 Ga0105249_10099715 Ga0105249_100997152 341
217 3300010375 Ga0105239_10065865 Ga0105239_100658652 341
218 3300010375 Ga0105239_10103817 Ga0105239_101038174 341
219 3300011119 Ga0105246_10037155 Ga0105246_100371553 341
220 3300013100 Ga0157373_10074399 Ga0157373_100743991 341
221 3300013296 Ga0157374_10042212 Ga0157374_100422122 341
222 3300013297 Ga0157378_10002351 Ga0157378_100023513 341
223 3300013297 Ga0157378_10063132 Ga0157378_100631321 341
224 3300013297 Ga0157378_10124653 Ga0157378_101246532 341
225 3300013297 Ga0157378_10183894 Ga0157378_101838942 341
226 3300013306 Ga0163162_10006565 Ga0163162_1000656513 341
227 3300013306 Ga0163162_10008494 Ga0163162_1000849410 341
228 3300013306 Ga0163162_10163488 Ga0163162_101634883 341
229 3300013306 Ga0163162_10259802 Ga0163162_102598021 341
230 3300013307 Ga0157372_10053737 Ga0157372_100537372 341
231 3300013307 Ga0157372_10082066 Ga0157372_100820662 341
232 3300013307 Ga0157372_10157572 Ga0157372_101575722 341
233 3300013308 Ga0157375_10003637 Ga0157375_1000363711 341
234 3300013308 Ga0157375_10020780 Ga0157375_100207803 341
235 3300013308 Ga0157375_10769435 Ga0157375_107694351 341
236 3300014325 Ga0163163_10002212 Ga0163163_100022122 341
237 3300014325 Ga0163163_10056721 Ga0163163_100567213 341
238 3300014325 Ga0163163_10080372 Ga0163163_100803722 341
239 3300014325 Ga0163163_10089429 Ga0163163_100894292 341
240 3300014326 Ga0157380_10007603 Ga0157380_100076033 341
241 3300014326 Ga0157380_10028790 Ga0157380_100287905 341
242 3300014326 Ga0157380_10088238 Ga0157380_100882382 341
243 3300014326 Ga0157380_10338539 Ga0157380_103385392 341
244 3300014745 Ga0157377_10025132 Ga0157377_100251325 341
245 3300014968 Ga0157379_10030607 Ga0157379_100306074 341
246 3300014968 Ga0157379_10072728 Ga0157379_100727285 341
247 3300014968 Ga0157379_10114648 Ga0157379_101146482 341
248 3300014969 Ga0157376_10050631 Ga0157376_100506314 341
249 3300014969 Ga0157376_10195392 Ga0157376_101953922 341
250 3300017792 Ga0163161_10023713 Ga0163161_100237133 341
251 3300017792 Ga0163161_10049428 Ga0163161_100494284 341
252 3300025321 Ga0207656_10000196 Ga0207656_100001962 341
253 3300025885 Ga0207653_10004823 Ga0207653_100048235 341
254 3300025904 Ga0207647_10001379 Ga0207647_1000137911 341
255 3300025907 Ga0207645_10076169 Ga0207645_100761692 341
256 3300025908 Ga0207643_10048303 Ga0207643_100483032 341
257 3300025910 Ga0207684_10000448 Ga0207684_1000044833 341
258 3300025910 Ga0207684_10111029 Ga0207684_101110292 341
259 3300025911 Ga0207654_10154231 Ga0207654_101542311 341
260 3300025912 Ga0207707_10000004 Ga0207707_10000004270 341
261 3300025912 Ga0207707_10016248 Ga0207707_100162482 341
262 3300025912 Ga0207707_10017642 Ga0207707_100176426 341
263 3300025913 Ga0207695_10460580 Ga0207695_104605801 341
264 3300025914 Ga0207671_10004405 Ga0207671_1000440512 341
265 3300025914 Ga0207671_10074856 Ga0207671_100748562 341
266 3300025917 Ga0207660_10188717 Ga0207660_101887172 341
267 3300025918 Ga0207662_10002083 Ga0207662_100020833 341
268 3300025921 Ga0207652_10001059 Ga0207652_100010593 341
269 3300025923 Ga0207681_10022001 Ga0207681_100220012 341
270 3300025925 Ga0207650_10078783 Ga0207650_100787832 341
271 3300025925 Ga0207650_10116732 Ga0207650_101167322 341
272 3300025932 Ga0207690_10062743 Ga0207690_100627431 341
273 3300025933 Ga0207706_10032899 Ga0207706_100328994 341
274 3300025934 Ga0207686_10114877 Ga0207686_101148772 341
275 3300025936 Ga0207670_10012844 Ga0207670_100128443 341
276 3300025936 Ga0207670_10014914 Ga0207670_100149143 341
277 3300025940 Ga0207691_10001245 Ga0207691_100012459 341
278 3300025941 Ga0207711_10004416 Ga0207711_100044164 341
279 3300025941 Ga0207711_10022392 Ga0207711_100223924 341
280 3300025941 Ga0207711_10139037 Ga0207711_101390373 341
281 3300025941 Ga0207711_10404686 Ga0207711_104046862 341
282 3300025942 Ga0207689_10007654 Ga0207689_100076543 341
283 3300025942 Ga0207689_10011850 Ga0207689_100118505 341
284 3300025942 Ga0207689_10031336 Ga0207689_100313363 341
285 3300025942 Ga0207689_10144968 Ga0207689_101449681 341
286 3300025949 Ga0207667_10325146 Ga0207667_103251461 341
287 3300025960 Ga0207651_10142771 Ga0207651_101427711 341
288 3300025961 Ga0207712_10005221 Ga0207712_100052212 341
289 3300025961 Ga0207712_10021573 Ga0207712_100215732 341
290 3300025981 Ga0207640_10029548 Ga0207640_100295482 341
291 3300025986 Ga0207658_10050118 Ga0207658_100501182 341
292 3300026035 Ga0207703_10061887 Ga0207703_100618872 341
293 3300026035 Ga0207703_10106749 Ga0207703_101067492 341
294 3300026075 Ga0207708_10000095 Ga0207708_1000009523 341
295 3300026075 Ga0207708_10034363 Ga0207708_100343633 341
296 3300026075 Ga0207708_10080496 Ga0207708_100804962 341
297 3300026078 Ga0207702_10068633 Ga0207702_100686332 341
298 3300026078 Ga0207702_10086489 Ga0207702_100864891 341
299 3300026088 Ga0207641_10032816 Ga0207641_100328162 341
300 3300026088 Ga0207641_10317464 Ga0207641_103174642 341
301 3300026089 Ga0207648_10006724 Ga0207648_100067245 341
302 3300026089 Ga0207648_10075163 Ga0207648_100751635 341
303 3300026095 Ga0207676_10018214 Ga0207676_100182143 341
