F483639
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 855 | 281 | 855 | 347 |
Family's Representative Sequence
| Representative Sequence | 3300049707|Ga0501234_005759|Ga0501234_005759_668_1660 |
| Length | 330 |
| Sequence | MTLEPRRKLRIIVLVHEDLVPPDSLNGLSDKEKQEVKTEFDVTSTLKKMGHDVYPVGLYNHLNAIGDALLEHKPHIAFNLLEEFHGYPLYDQHVVSYLELMKQAYTGCNPRGLTLAHDKALTKMILSYHRLLVPNFAVFPMNRKVKRPMRLKFPLLASIVYDDEKLAQRVEFIHRQNKTAAIAEQYIKGREIYVGVIGNQNIQTYAPWELVMEKLPEGAENIATLKVKWDPTYQEKVGVKTRAAELTPDQHKTLERLSKRIYRYLFLSGYARLDYRMTEEGQFYLLEANPNPQIAHNEDFADSAEHSGVAYDQLLQKIITVGLNYAGRSI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 174 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 175 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 176 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 177 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 180 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 183 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 191 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 192 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 195 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 196 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 197 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 198 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 199 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 200 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 219 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 220 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 221 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 222 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 223 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 224 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 225 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 226 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 227 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 239 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 240 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 241 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 242 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 243 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 244 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 245 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 246 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 247 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 248 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 249 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 250 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 251 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 252 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 253 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 254 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 255 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 256 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 257 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 258 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 263 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 264 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 267 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 268 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 279 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.12 |
| Nodule | 0 |
| Rhizoplane | 0.94 |
| Rhizosphere | 98.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_3391401 | 2162886006 | Unclassified | 1286 |
| 2 | SwRhRL2b_contig_151632 | 2162886007 | Bacteria | 2872 |
| 3 | CNAas_1000548 | 3300000532 | Unclassified | 3640 |
| 4 | JGI24034J14986_100245 | 3300001432 | Unclassified | 2984 |
| 5 | JGI24748J21848_1000010 | 3300002074 | Bacteria | 166979 |
| 6 | JGI24034J26672_10000001 | 3300002239 | Bacteria | 1118280 |
| 7 | JGI24751J29686_10000040 | 3300002459 | Bacteria | 79191 |
| 8 | JGI25406J46586_10003181 | 3300003203 | Bacteria | 7725 |
| 9 | Ga0065714_10064546 | 3300005288 | Bacteria | 38244 |
| 10 | Ga0065704_10010886 | 3300005289 | Unclassified | 2500 |
| 11 | Ga0065704_10097714 | 3300005289 | Bacteria | 2360 |
| 12 | Ga0065704_10103121 | 3300005289 | Bacteria | 2182 |
| 13 | Ga0065704_10168649 | 3300005289 | Unclassified | 1306 |
| 14 | Ga0065712_10000133 | 3300005290 | Bacteria | 66806 |
| 15 | Ga0065712_10001895 | 3300005290 | Bacteria | 5133 |
| 16 | Ga0065712_10007455 | 3300005290 | Bacteria | 4869 |
| 17 | Ga0065712_10073016 | 3300005290 | Bacteria | 4532 |
| 18 | Ga0065712_10076531 | 3300005290 | Bacteria | 3643 |
| 19 | Ga0065712_10087944 | 3300005290 | Bacteria | 2547 |
| 20 | Ga0065712_10089765 | 3300005290 | Bacteria | 2454 |
| 21 | Ga0065715_10002297 | 3300005293 | Bacteria | 5711 |
| 22 | Ga0065715_10011249 | 3300005293 | Bacteria | 2928 |
| 23 | Ga0065715_10092350 | 3300005293 | Bacteria | 5171 |
| 24 | Ga0065715_10129064 | 3300005293 | Bacteria | 2053 |
| 25 | Ga0065715_10143265 | 3300005293 | Unclassified | 1822 |
| 26 | Ga0065715_10161837 | 3300005293 | Bacteria | 1622 |
| 27 | Ga0065707_10001920 | 3300005295 | Bacteria | 13690 |
| 28 | Ga0065707_10002307 | 3300005295 | Bacteria | 4744 |
| 29 | Ga0065707_10002866 | 3300005295 | Bacteria | 6149 |
| 30 | Ga0065707_10085619 | 3300005295 | Bacteria | 6017 |
| 31 | Ga0065707_10092600 | 3300005295 | Bacteria | 3746 |
| 32 | Ga0065707_10127137 | 3300005295 | Bacteria | 1990 |
| 33 | Ga0070676_10029027 | 3300005328 | Bacteria | 3144 |
| 34 | Ga0070676_10099075 | 3300005328 | Bacteria | 1798 |
| 35 | Ga0070690_100001019 | 3300005330 | Bacteria | 14317 |
| 36 | Ga0070690_100002855 | 3300005330 | Bacteria | 9321 |
| 37 | Ga0070690_100003648 | 3300005330 | Bacteria | 8474 |
| 38 | Ga0070690_100009806 | 3300005330 | Bacteria | 5557 |
| 39 | Ga0070690_100056793 | 3300005330 | Bacteria | 2511 |
| 40 | Ga0070690_100056979 | 3300005330 | Bacteria | 2507 |
| 41 | Ga0070670_100000225 | 3300005331 | Bacteria | 52142 |
| 42 | Ga0070670_100001528 | 3300005331 | Bacteria | 18634 |
| 43 | Ga0070670_100007289 | 3300005331 | Bacteria | 9380 |
| 44 | Ga0070670_100024832 | 3300005331 | Bacteria | 5155 |
| 45 | Ga0070670_100042661 | 3300005331 | Bacteria | 3900 |
| 46 | Ga0070670_100253666 | 3300005331 | Unclassified | 1533 |
| 47 | Ga0070670_100286235 | 3300005331 | Bacteria | 1439 |
| 48 | Ga0070677_10098780 | 3300005333 | Unclassified | 1283 |
| 49 | Ga0068869_100003372 | 3300005334 | Bacteria | 9754 |
| 50 | Ga0068869_100003484 | 3300005334 | Bacteria | 9628 |
| 51 | Ga0068869_100011119 | 3300005334 | Bacteria | 5896 |
| 52 | Ga0068869_100013921 | 3300005334 | Bacteria | 5363 |
| 53 | Ga0068869_100021791 | 3300005334 | Bacteria | 4410 |
| 54 | Ga0068869_100074618 | 3300005334 | Unclassified | 2517 |
| 55 | Ga0068869_100237150 | 3300005334 | Bacteria | 1452 |
| 56 | Ga0070666_10068892 | 3300005335 | Bacteria | 2405 |
| 57 | Ga0070666_10074489 | 3300005335 | Bacteria | 2314 |
| 58 | Ga0070680_100002583 | 3300005336 | Bacteria | 13399 |
| 59 | Ga0070680_100013103 | 3300005336 | Bacteria | 6453 |
| 60 | Ga0070680_100069302 | 3300005336 | Unclassified | 2896 |
| 61 | Ga0070680_100226082 | 3300005336 | Unclassified | 1580 |
| 62 | Ga0070682_100000687 | 3300005337 | Bacteria | 20450 |
| 63 | Ga0070682_100007382 | 3300005337 | Bacteria | 6202 |
| 64 | Ga0068868_100000238 | 3300005338 | Bacteria | 37158 |
| 65 | Ga0068868_100024174 | 3300005338 | Bacteria | 4607 |
| 66 | Ga0068868_100108009 | 3300005338 | Bacteria | 2258 |
| 67 | Ga0070687_100000989 | 3300005343 | Bacteria | 9692 |
| 68 | Ga0070687_100102570 | 3300005343 | Bacteria | 1605 |
| 69 | Ga0070687_100108426 | 3300005343 | Bacteria | 1567 |
| 70 | Ga0070661_100008110 | 3300005344 | Bacteria | 7247 |
| 71 | Ga0070692_10075052 | 3300005345 | Bacteria | 1810 |
| 72 | Ga0070668_100098853 | 3300005347 | Unclassified | 2310 |
| 73 | Ga0070669_100004916 | 3300005353 | Bacteria | 9654 |
| 74 | Ga0070669_100007320 | 3300005353 | Bacteria | 7917 |
| 75 | Ga0070669_100013652 | 3300005353 | Archaea | 5774 |
| 76 | Ga0070675_100011584 | 3300005354 | Bacteria | 6906 |
| 77 | Ga0070675_100017185 | 3300005354 | Bacteria | 5750 |
| 78 | Ga0070675_100024762 | 3300005354 | Bacteria | 4807 |
| 79 | Ga0070675_100136949 | 3300005354 | Unclassified | 2090 |
| 80 | Ga0070671_100011918 | 3300005355 | Bacteria | 6993 |
| 81 | Ga0070671_100022400 | 3300005355 | Bacteria | 5159 |
| 82 | Ga0070671_100107639 | 3300005355 | Unclassified | 2341 |
| 83 | Ga0070673_100000896 | 3300005364 | Bacteria | 16813 |
| 84 | Ga0070673_100033143 | 3300005364 | Bacteria | 3896 |
| 85 | Ga0070673_100050859 | 3300005364 | Unclassified | 3242 |
| 86 | Ga0070673_100074151 | 3300005364 | Unclassified | 2742 |
| 87 | Ga0070673_100313755 | 3300005364 | Bacteria | 1384 |
| 88 | Ga0070688_100006011 | 3300005365 | Bacteria | 6438 |
| 89 | Ga0070667_100001127 | 3300005367 | Bacteria | 24353 |
| 90 | Ga0070667_100004875 | 3300005367 | Bacteria | 11235 |
| 91 | Ga0070667_100045643 | 3300005367 | Unclassified | 3685 |
| 92 | Ga0070667_100241267 | 3300005367 | Bacteria | 1614 |
| 93 | Ga0070703_10000015 | 3300005406 | Bacteria | 87420 |
| 94 | Ga0070703_10009549 | 3300005406 | Bacteria | 2736 |
| 95 | Ga0070709_10209482 | 3300005434 | Bacteria | 1385 |
| 96 | Ga0070705_100010194 | 3300005440 | Bacteria | 4695 |
| 97 | Ga0070705_100177537 | 3300005440 | Bacteria | 1439 |
| 98 | Ga0070700_100000090 | 3300005441 | Bacteria | 61626 |
| 99 | Ga0070700_100005323 | 3300005441 | Bacteria | 6803 |
| 100 | Ga0070700_100028118 | 3300005441 | Unclassified | 3341 |
| 101 | Ga0070700_100031845 | 3300005441 | Bacteria | 3164 |
| 102 | Ga0070700_100060745 | 3300005441 | Bacteria | 2383 |
| 103 | Ga0070700_100095453 | 3300005441 | Unclassified | 1949 |
| 104 | Ga0070694_100008789 | 3300005444 | Bacteria | 6189 |
| 105 | Ga0070694_100020401 | 3300005444 | Unclassified | 4224 |
| 106 | Ga0070694_100042190 | 3300005444 | Bacteria | 3047 |
| 107 | Ga0070694_100047898 | 3300005444 | Bacteria | 2874 |
| 108 | Ga0070694_100049593 | 3300005444 | Bacteria | 2828 |
| 109 | Ga0070694_100068366 | 3300005444 | Bacteria | 2441 |
| 110 | Ga0070694_100118232 | 3300005444 | Bacteria | 1898 |
| 111 | Ga0070694_100185259 | 3300005444 | Bacteria | 1542 |
| 112 | Ga0070694_100237321 | 3300005444 | Bacteria | 1374 |
| 113 | Ga0070708_100040287 | 3300005445 | Bacteria | 4091 |
| 114 | Ga0070708_100094887 | 3300005445 | Bacteria | 2722 |
| 115 | Ga0070708_100105189 | 3300005445 | Unclassified | 2589 |
| 116 | Ga0070678_100153822 | 3300005456 | Bacteria | 1856 |
| 117 | Ga0070678_100164643 | 3300005456 | Unclassified | 1800 |
| 118 | Ga0070681_10000011 | 3300005458 | Bacteria | 139059 |
| 119 | Ga0070681_10001243 | 3300005458 | Bacteria | 22166 |
| 120 | Ga0070681_10035918 | 3300005458 | Bacteria | 4978 |
| 121 | Ga0070681_10074750 | 3300005458 | Bacteria | 3349 |
| 122 | Ga0068867_100085490 | 3300005459 | Bacteria | 2385 |
| 123 | Ga0068867_100108447 | 3300005459 | Bacteria | 2130 |
| 124 | Ga0068867_100154358 | 3300005459 | Bacteria | 1806 |
| 125 | Ga0070685_10005103 | 3300005466 | Bacteria | 6655 |