304 3300026095 Ga0207676_10022540 Ga0207676_100225402 341
305 3300026095 Ga0207676_10064738 Ga0207676_100647382 341
306 3300026095 Ga0207676_10105658 Ga0207676_101056581 341
307 3300026116 Ga0207674_10021048 Ga0207674_100210482 341
308 3300026116 Ga0207674_10327410 Ga0207674_103274101 341
309 3300026118 Ga0207675_100009031 Ga0207675_10000903111 341
310 3300026118 Ga0207675_100038652 Ga0207675_1000386525 341
311 3300026118 Ga0207675_100195054 Ga0207675_1001950542 341
312 3300026121 Ga0207683_10013365 Ga0207683_100133652 341
313 3300026121 Ga0207683_10184508 Ga0207683_101845082 341
314 3300026142 Ga0207698_10134961 Ga0207698_101349612 341
315 3300028380 Ga0268265_10038475 Ga0268265_100384753 341
316 3300028381 Ga0268264_10014775 Ga0268264_100147755 341
317 3300028381 Ga0268264_10041380 Ga0268264_100413802 341
318 3300028381 Ga0268264_10043041 Ga0268264_100430412 341
319 3300028381 Ga0268264_10130668 Ga0268264_101306682 341
320 3300031548 Ga0307408_100037461 Ga0307408_1000374613 341
321 3300031731 Ga0307405_10033272 Ga0307405_100332723 341
322 3300031731 Ga0307405_10041484 Ga0307405_100414842 341
323 3300031731 Ga0307405_10147957 Ga0307405_101479571 341
324 3300031824 Ga0307413_10004115 Ga0307413_100041155 341
325 3300031852 Ga0307410_10108672 Ga0307410_101086722 341
326 3300031901 Ga0307406_10010553 Ga0307406_100105536 341
327 3300031911 Ga0307412_10003977 Ga0307412_100039778 341
328 3300032002 Ga0307416_100073421 Ga0307416_1000734211 341
329 3300032002 Ga0307416_100083873 Ga0307416_1000838731 341
330 3300032004 Ga0307414_10008840 Ga0307414_100088403 341
331 3300032004 Ga0307414_10054988 Ga0307414_100549883 341
332 3300032005 Ga0307411_10143586 Ga0307411_101435862 341
333 3300032126 Ga0307415_100006325 Ga0307415_1000063252 341
334 3300037418 Ga0395900_0110968 Ga0395900_0110968_744_1775 341
335 3300037466 Ga0395898_0239729 Ga0395898_0239729_630_1664 341
336 3300038443 Ga0395901_0041444 Ga0395901_0041444_2252_3283 341
337 3300042012 Ga0439455_0015200 Ga0439455_0015200_529_1560 341
338 3300042157 Ga0439458_0004057 Ga0439458_0004057_26_1057 341
339 3300048905 Ga0496102_0057261 Ga0496102_0057261_1190_2224 341
340 3300048909 Ga0496106_0116263 Ga0496106_0116263_241_1269 341
341 3300048913 Ga0496110_0080365 Ga0496110_0080365_430_1464 341
342 3300048915 Ga0496112_0199145 Ga0496112_0199145_99_1133 341
343 3300049513 Ga0501290_004638 Ga0501290_004638_99_1133 341
344 3300049514 Ga0501291_000669 Ga0501291_000669_1679_2713 341
345 3300049514 Ga0501291_004861 Ga0501291_004861_136_1170 341
346 3300049517 Ga0501294_003243 Ga0501294_003243_418_1452 341
347 3300049519 Ga0501296_000210 Ga0501296_000210_850_1884 341
348 3300049521 Ga0501298_000163 Ga0501298_000163_1337_2371 341
349 3300049522 Ga0501299_002847 Ga0501299_002847_576_1610 341
350 3300049522 Ga0501299_025947 Ga0501299_025947_31_1065 341
351 3300049574 Ga0501038_0001767 Ga0501038_0001767_3837_4871 341
352 3300049593 Ga0501077_0157717 Ga0501077_0157717_232_1266 341
353 3300049651 Ga0501201_001839 Ga0501201_001839_352_1386 341
354 3300049652 Ga0501202_004235 Ga0501202_004235_441_1472 341
355 3300049652 Ga0501202_005133 Ga0501202_005133_841_1869 341
356 3300049652 Ga0501202_008338 Ga0501202_008338_678_1712 341
357 3300049652 Ga0501202_009628 Ga0501202_009628_649_1683 341
358 3300049659 Ga0501214_003010 Ga0501214_003010_29_1060 341
359 3300049660 Ga0501216_007946 Ga0501216_007946_128_1162 341
360 3300049660 Ga0501216_010322 Ga0501216_010322_199_1233 341
361 3300049661 Ga0501217_001192 Ga0501217_001192_3583_4614 341
362 3300049661 Ga0501217_004996 Ga0501217_004996_202_1236 341
363 3300049661 Ga0501217_010431 Ga0501217_010431_778_1812 341
364 3300049663 Ga0501223_009610 Ga0501223_009610_194_1228 341
365 3300049664 Ga0501224_002898 Ga0501224_002898_488_1519 341
366 3300049664 Ga0501224_005567 Ga0501224_005567_734_1768 341
367 3300049665 Ga0501227_001143 Ga0501227_001143_4566_5597 341
368 3300049667 Ga0501230_006353 Ga0501230_006353_410_1441 341
369 3300049668 Ga0501233_004523 Ga0501233_004523_931_1965 341
370 3300049668 Ga0501233_005470 Ga0501233_005470_535_1566 341
371 3300049668 Ga0501233_023023 Ga0501233_023023_126_1160 341
372 3300049669 Ga0501235_002482 Ga0501235_002482_2327_3358 341
373 3300049669 Ga0501235_004920 Ga0501235_004920_177_1211 341
374 3300049677 Ga0501247_005845 Ga0501247_005845_164_1198 341
375 3300049679 Ga0501249_008964 Ga0501249_008964_121_1155 341
376 3300049686 Ga0501257_020979 Ga0501257_020979_252_1286 341
377 3300049688 Ga0501259_005583 Ga0501259_005583_238_1272 341
378 3300049704 Ga0501221_010656 Ga0501221_010656_198_1229 341
379 3300049705 Ga0501225_0002541 Ga0501225_0002541_2208_3239 341
380 3300049705 Ga0501225_0003934 Ga0501225_0003934_1015_2049 341
381 3300049706 Ga0501229_003244 Ga0501229_003244_627_1658 341
382 3300049707 Ga0501234_000552 Ga0501234_000552_488_1519 341
383 3300049707 Ga0501234_003877 Ga0501234_003877_870_1904 341
384 3300049708 Ga0501245_005395 Ga0501245_005395_160_1194 341
385 3300049776 Ga0501280_006674 Ga0501280_006674_26_1060 341
386 3300049779 Ga0501283_000161 Ga0501283_000161_6659_7693 341
387 3300049851 Ga0501212_002182 Ga0501212_002182_404_1435 341
388 3300049851 Ga0501212_006849 Ga0501212_006849_99_1133 341
389 3300049851 Ga0501212_007525 Ga0501212_007525_384_1418 341
390 3300049853 Ga0501226_002206 Ga0501226_002206_838_1869 341
391 3300050507 nmdc:mga05p37_11175_c1 nmdc:mga05p37_11175_c1_5626_6660 341
392 3300050507 nmdc:mga05p37_196143_c1 nmdc:mga05p37_196143_c1_99_1133 341
393 3300050507 nmdc:mga05p37_425245_c1 nmdc:mga05p37_425245_c1_141_1175 341
394 3300050507 nmdc:mga05p37_59162_c1 nmdc:mga05p37_59162_c1_1885_2919 341
395 3300050507 nmdc:mga05p37_601327_c1 nmdc:mga05p37_601327_c1_31_1062 341
396 3300050508 nmdc:mga09592_396881_c1 nmdc:mga09592_396881_c1_123_1157 341
397 3300050509 nmdc:mga0qj67_213361_c1 nmdc:mga0qj67_213361_c1_103_1137 341
398 3300050510 nmdc:mga06r32_265875_c1 nmdc:mga06r32_265875_c1_359_1390 341
399 3300050511 nmdc:mga08y16_125568_c1 nmdc:mga08y16_125568_c1_473_1507 341
400 3300050511 nmdc:mga08y16_165676_c1 nmdc:mga08y16_165676_c1_544_1578 341
401 3300050511 nmdc:mga08y16_46273_c1 nmdc:mga08y16_46273_c1_213_1247 341
402 3300050512 nmdc:mga0n895_106710_c1 nmdc:mga0n895_106710_c1_1514_2548 341
403 3300050512 nmdc:mga0n895_108010_c1 nmdc:mga0n895_108010_c1_1675_2706 341
404 3300050512 nmdc:mga0n895_69017_c1 nmdc:mga0n895_69017_c1_698_1726 341
405 3300050513 nmdc:mga0rr50_202617_c1 nmdc:mga0rr50_202617_c1_139_1167 341
406 3300050515 nmdc:mga0a205_19414_c1 nmdc:mga0a205_19414_c1_2369_3403 341
407 3300050515 nmdc:mga0a205_34453_c1 nmdc:mga0a205_34453_c1_2197_3228 341
408 3300061734 Ga0530510_0198060 Ga0530510_0198060_293_1327 341
409 2162886007 SwRhRL2b_contig_151632 SwRhRL2b_0003.00000820 342
410 3300002459 JGI24751J29686_10000040 JGI24751J29686_1000004028 342
411 3300003203 JGI25406J46586_10003181 JGI25406J46586_100031812 342
412 3300005290 Ga0065712_10007455 Ga0065712_100074553 342
413 3300005290 Ga0065712_10073016 Ga0065712_100730163 342
414 3300005295 Ga0065707_10001920 Ga0065707_100019209 342
415 3300005295 Ga0065707_10092600 Ga0065707_100926005 342
416 3300005330 Ga0070690_100002855 Ga0070690_1000028554 342
417 3300005331 Ga0070670_100000225 Ga0070670_10000022528 342
418 3300005331 Ga0070670_100007289 Ga0070670_1000072897 342
419 3300005331 Ga0070670_100024832 Ga0070670_1000248324 342
420 3300005331 Ga0070670_100253666 Ga0070670_1002536662 342
421 3300005331 Ga0070670_100286235 Ga0070670_1002862351 342
422 3300005336 Ga0070680_100226082 Ga0070680_1002260822 342
423 3300005337 Ga0070682_100000687 Ga0070682_10000068712 342
424 3300005337 Ga0070682_100007382 Ga0070682_1000073823 342
425 3300005353 Ga0070669_100004916 Ga0070669_10000491613 342
426 3300005353 Ga0070669_100013652 Ga0070669_1000136521 342
427 3300005354 Ga0070675_100011584 Ga0070675_1000115848 342
428 3300005354 Ga0070675_100024762 Ga0070675_1000247626 342
429 3300005364 Ga0070673_100000896 Ga0070673_1000008962 342
430 3300005365 Ga0070688_100006011 Ga0070688_1000060112 342
431 3300005367 Ga0070667_100004875 Ga0070667_1000048754 342
432 3300005441 Ga0070700_100095453 Ga0070700_1000954532 342
433 3300005444 Ga0070694_100042190 Ga0070694_1000421901 342
434 3300005444 Ga0070694_100185259 Ga0070694_1001852592 342
435 3300005444 Ga0070694_100237321 Ga0070694_1002373211 342
436 3300005459 Ga0068867_100108447 Ga0068867_1001084472 342
437 3300005466 Ga0070685_10005103 Ga0070685_100051035 342
438 3300005468 Ga0070707_100227929 Ga0070707_1002279291 342
439 3300005471 Ga0070698_100016433 Ga0070698_1000164336 342
440 3300005530 Ga0070679_100347636 Ga0070679_1003476361 342
441 3300005536 Ga0070697_100010463 Ga0070697_1000104635 342
442 3300005536 Ga0070697_100334660 Ga0070697_1003346601 342
443 3300005543 Ga0070672_100005650 Ga0070672_1000056508 342
444 3300005544 Ga0070686_100011736 Ga0070686_1000117362 342
445 3300005544 Ga0070686_100040560 Ga0070686_1000405602 342
446 3300005544 Ga0070686_100093818 Ga0070686_1000938182 342
447 3300005545 Ga0070695_100046494 Ga0070695_1000464943 342
448 3300005545 Ga0070695_100088274 Ga0070695_1000882742 342
449 3300005545 Ga0070695_100215278 Ga0070695_1002152781 342
450 3300005548 Ga0070665_100155992 Ga0070665_1001559922 342
451 3300005549 Ga0070704_100085418 Ga0070704_1000854182 342
452 3300005577 Ga0068857_100169286 Ga0068857_1001692863 342
453 3300005577 Ga0068857_100276358 Ga0068857_1002763582 342
454 3300005615 Ga0070702_100042468 Ga0070702_1000424682 342
455 3300005617 Ga0068859_100011838 Ga0068859_10001183810 342
456 3300005617 Ga0068859_100140866 Ga0068859_1001408661 342
457 3300005617 Ga0068859_100535048 Ga0068859_1005350482 342
458 3300005617 Ga0068859_100589112 Ga0068859_1005891122 342
459 3300005618 Ga0068864_100253631 Ga0068864_1002536312 342
460 3300005719 Ga0068861_100052526 Ga0068861_1000525266 342
461 3300005719 Ga0068861_100093034 Ga0068861_1000930342 342
462 3300005719 Ga0068861_100369880 Ga0068861_1003698801 342
463 3300005841 Ga0068863_100024162 Ga0068863_1000241626 342
464 3300005842 Ga0068858_100037873 Ga0068858_1000378737 342
465 3300005843 Ga0068860_100298300 Ga0068860_1002983002 342
466 3300005844 Ga0068862_100149272 Ga0068862_1001492722 342