| 126 | Ga0070685_10010181 | 3300005466 | Bacteria | 4881 |
| 127 | Ga0070685_10057830 | 3300005466 | Bacteria | 2258 |
| 128 | Ga0070685_10107919 | 3300005466 | Bacteria | 1710 |
| 129 | Ga0070706_100000312 | 3300005467 | Bacteria | 59056 |
| 130 | Ga0070706_100001884 | 3300005467 | Bacteria | 21660 |
| 131 | Ga0070706_100033422 | 3300005467 | Bacteria | 4747 |
| 132 | Ga0070706_100045247 | 3300005467 | Bacteria | 4066 |
| 133 | Ga0070706_100079320 | 3300005467 | Bacteria | 3039 |
| 134 | Ga0070706_100268017 | 3300005467 | Unclassified | 1594 |
| 135 | Ga0070706_100507618 | 3300005467 | Unclassified | 1122 |
| 136 | Ga0070707_100000612 | 3300005468 | Bacteria | 35823 |
| 137 | Ga0070707_100004557 | 3300005468 | Bacteria | 12978 |
| 138 | Ga0070707_100014740 | 3300005468 | Bacteria | 7328 |
| 139 | Ga0070707_100046596 | 3300005468 | Bacteria | 4149 |
| 140 | Ga0070707_100080009 | 3300005468 | Bacteria | 3154 |
| 141 | Ga0070707_100215335 | 3300005468 | Unclassified | 1872 |
| 142 | Ga0070707_100227929 | 3300005468 | Bacteria | 1814 |
| 143 | Ga0070707_100414052 | 3300005468 | Unclassified | 1308 |
| 144 | Ga0070707_100423219 | 3300005468 | Unclassified | 1292 |
| 145 | Ga0070698_100000398 | 3300005471 | Bacteria | 45901 |
| 146 | Ga0070698_100007201 | 3300005471 | Bacteria | 12051 |
| 147 | Ga0070698_100009908 | 3300005471 | Bacteria | 10189 |
| 148 | Ga0070698_100016433 | 3300005471 | Bacteria | 7809 |
| 149 | Ga0070698_100047297 | 3300005471 | Bacteria | 4398 |
| 150 | Ga0070698_100124185 | 3300005471 | Bacteria | 2538 |
| 151 | Ga0070698_100193495 | 3300005471 | Bacteria | 1971 |
| 152 | Ga0070699_100003914 | 3300005518 | Bacteria | 13152 |
| 153 | Ga0070699_100006392 | 3300005518 | Bacteria | 10264 |
| 154 | Ga0070699_100301548 | 3300005518 | Bacteria | 1437 |
| 155 | Ga0070679_100000013 | 3300005530 | Bacteria | 151602 |
| 156 | Ga0070679_100170168 | 3300005530 | Bacteria | 2151 |
| 157 | Ga0070679_100347636 | 3300005530 | Bacteria | 1431 |
| 158 | Ga0070697_100001655 | 3300005536 | Bacteria | 16982 |
| 159 | Ga0070697_100010463 | 3300005536 | Bacteria | 7241 |
| 160 | Ga0070697_100033785 | 3300005536 | Bacteria | 4122 |
| 161 | Ga0070697_100334660 | 3300005536 | Bacteria | 1306 |
| 162 | Ga0070672_100000998 | 3300005543 | Bacteria | 17126 |
| 163 | Ga0070672_100005650 | 3300005543 | Bacteria | 8322 |
| 164 | Ga0070672_100008730 | 3300005543 | Bacteria | 6957 |
| 165 | Ga0070686_100011105 | 3300005544 | Bacteria | 5102 |
| 166 | Ga0070686_100011736 | 3300005544 | Unclassified | 4977 |
| 167 | Ga0070686_100030967 | 3300005544 | Unclassified | 3267 |
| 168 | Ga0070686_100040560 | 3300005544 | Bacteria | 2905 |
| 169 | Ga0070686_100061035 | 3300005544 | Unclassified | 2435 |
| 170 | Ga0070686_100093818 | 3300005544 | Bacteria | 2013 |
| 171 | Ga0070686_100252088 | 3300005544 | Unclassified | 1290 |
| 172 | Ga0070695_100046494 | 3300005545 | Bacteria | 2769 |
| 173 | Ga0070695_100065565 | 3300005545 | Unclassified | 2365 |
| 174 | Ga0070695_100088274 | 3300005545 | Bacteria | 2064 |
| 175 | Ga0070695_100215278 | 3300005545 | Unclassified | 1381 |
| 176 | Ga0070696_100004652 | 3300005546 | Bacteria | 9164 |
| 177 | Ga0070696_100013630 | 3300005546 | Bacteria | 5456 |
| 178 | Ga0070696_100077786 | 3300005546 | Bacteria | 2345 |
| 179 | Ga0070696_100264924 | 3300005546 | Unclassified | 1304 |
| 180 | Ga0070696_100305668 | 3300005546 | Bacteria | 1219 |
| 181 | Ga0070693_100035033 | 3300005547 | Bacteria | 2781 |
| 182 | Ga0070693_100137513 | 3300005547 | Unclassified | 1534 |
| 183 | Ga0070693_100170796 | 3300005547 | Bacteria | 1392 |
| 184 | Ga0070665_100155992 | 3300005548 | Bacteria | 2285 |
| 185 | Ga0070704_100023962 | 3300005549 | Unclassified | 3997 |
| 186 | Ga0070704_100055081 | 3300005549 | Unclassified | 2818 |
| 187 | Ga0070704_100085418 | 3300005549 | Bacteria | 2335 |
| 188 | Ga0068855_100352150 | 3300005563 | Bacteria | 1622 |
| 189 | Ga0070664_100001082 | 3300005564 | Bacteria | 21465 |
| 190 | Ga0068857_100034429 | 3300005577 | Unclassified | 4481 |
| 191 | Ga0068857_100042876 | 3300005577 | Bacteria | 4014 |
| 192 | Ga0068857_100169286 | 3300005577 | Unclassified | 1985 |
| 193 | Ga0068857_100276358 | 3300005577 | Unclassified | 1544 |
| 194 | Ga0068854_100045673 | 3300005578 | Bacteria | 3116 |
| 195 | Ga0068854_100104550 | 3300005578 | Unclassified | 2127 |
| 196 | Ga0068856_100009499 | 3300005614 | Bacteria | 9444 |
| 197 | Ga0068856_100108545 | 3300005614 | Bacteria | 2771 |
| 198 | Ga0070702_100042468 | 3300005615 | Bacteria | 2557 |
| 199 | Ga0070702_100116499 | 3300005615 | Unclassified | 1666 |
| 200 | Ga0070702_100125938 | 3300005615 | Unclassified | 1611 |
| 201 | Ga0070702_100204413 | 3300005615 | Bacteria | 1310 |
| 202 | Ga0068859_100003569 | 3300005617 | Bacteria | 15854 |
| 203 | Ga0068859_100011838 | 3300005617 | Bacteria | 8762 |
| 204 | Ga0068859_100022679 | 3300005617 | Bacteria | 6294 |
| 205 | Ga0068859_100071051 | 3300005617 | Bacteria | 3516 |
| 206 | Ga0068859_100140866 | 3300005617 | Unclassified | 2485 |
| 207 | Ga0068859_100535048 | 3300005617 | Unclassified | 1266 |
| 208 | Ga0068859_100589112 | 3300005617 | Bacteria | 1205 |
| 209 | Ga0068864_100000368 | 3300005618 | Bacteria | 39343 |
| 210 | Ga0068864_100007568 | 3300005618 | Bacteria | 8949 |
| 211 | Ga0068864_100026211 | 3300005618 | Unclassified | 4915 |
| 212 | Ga0068864_100031869 | 3300005618 | Bacteria | 4475 |
| 213 | Ga0068864_100081234 | 3300005618 | Bacteria | 2841 |
| 214 | Ga0068864_100253631 | 3300005618 | Bacteria | 1634 |
| 215 | Ga0068866_10013594 | 3300005718 | Bacteria | 3577 |
| 216 | Ga0068866_10028189 | 3300005718 | Bacteria | 2673 |
| 217 | Ga0068861_100052526 | 3300005719 | Bacteria | 3098 |
| 218 | Ga0068861_100093034 | 3300005719 | Bacteria | 2383 |
| 219 | Ga0068861_100125676 | 3300005719 | Bacteria | 2074 |
| 220 | Ga0068861_100369880 | 3300005719 | Bacteria | 1263 |
| 221 | Ga0068851_10017649 | 3300005834 | Bacteria | 3430 |
| 222 | Ga0068870_10007877 | 3300005840 | Bacteria | 4765 |
| 223 | Ga0068863_100022102 | 3300005841 | Bacteria | 6073 |
| 224 | Ga0068863_100024162 | 3300005841 | Bacteria | 5798 |
| 225 | Ga0068863_100031683 | 3300005841 | Bacteria | 5044 |
| 226 | Ga0068863_100123402 | 3300005841 | Unclassified | 2471 |
| 227 | Ga0068863_100313715 | 3300005841 | Bacteria | 1522 |
| 228 | Ga0068858_100000005 | 3300005842 | Bacteria | 305830 |
| 229 | Ga0068858_100011012 | 3300005842 | Bacteria | 8547 |
| 230 | Ga0068858_100037873 | 3300005842 | Bacteria | 4472 |
| 231 | Ga0068858_100077372 | 3300005842 | Unclassified | 3091 |
| 232 | Ga0068858_100102209 | 3300005842 | Unclassified | 2674 |
| 233 | Ga0068858_100163243 | 3300005842 | Bacteria | 2098 |
| 234 | Ga0068858_100170144 | 3300005842 | Unclassified | 2054 |
| 235 | Ga0068860_100029077 | 3300005843 | Bacteria | 5315 |
| 236 | Ga0068860_100036110 | 3300005843 | Bacteria | 4737 |
| 237 | Ga0068860_100058473 | 3300005843 | Unclassified | 3665 |
| 238 | Ga0068860_100215538 | 3300005843 | Bacteria | 1863 |
| 239 | Ga0068860_100298300 | 3300005843 | Bacteria | 1578 |
| 240 | Ga0068862_100043156 | 3300005844 | Unclassified | 3844 |
| 241 | Ga0068862_100057909 | 3300005844 | Bacteria | 3324 |
| 242 | Ga0068862_100115396 | 3300005844 | Bacteria | 2361 |
| 243 | Ga0068862_100123737 | 3300005844 | Bacteria | 2282 |
| 244 | Ga0068862_100149272 | 3300005844 | Unclassified | 2080 |
| 245 | Ga0081455_10002043 | 3300005937 | Bacteria | 24122 |
| 246 | Ga0081539_10002465 | 3300005985 | Bacteria | 26058 |
| 247 | Ga0081539_10003882 | 3300005985 | Bacteria | 17449 |
| 248 | Ga0070715_10000024 | 3300006163 | Bacteria | 110647 |
| 249 | Ga0070716_100000046 | 3300006173 | Bacteria | 49780 |
| 250 | Ga0097621_100005896 | 3300006237 | Bacteria | 8659 |
| 251 | Ga0097621_100088971 | 3300006237 | Bacteria | 2581 |
| 252 | Ga0097621_100121494 | 3300006237 | Unclassified | 2215 |
| 253 | Ga0068871_100010565 | 3300006358 | Bacteria | 6744 |
| 254 | Ga0068871_100033822 | 3300006358 | Unclassified | 4050 |
| 255 | Ga0068871_100059286 | 3300006358 | Bacteria | 3118 |
| 256 | Ga0068871_100101761 | 3300006358 | Bacteria | 2408 |
| 257 | Ga0068871_100259361 | 3300006358 | Bacteria | 1516 |
| 258 | Ga0075428_100036992 | 3300006844 | Bacteria | 5375 |
| 259 | Ga0075428_100060654 | 3300006844 | Bacteria | 4142 |
| 260 | Ga0075428_100073725 | 3300006844 | Unclassified | 3728 |
| 261 | Ga0075428_100088917 | 3300006844 | Unclassified | 3369 |
| 262 | Ga0075428_100093182 | 3300006844 | Bacteria | 3284 |
| 263 | Ga0075428_100142765 | 3300006844 | Bacteria | 2603 |
| 264 | Ga0075428_100148334 | 3300006844 | Bacteria | 2549 |
| 265 | Ga0075428_100227044 | 3300006844 | Unclassified | 2015 |
| 266 | Ga0075428_100233906 | 3300006844 | Bacteria | 1983 |
| 267 | Ga0075428_100468093 | 3300006844 | Bacteria | 1349 |
| 268 | Ga0075430_100022303 | 3300006846 | Bacteria | 5385 |
| 269 | Ga0075430_100122287 | 3300006846 | Bacteria | 2170 |
| 270 | Ga0075430_100146038 | 3300006846 | Bacteria | 1970 |
| 271 | Ga0075430_100277763 | 3300006846 | Unclassified | 1386 |
| 272 | Ga0075431_100071017 | 3300006847 | Bacteria | 3592 |
| 273 | Ga0075431_100085225 | 3300006847 | Bacteria | 3261 |
| 274 | Ga0075431_100158080 | 3300006847 | Bacteria | 2331 |
| 275 | Ga0075431_100200862 | 3300006847 | Bacteria | 2040 |
| 276 | Ga0075433_10005017 | 3300006852 | Bacteria | 10369 |
| 277 | Ga0075433_10010069 | 3300006852 | Bacteria | 7577 |
| 278 | Ga0075433_10020245 | 3300006852 | Bacteria | 5559 |
| 279 | Ga0075433_10022933 | 3300006852 | Bacteria | 5247 |
| 280 | Ga0075433_10067080 | 3300006852 | Bacteria | 3149 |
| 281 | Ga0075433_10140455 | 3300006852 | Unclassified | 2147 |
| 282 | Ga0075433_10146272 | 3300006852 | Bacteria | 2101 |
| 283 | Ga0075433_10148412 | 3300006852 | Unclassified | 2085 |
| 284 | Ga0075433_10160634 | 3300006852 | Bacteria | 2000 |
| 285 | Ga0075434_100007920 | 3300006871 | Bacteria | 9849 |
| 286 | Ga0075434_100009798 | 3300006871 | Bacteria | 8960 |
| 287 | Ga0075434_100038179 | 3300006871 | Bacteria | 4757 |
| 288 | Ga0075434_100057816 | 3300006871 | Unclassified | 3854 |
| 289 | Ga0075434_100081914 | 3300006871 | Bacteria | 3224 |
| 290 | Ga0075434_100206019 | 3300006871 | Bacteria | 1987 |
| 291 | Ga0075434_100218216 | 3300006871 | Unclassified | 1927 |
| 292 | Ga0075434_100383243 | 3300006871 | Bacteria | 1427 |
| 293 | Ga0075429_100006227 | 3300006880 | Bacteria | 10326 |
| 294 | Ga0075429_100037564 | 3300006880 | Unclassified | 4216 |
| 295 | Ga0075429_100104035 | 3300006880 | Bacteria | 2479 |
| 296 | Ga0068865_100018706 | 3300006881 | Unclassified | 4474 |
| 297 | Ga0075436_100000002 | 3300006914 | Bacteria | 475522 |
| 298 | Ga0075436_100220550 | 3300006914 | Unclassified | 1346 |
| 299 | Ga0097620_100003568 | 3300006931 | Bacteria | 15854 |
| 300 | Ga0097620_100011838 | 3300006931 | Bacteria | 8762 |
| 301 | Ga0097620_100022678 | 3300006931 | Bacteria | 6294 |
| 302 | Ga0097620_100071052 | 3300006931 | Bacteria | 3516 |
| 303 | Ga0097620_100140870 | 3300006931 | Unclassified | 2485 |
| 304 | Ga0097620_100535108 | 3300006931 | Unclassified | 1266 |
| 305 | Ga0097620_100589138 | 3300006931 | Bacteria | 1205 |