467 3300005985 Ga0081539_10002465 Ga0081539_1000246515 342
468 3300006237 Ga0097621_100121494 Ga0097621_1001214942 342
469 3300006844 Ga0075428_100060654 Ga0075428_1000606543 342
470 3300006844 Ga0075428_100088917 Ga0075428_1000889172 342
471 3300006844 Ga0075428_100093182 Ga0075428_1000931825 342
472 3300006844 Ga0075428_100233906 Ga0075428_1002339062 342
473 3300006844 Ga0075428_100468093 Ga0075428_1004680932 342
474 3300006846 Ga0075430_100122287 Ga0075430_1001222872 342
475 3300006846 Ga0075430_100277763 Ga0075430_1002777632 342
476 3300006847 Ga0075431_100071017 Ga0075431_1000710172 342
477 3300006847 Ga0075431_100200862 Ga0075431_1002008621 342
478 3300006852 Ga0075433_10005017 Ga0075433_1000501712 342
479 3300006852 Ga0075433_10010069 Ga0075433_100100692 342
480 3300006852 Ga0075433_10020245 Ga0075433_100202455 342
481 3300006852 Ga0075433_10140455 Ga0075433_101404551 342
482 3300006871 Ga0075434_100081914 Ga0075434_1000819142 342
483 3300006880 Ga0075429_100037564 Ga0075429_1000375642 342
484 3300006931 Ga0097620_100011838 Ga0097620_10001183810 342
485 3300006931 Ga0097620_100140870 Ga0097620_1001408703 342
486 3300006931 Ga0097620_100535108 Ga0097620_1005351082 342
487 3300006931 Ga0097620_100589138 Ga0097620_1005891382 342
488 3300007265 Ga0099794_10114755 Ga0099794_101147552 342
489 3300009094 Ga0111539_10009788 Ga0111539_100097885 342
490 3300009094 Ga0111539_10024520 Ga0111539_100245206 342
491 3300009094 Ga0111539_10074668 Ga0111539_100746682 342
492 3300009101 Ga0105247_10045574 Ga0105247_100455742 342
493 3300009147 Ga0114129_10004880 Ga0114129_100048807 342
494 3300009147 Ga0114129_10011151 Ga0114129_1001115110 342
495 3300009147 Ga0114129_10019919 Ga0114129_100199193 342
496 3300009147 Ga0114129_10025796 Ga0114129_100257965 342
497 3300009147 Ga0114129_10214249 Ga0114129_102142492 342
498 3300009147 Ga0114129_10263548 Ga0114129_102635482 342
499 3300009147 Ga0114129_10311223 Ga0114129_103112232 342
500 3300009147 Ga0114129_10349888 Ga0114129_103498882 342
501 3300009147 Ga0114129_10518574 Ga0114129_105185742 342
502 3300009174 Ga0105241_10199120 Ga0105241_101991202 342
503 3300009176 Ga0105242_10038649 Ga0105242_100386492 342
504 3300009176 Ga0105242_10176157 Ga0105242_101761572 342
505 3300009177 Ga0105248_10050265 Ga0105248_100502651 342
506 3300009177 Ga0105248_10098295 Ga0105248_100982951 342
507 3300009551 Ga0105238_10001168 Ga0105238_1000116821 342
508 3300009551 Ga0105238_10230856 Ga0105238_102308562 342
509 3300009553 Ga0105249_10089815 Ga0105249_100898152 342
510 3300009553 Ga0105249_10153102 Ga0105249_101531022 342
511 3300009553 Ga0105249_10153223 Ga0105249_101532232 342
512 3300010375 Ga0105239_10143785 Ga0105239_101437851 342
513 3300013296 Ga0157374_10062419 Ga0157374_100624192 342
514 3300013297 Ga0157378_10031425 Ga0157378_100314252 342
515 3300013297 Ga0157378_10116415 Ga0157378_101164152 342
516 3300013297 Ga0157378_10155581 Ga0157378_101555812 342
517 3300013297 Ga0157378_10170340 Ga0157378_101703401 342
518 3300013297 Ga0157378_10247742 Ga0157378_102477422 342
519 3300013297 Ga0157378_10360115 Ga0157378_103601152 342
520 3300013308 Ga0157375_10032365 Ga0157375_100323656 342
521 3300013308 Ga0157375_10086496 Ga0157375_100864963 342
522 3300013308 Ga0157375_10242517 Ga0157375_102425171 342
523 3300014325 Ga0163163_10017600 Ga0163163_100176003 342
524 3300014325 Ga0163163_10224435 Ga0163163_102244351 342
525 3300014326 Ga0157380_10008560 Ga0157380_100085609 342
526 3300014326 Ga0157380_10025709 Ga0157380_100257092 342
527 3300014326 Ga0157380_10225930 Ga0157380_102259302 342
528 3300014326 Ga0157380_10311359 Ga0157380_103113592 342
529 3300025899 Ga0207642_10071003 Ga0207642_100710031 342
530 3300025921 Ga0207652_10305100 Ga0207652_103051001 342
531 3300025922 Ga0207646_10030456 Ga0207646_100304565 342
532 3300025923 Ga0207681_10006524 Ga0207681_100065245 342
533 3300025923 Ga0207681_10036958 Ga0207681_100369581 342
534 3300025924 Ga0207694_10022763 Ga0207694_100227634 342
535 3300025925 Ga0207650_10000001 Ga0207650_100000011135 342
536 3300025925 Ga0207650_10004340 Ga0207650_100043407 342
537 3300025925 Ga0207650_10028463 Ga0207650_100284632 342
538 3300025926 Ga0207659_10020047 Ga0207659_100200472 342
539 3300025926 Ga0207659_10056814 Ga0207659_100568142 342
540 3300025932 Ga0207690_10098613 Ga0207690_100986132 342
541 3300025933 Ga0207706_10029341 Ga0207706_100293414 342
542 3300025934 Ga0207686_10018600 Ga0207686_100186004 342
543 3300025935 Ga0207709_10022298 Ga0207709_100222982 342
544 3300025936 Ga0207670_10021386 Ga0207670_100213864 342
545 3300025937 Ga0207669_10212328 Ga0207669_102123281 342
546 3300025941 Ga0207711_10063758 Ga0207711_100637583 342
547 3300025960 Ga0207651_10000598 Ga0207651_100005987 342
548 3300025960 Ga0207651_10021160 Ga0207651_100211604 342
549 3300025960 Ga0207651_10031957 Ga0207651_100319574 342
550 3300025960 Ga0207651_10281958 Ga0207651_102819582 342
551 3300025961 Ga0207712_10018531 Ga0207712_100185312 342
552 3300025961 Ga0207712_10196191 Ga0207712_101961912 342
553 3300025986 Ga0207658_10008335 Ga0207658_100083356 342
554 3300026035 Ga0207703_10059248 Ga0207703_100592482 342