| 306 | Ga0075435_100000687 | 3300007076 | Bacteria | 20986 |
| 307 | Ga0075435_100019273 | 3300007076 | Bacteria | 5207 |
| 308 | Ga0075435_100329251 | 3300007076 | Unclassified | 1308 |
| 309 | Ga0099794_10001085 | 3300007265 | Bacteria | 9307 |
| 310 | Ga0099794_10114755 | 3300007265 | Bacteria | 1352 |
| 311 | Ga0105240_10113858 | 3300009093 | Unclassified | 3268 |
| 312 | Ga0105240_10351415 | 3300009093 | Bacteria | 1672 |
| 313 | Ga0111539_10009788 | 3300009094 | Bacteria | 12100 |
| 314 | Ga0111539_10013017 | 3300009094 | Bacteria | 10410 |
| 315 | Ga0111539_10022812 | 3300009094 | Bacteria | 7688 |
| 316 | Ga0111539_10024520 | 3300009094 | Bacteria | 7399 |
| 317 | Ga0111539_10074668 | 3300009094 | Bacteria | 3995 |
| 318 | Ga0111539_10116124 | 3300009094 | Bacteria | 3138 |
| 319 | Ga0111539_10162591 | 3300009094 | Bacteria | 2611 |
| 320 | Ga0111539_10268686 | 3300009094 | Bacteria | 1985 |
| 321 | Ga0111539_10387075 | 3300009094 | Bacteria | 1628 |
| 322 | Ga0111539_10594079 | 3300009094 | Unclassified | 1289 |
| 323 | Ga0105245_10038382 | 3300009098 | Bacteria | 4261 |
| 324 | Ga0105245_10043122 | 3300009098 | Bacteria | 4025 |
| 325 | Ga0105247_10000002 | 3300009101 | Bacteria | 724587 |
| 326 | Ga0105247_10045574 | 3300009101 | Unclassified | 2691 |
| 327 | Ga0105247_10127938 | 3300009101 | Unclassified | 1653 |
| 328 | Ga0105247_10148934 | 3300009101 | Bacteria | 1540 |
| 329 | Ga0114129_10004880 | 3300009147 | Bacteria | 18921 |
| 330 | Ga0114129_10011151 | 3300009147 | Bacteria | 12812 |
| 331 | Ga0114129_10016316 | 3300009147 | Bacteria | 10572 |
| 332 | Ga0114129_10017644 | 3300009147 | Bacteria | 10162 |
| 333 | Ga0114129_10019919 | 3300009147 | Bacteria | 9548 |
| 334 | Ga0114129_10024266 | 3300009147 | Bacteria | 8591 |
| 335 | Ga0114129_10025796 | 3300009147 | Bacteria | 8324 |
| 336 | Ga0114129_10033829 | 3300009147 | Bacteria | 7220 |
| 337 | Ga0114129_10071082 | 3300009147 | Bacteria | 4852 |
| 338 | Ga0114129_10108595 | 3300009147 | Unclassified | 3830 |
| 339 | Ga0114129_10214249 | 3300009147 | Unclassified | 2602 |
| 340 | Ga0114129_10263292 | 3300009147 | Unclassified | 2310 |
| 341 | Ga0114129_10263548 | 3300009147 | Bacteria | 2308 |
| 342 | Ga0114129_10282140 | 3300009147 | Bacteria | 2219 |
| 343 | Ga0114129_10311223 | 3300009147 | Bacteria | 2096 |
| 344 | Ga0114129_10313216 | 3300009147 | Unclassified | 2088 |
| 345 | Ga0114129_10349888 | 3300009147 | Unclassified | 1958 |
| 346 | Ga0114129_10350214 | 3300009147 | Bacteria | 1957 |
| 347 | Ga0114129_10518574 | 3300009147 | Unclassified | 1554 |
| 348 | Ga0114129_10738617 | 3300009147 | Bacteria | 1261 |
| 349 | Ga0114129_10893761 | 3300009147 | Unclassified | 1126 |
| 350 | Ga0105243_10001062 | 3300009148 | Bacteria | 25128 |
| 351 | Ga0105243_10001709 | 3300009148 | Bacteria | 18920 |
| 352 | Ga0105243_10082410 | 3300009148 | Unclassified | 2629 |
| 353 | Ga0105243_10132597 | 3300009148 | Unclassified | 2116 |
| 354 | Ga0105243_10134602 | 3300009148 | Bacteria | 2101 |
| 355 | Ga0105243_10224225 | 3300009148 | Bacteria | 1663 |
| 356 | Ga0105241_10028687 | 3300009174 | Bacteria | 4148 |
| 357 | Ga0105241_10049962 | 3300009174 | Bacteria | 3187 |
| 358 | Ga0105241_10093200 | 3300009174 | Bacteria | 2380 |
| 359 | Ga0105241_10199120 | 3300009174 | Unclassified | 1672 |
| 360 | Ga0105241_10293093 | 3300009174 | Bacteria | 1394 |
| 361 | Ga0105242_10000301 | 3300009176 | Bacteria | 39312 |
| 362 | Ga0105242_10000554 | 3300009176 | Bacteria | 29570 |
| 363 | Ga0105242_10001732 | 3300009176 | Bacteria | 17229 |
| 364 | Ga0105242_10017871 | 3300009176 | Bacteria | 5535 |
| 365 | Ga0105242_10038649 | 3300009176 | Bacteria | 3839 |
| 366 | Ga0105242_10053256 | 3300009176 | Bacteria | 3304 |
| 367 | Ga0105242_10176157 | 3300009176 | Bacteria | 1883 |
| 368 | Ga0105248_10001606 | 3300009177 | Bacteria | 25125 |
| 369 | Ga0105248_10011136 | 3300009177 | Bacteria | 9924 |
| 370 | Ga0105248_10050265 | 3300009177 | Bacteria | 4675 |
| 371 | Ga0105248_10098295 | 3300009177 | Bacteria | 3297 |
| 372 | Ga0105248_10099896 | 3300009177 | Bacteria | 3270 |
| 373 | Ga0105248_10225484 | 3300009177 | Unclassified | 2109 |
| 374 | Ga0105248_10380932 | 3300009177 | Unclassified | 1588 |
| 375 | Ga0105248_10385952 | 3300009177 | Bacteria | 1577 |
| 376 | Ga0105248_10662622 | 3300009177 | Unclassified | 1177 |
| 377 | Ga0105237_10006126 | 3300009545 | Bacteria | 13445 |
| 378 | Ga0105237_10016051 | 3300009545 | Bacteria | 7788 |
| 379 | Ga0105237_10105556 | 3300009545 | Unclassified | 2808 |
| 380 | Ga0105238_10001168 | 3300009551 | Bacteria | 26434 |
| 381 | Ga0105238_10230856 | 3300009551 | Bacteria | 1827 |
| 382 | Ga0105249_10000030 | 3300009553 | Bacteria | 221992 |
| 383 | Ga0105249_10006291 | 3300009553 | Bacteria | 10315 |
| 384 | Ga0105249_10030403 | 3300009553 | Unclassified | 4882 |
| 385 | Ga0105249_10089815 | 3300009553 | Bacteria | 2871 |
| 386 | Ga0105249_10099715 | 3300009553 | Bacteria | 2730 |
| 387 | Ga0105249_10153102 | 3300009553 | Bacteria | 2222 |
| 388 | Ga0105249_10153223 | 3300009553 | Bacteria | 2221 |
| 389 | Ga0105239_10065865 | 3300010375 | Bacteria | 3980 |
| 390 | Ga0105239_10103817 | 3300010375 | Bacteria | 3146 |
| 391 | Ga0105239_10143785 | 3300010375 | Unclassified | 2659 |
| 392 | Ga0105239_10411349 | 3300010375 | Bacteria | 1532 |
| 393 | Ga0105246_10037155 | 3300011119 | Unclassified | 3267 |
| 394 | Ga0157373_10074399 | 3300013100 | Bacteria | 2396 |
| 395 | Ga0157374_10042212 | 3300013296 | Bacteria | 4206 |
| 396 | Ga0157374_10062419 | 3300013296 | Bacteria | 3492 |
| 397 | Ga0157374_10154521 | 3300013296 | Bacteria | 2232 |
| 398 | Ga0157378_10000003 | 3300013297 | Bacteria | 203725 |
| 399 | Ga0157378_10002351 | 3300013297 | Bacteria | 16810 |
| 400 | Ga0157378_10005802 | 3300013297 | Bacteria | 10820 |
| 401 | Ga0157378_10031425 | 3300013297 | Unclassified | 4690 |
| 402 | Ga0157378_10034039 | 3300013297 | Bacteria | 4507 |
| 403 | Ga0157378_10063132 | 3300013297 | Bacteria | 3309 |
| 404 | Ga0157378_10071168 | 3300013297 | Bacteria | 3123 |
| 405 | Ga0157378_10116415 | 3300013297 | Bacteria | 2458 |
| 406 | Ga0157378_10124653 | 3300013297 | Bacteria | 2379 |
| 407 | Ga0157378_10155581 | 3300013297 | Bacteria | 2134 |
| 408 | Ga0157378_10167178 | 3300013297 | Bacteria | 2061 |
| 409 | Ga0157378_10170340 | 3300013297 | Unclassified | 2042 |
| 410 | Ga0157378_10183894 | 3300013297 | Unclassified | 1967 |
| 411 | Ga0157378_10247742 | 3300013297 | Unclassified | 1705 |
| 412 | Ga0157378_10360115 | 3300013297 | Bacteria | 1423 |
| 413 | Ga0157378_10380608 | 3300013297 | Bacteria | 1386 |
| 414 | Ga0163162_10000002 | 3300013306 | Bacteria | 717331 |
| 415 | Ga0163162_10006565 | 3300013306 | Bacteria | 11271 |
| 416 | Ga0163162_10008494 | 3300013306 | Bacteria | 10018 |
| 417 | Ga0163162_10163488 | 3300013306 | Bacteria | 2349 |
| 418 | Ga0163162_10230964 | 3300013306 | Unclassified | 1981 |
| 419 | Ga0163162_10259802 | 3300013306 | Unclassified | 1868 |
| 420 | Ga0157372_10053737 | 3300013307 | Unclassified | 4491 |
| 421 | Ga0157372_10082066 | 3300013307 | Unclassified | 3649 |
| 422 | Ga0157372_10157572 | 3300013307 | Bacteria | 2623 |
| 423 | Ga0157375_10000538 | 3300013308 | Bacteria | 33986 |
| 424 | Ga0157375_10003637 | 3300013308 | Bacteria | 13372 |
| 425 | Ga0157375_10020780 | 3300013308 | Bacteria | 6008 |
| 426 | Ga0157375_10032365 | 3300013308 | Bacteria | 4959 |
| 427 | Ga0157375_10086496 | 3300013308 | Unclassified | 3185 |
| 428 | Ga0157375_10242517 | 3300013308 | Unclassified | 1962 |
| 429 | Ga0157375_10260123 | 3300013308 | Bacteria | 1897 |
| 430 | Ga0157375_10282936 | 3300013308 | Unclassified | 1821 |
| 431 | Ga0157375_10769435 | 3300013308 | Bacteria | 1113 |
| 432 | Ga0163163_10002212 | 3300014325 | Bacteria | 16356 |
| 433 | Ga0163163_10013520 | 3300014325 | Bacteria | 7480 |
| 434 | Ga0163163_10017600 | 3300014325 | Bacteria | 6669 |
| 435 | Ga0163163_10056721 | 3300014325 | Bacteria | 3871 |
| 436 | Ga0163163_10080372 | 3300014325 | Bacteria | 3260 |
| 437 | Ga0163163_10089429 | 3300014325 | Bacteria | 3091 |
| 438 | Ga0163163_10110201 | 3300014325 | Bacteria | 2781 |
| 439 | Ga0163163_10146106 | 3300014325 | Bacteria | 2408 |
| 440 | Ga0163163_10152334 | 3300014325 | Unclassified | 2356 |
| 441 | Ga0163163_10224435 | 3300014325 | Bacteria | 1927 |
| 442 | Ga0157380_10007603 | 3300014326 | Bacteria | 7702 |
| 443 | Ga0157380_10008560 | 3300014326 | Bacteria | 7315 |
| 444 | Ga0157380_10025709 | 3300014326 | Unclassified | 4467 |
| 445 | Ga0157380_10028077 | 3300014326 | Bacteria | 4286 |
| 446 | Ga0157380_10028790 | 3300014326 | Bacteria | 4240 |
| 447 | Ga0157380_10088238 | 3300014326 | Unclassified | 2551 |
| 448 | Ga0157380_10225930 | 3300014326 | Unclassified | 1678 |
| 449 | Ga0157380_10311359 | 3300014326 | Bacteria | 1455 |
| 450 | Ga0157380_10338539 | 3300014326 | Unclassified | 1402 |
| 451 | Ga0157377_10015473 | 3300014745 | Unclassified | 3905 |
| 452 | Ga0157377_10025132 | 3300014745 | Bacteria | 3174 |
| 453 | Ga0157379_10030607 | 3300014968 | Unclassified | 4792 |
| 454 | Ga0157379_10072728 | 3300014968 | Bacteria | 3077 |
| 455 | Ga0157379_10102346 | 3300014968 | Unclassified | 2571 |
| 456 | Ga0157379_10114648 | 3300014968 | Bacteria | 2422 |
| 457 | Ga0157379_10233713 | 3300014968 | Bacteria | 1667 |
| 458 | Ga0157376_10050631 | 3300014969 | Bacteria | 3446 |
| 459 | Ga0157376_10195392 | 3300014969 | Unclassified | 1858 |
| 460 | Ga0157376_10320878 | 3300014969 | Bacteria | 1473 |
| 461 | Ga0163161_10023713 | 3300017792 | Bacteria | 4330 |
| 462 | Ga0163161_10049428 | 3300017792 | Unclassified | 3039 |
| 463 | Ga0163161_10162238 | 3300017792 | Unclassified | 1704 |
| 464 | Ga0207672_1000317 | 3300025223 | Bacteria | 6457 |
| 465 | Ga0207656_10000196 | 3300025321 | Bacteria | 21638 |
| 466 | Ga0207653_10000007 | 3300025885 | Bacteria | 198873 |
| 467 | Ga0207653_10004823 | 3300025885 | Bacteria | 4218 |
| 468 | Ga0207642_10003129 | 3300025899 | Bacteria | 5187 |
| 469 | Ga0207642_10071003 | 3300025899 | Bacteria | 1657 |
| 470 | Ga0207710_10000002 | 3300025900 | Bacteria | 1251998 |
| 471 | Ga0207680_10031052 | 3300025903 | Unclassified | 3023 |
| 472 | Ga0207647_10001379 | 3300025904 | Bacteria | 18664 |
| 473 | Ga0207685_10000018 | 3300025905 | Bacteria | 145715 |
| 474 | Ga0207645_10076169 | 3300025907 | Unclassified | 2148 |
| 475 | Ga0207643_10048303 | 3300025908 | Bacteria | 2410 |
| 476 | Ga0207643_10059562 | 3300025908 | Bacteria | 2178 |
| 477 | Ga0207684_10000448 | 3300025910 | Bacteria | 54372 |
| 478 | Ga0207684_10010854 | 3300025910 | Bacteria | 7993 |
| 479 | Ga0207684_10012695 | 3300025910 | Bacteria | 7314 |
| 480 | Ga0207684_10043729 | 3300025910 | Bacteria | 3798 |
| 481 | Ga0207684_10111029 | 3300025910 | Bacteria | 2347 |
| 482 | Ga0207654_10154231 | 3300025911 | Bacteria | 1477 |
| 483 | Ga0207654_10190921 | 3300025911 | Unclassified | 1342 |
| 484 | Ga0207707_10000004 | 3300025912 | Bacteria | 391281 |
| 485 | Ga0207707_10016248 | 3300025912 | Bacteria | 6492 |
| 486 | Ga0207707_10017642 | 3300025912 | Bacteria | 6226 |