555 3300026035 Ga0207703_10140243 Ga0207703_101402432 342
556 3300026041 Ga0207639_10040254 Ga0207639_100402542 342
557 3300026041 Ga0207639_10168606 Ga0207639_101686062 342
558 3300026075 Ga0207708_10025165 Ga0207708_100251657 342
559 3300026075 Ga0207708_10045435 Ga0207708_100454352 342
560 3300026075 Ga0207708_10069850 Ga0207708_100698502 342
561 3300026075 Ga0207708_10132620 Ga0207708_101326202 342
562 3300026075 Ga0207708_10309700 Ga0207708_103097002 342
563 3300026088 Ga0207641_10008925 Ga0207641_100089256 342
564 3300026088 Ga0207641_10072291 Ga0207641_100722913 342
565 3300026088 Ga0207641_10088979 Ga0207641_100889792 342
566 3300026089 Ga0207648_10060104 Ga0207648_100601045 342
567 3300026095 Ga0207676_10128477 Ga0207676_101284772 342
568 3300026095 Ga0207676_10266820 Ga0207676_102668201 342
569 3300026118 Ga0207675_100024454 Ga0207675_1000244543 342
570 3300026118 Ga0207675_100224666 Ga0207675_1002246662 342
571 3300027907 Ga0207428_10001203 Ga0207428_1000120311 342
572 3300027907 Ga0207428_10064220 Ga0207428_100642202 342
573 3300027907 Ga0207428_10089947 Ga0207428_100899472 342
574 3300028380 Ga0268265_10011947 Ga0268265_100119475 342
575 3300028380 Ga0268265_10323921 Ga0268265_103239212 342
576 3300028381 Ga0268264_10011660 Ga0268264_100116605 342
577 3300035091 Ga0373951_0001697 Ga0373951_0001697_2282_3328 342
578 3300035172 Ga0373955_0082553 Ga0373955_0082553_383_1426 342
579 3300037312 Ga0395899_0140889 Ga0395899_0140889_335_1369 342
580 3300045051 Ga0451576_0140839 Ga0451576_0140839_1424_2455 342
581 3300046512 Ga0495610_0078973 Ga0495610_0078973_346_1386 342
582 3300046525 Ga0495663_0000880 Ga0495663_0000880_1958_2998 342
583 3300046537 Ga0495598_0000239 Ga0495598_0000239_427_1467 342
584 3300046539 Ga0495621_0001254 Ga0495621_0001254_1382_2422 342
585 3300046689 Ga0495613_0167917 Ga0495613_0167917_194_1237 342
586 3300048907 Ga0496104_0070865 Ga0496104_0070865_1786_2826 342
587 3300049568 Ga0501031_0074082 Ga0501031_0074082_576_1607 342
588 3300049574 Ga0501038_0123813 Ga0501038_0123813_214_1245 342
589 3300049576 Ga0501040_0035568 Ga0501040_0035568_568_1599 342
590 3300049576 Ga0501040_0143311 Ga0501040_0143311_553_1593 342
591 3300049578 Ga0501042_0031245 Ga0501042_0031245_1407_2438 342
592 3300049582 Ga0501048_0022363 Ga0501048_0022363_364_1395 342
593 3300049585 Ga0501069_0028851 Ga0501069_0028851_1521_2552 342
594 3300049587 Ga0501071_0135778 Ga0501071_0135778_513_1544 342
595 3300049587 Ga0501071_0169772 Ga0501071_0169772_271_1302 342
596 3300049590 Ga0501074_0210810 Ga0501074_0210810_161_1192 342
597 3300049591 Ga0501075_0017112 Ga0501075_0017112_1555_2586 342
598 3300049591 Ga0501075_0109007 Ga0501075_0109007_76_1107 342
599 3300049592 Ga0501076_0017789 Ga0501076_0017789_1523_2554 342
600 3300049593 Ga0501077_0019173 Ga0501077_0019173_50_1081 342
601 3300049741 Ga0501079_0012525 Ga0501079_0012525_2850_3881 342
602 3300049741 Ga0501079_0029871 Ga0501079_0029871_276_1307 342
603 3300049742 Ga0501080_0011951 Ga0501080_0011951_1307_2338 342
604 3300049743 Ga0501081_0021201 Ga0501081_0021201_1577_2608 342
605 3300049744 Ga0501083_0101595 Ga0501083_0101595_348_1379 342
606 3300049822 Ga0501035_0158318 Ga0501035_0158318_148_1179 342
607 3300049824 Ga0501045_0028872 Ga0501045_0028872_1610_2641 342
608 3300050507 nmdc:mga05p37_168018_c1 nmdc:mga05p37_168018_c1_185_1237 342
609 3300050507 nmdc:mga05p37_2065_c1 nmdc:mga05p37_2065_c1_15559_16602 342
610 3300050507 nmdc:mga05p37_268162_c1 nmdc:mga05p37_268162_c1_184_1215 342
611 3300050507 nmdc:mga05p37_29589_c1 nmdc:mga05p37_29589_c1_2934_3992 342
612 3300050507 nmdc:mga05p37_444794_c1 nmdc:mga05p37_444794_c1_346_1386 342
613 3300050508 nmdc:mga09592_59549_c1 nmdc:mga09592_59549_c1_243_1274 342
614 3300050510 nmdc:mga06r32_210121_c1 nmdc:mga06r32_210121_c1_161_1192 342
615 3300050510 nmdc:mga06r32_32760_c1 nmdc:mga06r32_32760_c1_2961_3992 342
616 3300050511 nmdc:mga08y16_184618_c1 nmdc:mga08y16_184618_c1_201_1232 342
617 3300050511 nmdc:mga08y16_2321_c1 nmdc:mga08y16_2321_c1_11231_12283 342
618 3300050511 nmdc:mga08y16_256643_c1 nmdc:mga08y16_256643_c1_653_1684 342
619 3300050512 nmdc:mga0n895_37099_c1 nmdc:mga0n895_37099_c1_1588_2619 342
620 3300050512 nmdc:mga0n895_7573_c1 nmdc:mga0n895_7573_c1_3456_4499 342
621 3300050515 nmdc:mga0a205_220917_c1 nmdc:mga0a205_220917_c1_272_1303 342
622 3300050515 nmdc:mga0a205_314794_c1 nmdc:mga0a205_314794_c1_363_1415 342
623 3300050515 nmdc:mga0a205_4815_c1 nmdc:mga0a205_4815_c1_805_1836 342
624 3300054114 Ga0501084_0013070 Ga0501084_0013070_5027_6058 342
625 3300054114 Ga0501084_0034662 Ga0501084_0034662_534_1565 342
626 3300054114 Ga0501084_0072377 Ga0501084_0072377_625_1662 342
627 3300054114 Ga0501084_0281474 Ga0501084_0281474_68_1108 342
628 3300060353 Ga0501082_0015213 Ga0501082_0015213_483_1514 342
629 3300060353 Ga0501082_0036111 Ga0501082_0036111_1458_2489 342
630 3300060353 Ga0501082_0231460 Ga0501082_0231460_295_1326 342
631 3300061734 Ga0530510_0053621 Ga0530510_0053621_1784_2815 342
632 3300005330 Ga0070690_100001019 Ga0070690_10000101911 343
633 3300005331 Ga0070670_100001528 Ga0070670_10000152810 343
634 3300005333 Ga0070677_10098780 Ga0070677_100987802 343
635 3300005338 Ga0068868_100000238 Ga0068868_10000023820 343
636 3300005344 Ga0070661_100008110 Ga0070661_1000081107 343
637 3300005347 Ga0070668_100098853 Ga0070668_1000988532 343
638 3300005354 Ga0070675_100017185 Ga0070675_1000171856 343
639 3300005355 Ga0070671_100022400 Ga0070671_1000224005 343
640 3300005364 Ga0070673_100050859 Ga0070673_1000508593 343
641 3300005367 Ga0070667_100001127 Ga0070667_10000112715 343
642 3300005434 Ga0070709_10209482 Ga0070709_102094822 343
643 3300005445 Ga0070708_100094887 Ga0070708_1000948872 343
644 3300005456 Ga0070678_100164643 Ga0070678_1001646432 343
645 3300005466 Ga0070685_10107919 Ga0070685_101079192 343
646 3300005467 Ga0070706_100268017 Ga0070706_1002680172 343
647 3300005467 Ga0070706_100507618 Ga0070706_1005076181 343
648 3300005471 Ga0070698_100000398 Ga0070698_10000039830 343
649 3300005543 Ga0070672_100000998 Ga0070672_1000009987 343
650 3300005544 Ga0070686_100011105 Ga0070686_1000111052 343
651 3300005564 Ga0070664_100001082 Ga0070664_1000010823 343
652 3300005618 Ga0068864_100000368 Ga0068864_10000036835 343
653 3300005841 Ga0068863_100022102 Ga0068863_1000221021 343
654 3300005841 Ga0068863_100031683 Ga0068863_1000316835 343
655 3300005842 Ga0068858_100011012 Ga0068858_1000110123 343
656 3300006173 Ga0070716_100000046 Ga0070716_10000004626 343
657 3300006358 Ga0068871_100059286 Ga0068871_1000592863 343
658 3300006358 Ga0068871_100259361 Ga0068871_1002593612 343
659 3300006844 Ga0075428_100142765 Ga0075428_1001427652 343
660 3300006847 Ga0075431_100085225 Ga0075431_1000852252 343
661 3300009148 Ga0105243_10132597 Ga0105243_101325972 343
662 3300009176 Ga0105242_10053256 Ga0105242_100532563 343
663 3300009177 Ga0105248_10001606 Ga0105248_1000160613 343
664 3300009553 Ga0105249_10000030 Ga0105249_10000030164 343
665 3300013296 Ga0157374_10154521 Ga0157374_101545212 343
666 3300013306 Ga0163162_10000002 Ga0163162_10000002163 343
667 3300013308 Ga0157375_10000538 Ga0157375_1000053817 343
668 3300013308 Ga0157375_10260123 Ga0157375_102601232 343
669 3300013308 Ga0157375_10282936 Ga0157375_102829362 343
670 3300014325 Ga0163163_10013520 Ga0163163_100135209 343
671 3300014325 Ga0163163_10110201 Ga0163163_101102012 343
672 3300014325 Ga0163163_10146106 Ga0163163_101461062 343
673 3300014745 Ga0157377_10015473 Ga0157377_100154732 343
674 3300014968 Ga0157379_10102346 Ga0157379_101023462 343
675 3300025903 Ga0207680_10031052 Ga0207680_100310522 343
676 3300025920 Ga0207649_10026095 Ga0207649_100260952 343
677 3300025922 Ga0207646_10300274 Ga0207646_103002741 343
678 3300025925 Ga0207650_10001416 Ga0207650_100014167 343
679 3300025934 Ga0207686_10041054 Ga0207686_100410543 343
680 3300025939 Ga0207665_10000131 Ga0207665_1000013116 343
681 3300025940 Ga0207691_10002279 Ga0207691_1000227911 343
682 3300025945 Ga0207679_10004427 Ga0207679_100044272 343
683 3300025960 Ga0207651_10028764 Ga0207651_100287643 343
684 3300025961 Ga0207712_10000041 Ga0207712_10000041120 343
685 3300025972 Ga0207668_10097433 Ga0207668_100974332 343
686 3300025986 Ga0207658_10037469 Ga0207658_100374693 343
687 3300026023 Ga0207677_10000835 Ga0207677_1000083510 343
688 3300026035 Ga0207703_10014535 Ga0207703_100145356 343
689 3300026088 Ga0207641_10027252 Ga0207641_100272525 343
690 3300026095 Ga0207676_10001257 Ga0207676_1000125711 343
691 3300032126 Ga0307415_100107945 Ga0307415_1001079452 343
692 3300035117 Ga0373953_0034045 Ga0373953_0034045_670_1713 343
693 3300036401 Ga0373937_0004612 Ga0373937_0004612_3237_4280 343
694 3300036401 Ga0373937_0037580 Ga0373937_0037580_102_1145 343
695 3300044673 Ga0453683_0022885 Ga0453683_0022885_113_1144 343
696 3300046454 Ga0495592_0002030 Ga0495592_0002030_7179_8222 343
697 3300046559 Ga0495667_0001527 Ga0495667_0001527_7476_8519 343
698 3300046642 Ga0495634_0188231 Ga0495634_0188231_88_1131 343
699 3300046675 Ga0495657_0013716 Ga0495657_0013716_4750_5793 343
700 3300047318 Ga0495636_0016131 Ga0495636_0016131_259_1302 343
701 3300047319 Ga0495674_0041641 Ga0495674_0041641_1970_3013 343
702 3300047319 Ga0495674_0377534 Ga0495674_0377534_65_1108 343
703 3300047444 Ga0495675_0183057 Ga0495675_0183057_60_1103 343
704 3300047471 Ga0495684_0121397 Ga0495684_0121397_873_1916 343
705 3300050515 nmdc:mga0a205_35775_c1 nmdc:mga0a205_35775_c1_1542_2591 343
706 3300053085 Ga0495619_0027387 Ga0495619_0027387_1775_2818 343
707 3300005293 Ga0065715_10092350 Ga0065715_100923503 344
708 3300005295 Ga0065707_10002307 Ga0065707_100023073 344
709 3300005334 Ga0068869_100003484 Ga0068869_1000034846 344
710 3300005334 Ga0068869_100013921 Ga0068869_1000139212 344
711 3300005444 Ga0070694_100049593 Ga0070694_1000495932 344
712 3300005467 Ga0070706_100001884 Ga0070706_1000018849 344
713 3300005467 Ga0070706_100045247 Ga0070706_1000452473 344
714 3300005471 Ga0070698_100009908 Ga0070698_1000099085 344
715 3300005471 Ga0070698_100047297 Ga0070698_1000472972 344
716 3300005471 Ga0070698_100193495 Ga0070698_1001934952 344
717 3300005536 Ga0070697_100001655 Ga0070697_10000165514 344