| 487 | Ga0207695_10460580 | 3300025913 | Unclassified | 1154 |
| 488 | Ga0207671_10004405 | 3300025914 | Bacteria | 13490 |
| 489 | Ga0207671_10074856 | 3300025914 | Unclassified | 2531 |
| 490 | Ga0207660_10188717 | 3300025917 | Bacteria | 1604 |
| 491 | Ga0207662_10002083 | 3300025918 | Bacteria | 9930 |
| 492 | Ga0207662_10033491 | 3300025918 | Bacteria | 2995 |
| 493 | Ga0207662_10074213 | 3300025918 | Unclassified | 2064 |
| 494 | Ga0207649_10026095 | 3300025920 | Unclassified | 3414 |
| 495 | Ga0207652_10001059 | 3300025921 | Bacteria | 25028 |
| 496 | Ga0207652_10305100 | 3300025921 | Bacteria | 1437 |
| 497 | Ga0207646_10001205 | 3300025922 | Bacteria | 32528 |
| 498 | Ga0207646_10002372 | 3300025922 | Bacteria | 22266 |
| 499 | Ga0207646_10014963 | 3300025922 | Bacteria | 7347 |
| 500 | Ga0207646_10030456 | 3300025922 | Bacteria | 4891 |
| 501 | Ga0207646_10035462 | 3300025922 | Bacteria | 4505 |
| 502 | Ga0207646_10054762 | 3300025922 | Bacteria | 3567 |
| 503 | Ga0207646_10118038 | 3300025922 | Bacteria | 2383 |
| 504 | Ga0207646_10300274 | 3300025922 | Bacteria | 1451 |
| 505 | Ga0207681_10006524 | 3300025923 | Bacteria | 7158 |
| 506 | Ga0207681_10022001 | 3300025923 | Bacteria | 4061 |
| 507 | Ga0207681_10036958 | 3300025923 | Unclassified | 3225 |
| 508 | Ga0207694_10022763 | 3300025924 | Bacteria | 4753 |
| 509 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 510 | Ga0207650_10001416 | 3300025925 | Bacteria | 17284 |
| 511 | Ga0207650_10004340 | 3300025925 | Bacteria | 9686 |
| 512 | Ga0207650_10028463 | 3300025925 | Bacteria | 4007 |
| 513 | Ga0207650_10078783 | 3300025925 | Bacteria | 2494 |
| 514 | Ga0207650_10116732 | 3300025925 | Bacteria | 2073 |
| 515 | Ga0207650_10362002 | 3300025925 | Unclassified | 1195 |
| 516 | Ga0207659_10020047 | 3300025926 | Bacteria | 4413 |
| 517 | Ga0207659_10022526 | 3300025926 | Bacteria | 4194 |
| 518 | Ga0207659_10056814 | 3300025926 | Bacteria | 2804 |
| 519 | Ga0207644_10004396 | 3300025931 | Bacteria | 9141 |
| 520 | Ga0207690_10062743 | 3300025932 | Bacteria | 2531 |
| 521 | Ga0207690_10098613 | 3300025932 | Bacteria | 2081 |
| 522 | Ga0207706_10029341 | 3300025933 | Bacteria | 4910 |
| 523 | Ga0207706_10032899 | 3300025933 | Bacteria | 4613 |
| 524 | Ga0207686_10000018 | 3300025934 | Bacteria | 189717 |
| 525 | Ga0207686_10000021 | 3300025934 | Bacteria | 181793 |
| 526 | Ga0207686_10000132 | 3300025934 | Bacteria | 58994 |
| 527 | Ga0207686_10000436 | 3300025934 | Bacteria | 28156 |
| 528 | Ga0207686_10018600 | 3300025934 | Bacteria | 3936 |
| 529 | Ga0207686_10041054 | 3300025934 | Bacteria | 2818 |
| 530 | Ga0207686_10114877 | 3300025934 | Bacteria | 1822 |
| 531 | Ga0207709_10000069 | 3300025935 | Bacteria | 183367 |
| 532 | Ga0207709_10002653 | 3300025935 | Bacteria | 11110 |
| 533 | Ga0207709_10022298 | 3300025935 | Bacteria | 3591 |
| 534 | Ga0207709_10059971 | 3300025935 | Bacteria | 2370 |
| 535 | Ga0207670_10012844 | 3300025936 | Bacteria | 4915 |
| 536 | Ga0207670_10014914 | 3300025936 | Bacteria | 4628 |
| 537 | Ga0207670_10021386 | 3300025936 | Bacteria | 3991 |
| 538 | Ga0207669_10212328 | 3300025937 | Unclassified | 1414 |
| 539 | Ga0207665_10000131 | 3300025939 | Bacteria | 49773 |
| 540 | Ga0207691_10001245 | 3300025940 | Bacteria | 25434 |
| 541 | Ga0207691_10002279 | 3300025940 | Bacteria | 18787 |
| 542 | Ga0207691_10010424 | 3300025940 | Bacteria | 8917 |
| 543 | Ga0207711_10004416 | 3300025941 | Bacteria | 11989 |
| 544 | Ga0207711_10011189 | 3300025941 | Bacteria | 7456 |
| 545 | Ga0207711_10022392 | 3300025941 | Bacteria | 5283 |
| 546 | Ga0207711_10063758 | 3300025941 | Unclassified | 3182 |
| 547 | Ga0207711_10139037 | 3300025941 | Unclassified | 2184 |
| 548 | Ga0207711_10404686 | 3300025941 | Bacteria | 1268 |
| 549 | Ga0207689_10005406 | 3300025942 | Bacteria | 11431 |
| 550 | Ga0207689_10007654 | 3300025942 | Bacteria | 9461 |
| 551 | Ga0207689_10011776 | 3300025942 | Bacteria | 7494 |
| 552 | Ga0207689_10011850 | 3300025942 | Bacteria | 7468 |
| 553 | Ga0207689_10027730 | 3300025942 | Bacteria | 4740 |
| 554 | Ga0207689_10031336 | 3300025942 | Unclassified | 4428 |
| 555 | Ga0207689_10066328 | 3300025942 | Bacteria | 2968 |
| 556 | Ga0207689_10144968 | 3300025942 | Unclassified | 1957 |
| 557 | Ga0207679_10004427 | 3300025945 | Bacteria | 8748 |
| 558 | Ga0207667_10325146 | 3300025949 | Bacteria | 1570 |
| 559 | Ga0207651_10000598 | 3300025960 | Bacteria | 15206 |
| 560 | Ga0207651_10021160 | 3300025960 | Bacteria | 3946 |
| 561 | Ga0207651_10022272 | 3300025960 | Bacteria | 3870 |
| 562 | Ga0207651_10028764 | 3300025960 | Unclassified | 3511 |
| 563 | Ga0207651_10031957 | 3300025960 | Bacteria | 3373 |
| 564 | Ga0207651_10142771 | 3300025960 | Bacteria | 1852 |
| 565 | Ga0207651_10281958 | 3300025960 | Bacteria | 1374 |
| 566 | Ga0207712_10000041 | 3300025961 | Bacteria | 180000 |
| 567 | Ga0207712_10005221 | 3300025961 | Bacteria | 8213 |
| 568 | Ga0207712_10018531 | 3300025961 | Unclassified | 4536 |
| 569 | Ga0207712_10021573 | 3300025961 | Bacteria | 4230 |
| 570 | Ga0207712_10094557 | 3300025961 | Bacteria | 2208 |
| 571 | Ga0207712_10196191 | 3300025961 | Unclassified | 1597 |
| 572 | Ga0207668_10097433 | 3300025972 | Unclassified | 2176 |
| 573 | Ga0207640_10029548 | 3300025981 | Bacteria | 3366 |
| 574 | Ga0207640_10216403 | 3300025981 | Unclassified | 1463 |
| 575 | Ga0207658_10008335 | 3300025986 | Bacteria | 7059 |
| 576 | Ga0207658_10037469 | 3300025986 | Bacteria | 3485 |
| 577 | Ga0207658_10050118 | 3300025986 | Unclassified | 3071 |
| 578 | Ga0207677_10000835 | 3300026023 | Bacteria | 17599 |
| 579 | Ga0207703_10000150 | 3300026035 | Bacteria | 80047 |
| 580 | Ga0207703_10014535 | 3300026035 | Bacteria | 6141 |
| 581 | Ga0207703_10034451 | 3300026035 | Unclassified | 4017 |
| 582 | Ga0207703_10059248 | 3300026035 | Bacteria | 3127 |
| 583 | Ga0207703_10061887 | 3300026035 | Unclassified | 3066 |
| 584 | Ga0207703_10106749 | 3300026035 | Bacteria | 2382 |
| 585 | Ga0207703_10140243 | 3300026035 | Unclassified | 2097 |
| 586 | Ga0207639_10040254 | 3300026041 | Bacteria | 3487 |
| 587 | Ga0207639_10168606 | 3300026041 | Bacteria | 1852 |
| 588 | Ga0207708_10000095 | 3300026075 | Bacteria | 67730 |
| 589 | Ga0207708_10017022 | 3300026075 | Bacteria | 5472 |
| 590 | Ga0207708_10025165 | 3300026075 | Bacteria | 4501 |
| 591 | Ga0207708_10034363 | 3300026075 | Unclassified | 3857 |
| 592 | Ga0207708_10045435 | 3300026075 | Bacteria | 3347 |
| 593 | Ga0207708_10069850 | 3300026075 | Unclassified | 2689 |
| 594 | Ga0207708_10080496 | 3300026075 | Bacteria | 2503 |
| 595 | Ga0207708_10132620 | 3300026075 | Unclassified | 1949 |
| 596 | Ga0207708_10309700 | 3300026075 | Bacteria | 1286 |
| 597 | Ga0207702_10068633 | 3300026078 | Unclassified | 3046 |
| 598 | Ga0207702_10086489 | 3300026078 | Bacteria | 2734 |
| 599 | Ga0207641_10008925 | 3300026088 | Bacteria | 8283 |
| 600 | Ga0207641_10027252 | 3300026088 | Unclassified | 4719 |
| 601 | Ga0207641_10032816 | 3300026088 | Bacteria | 4312 |
| 602 | Ga0207641_10072291 | 3300026088 | Unclassified | 2970 |
| 603 | Ga0207641_10088979 | 3300026088 | Unclassified | 2698 |
| 604 | Ga0207641_10317464 | 3300026088 | Unclassified | 1476 |
| 605 | Ga0207648_10006724 | 3300026089 | Bacteria | 11406 |
| 606 | Ga0207648_10060104 | 3300026089 | Bacteria | 3314 |
| 607 | Ga0207648_10075163 | 3300026089 | Bacteria | 2946 |
| 608 | Ga0207676_10001257 | 3300026095 | Bacteria | 18846 |
| 609 | Ga0207676_10018214 | 3300026095 | Bacteria | 5101 |
| 610 | Ga0207676_10022540 | 3300026095 | Bacteria | 4631 |
| 611 | Ga0207676_10064738 | 3300026095 | Bacteria | 2908 |
| 612 | Ga0207676_10101294 | 3300026095 | Bacteria | 2388 |
| 613 | Ga0207676_10105658 | 3300026095 | Bacteria | 2344 |
| 614 | Ga0207676_10128477 | 3300026095 | Bacteria | 2151 |
| 615 | Ga0207676_10266820 | 3300026095 | Unclassified | 1548 |
| 616 | Ga0207674_10021048 | 3300026116 | Bacteria | 7034 |
| 617 | Ga0207674_10327410 | 3300026116 | Unclassified | 1482 |
| 618 | Ga0207675_100001831 | 3300026118 | Bacteria | 21313 |
| 619 | Ga0207675_100009031 | 3300026118 | Bacteria | 9351 |
| 620 | Ga0207675_100024454 | 3300026118 | Bacteria | 5616 |
| 621 | Ga0207675_100038652 | 3300026118 | Bacteria | 4453 |
| 622 | Ga0207675_100120881 | 3300026118 | Unclassified | 2478 |
| 623 | Ga0207675_100128388 | 3300026118 | Unclassified | 2403 |
| 624 | Ga0207675_100195054 | 3300026118 | Unclassified | 1944 |
| 625 | Ga0207675_100224028 | 3300026118 | Bacteria | 1812 |
| 626 | Ga0207675_100224666 | 3300026118 | Unclassified | 1810 |
| 627 | Ga0207683_10013365 | 3300026121 | Bacteria | 7001 |
| 628 | Ga0207683_10184508 | 3300026121 | Bacteria | 1892 |
| 629 | Ga0207698_10134961 | 3300026142 | Unclassified | 2116 |
| 630 | Ga0207428_10001203 | 3300027907 | Bacteria | 27741 |
| 631 | Ga0207428_10001442 | 3300027907 | Bacteria | 24974 |
| 632 | Ga0207428_10011524 | 3300027907 | Bacteria | 7810 |
| 633 | Ga0207428_10064220 | 3300027907 | Bacteria | 2899 |
| 634 | Ga0207428_10089947 | 3300027907 | Bacteria | 2385 |
| 635 | Ga0268265_10011947 | 3300028380 | Bacteria | 5875 |
| 636 | Ga0268265_10038475 | 3300028380 | Bacteria | 3519 |
| 637 | Ga0268265_10076377 | 3300028380 | Bacteria | 2628 |
| 638 | Ga0268265_10323921 | 3300028380 | Unclassified | 1397 |
| 639 | Ga0268264_10011660 | 3300028381 | Bacteria | 7248 |
| 640 | Ga0268264_10014775 | 3300028381 | Bacteria | 6413 |
| 641 | Ga0268264_10041380 | 3300028381 | Bacteria | 3812 |
| 642 | Ga0268264_10043041 | 3300028381 | Unclassified | 3740 |
| 643 | Ga0268264_10130668 | 3300028381 | Bacteria | 2225 |
| 644 | Ga0268264_10287206 | 3300028381 | Bacteria | 1543 |
| 645 | Ga0307408_100037461 | 3300031548 | Unclassified | 3416 |
| 646 | Ga0307405_10033272 | 3300031731 | Unclassified | 3056 |
| 647 | Ga0307405_10041484 | 3300031731 | Bacteria | 2795 |
| 648 | Ga0307405_10147957 | 3300031731 | Unclassified | 1648 |
| 649 | Ga0307405_10223262 | 3300031731 | Unclassified | 1384 |
| 650 | Ga0307413_10004115 | 3300031824 | Bacteria | 6267 |
| 651 | Ga0307410_10108672 | 3300031852 | Bacteria | 2003 |
| 652 | Ga0307406_10010553 | 3300031901 | Bacteria | 5214 |
| 653 | Ga0307412_10003977 | 3300031911 | Bacteria | 8234 |
| 654 | Ga0307416_100073421 | 3300032002 | Unclassified | 2852 |
| 655 | Ga0307416_100083873 | 3300032002 | Unclassified | 2705 |
| 656 | Ga0307414_10008840 | 3300032004 | Bacteria | 5746 |
| 657 | Ga0307414_10054988 | 3300032004 | Bacteria | 2785 |
| 658 | Ga0307411_10143586 | 3300032005 | Bacteria | 1763 |
| 659 | Ga0307415_100006325 | 3300032126 | Bacteria | 6373 |
| 660 | Ga0307415_100107945 | 3300032126 | Bacteria | 2058 |
| 661 | Ga0373930_0025405 | 3300034816 | Unclassified | 1189 |
| 662 | Ga0373940_0019778 | 3300035088 | Bacteria | 1704 |
| 663 | Ga0373951_0001697 | 3300035091 | Bacteria | 5754 |
| 664 | Ga0373932_0025122 | 3300035112 | Bacteria | 1610 |
| 665 | Ga0373953_0034045 | 3300035117 | Bacteria | 1996 |
| 666 | Ga0373955_0082553 | 3300035172 | Bacteria | 1819 |
| 667 | Ga0373961_0031650 | 3300035241 | Bacteria | 1479 |
| 668 | Ga0373937_0004612 | 3300036401 | Bacteria | 11701 |
| 669 | Ga0373937_0037580 | 3300036401 | Bacteria | 4413 |
| 670 | Ga0395899_0140889 | 3300037312 | Bacteria | 1716 |
| 671 | Ga0395900_0110968 | 3300037418 | Bacteria | 2817 |
| 672 | Ga0395898_0239729 | 3300037466 | Bacteria | 1730 |
| 673 | Ga0395901_0041444 | 3300038443 | Bacteria | 4772 |
| 674 | Ga0439455_0015200 | 3300042012 | Bacteria | 1767 |
| 675 | Ga0439458_0004057 | 3300042157 | Unclassified | 3379 |
| 676 | Ga0439434_0014184 | 3300042435 | Bacteria | 2371 |
| 677 | Ga0453683_0009301 | 3300044673 | Bacteria | 6568 |
| 678 | Ga0453683_0022885 | 3300044673 | Bacteria | 3984 |
| 679 | Ga0453684_0293472 | 3300044712 | Bacteria | 1850 |
| 680 | Ga0451576_0140839 | 3300045051 | Bacteria | 2515 |
| 681 | Ga0451576_0390179 | 3300045051 | Bacteria | 1459 |
| 682 | Ga0495592_0002030 | 3300046454 | Bacteria | 14250 |
| 683 | Ga0495610_0078973 | 3300046512 | Bacteria | 1516 |
| 684 | Ga0495663_0000880 | 3300046525 | Bacteria | 10119 |
| 685 | Ga0495598_0000239 | 3300046537 | Bacteria | 9795 |
| 686 | Ga0495621_0001254 | 3300046539 | Bacteria | 6549 |
| 687 | Ga0495621_0079195 | 3300046539 | Unclassified | 1223 |
| 688 | Ga0495667_0001527 | 3300046559 | Bacteria | 15310 |
| 689 | Ga0495634_0069819 | 3300046642 | Unclassified | 2317 |
| 690 | Ga0495634_0188231 | 3300046642 | Unclassified | 1289 |
| 691 | Ga0495657_0013716 | 3300046675 | Bacteria | 5969 |
| 692 | Ga0495613_0167917 | 3300046689 | Bacteria | 1558 |
| 693 | Ga0495636_0016131 | 3300047318 | Bacteria | 2981 |
| 694 | Ga0495674_0041641 | 3300047319 | Unclassified | 4102 |
| 695 | Ga0495674_0377534 | 3300047319 | Bacteria | 1147 |
| 696 | Ga0495672_0039395 | 3300047320 | Bacteria | 2873 |
| 697 | Ga0495675_0183057 | 3300047444 | Bacteria | 1282 |
| 698 | Ga0495684_0121397 | 3300047471 | Bacteria | 1968 |
| 699 | Ga0496102_0057261 | 3300048905 | Unclassified | 3558 |
| 700 | Ga0496104_0070865 | 3300048907 | Unclassified | 3315 |
| 701 | Ga0496104_0419800 | 3300048907 | Unclassified | 1250 |
| 702 | Ga0496106_0000917 | 3300048909 | Bacteria | 21420 |
| 703 | Ga0496106_0116263 | 3300048909 | Bacteria | 2086 |
| 704 | Ga0496109_0000100 | 3300048912 | Bacteria | 89897 |
| 705 | Ga0496110_0080365 | 3300048913 | Bacteria | 2905 |
| 706 | Ga0496112_0199145 | 3300048915 | Unclassified | 1963 |
| 707 | Ga0501290_004638 | 3300049513 | Unclassified | 1714 |
| 708 | Ga0501291_000669 | 3300049514 | Unclassified | 3914 |
| 709 | Ga0501291_004861 | 3300049514 | Bacteria | 1731 |
| 710 | Ga0501294_003243 | 3300049517 | Unclassified | 1533 |
| 711 | Ga0501295_002663 | 3300049518 | Unclassified | 2077 |
| 712 | Ga0501296_000210 | 3300049519 | Bacteria | 6106 |
| 713 | Ga0501298_000163 | 3300049521 | Bacteria | 8191 |
| 714 | Ga0501299_002847 | 3300049522 | Unclassified | 2445 |
| 715 | Ga0501299_025947 | 3300049522 | Unclassified | 1103 |
| 716 | Ga0501031_0074082 | 3300049568 | Bacteria | 2217 |
| 717 | Ga0501038_0001767 | 3300049574 | Bacteria | 20103 |
| 718 | Ga0501038_0123813 | 3300049574 | Unclassified | 2129 |
| 719 | Ga0501040_0035568 | 3300049576 | Bacteria | 3378 |
| 720 | Ga0501040_0143311 | 3300049576 | Unclassified | 1684 |
| 721 | Ga0501042_0031245 | 3300049578 | Unclassified | 3768 |
| 722 | Ga0501048_0022363 | 3300049582 | Unclassified | 4625 |
| 723 | Ga0501069_0028851 | 3300049585 | Bacteria | 3044 |
| 724 | Ga0501071_0135778 | 3300049587 | Bacteria | 1830 |
| 725 | Ga0501071_0169772 | 3300049587 | Unclassified | 1633 |
| 726 | Ga0501071_0254963 | 3300049587 | Bacteria | 1324 |
| 727 | Ga0501074_0210810 | 3300049590 | Unclassified | 1384 |
| 728 | Ga0501075_0017112 | 3300049591 | Bacteria | 5233 |
| 729 | Ga0501075_0109007 | 3300049591 | Unclassified | 2105 |
| 730 | Ga0501076_0017789 | 3300049592 | Bacteria | 5404 |
| 731 | Ga0501077_0019173 | 3300049593 | Bacteria | 4326 |
| 732 | Ga0501077_0074146 | 3300049593 | Bacteria | 2156 |
| 733 | Ga0501077_0157717 | 3300049593 | Unclassified | 1441 |
| 734 | Ga0501201_001839 | 3300049651 | Unclassified | 1961 |
| 735 | Ga0501202_004235 | 3300049652 | Bacteria | 2507 |
| 736 | Ga0501202_005133 | 3300049652 | Unclassified | 2315 |
| 737 | Ga0501202_008338 | 3300049652 | Unclassified | 1887 |
| 738 | Ga0501202_009628 | 3300049652 | Unclassified | 1780 |
| 739 | Ga0501214_003010 | 3300049659 | Unclassified | 1461 |
| 740 | Ga0501216_007946 | 3300049660 | Unclassified | 1659 |
| 741 | Ga0501216_010322 | 3300049660 | Unclassified | 1500 |
| 742 | Ga0501217_001192 | 3300049661 | Unclassified | 4789 |
| 743 | Ga0501217_004996 | 3300049661 | Bacteria | 2754 |
| 744 | Ga0501217_010431 | 3300049661 | Unclassified | 2035 |
| 745 | Ga0501223_009610 | 3300049663 | Unclassified | 1955 |
| 746 | Ga0501224_002898 | 3300049664 | Unclassified | 2368 |
| 747 | Ga0501224_005567 | 3300049664 | Unclassified | 1808 |
| 748 | Ga0501227_001143 | 3300049665 | Bacteria | 5930 |
| 749 | Ga0501230_006353 | 3300049667 | Unclassified | 1711 |
| 750 | Ga0501233_004523 | 3300049668 | Bacteria | 2552 |
| 751 | Ga0501233_005470 | 3300049668 | Bacteria | 2359 |
| 752 | Ga0501233_023023 | 3300049668 | Unclassified | 1350 |
| 753 | Ga0501235_002482 | 3300049669 | Unclassified | 3975 |
| 754 | Ga0501235_004920 | 3300049669 | Bacteria | 2895 |
| 755 | Ga0501247_005845 | 3300049677 | Bacteria | 1380 |
| 756 | Ga0501249_008964 | 3300049679 | Unclassified | 2079 |
| 757 | Ga0501257_020979 | 3300049686 | Unclassified | 1538 |
| 758 | Ga0501259_005583 | 3300049688 | Unclassified | 1995 |
| 759 | Ga0501221_010656 | 3300049704 | Unclassified | 1637 |
| 760 | Ga0501225_0002541 | 3300049705 | Bacteria | 5629 |
| 761 | Ga0501225_0003934 | 3300049705 | Unclassified | 4447 |
| 762 | Ga0501229_003244 | 3300049706 | Bacteria | 1942 |
| 763 | Ga0501234_000552 | 3300049707 | Bacteria | 5710 |
| 764 | Ga0501234_003877 | 3300049707 | Unclassified | 2353 |
| 765 | Ga0501234_005759 | 3300049707 | Bacteria | 1936 |
| 766 | Ga0501245_005395 | 3300049708 | Unclassified | 1770 |
| 767 | Ga0501079_0012525 | 3300049741 | Bacteria | 6473 |
| 768 | Ga0501079_0029871 | 3300049741 | Bacteria | 4187 |
| 769 | Ga0501080_0011951 | 3300049742 | Bacteria | 7953 |
| 770 | Ga0501081_0021201 | 3300049743 | Unclassified | 4337 |
| 771 | Ga0501083_0101595 | 3300049744 | Bacteria | 1896 |
| 772 | Ga0501280_006674 | 3300049776 | Unclassified | 1623 |
| 773 | Ga0501283_000161 | 3300049779 | Bacteria | 8519 |
| 774 | Ga0501035_0158318 | 3300049822 | Bacteria | 1962 |
| 775 | Ga0501045_0028872 | 3300049824 | Bacteria | 4004 |
| 776 | Ga0501212_002182 | 3300049851 | Bacteria | 2334 |
| 777 | Ga0501212_006849 | 3300049851 | Unclassified | 1547 |
| 778 | Ga0501212_007525 | 3300049851 | Unclassified | 1495 |
| 779 | Ga0501226_002206 | 3300049853 | Unclassified | 2403 |
| 780 | nmdc:mga05p37_11175_c1 | 3300050507 | Bacteria | 10670 |
| 781 | nmdc:mga05p37_168018_c1 | 3300050507 | Bacteria | 2676 |
| 782 | nmdc:mga05p37_190569_c1 | 3300050507 | Unclassified | 2490 |
| 783 | nmdc:mga05p37_190944_c1 | 3300050507 | Unclassified | 2487 |
| 784 | nmdc:mga05p37_196143_c1 | 3300050507 | Unclassified | 2448 |
| 785 | nmdc:mga05p37_2065_c1 | 3300050507 | Bacteria | 23410 |
| 786 | nmdc:mga05p37_268162_c1 | 3300050507 | Bacteria | 2041 |
| 787 | nmdc:mga05p37_27884_c1 | 3300050507 | Bacteria | 6880 |
| 788 | nmdc:mga05p37_29589_c1 | 3300050507 | Bacteria | 6683 |
| 789 | nmdc:mga05p37_425245_c1 | 3300050507 | Unclassified | 1545 |
| 790 | nmdc:mga05p37_431137_c1 | 3300050507 | Bacteria | 1532 |
| 791 | nmdc:mga05p37_444794_c1 | 3300050507 | Unclassified | 1502 |
| 792 | nmdc:mga05p37_458728_c1 | 3300050507 | Unclassified | 1473 |
| 793 | nmdc:mga05p37_459465_c1 | 3300050507 | Bacteria | 1472 |
| 794 | nmdc:mga05p37_581721_c1 | 3300050507 | Unclassified | 1268 |
| 795 | nmdc:mga05p37_59162_c1 | 3300050507 | Bacteria | 4719 |
| 796 | nmdc:mga05p37_601327_c1 | 3300050507 | Unclassified | 1241 |
| 797 | nmdc:mga09592_396881_c1 | 3300050508 | Bacteria | 1192 |
| 798 | nmdc:mga09592_59549_c1 | 3300050508 | Bacteria | 3228 |
| 799 | nmdc:mga09592_91985_c1 | 3300050508 | Unclassified | 2593 |
| 800 | nmdc:mga0qj67_213361_c1 | 3300050509 | Bacteria | 1567 |
| 801 | nmdc:mga0qj67_248169_c1 | 3300050509 | Unclassified | 1444 |
| 802 | nmdc:mga0qj67_409014_c1 | 3300050509 | Bacteria | 1094 |
| 803 | nmdc:mga06r32_210121_c1 | 3300050510 | Bacteria | 1934 |
| 804 | nmdc:mga06r32_258155_c1 | 3300050510 | Bacteria | 1730 |
| 805 | nmdc:mga06r32_265875_c1 | 3300050510 | Unclassified | 1702 |
| 806 | nmdc:mga06r32_32760_c1 | 3300050510 | Bacteria | 4893 |
| 807 | nmdc:mga06r32_49762_c1 | 3300050510 | Bacteria | 4009 |
| 808 | nmdc:mga06r32_58304_c1 | 3300050510 | Bacteria | 3711 |
| 809 | nmdc:mga08y16_125568_c1 | 3300050511 | Unclassified | 2669 |
| 810 | nmdc:mga08y16_14312_c1 | 3300050511 | Bacteria | 8350 |
| 811 | nmdc:mga08y16_155187_c1 | 3300050511 | Unclassified | 2379 |
| 812 | nmdc:mga08y16_16214_c1 | 3300050511 | Bacteria | 7834 |
| 813 | nmdc:mga08y16_165676_c1 | 3300050511 | Bacteria | 2296 |
| 814 | nmdc:mga08y16_184618_c1 | 3300050511 | Unclassified | 2165 |
| 815 | nmdc:mga08y16_2321_c1 | 3300050511 | Bacteria | 19497 |
| 816 | nmdc:mga08y16_256643_c1 | 3300050511 | Bacteria | 1806 |
| 817 | nmdc:mga08y16_31610_c1 | 3300050511 | Bacteria | 5567 |
| 818 | nmdc:mga08y16_368229_c1 | 3300050511 | Bacteria | 1474 |
| 819 | nmdc:mga08y16_46273_c1 | 3300050511 | Bacteria | 4555 |
| 820 | nmdc:mga08y16_49419_c1 | 3300050511 | Unclassified | 4402 |
| 821 | nmdc:mga0n895_106710_c1 | 3300050512 | Unclassified | 2814 |
| 822 | nmdc:mga0n895_108010_c1 | 3300050512 | Bacteria | 2797 |
| 823 | nmdc:mga0n895_23514_c1 | 3300050512 | Bacteria | 5793 |
| 824 | nmdc:mga0n895_37099_c1 | 3300050512 | Unclassified | 4712 |
| 825 | nmdc:mga0n895_45511_c1 | 3300050512 | Unclassified | 4282 |
| 826 | nmdc:mga0n895_46685_c1 | 3300050512 | Bacteria | 4232 |
| 827 | nmdc:mga0n895_57260_c1 | 3300050512 | Bacteria | 3841 |
| 828 | nmdc:mga0n895_69017_c1 | 3300050512 | Bacteria | 3501 |
| 829 | nmdc:mga0n895_7573_c1 | 3300050512 | Bacteria | 9333 |
| 830 | nmdc:mga0rr50_178557_c1 | 3300050513 | Bacteria | 1734 |
| 831 | nmdc:mga0rr50_202617_c1 | 3300050513 | Unclassified | 1631 |
| 832 | nmdc:mga0rr50_377_c1 | 3300050513 | Bacteria | 24435 |
| 833 | nmdc:mga08x19_9_c1 | 3300050514 | Bacteria | 418852 |
| 834 | nmdc:mga0a205_138065_c1 | 3300050515 | Unclassified | 2338 |
| 835 | nmdc:mga0a205_157987_c1 | 3300050515 | Bacteria | 2165 |
| 836 | nmdc:mga0a205_18848_c1 | 3300050515 | Bacteria | 6496 |
| 837 | nmdc:mga0a205_19414_c1 | 3300050515 | Bacteria | 6407 |
| 838 | nmdc:mga0a205_220917_c1 | 3300050515 | Bacteria | 1780 |
| 839 | nmdc:mga0a205_314794_c1 | 3300050515 | Bacteria | 1437 |
| 840 | nmdc:mga0a205_34453_c1 | 3300050515 | Unclassified | 4857 |
| 841 | nmdc:mga0a205_35775_c1 | 3300050515 | Bacteria | 4769 |
| 842 | nmdc:mga0a205_46989_c1 | 3300050515 | Bacteria | 4164 |
| 843 | nmdc:mga0a205_4815_c1 | 3300050515 | Bacteria | 12133 |
| 844 | nmdc:mga0a205_499_c1 | 3300050515 | Bacteria | 30757 |
| 845 | Ga0495619_0027387 | 3300053085 | Bacteria | 3670 |
| 846 | Ga0500641_0022760 | 3300053096 | Bacteria | 2404 |
| 847 | Ga0501084_0013070 | 3300054114 | Bacteria | 6869 |