718 3300005546 Ga0070696_100264924 Ga0070696_1002649241 344
719 3300005546 Ga0070696_100305668 Ga0070696_1003056681 344
720 3300009148 Ga0105243_10082410 Ga0105243_100824103 344
721 3300025910 Ga0207684_10010854 Ga0207684_100108541 344
722 3300025910 Ga0207684_10012695 Ga0207684_100126956 344
723 3300025922 Ga0207646_10118038 Ga0207646_101180382 344
724 3300025942 Ga0207689_10005406 Ga0207689_100054066 344
725 3300025942 Ga0207689_10011776 Ga0207689_100117762 344
726 3300031731 Ga0307405_10223262 Ga0307405_102232621 344
727 3300034816 Ga0373930_0025405 Ga0373930_0025405_86_1135 344
728 3300035112 Ga0373932_0025122 Ga0373932_0025122_119_1168 344
729 3300047320 Ga0495672_0039395 Ga0495672_0039395_1070_2122 344
730 3300050511 nmdc:mga08y16_49419_c1 nmdc:mga08y16_49419_c1_538_1587 344
731 3300050515 nmdc:mga0a205_499_c1 nmdc:mga0a205_499_c1_25166_26215 344
732 3300005468 Ga0070707_100046596 Ga0070707_1000465963 345
733 3300005471 Ga0070698_100007201 Ga0070698_1000072014 345
734 3300005518 Ga0070699_100003914 Ga0070699_1000039145 345
735 3300005718 Ga0068866_10013594 Ga0068866_100135943 345
736 3300025899 Ga0207642_10003129 Ga0207642_100031293 345
737 3300025922 Ga0207646_10035462 Ga0207646_100354621 345
738 3300025925 Ga0207650_10362002 Ga0207650_103620021 345
739 3300006844 Ga0075428_100036992 Ga0075428_1000369929 346
740 3300007265 Ga0099794_10001085 Ga0099794_100010852 346
741 3300009174 Ga0105241_10293093 Ga0105241_102930931 347
742 3300050507 nmdc:mga05p37_190569_c1 nmdc:mga05p37_190569_c1_288_1352 347
743 3300005545 Ga0070695_100065565 Ga0070695_1000655652 348
744 3300005546 Ga0070696_100013630 Ga0070696_1000136302 348
745 3300013306 Ga0163162_10230964 Ga0163162_102309642 348
746 3300050507 nmdc:mga05p37_458728_c1 nmdc:mga05p37_458728_c1_272_1435 348
747 3300013297 Ga0157378_10167178 Ga0157378_101671782 349
748 3300026118 Ga0207675_100120881 Ga0207675_1001208811 350
749 3300005468 Ga0070707_100423219 Ga0070707_1004232192 354
750 3300005468 Ga0070707_100000612 Ga0070707_10000061217 357
751 3300005546 Ga0070696_100077786 Ga0070696_1000777861 357
752 3300025922 Ga0207646_10001205 Ga0207646_1000120513 357
753 3300005289 Ga0065704_10103121 Ga0065704_101031213 358
754 3300005467 Ga0070706_100079320 Ga0070706_1000793202 358
755 3300005468 Ga0070707_100080009 Ga0070707_1000800093 358
756 3300005518 Ga0070699_100301548 Ga0070699_1003015481 358
757 3300025910 Ga0207684_10043729 Ga0207684_100437293 358
758 3300025922 Ga0207646_10054762 Ga0207646_100547623 358
759 3300009147 Ga0114129_10108595 Ga0114129_101085954 359
760 3300005549 Ga0070704_100055081 Ga0070704_1000550813 360
761 3300005330 Ga0070690_100056793 Ga0070690_1000567932 361
762 3300005364 Ga0070673_100033143 Ga0070673_1000331434 361
763 3300005444 Ga0070694_100008789 Ga0070694_1000087893 361
764 3300005471 Ga0070698_100124185 Ga0070698_1001241852 361
765 3300005842 Ga0068858_100163243 Ga0068858_1001632433 361
766 3300009148 Ga0105243_10001062 Ga0105243_100010628 361
767 3300009148 Ga0105243_10001709 Ga0105243_1000170914 361
768 3300009148 Ga0105243_10224225 Ga0105243_102242252 361
769 3300009174 Ga0105241_10049962 Ga0105241_100499622 361
770 3300009176 Ga0105242_10000301 Ga0105242_1000030114 361
771 3300009176 Ga0105242_10000554 Ga0105242_1000055416 361
772 3300013297 Ga0157378_10000003 Ga0157378_1000000326 361
773 3300013297 Ga0157378_10071168 Ga0157378_100711682 361
774 3300017792 Ga0163161_10162238 Ga0163161_101622382 361
775 3300025934 Ga0207686_10000018 Ga0207686_1000001866 361
776 3300025934 Ga0207686_10000021 Ga0207686_10000021124 361
777 3300025934 Ga0207686_10000436 Ga0207686_1000043610 361
778 3300025935 Ga0207709_10000069 Ga0207709_1000006927 361
779 3300025935 Ga0207709_10002653 Ga0207709_100026534 361
780 3300025935 Ga0207709_10059971 Ga0207709_100599712 361
781 3300046642 Ga0495634_0069819 Ga0495634_0069819_234_1346 361
782 3300048909 Ga0496106_0000917 Ga0496106_0000917_1142_2257 361
783 3300001432 JGI24034J14986_100245 JGI24034J14986_1002453 362
784 3300002074 JGI24748J21848_1000010 JGI24748J21848_100001068 362
785 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001614 362
786 3300005330 Ga0070690_100056979 Ga0070690_1000569792 362
787 3300005445 Ga0070708_100105189 Ga0070708_1001051892 362
788 3300005842 Ga0068858_100000005 Ga0068858_100000005125 362
789 3300006163 Ga0070715_10000024 Ga0070715_1000002440 362
790 3300009101 Ga0105247_10000002 Ga0105247_10000002381 362
791 3300025223 Ga0207672_1000317 Ga0207672_10003176 362
792 3300025900 Ga0207710_10000002 Ga0207710_10000002381 362
793 3300025905 Ga0207685_10000018 Ga0207685_1000001837 362
794 3300025931 Ga0207644_10004396 Ga0207644_100043963 362
795 3300026035 Ga0207703_10000150 Ga0207703_1000015023 362
796 3300026118 Ga0207675_100224028 Ga0207675_1002240281 362
797 3300005334 Ga0068869_100237150 Ga0068869_1002371501 363
798 3300005343 Ga0070687_100102570 Ga0070687_1001025702 363
799 3300005406 Ga0070703_10000015 Ga0070703_1000001545 363
800 3300005441 Ga0070700_100005323 Ga0070700_1000053236 363
801 3300005445 Ga0070708_100040287 Ga0070708_1000402872 363