| 848 | Ga0501084_0034662 | 3300054114 | Unclassified | 4220 |
| 849 | Ga0501084_0072377 | 3300054114 | Unclassified | 2887 |
| 850 | Ga0501084_0281474 | 3300054114 | Unclassified | 1404 |
| 851 | Ga0501082_0015213 | 3300060353 | Bacteria | 6630 |
| 852 | Ga0501082_0036111 | 3300060353 | Bacteria | 4258 |
| 853 | Ga0501082_0231460 | 3300060353 | Unclassified | 1608 |
| 854 | Ga0530510_0053621 | 3300061734 | Bacteria | 2914 |
| 855 | Ga0530510_0198060 | 3300061734 | Bacteria | 1491 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006871 | Ga0075434_100057816 | Ga0075434_1000578162 | 311 |
| 2 | 3300014969 | Ga0157376_10320878 | Ga0157376_103208781 | 313 |
| 3 | 3300005468 | Ga0070707_100004557 | Ga0070707_1000045579 | 316 |
| 4 | 3300025922 | Ga0207646_10002372 | Ga0207646_1000237210 | 316 |
| 5 | 3300050512 | nmdc:mga0n895_45511_c1 | nmdc:mga0n895_45511_c1_348_1358 | 316 |
| 6 | 3300049518 | Ga0501295_002663 | Ga0501295_002663_18_995 | 322 |
| 7 | 3300005293 | Ga0065715_10161837 | Ga0065715_101618372 | 323 |
| 8 | 3300006844 | Ga0075428_100073725 | Ga0075428_1000737252 | 323 |
| 9 | 3300006847 | Ga0075431_100158080 | Ga0075431_1001580802 | 323 |
| 10 | 3300006871 | Ga0075434_100009798 | Ga0075434_1000097985 | 323 |
| 11 | 3300006880 | Ga0075429_100104035 | Ga0075429_1001040353 | 323 |
| 12 | 3300007076 | Ga0075435_100019273 | Ga0075435_1000192734 | 323 |
| 13 | 3300009147 | Ga0114129_10282140 | Ga0114129_102821402 | 323 |
| 14 | 3300026118 | Ga0207675_100128388 | Ga0207675_1001283882 | 323 |
| 15 | 3300050507 | nmdc:mga05p37_27884_c1 | nmdc:mga05p37_27884_c1_5875_6861 | 323 |
| 16 | 3300050507 | nmdc:mga05p37_431137_c1 | nmdc:mga05p37_431137_c1_226_1212 | 323 |
| 17 | 3300050507 | nmdc:mga05p37_459465_c1 | nmdc:mga05p37_459465_c1_273_1259 | 323 |
| 18 | 3300050510 | nmdc:mga06r32_258155_c1 | nmdc:mga06r32_258155_c1_409_1395 | 323 |
| 19 | 3300050511 | nmdc:mga08y16_155187_c1 | nmdc:mga08y16_155187_c1_1056_2048 | 323 |
| 20 | 3300050512 | nmdc:mga0n895_23514_c1 | nmdc:mga0n895_23514_c1_627_1628 | 323 |
| 21 | 3300050512 | nmdc:mga0n895_57260_c1 | nmdc:mga0n895_57260_c1_1174_2160 | 323 |
| 22 | 3300005295 | Ga0065707_10085619 | Ga0065707_100856193 | 324 |
| 23 | 3300006846 | Ga0075430_100146038 | Ga0075430_1001460382 | 324 |
| 24 | 3300049707 | Ga0501234_005759 | Ga0501234_005759_668_1660 | 327 |
| 25 | 3300005549 | Ga0070704_100023962 | Ga0070704_1000239623 | 328 |
| 26 | 3300005937 | Ga0081455_10002043 | Ga0081455_100020434 | 328 |
| 27 | 3300006871 | Ga0075434_100206019 | Ga0075434_1002060192 | 328 |
| 28 | 3300007076 | Ga0075435_100329251 | Ga0075435_1003292512 | 328 |
| 29 | 3300009147 | Ga0114129_10263292 | Ga0114129_102632921 | 328 |
| 30 | 3300027907 | Ga0207428_10011524 | Ga0207428_100115242 | 328 |
| 31 | 3300046539 | Ga0495621_0079195 | Ga0495621_0079195_215_1213 | 328 |
| 32 | 3300048912 | Ga0496109_0000100 | Ga0496109_0000100_24508_25500 | 328 |
| 33 | 3300049587 | Ga0501071_0254963 | Ga0501071_0254963_313_1302 | 328 |
| 34 | 3300049593 | Ga0501077_0074146 | Ga0501077_0074146_1053_2048 | 328 |
| 35 | 3300050507 | nmdc:mga05p37_581721_c1 | nmdc:mga05p37_581721_c1_132_1121 | 328 |
| 36 | 3300050510 | nmdc:mga06r32_49762_c1 | nmdc:mga06r32_49762_c1_2686_3681 | 328 |
| 37 | 3300050511 | nmdc:mga08y16_16214_c1 | nmdc:mga08y16_16214_c1_2528_3523 | 328 |
| 38 | 3300050515 | nmdc:mga0a205_138065_c1 | nmdc:mga0a205_138065_c1_1244_2239 | 328 |
| 39 | 3300006871 | Ga0075434_100383243 | Ga0075434_1003832431 | 329 |
| 40 | 3300005290 | Ga0065712_10087944 | Ga0065712_100879443 | 330 |
| 41 | 3300005290 | Ga0065712_10089765 | Ga0065712_100897652 | 330 |
| 42 | 3300005335 | Ga0070666_10074489 | Ga0070666_100744891 | 330 |
| 43 | 3300005466 | Ga0070685_10057830 | Ga0070685_100578301 | 330 |
| 44 | 3300005618 | Ga0068864_100031869 | Ga0068864_1000318693 | 330 |
| 45 | 3300005843 | Ga0068860_100036110 | Ga0068860_1000361104 | 330 |
| 46 | 3300005843 | Ga0068860_100215538 | Ga0068860_1002155383 | 330 |
| 47 | 3300005844 | Ga0068862_100123737 | Ga0068862_1001237373 | 330 |
| 48 | 3300006358 | Ga0068871_100101761 | Ga0068871_1001017613 | 330 |
| 49 | 3300014326 | Ga0157380_10028077 | Ga0157380_100280775 | 330 |
| 50 | 3300025908 | Ga0207643_10059562 | Ga0207643_100595622 | 330 |
| 51 | 3300025926 | Ga0207659_10022526 | Ga0207659_100225262 | 330 |
| 52 | 3300025940 | Ga0207691_10010424 | Ga0207691_100104244 | 330 |
| 53 | 3300025941 | Ga0207711_10011189 | Ga0207711_100111894 | 330 |
| 54 | 3300025961 | Ga0207712_10094557 | Ga0207712_100945572 | 330 |
| 55 | 3300026095 | Ga0207676_10101294 | Ga0207676_101012942 | 330 |
| 56 | 3300028380 | Ga0268265_10076377 | Ga0268265_100763772 | 330 |
| 57 | 3300035088 | Ga0373940_0019778 | Ga0373940_0019778_32_1036 | 330 |
| 58 | 3300035241 | Ga0373961_0031650 | Ga0373961_0031650_442_1446 | 330 |
| 59 | 3300050509 | nmdc:mga0qj67_409014_c1 | nmdc:mga0qj67_409014_c1_80_1075 | 330 |
| 60 | 3300050511 | nmdc:mga08y16_31610_c1 | nmdc:mga08y16_31610_c1_2905_3915 | 330 |
| 61 | 3300042435 | Ga0439434_0014184 | Ga0439434_0014184_811_1809 | 331 |
| 62 | 3300048907 | Ga0496104_0419800 | Ga0496104_0419800_136_1146 | 331 |
| 63 | 3300025911 | Ga0207654_10190921 | Ga0207654_101909212 | 332 |
| 64 | 3300025960 | Ga0207651_10022272 | Ga0207651_100222724 | 332 |
| 65 | 3300025981 | Ga0207640_10216403 | Ga0207640_102164031 | 332 |
| 66 | 3300050513 | nmdc:mga0rr50_178557_c1 | nmdc:mga0rr50_178557_c1_512_1510 | 332 |
| 67 | 3300005289 | Ga0065704_10168649 | Ga0065704_101686491 | 333 |
| 68 | 3300006880 | Ga0075429_100006227 | Ga0075429_1000062273 | 333 |
| 69 | 3300027907 | Ga0207428_10001442 | Ga0207428_100014423 | 333 |
| 70 | 3300050510 | nmdc:mga06r32_58304_c1 | nmdc:mga06r32_58304_c1_2068_3081 | 333 |
| 71 | 3300013297 | Ga0157378_10380608 | Ga0157378_103806082 | 334 |
| 72 | 3300053096 | Ga0500641_0022760 | Ga0500641_0022760_222_1232 | 334 |
| 73 | 3300009147 | Ga0114129_10313216 | Ga0114129_103132162 | 338 |
| 74 | 3300050511 | nmdc:mga08y16_368229_c1 | nmdc:mga08y16_368229_c1_248_1300 | 338 |
| 75 | 3300050509 | nmdc:mga0qj67_248169_c1 | nmdc:mga0qj67_248169_c1_317_1375 | 339 |
| 76 | 3300000532 | CNAas_1000548 | CNAas_10005481 | 341 |
| 77 | 3300005288 | Ga0065714_10064546 | Ga0065714_1006454619 | 341 |
| 78 | 3300005289 | Ga0065704_10010886 | Ga0065704_100108862 | 341 |
| 79 | 3300005289 | Ga0065704_10097714 | Ga0065704_100977141 | 341 |
| 80 | 3300005290 | Ga0065712_10000133 | Ga0065712_1000013342 | 341 |
| 81 | 3300005290 | Ga0065712_10001895 | Ga0065712_100018955 | 341 |
| 82 | 3300005290 | Ga0065712_10076531 | Ga0065712_100765312 | 341 |
| 83 | 3300005293 | Ga0065715_10002297 | Ga0065715_100022976 | 341 |
| 84 | 3300005293 | Ga0065715_10011249 | Ga0065715_100112492 | 341 |
| 85 | 3300005293 | Ga0065715_10129064 | Ga0065715_101290641 | 341 |
| 86 | 3300005293 | Ga0065715_10143265 | Ga0065715_101432652 | 341 |
| 87 | 3300005295 | Ga0065707_10002866 | Ga0065707_100028666 | 341 |
| 88 | 3300005295 | Ga0065707_10127137 | Ga0065707_101271372 | 341 |
| 89 | 3300005328 | Ga0070676_10029027 | Ga0070676_100290274 | 341 |
| 90 | 3300005328 | Ga0070676_10099075 | Ga0070676_100990751 | 341 |
| 91 | 3300005330 | Ga0070690_100003648 | Ga0070690_10000364810 | 341 |
| 92 | 3300005330 | Ga0070690_100009806 | Ga0070690_1000098064 | 341 |
| 93 | 3300005331 | Ga0070670_100042661 | Ga0070670_1000426612 | 341 |
| 94 | 3300005334 | Ga0068869_100003372 | Ga0068869_10000337211 | 341 |
| 95 | 3300005334 | Ga0068869_100011119 | Ga0068869_1000111195 | 341 |
| 96 | 3300005334 | Ga0068869_100074618 | Ga0068869_1000746182 | 341 |
| 97 | 3300005335 | Ga0070666_10068892 | Ga0070666_100688923 | 341 |
| 98 | 3300005336 | Ga0070680_100002583 | Ga0070680_1000025839 | 341 |
| 99 | 3300005336 | Ga0070680_100013103 | Ga0070680_1000131032 | 341 |
| 100 | 3300005336 | Ga0070680_100069302 | Ga0070680_1000693022 | 341 |
| 101 | 3300005338 | Ga0068868_100108009 | Ga0068868_1001080092 | 341 |
| 102 | 3300005343 | Ga0070687_100000989 | Ga0070687_10000098910 | 341 |
| 103 | 3300005343 | Ga0070687_100108426 | Ga0070687_1001084262 | 341 |
| 104 | 3300005345 | Ga0070692_10075052 | Ga0070692_100750521 | 341 |
| 105 | 3300005353 | Ga0070669_100007320 | Ga0070669_1000073203 | 341 |
| 106 | 3300005354 | Ga0070675_100136949 | Ga0070675_1001369492 | 341 |
| 107 | 3300005355 | Ga0070671_100011918 | Ga0070671_1000119185 | 341 |
| 108 | 3300005355 | Ga0070671_100107639 | Ga0070671_1001076392 | 341 |
| 109 | 3300005364 | Ga0070673_100074151 | Ga0070673_1000741515 | 341 |
| 110 | 3300005364 | Ga0070673_100313755 | Ga0070673_1003137552 | 341 |
| 111 | 3300005367 | Ga0070667_100045643 | Ga0070667_1000456433 | 341 |
| 112 | 3300005367 | Ga0070667_100241267 | Ga0070667_1002412671 | 341 |
| 113 | 3300005406 | Ga0070703_10009549 | Ga0070703_100095492 | 341 |
| 114 | 3300005440 | Ga0070705_100010194 | Ga0070705_1000101946 | 341 |
| 115 | 3300005440 | Ga0070705_100177537 | Ga0070705_1001775372 | 341 |
| 116 | 3300005441 | Ga0070700_100000090 | Ga0070700_10000009027 | 341 |
| 117 | 3300005441 | Ga0070700_100028118 | Ga0070700_1000281181 | 341 |
| 118 | 3300005441 | Ga0070700_100031845 | Ga0070700_1000318452 | 341 |
| 119 | 3300005441 | Ga0070700_100060745 | Ga0070700_1000607451 | 341 |
| 120 | 3300005444 | Ga0070694_100020401 | Ga0070694_1000204016 | 341 |
| 121 | 3300005444 | Ga0070694_100047898 | Ga0070694_1000478983 | 341 |
| 122 | 3300005444 | Ga0070694_100068366 | Ga0070694_1000683662 | 341 |
| 123 | 3300005444 | Ga0070694_100118232 | Ga0070694_1001182322 | 341 |
| 124 | 3300005456 | Ga0070678_100153822 | Ga0070678_1001538222 | 341 |
| 125 | 3300005458 | Ga0070681_10000011 | Ga0070681_1000001113 | 341 |
| 126 | 3300005458 | Ga0070681_10001243 | Ga0070681_100012438 | 341 |
| 127 | 3300005458 | Ga0070681_10035918 | Ga0070681_100359182 | 341 |
| 128 | 3300005458 | Ga0070681_10074750 | Ga0070681_100747502 | 341 |
| 129 | 3300005459 | Ga0068867_100085490 | Ga0068867_1000854902 | 341 |
| 130 | 3300005459 | Ga0068867_100154358 | Ga0068867_1001543581 | 341 |
| 131 | 3300005466 | Ga0070685_10010181 | Ga0070685_100101817 | 341 |
| 132 | 3300005467 | Ga0070706_100000312 | Ga0070706_10000031219 | 341 |
| 133 | 3300005467 | Ga0070706_100033422 | Ga0070706_1000334223 | 341 |
| 134 | 3300005468 | Ga0070707_100215335 | Ga0070707_1002153352 | 341 |
| 135 | 3300005468 | Ga0070707_100414052 | Ga0070707_1004140522 | 341 |
| 136 | 3300005518 | Ga0070699_100006392 | Ga0070699_1000063925 | 341 |
| 137 | 3300005530 | Ga0070679_100000013 | Ga0070679_10000001354 | 341 |
| 138 | 3300005530 | Ga0070679_100170168 | Ga0070679_1001701681 | 341 |
| 139 | 3300005543 | Ga0070672_100008730 | Ga0070672_1000087306 | 341 |
| 140 | 3300005544 | Ga0070686_100030967 | Ga0070686_1000309673 | 341 |
| 141 | 3300005544 | Ga0070686_100252088 | Ga0070686_1002520881 | 341 |
| 142 | 3300005546 | Ga0070696_100004652 | Ga0070696_1000046525 | 341 |
| 143 | 3300005547 | Ga0070693_100035033 | Ga0070693_1000350332 | 341 |
| 144 | 3300005547 | Ga0070693_100137513 | Ga0070693_1001375131 | 341 |
| 145 | 3300005547 | Ga0070693_100170796 | Ga0070693_1001707961 | 341 |
| 146 | 3300005563 | Ga0068855_100352150 | Ga0068855_1003521501 | 341 |
| 147 | 3300005577 | Ga0068857_100034429 | Ga0068857_1000344292 | 341 |
| 148 | 3300005577 | Ga0068857_100042876 | Ga0068857_1000428763 | 341 |
| 149 | 3300005578 | Ga0068854_100045673 | Ga0068854_1000456732 | 341 |
| 150 | 3300005614 | Ga0068856_100009499 | Ga0068856_1000094992 | 341 |
| 151 | 3300005614 | Ga0068856_100108545 | Ga0068856_1001085451 | 341 |
| 152 | 3300005615 | Ga0070702_100116499 | Ga0070702_1001164992 | 341 |
| 153 | 3300005615 | Ga0070702_100125938 | Ga0070702_1001259381 | 341 |
| 154 | 3300005617 | Ga0068859_100022679 | Ga0068859_1000226794 | 341 |
| 155 | 3300005617 | Ga0068859_100071051 | Ga0068859_1000710513 | 341 |
| 156 | 3300005618 | Ga0068864_100007568 | Ga0068864_10000756812 | 341 |
| 157 | 3300005618 | Ga0068864_100081234 | Ga0068864_1000812343 | 341 |
| 158 | 3300005718 | Ga0068866_10028189 | Ga0068866_100281892 | 341 |
| 159 | 3300005719 | Ga0068861_100125676 | Ga0068861_1001256762 | 341 |
| 160 | 3300005834 | Ga0068851_10017649 | Ga0068851_100176493 | 341 |
| 161 | 3300005840 | Ga0068870_10007877 | Ga0068870_100078774 | 341 |
| 162 | 3300005841 | Ga0068863_100123402 | Ga0068863_1001234022 | 341 |
| 163 | 3300005841 | Ga0068863_100313715 | Ga0068863_1003137151 | 341 |
| 164 | 3300005842 | Ga0068858_100077372 | Ga0068858_1000773722 | 341 |
| 165 | 3300005842 | Ga0068858_100170144 | Ga0068858_1001701441 | 341 |
| 166 | 3300005843 | Ga0068860_100029077 | Ga0068860_1000290773 | 341 |
| 167 | 3300005843 | Ga0068860_100058473 | Ga0068860_1000584734 | 341 |
| 168 | 3300005844 | Ga0068862_100043156 | Ga0068862_1000431563 | 341 |
| 169 | 3300005844 | Ga0068862_100057909 | Ga0068862_1000579092 | 341 |
| 170 | 3300005844 | Ga0068862_100115396 | Ga0068862_1001153962 | 341 |
| 171 | 3300005985 | Ga0081539_10003882 | Ga0081539_100038827 | 341 |
| 172 | 3300006237 | Ga0097621_100005896 | Ga0097621_1000058962 | 341 |
| 173 | 3300006358 | Ga0068871_100010565 | Ga0068871_1000105656 | 341 |
| 174 | 3300006358 | Ga0068871_100033822 | Ga0068871_1000338222 | 341 |
| 175 | 3300006844 | Ga0075428_100148334 | Ga0075428_1001483342 | 341 |
| 176 | 3300006844 | Ga0075428_100227044 | Ga0075428_1002270441 | 341 |
| 177 | 3300006846 | Ga0075430_100022303 | Ga0075430_1000223035 | 341 |
| 178 | 3300006852 | Ga0075433_10067080 | Ga0075433_100670804 | 341 |
| 179 | 3300006852 | Ga0075433_10148412 | Ga0075433_101484122 | 341 |
| 180 | 3300006871 | Ga0075434_100007920 | Ga0075434_1000079203 | 341 |
| 181 | 3300006871 | Ga0075434_100218216 | Ga0075434_1002182161 | 341 |
| 182 | 3300006881 | Ga0068865_100018706 | Ga0068865_1000187064 | 341 |
| 183 | 3300006914 | Ga0075436_100220550 | Ga0075436_1002205501 | 341 |
| 184 | 3300006931 | Ga0097620_100022678 | Ga0097620_1000226784 | 341 |
| 185 | 3300006931 | Ga0097620_100071052 | Ga0097620_1000710523 | 341 |
| 186 | 3300009093 | Ga0105240_10113858 | Ga0105240_101138582 | 341 |
| 187 | 3300009093 | Ga0105240_10351415 | Ga0105240_103514151 | 341 |
| 188 | 3300009094 | Ga0111539_10013017 | Ga0111539_1001301710 | 341 |
| 189 | 3300009094 | Ga0111539_10116124 | Ga0111539_101161242 | 341 |
| 190 | 3300009094 | Ga0111539_10162591 | Ga0111539_101625911 | 341 |
| 191 | 3300009094 | Ga0111539_10268686 | Ga0111539_102686861 | 341 |
| 192 | 3300009094 | Ga0111539_10387075 | Ga0111539_103870751 | 341 |
| 193 | 3300009094 | Ga0111539_10594079 | Ga0111539_105940791 | 341 |
| 194 | 3300009098 | Ga0105245_10043122 | Ga0105245_100431224 | 341 |
| 195 | 3300009101 | Ga0105247_10148934 | Ga0105247_101489341 | 341 |
| 196 | 3300009147 | Ga0114129_10016316 | Ga0114129_1001631612 | 341 |
| 197 | 3300009147 | Ga0114129_10017644 | Ga0114129_100176445 | 341 |
| 198 | 3300009147 | Ga0114129_10033829 | Ga0114129_100338293 | 341 |
| 199 | 3300009147 | Ga0114129_10071082 | Ga0114129_100710823 | 341 |
| 200 | 3300009147 | Ga0114129_10350214 | Ga0114129_103502142 | 341 |
| 201 | 3300009147 | Ga0114129_10738617 | Ga0114129_107386171 | 341 |
| 202 | 3300009147 | Ga0114129_10893761 | Ga0114129_108937611 | 341 |
| 203 | 3300009148 | Ga0105243_10134602 | Ga0105243_101346021 | 341 |
| 204 | 3300009174 | Ga0105241_10028687 | Ga0105241_100286873 | 341 |
| 205 | 3300009174 | Ga0105241_10093200 | Ga0105241_100932001 | 341 |
| 206 | 3300009176 | Ga0105242_10001732 | Ga0105242_1000173211 | 341 |
| 207 | 3300009177 | Ga0105248_10011136 | Ga0105248_100111367 | 341 |
| 208 | 3300009177 | Ga0105248_10099896 | Ga0105248_100998965 | 341 |
| 209 | 3300009177 | Ga0105248_10225484 | Ga0105248_102254842 | 341 |
| 210 | 3300009177 | Ga0105248_10385952 | Ga0105248_103859522 | 341 |
| 211 | 3300009177 | Ga0105248_10662622 | Ga0105248_106626221 | 341 |
| 212 | 3300009545 | Ga0105237_10006126 | Ga0105237_100061268 | 341 |
| 213 | 3300009545 | Ga0105237_10016051 | Ga0105237_100160514 | 341 |
| 214 | 3300009545 | Ga0105237_10105556 | Ga0105237_101055563 | 341 |
| 215 | 3300009553 | Ga0105249_10030403 | Ga0105249_100304032 | 341 |
| 216 | 3300009553 | Ga0105249_10099715 | Ga0105249_100997152 | 341 |
| 217 | 3300010375 | Ga0105239_10065865 | Ga0105239_100658652 | 341 |
| 218 | 3300010375 | Ga0105239_10103817 | Ga0105239_101038174 | 341 |
| 219 | 3300011119 | Ga0105246_10037155 | Ga0105246_100371553 | 341 |
| 220 | 3300013100 | Ga0157373_10074399 | Ga0157373_100743991 | 341 |
| 221 | 3300013296 | Ga0157374_10042212 | Ga0157374_100422122 | 341 |
| 222 | 3300013297 | Ga0157378_10002351 | Ga0157378_100023513 | 341 |
| 223 | 3300013297 | Ga0157378_10063132 | Ga0157378_100631321 | 341 |
| 224 | 3300013297 | Ga0157378_10124653 | Ga0157378_101246532 | 341 |
| 225 | 3300013297 | Ga0157378_10183894 | Ga0157378_101838942 | 341 |
| 226 | 3300013306 | Ga0163162_10006565 | Ga0163162_1000656513 | 341 |
| 227 | 3300013306 | Ga0163162_10008494 | Ga0163162_1000849410 | 341 |
| 228 | 3300013306 | Ga0163162_10163488 | Ga0163162_101634883 | 341 |
| 229 | 3300013306 | Ga0163162_10259802 | Ga0163162_102598021 | 341 |
| 230 | 3300013307 | Ga0157372_10053737 | Ga0157372_100537372 | 341 |
| 231 | 3300013307 | Ga0157372_10082066 | Ga0157372_100820662 | 341 |
| 232 | 3300013307 | Ga0157372_10157572 | Ga0157372_101575722 | 341 |
| 233 | 3300013308 | Ga0157375_10003637 | Ga0157375_1000363711 | 341 |
| 234 | 3300013308 | Ga0157375_10020780 | Ga0157375_100207803 | 341 |
| 235 | 3300013308 | Ga0157375_10769435 | Ga0157375_107694351 | 341 |
| 236 | 3300014325 | Ga0163163_10002212 | Ga0163163_100022122 | 341 |
| 237 | 3300014325 | Ga0163163_10056721 | Ga0163163_100567213 | 341 |
| 238 | 3300014325 | Ga0163163_10080372 | Ga0163163_100803722 | 341 |
| 239 | 3300014325 | Ga0163163_10089429 | Ga0163163_100894292 | 341 |
| 240 | 3300014326 | Ga0157380_10007603 | Ga0157380_100076033 | 341 |
| 241 | 3300014326 | Ga0157380_10028790 | Ga0157380_100287905 | 341 |
| 242 | 3300014326 | Ga0157380_10088238 | Ga0157380_100882382 | 341 |
| 243 | 3300014326 | Ga0157380_10338539 | Ga0157380_103385392 | 341 |
| 244 | 3300014745 | Ga0157377_10025132 | Ga0157377_100251325 | 341 |
| 245 | 3300014968 | Ga0157379_10030607 | Ga0157379_100306074 | 341 |
| 246 | 3300014968 | Ga0157379_10072728 | Ga0157379_100727285 | 341 |
| 247 | 3300014968 | Ga0157379_10114648 | Ga0157379_101146482 | 341 |
| 248 | 3300014969 | Ga0157376_10050631 | Ga0157376_100506314 | 341 |
| 249 | 3300014969 | Ga0157376_10195392 | Ga0157376_101953922 | 341 |
| 250 | 3300017792 | Ga0163161_10023713 | Ga0163161_100237133 | 341 |
| 251 | 3300017792 | Ga0163161_10049428 | Ga0163161_100494284 | 341 |
| 252 | 3300025321 | Ga0207656_10000196 | Ga0207656_100001962 | 341 |
| 253 | 3300025885 | Ga0207653_10004823 | Ga0207653_100048235 | 341 |
| 254 | 3300025904 | Ga0207647_10001379 | Ga0207647_1000137911 | 341 |
| 255 | 3300025907 | Ga0207645_10076169 | Ga0207645_100761692 | 341 |
| 256 | 3300025908 | Ga0207643_10048303 | Ga0207643_100483032 | 341 |
| 257 | 3300025910 | Ga0207684_10000448 | Ga0207684_1000044833 | 341 |
| 258 | 3300025910 | Ga0207684_10111029 | Ga0207684_101110292 | 341 |
| 259 | 3300025911 | Ga0207654_10154231 | Ga0207654_101542311 | 341 |
| 260 | 3300025912 | Ga0207707_10000004 | Ga0207707_10000004270 | 341 |
| 261 | 3300025912 | Ga0207707_10016248 | Ga0207707_100162482 | 341 |
| 262 | 3300025912 | Ga0207707_10017642 | Ga0207707_100176426 | 341 |
| 263 | 3300025913 | Ga0207695_10460580 | Ga0207695_104605801 | 341 |
| 264 | 3300025914 | Ga0207671_10004405 | Ga0207671_1000440512 | 341 |
| 265 | 3300025914 | Ga0207671_10074856 | Ga0207671_100748562 | 341 |
| 266 | 3300025917 | Ga0207660_10188717 | Ga0207660_101887172 | 341 |
| 267 | 3300025918 | Ga0207662_10002083 | Ga0207662_100020833 | 341 |
| 268 | 3300025921 | Ga0207652_10001059 | Ga0207652_100010593 | 341 |
| 269 | 3300025923 | Ga0207681_10022001 | Ga0207681_100220012 | 341 |
| 270 | 3300025925 | Ga0207650_10078783 | Ga0207650_100787832 | 341 |
| 271 | 3300025925 | Ga0207650_10116732 | Ga0207650_101167322 | 341 |
| 272 | 3300025932 | Ga0207690_10062743 | Ga0207690_100627431 | 341 |
| 273 | 3300025933 | Ga0207706_10032899 | Ga0207706_100328994 | 341 |
| 274 | 3300025934 | Ga0207686_10114877 | Ga0207686_101148772 | 341 |
| 275 | 3300025936 | Ga0207670_10012844 | Ga0207670_100128443 | 341 |
| 276 | 3300025936 | Ga0207670_10014914 | Ga0207670_100149143 | 341 |
| 277 | 3300025940 | Ga0207691_10001245 | Ga0207691_100012459 | 341 |
| 278 | 3300025941 | Ga0207711_10004416 | Ga0207711_100044164 | 341 |
| 279 | 3300025941 | Ga0207711_10022392 | Ga0207711_100223924 | 341 |
| 280 | 3300025941 | Ga0207711_10139037 | Ga0207711_101390373 | 341 |
| 281 | 3300025941 | Ga0207711_10404686 | Ga0207711_104046862 | 341 |
| 282 | 3300025942 | Ga0207689_10007654 | Ga0207689_100076543 | 341 |
| 283 | 3300025942 | Ga0207689_10011850 | Ga0207689_100118505 | 341 |
| 284 | 3300025942 | Ga0207689_10031336 | Ga0207689_100313363 | 341 |
| 285 | 3300025942 | Ga0207689_10144968 | Ga0207689_101449681 | 341 |
| 286 | 3300025949 | Ga0207667_10325146 | Ga0207667_103251461 | 341 |
| 287 | 3300025960 | Ga0207651_10142771 | Ga0207651_101427711 | 341 |
| 288 | 3300025961 | Ga0207712_10005221 | Ga0207712_100052212 | 341 |
| 289 | 3300025961 | Ga0207712_10021573 | Ga0207712_100215732 | 341 |
| 290 | 3300025981 | Ga0207640_10029548 | Ga0207640_100295482 | 341 |
| 291 | 3300025986 | Ga0207658_10050118 | Ga0207658_100501182 | 341 |
| 292 | 3300026035 | Ga0207703_10061887 | Ga0207703_100618872 | 341 |
| 293 | 3300026035 | Ga0207703_10106749 | Ga0207703_101067492 | 341 |
| 294 | 3300026075 | Ga0207708_10000095 | Ga0207708_1000009523 | 341 |
| 295 | 3300026075 | Ga0207708_10034363 | Ga0207708_100343633 | 341 |
| 296 | 3300026075 | Ga0207708_10080496 | Ga0207708_100804962 | 341 |
| 297 | 3300026078 | Ga0207702_10068633 | Ga0207702_100686332 | 341 |
| 298 | 3300026078 | Ga0207702_10086489 | Ga0207702_100864891 | 341 |
| 299 | 3300026088 | Ga0207641_10032816 | Ga0207641_100328162 | 341 |
| 300 | 3300026088 | Ga0207641_10317464 | Ga0207641_103174642 | 341 |
| 301 | 3300026089 | Ga0207648_10006724 | Ga0207648_100067245 | 341 |
| 302 | 3300026089 | Ga0207648_10075163 | Ga0207648_100751635 | 341 |
| 303 | 3300026095 | Ga0207676_10018214 | Ga0207676_100182143 | 341 |