802 3300005468 Ga0070707_100014740 Ga0070707_1000147405 363
803 3300005536 Ga0070697_100033785 Ga0070697_1000337852 363
804 3300005544 Ga0070686_100061035 Ga0070686_1000610351 363
805 3300005615 Ga0070702_100204413 Ga0070702_1002044131 363
806 3300005618 Ga0068864_100026211 Ga0068864_1000262112 363
807 3300005842 Ga0068858_100102209 Ga0068858_1001022092 363
808 3300006237 Ga0097621_100088971 Ga0097621_1000889713 363
809 3300006914 Ga0075436_100000002 Ga0075436_100000002358 363
810 3300007076 Ga0075435_100000687 Ga0075435_10000068711 363
811 3300009101 Ga0105247_10127938 Ga0105247_101279382 363
812 3300009147 Ga0114129_10024266 Ga0114129_100242665 363
813 3300009176 Ga0105242_10017871 Ga0105242_100178714 363
814 3300025885 Ga0207653_10000007 Ga0207653_10000007117 363
815 3300025918 Ga0207662_10033491 Ga0207662_100334913 363
816 3300025922 Ga0207646_10014963 Ga0207646_100149633 363
817 3300025934 Ga0207686_10000132 Ga0207686_1000013221 363
818 3300025942 Ga0207689_10066328 Ga0207689_100663283 363
819 3300026035 Ga0207703_10034451 Ga0207703_100344513 363
820 3300026075 Ga0207708_10017022 Ga0207708_100170225 363
821 3300028381 Ga0268264_10287206 Ga0268264_102872062 363
822 3300050507 nmdc:mga05p37_190944_c1 nmdc:mga05p37_190944_c1_826_1947 363
823 3300050513 nmdc:mga0rr50_377_c1 nmdc:mga0rr50_377_c1_11130_12227 363
824 3300050514 nmdc:mga08x19_9_c1 nmdc:mga08x19_9_c1_281_1378 363
825 3300006852 Ga0075433_10160634 Ga0075433_101606341 365
826 3300014968 Ga0157379_10233713 Ga0157379_102337132 366
827 3300005334 Ga0068869_100021791 Ga0068869_1000217915 369
828 3300005338 Ga0068868_100024174 Ga0068868_1000241744 369
829 3300005578 Ga0068854_100104550 Ga0068854_1001045503 369
830 3300006852 Ga0075433_10146272 Ga0075433_101462722 369
831 3300006871 Ga0075434_100038179 Ga0075434_1000381794 369
832 3300009098 Ga0105245_10038382 Ga0105245_100383823 369
833 3300009553 Ga0105249_10006291 Ga0105249_100062914 369
834 3300010375 Ga0105239_10411349 Ga0105239_104113492 369
835 3300013297 Ga0157378_10005802 Ga0157378_100058026 369
836 3300013297 Ga0157378_10034039 Ga0157378_100340393 369
837 3300025918 Ga0207662_10074213 Ga0207662_100742132 369
838 3300025942 Ga0207689_10027730 Ga0207689_100277302 369
839 3300026118 Ga0207675_100001831 Ga0207675_10000183110 369
840 3300044673 Ga0453683_0009301 Ga0453683_0009301_3341_4483 369
841 3300044712 Ga0453684_0293472 Ga0453684_0293472_634_1776 369
842 3300045051 Ga0451576_0390179 Ga0451576_0390179_181_1323 369
843 3300050512 nmdc:mga0n895_46685_c1 nmdc:mga0n895_46685_c1_604_1746 369
844 3300050515 nmdc:mga0a205_46989_c1 nmdc:mga0a205_46989_c1_665_1807 369
845 3300006852 Ga0075433_10022933 Ga0075433_100229334 371
846 3300050515 nmdc:mga0a205_157987_c1 nmdc:mga0a205_157987_c1_189_1352 371
847 3300050515 nmdc:mga0a205_18848_c1 nmdc:mga0a205_18848_c1_652_1833 371
848 3300009177 Ga0105248_10380932 Ga0105248_103809321 376
849 3300014325 Ga0163163_10152334 Ga0163163_101523343 376
850 2162886006 SwRhRL3b_contig_3391401 SwRhRL3b_0232.00000400 378
851 3300005617 Ga0068859_100003569 Ga0068859_1000035699 378
852 3300006931 Ga0097620_100003568 Ga0097620_1000035689 378
853 3300009094 Ga0111539_10022812 Ga0111539_100228123 378
854 3300050508 nmdc:mga09592_91985_c1 nmdc:mga09592_91985_c1_98_1234 378
855 3300050511 nmdc:mga08y16_14312_c1 nmdc:mga08y16_14312_c1_459_1595 378

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

155

320

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lwb-assembly1.cif.gz_B crystal structure of apo d-alanine:d-alanine ligase (ddl) from mycobacterium tuberculosis 0.867 43 378
3r5x-assembly2.cif.gz_C crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp 0.8645 44 378
3r5x-assembly1.cif.gz_B crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp 0.8643 44 373
3lwb-assembly1.cif.gz_B crystal structure of apo d-alanine:d-alanine ligase (ddl) from mycobacterium tuberculosis 0.8616 43 378
5d8d-assembly3.cif.gz_D crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii 0.8538 38 369
ID Description Score Start End Superfamily
3q1kB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.908 142 372 3.30.470.20
af_P9WP31_140_368_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8941 142 372 3.40.50.20
2i8cA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8927 238 370 3.30.470.20
3i12A02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8891 142 372 3.30.470.20
1ehiA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8864 237 371 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A2V8PF42-F1-model_v4 ATP-grasp domain-containing protein 0.9975 233 378 GO:0005524
GO:0008716
GO:0046872
AF-A0A2V8PF42-F1-model_v4 ATP-grasp domain-containing protein 0.9775 233 378 GO:0005524
GO:0008716
GO:0046872
AF-A0A2V9MLS0-F1-model_v4 D-alanine--D-alanine ligase 0.9734 36 183 GO:0016874
AF-A0A7W0GS63-F1-model_v4 ATP-grasp domain-containing protein 0.9723 180 378 GO:0005524
GO:0008716
GO:0046872
AF-A0A524KLL9-F1-model_v4 D-alanine--D-alanine ligase 0.972 41 376 GO:0005524
GO:0008716
GO:0046872
GO:0071555

Feature Viewer

pLDDT pTM Quality
83.17 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map