| 304 | 3300026095 | Ga0207676_10022540 | Ga0207676_100225402 | 341 |
| 305 | 3300026095 | Ga0207676_10064738 | Ga0207676_100647382 | 341 |
| 306 | 3300026095 | Ga0207676_10105658 | Ga0207676_101056581 | 341 |
| 307 | 3300026116 | Ga0207674_10021048 | Ga0207674_100210482 | 341 |
| 308 | 3300026116 | Ga0207674_10327410 | Ga0207674_103274101 | 341 |
| 309 | 3300026118 | Ga0207675_100009031 | Ga0207675_10000903111 | 341 |
| 310 | 3300026118 | Ga0207675_100038652 | Ga0207675_1000386525 | 341 |
| 311 | 3300026118 | Ga0207675_100195054 | Ga0207675_1001950542 | 341 |
| 312 | 3300026121 | Ga0207683_10013365 | Ga0207683_100133652 | 341 |
| 313 | 3300026121 | Ga0207683_10184508 | Ga0207683_101845082 | 341 |
| 314 | 3300026142 | Ga0207698_10134961 | Ga0207698_101349612 | 341 |
| 315 | 3300028380 | Ga0268265_10038475 | Ga0268265_100384753 | 341 |
| 316 | 3300028381 | Ga0268264_10014775 | Ga0268264_100147755 | 341 |
| 317 | 3300028381 | Ga0268264_10041380 | Ga0268264_100413802 | 341 |
| 318 | 3300028381 | Ga0268264_10043041 | Ga0268264_100430412 | 341 |
| 319 | 3300028381 | Ga0268264_10130668 | Ga0268264_101306682 | 341 |
| 320 | 3300031548 | Ga0307408_100037461 | Ga0307408_1000374613 | 341 |
| 321 | 3300031731 | Ga0307405_10033272 | Ga0307405_100332723 | 341 |
| 322 | 3300031731 | Ga0307405_10041484 | Ga0307405_100414842 | 341 |
| 323 | 3300031731 | Ga0307405_10147957 | Ga0307405_101479571 | 341 |
| 324 | 3300031824 | Ga0307413_10004115 | Ga0307413_100041155 | 341 |
| 325 | 3300031852 | Ga0307410_10108672 | Ga0307410_101086722 | 341 |
| 326 | 3300031901 | Ga0307406_10010553 | Ga0307406_100105536 | 341 |
| 327 | 3300031911 | Ga0307412_10003977 | Ga0307412_100039778 | 341 |
| 328 | 3300032002 | Ga0307416_100073421 | Ga0307416_1000734211 | 341 |
| 329 | 3300032002 | Ga0307416_100083873 | Ga0307416_1000838731 | 341 |
| 330 | 3300032004 | Ga0307414_10008840 | Ga0307414_100088403 | 341 |
| 331 | 3300032004 | Ga0307414_10054988 | Ga0307414_100549883 | 341 |
| 332 | 3300032005 | Ga0307411_10143586 | Ga0307411_101435862 | 341 |
| 333 | 3300032126 | Ga0307415_100006325 | Ga0307415_1000063252 | 341 |
| 334 | 3300037418 | Ga0395900_0110968 | Ga0395900_0110968_744_1775 | 341 |
| 335 | 3300037466 | Ga0395898_0239729 | Ga0395898_0239729_630_1664 | 341 |
| 336 | 3300038443 | Ga0395901_0041444 | Ga0395901_0041444_2252_3283 | 341 |
| 337 | 3300042012 | Ga0439455_0015200 | Ga0439455_0015200_529_1560 | 341 |
| 338 | 3300042157 | Ga0439458_0004057 | Ga0439458_0004057_26_1057 | 341 |
| 339 | 3300048905 | Ga0496102_0057261 | Ga0496102_0057261_1190_2224 | 341 |
| 340 | 3300048909 | Ga0496106_0116263 | Ga0496106_0116263_241_1269 | 341 |
| 341 | 3300048913 | Ga0496110_0080365 | Ga0496110_0080365_430_1464 | 341 |
| 342 | 3300048915 | Ga0496112_0199145 | Ga0496112_0199145_99_1133 | 341 |
| 343 | 3300049513 | Ga0501290_004638 | Ga0501290_004638_99_1133 | 341 |
| 344 | 3300049514 | Ga0501291_000669 | Ga0501291_000669_1679_2713 | 341 |
| 345 | 3300049514 | Ga0501291_004861 | Ga0501291_004861_136_1170 | 341 |
| 346 | 3300049517 | Ga0501294_003243 | Ga0501294_003243_418_1452 | 341 |
| 347 | 3300049519 | Ga0501296_000210 | Ga0501296_000210_850_1884 | 341 |
| 348 | 3300049521 | Ga0501298_000163 | Ga0501298_000163_1337_2371 | 341 |
| 349 | 3300049522 | Ga0501299_002847 | Ga0501299_002847_576_1610 | 341 |
| 350 | 3300049522 | Ga0501299_025947 | Ga0501299_025947_31_1065 | 341 |
| 351 | 3300049574 | Ga0501038_0001767 | Ga0501038_0001767_3837_4871 | 341 |
| 352 | 3300049593 | Ga0501077_0157717 | Ga0501077_0157717_232_1266 | 341 |
| 353 | 3300049651 | Ga0501201_001839 | Ga0501201_001839_352_1386 | 341 |
| 354 | 3300049652 | Ga0501202_004235 | Ga0501202_004235_441_1472 | 341 |
| 355 | 3300049652 | Ga0501202_005133 | Ga0501202_005133_841_1869 | 341 |
| 356 | 3300049652 | Ga0501202_008338 | Ga0501202_008338_678_1712 | 341 |
| 357 | 3300049652 | Ga0501202_009628 | Ga0501202_009628_649_1683 | 341 |
| 358 | 3300049659 | Ga0501214_003010 | Ga0501214_003010_29_1060 | 341 |
| 359 | 3300049660 | Ga0501216_007946 | Ga0501216_007946_128_1162 | 341 |
| 360 | 3300049660 | Ga0501216_010322 | Ga0501216_010322_199_1233 | 341 |
| 361 | 3300049661 | Ga0501217_001192 | Ga0501217_001192_3583_4614 | 341 |
| 362 | 3300049661 | Ga0501217_004996 | Ga0501217_004996_202_1236 | 341 |
| 363 | 3300049661 | Ga0501217_010431 | Ga0501217_010431_778_1812 | 341 |
| 364 | 3300049663 | Ga0501223_009610 | Ga0501223_009610_194_1228 | 341 |
| 365 | 3300049664 | Ga0501224_002898 | Ga0501224_002898_488_1519 | 341 |
| 366 | 3300049664 | Ga0501224_005567 | Ga0501224_005567_734_1768 | 341 |
| 367 | 3300049665 | Ga0501227_001143 | Ga0501227_001143_4566_5597 | 341 |
| 368 | 3300049667 | Ga0501230_006353 | Ga0501230_006353_410_1441 | 341 |
| 369 | 3300049668 | Ga0501233_004523 | Ga0501233_004523_931_1965 | 341 |
| 370 | 3300049668 | Ga0501233_005470 | Ga0501233_005470_535_1566 | 341 |
| 371 | 3300049668 | Ga0501233_023023 | Ga0501233_023023_126_1160 | 341 |
| 372 | 3300049669 | Ga0501235_002482 | Ga0501235_002482_2327_3358 | 341 |
| 373 | 3300049669 | Ga0501235_004920 | Ga0501235_004920_177_1211 | 341 |
| 374 | 3300049677 | Ga0501247_005845 | Ga0501247_005845_164_1198 | 341 |
| 375 | 3300049679 | Ga0501249_008964 | Ga0501249_008964_121_1155 | 341 |
| 376 | 3300049686 | Ga0501257_020979 | Ga0501257_020979_252_1286 | 341 |
| 377 | 3300049688 | Ga0501259_005583 | Ga0501259_005583_238_1272 | 341 |
| 378 | 3300049704 | Ga0501221_010656 | Ga0501221_010656_198_1229 | 341 |
| 379 | 3300049705 | Ga0501225_0002541 | Ga0501225_0002541_2208_3239 | 341 |
| 380 | 3300049705 | Ga0501225_0003934 | Ga0501225_0003934_1015_2049 | 341 |
| 381 | 3300049706 | Ga0501229_003244 | Ga0501229_003244_627_1658 | 341 |
| 382 | 3300049707 | Ga0501234_000552 | Ga0501234_000552_488_1519 | 341 |
| 383 | 3300049707 | Ga0501234_003877 | Ga0501234_003877_870_1904 | 341 |
| 384 | 3300049708 | Ga0501245_005395 | Ga0501245_005395_160_1194 | 341 |
| 385 | 3300049776 | Ga0501280_006674 | Ga0501280_006674_26_1060 | 341 |
| 386 | 3300049779 | Ga0501283_000161 | Ga0501283_000161_6659_7693 | 341 |
| 387 | 3300049851 | Ga0501212_002182 | Ga0501212_002182_404_1435 | 341 |
| 388 | 3300049851 | Ga0501212_006849 | Ga0501212_006849_99_1133 | 341 |
| 389 | 3300049851 | Ga0501212_007525 | Ga0501212_007525_384_1418 | 341 |
| 390 | 3300049853 | Ga0501226_002206 | Ga0501226_002206_838_1869 | 341 |
| 391 | 3300050507 | nmdc:mga05p37_11175_c1 | nmdc:mga05p37_11175_c1_5626_6660 | 341 |
| 392 | 3300050507 | nmdc:mga05p37_196143_c1 | nmdc:mga05p37_196143_c1_99_1133 | 341 |
| 393 | 3300050507 | nmdc:mga05p37_425245_c1 | nmdc:mga05p37_425245_c1_141_1175 | 341 |
| 394 | 3300050507 | nmdc:mga05p37_59162_c1 | nmdc:mga05p37_59162_c1_1885_2919 | 341 |
| 395 | 3300050507 | nmdc:mga05p37_601327_c1 | nmdc:mga05p37_601327_c1_31_1062 | 341 |
| 396 | 3300050508 | nmdc:mga09592_396881_c1 | nmdc:mga09592_396881_c1_123_1157 | 341 |
| 397 | 3300050509 | nmdc:mga0qj67_213361_c1 | nmdc:mga0qj67_213361_c1_103_1137 | 341 |
| 398 | 3300050510 | nmdc:mga06r32_265875_c1 | nmdc:mga06r32_265875_c1_359_1390 | 341 |
| 399 | 3300050511 | nmdc:mga08y16_125568_c1 | nmdc:mga08y16_125568_c1_473_1507 | 341 |
| 400 | 3300050511 | nmdc:mga08y16_165676_c1 | nmdc:mga08y16_165676_c1_544_1578 | 341 |
| 401 | 3300050511 | nmdc:mga08y16_46273_c1 | nmdc:mga08y16_46273_c1_213_1247 | 341 |
| 402 | 3300050512 | nmdc:mga0n895_106710_c1 | nmdc:mga0n895_106710_c1_1514_2548 | 341 |
| 403 | 3300050512 | nmdc:mga0n895_108010_c1 | nmdc:mga0n895_108010_c1_1675_2706 | 341 |
| 404 | 3300050512 | nmdc:mga0n895_69017_c1 | nmdc:mga0n895_69017_c1_698_1726 | 341 |
| 405 | 3300050513 | nmdc:mga0rr50_202617_c1 | nmdc:mga0rr50_202617_c1_139_1167 | 341 |
| 406 | 3300050515 | nmdc:mga0a205_19414_c1 | nmdc:mga0a205_19414_c1_2369_3403 | 341 |
| 407 | 3300050515 | nmdc:mga0a205_34453_c1 | nmdc:mga0a205_34453_c1_2197_3228 | 341 |
| 408 | 3300061734 | Ga0530510_0198060 | Ga0530510_0198060_293_1327 | 341 |
| 409 | 2162886007 | SwRhRL2b_contig_151632 | SwRhRL2b_0003.00000820 | 342 |
| 410 | 3300002459 | JGI24751J29686_10000040 | JGI24751J29686_1000004028 | 342 |
| 411 | 3300003203 | JGI25406J46586_10003181 | JGI25406J46586_100031812 | 342 |
| 412 | 3300005290 | Ga0065712_10007455 | Ga0065712_100074553 | 342 |
| 413 | 3300005290 | Ga0065712_10073016 | Ga0065712_100730163 | 342 |
| 414 | 3300005295 | Ga0065707_10001920 | Ga0065707_100019209 | 342 |
| 415 | 3300005295 | Ga0065707_10092600 | Ga0065707_100926005 | 342 |
| 416 | 3300005330 | Ga0070690_100002855 | Ga0070690_1000028554 | 342 |
| 417 | 3300005331 | Ga0070670_100000225 | Ga0070670_10000022528 | 342 |
| 418 | 3300005331 | Ga0070670_100007289 | Ga0070670_1000072897 | 342 |
| 419 | 3300005331 | Ga0070670_100024832 | Ga0070670_1000248324 | 342 |
| 420 | 3300005331 | Ga0070670_100253666 | Ga0070670_1002536662 | 342 |
| 421 | 3300005331 | Ga0070670_100286235 | Ga0070670_1002862351 | 342 |
| 422 | 3300005336 | Ga0070680_100226082 | Ga0070680_1002260822 | 342 |
| 423 | 3300005337 | Ga0070682_100000687 | Ga0070682_10000068712 | 342 |
| 424 | 3300005337 | Ga0070682_100007382 | Ga0070682_1000073823 | 342 |
| 425 | 3300005353 | Ga0070669_100004916 | Ga0070669_10000491613 | 342 |
| 426 | 3300005353 | Ga0070669_100013652 | Ga0070669_1000136521 | 342 |
| 427 | 3300005354 | Ga0070675_100011584 | Ga0070675_1000115848 | 342 |
| 428 | 3300005354 | Ga0070675_100024762 | Ga0070675_1000247626 | 342 |
| 429 | 3300005364 | Ga0070673_100000896 | Ga0070673_1000008962 | 342 |
| 430 | 3300005365 | Ga0070688_100006011 | Ga0070688_1000060112 | 342 |
| 431 | 3300005367 | Ga0070667_100004875 | Ga0070667_1000048754 | 342 |
| 432 | 3300005441 | Ga0070700_100095453 | Ga0070700_1000954532 | 342 |
| 433 | 3300005444 | Ga0070694_100042190 | Ga0070694_1000421901 | 342 |
| 434 | 3300005444 | Ga0070694_100185259 | Ga0070694_1001852592 | 342 |
| 435 | 3300005444 | Ga0070694_100237321 | Ga0070694_1002373211 | 342 |
| 436 | 3300005459 | Ga0068867_100108447 | Ga0068867_1001084472 | 342 |
| 437 | 3300005466 | Ga0070685_10005103 | Ga0070685_100051035 | 342 |
| 438 | 3300005468 | Ga0070707_100227929 | Ga0070707_1002279291 | 342 |
| 439 | 3300005471 | Ga0070698_100016433 | Ga0070698_1000164336 | 342 |
| 440 | 3300005530 | Ga0070679_100347636 | Ga0070679_1003476361 | 342 |
| 441 | 3300005536 | Ga0070697_100010463 | Ga0070697_1000104635 | 342 |
| 442 | 3300005536 | Ga0070697_100334660 | Ga0070697_1003346601 | 342 |
| 443 | 3300005543 | Ga0070672_100005650 | Ga0070672_1000056508 | 342 |
| 444 | 3300005544 | Ga0070686_100011736 | Ga0070686_1000117362 | 342 |
| 445 | 3300005544 | Ga0070686_100040560 | Ga0070686_1000405602 | 342 |
| 446 | 3300005544 | Ga0070686_100093818 | Ga0070686_1000938182 | 342 |
| 447 | 3300005545 | Ga0070695_100046494 | Ga0070695_1000464943 | 342 |
| 448 | 3300005545 | Ga0070695_100088274 | Ga0070695_1000882742 | 342 |
| 449 | 3300005545 | Ga0070695_100215278 | Ga0070695_1002152781 | 342 |
| 450 | 3300005548 | Ga0070665_100155992 | Ga0070665_1001559922 | 342 |
| 451 | 3300005549 | Ga0070704_100085418 | Ga0070704_1000854182 | 342 |
| 452 | 3300005577 | Ga0068857_100169286 | Ga0068857_1001692863 | 342 |
| 453 | 3300005577 | Ga0068857_100276358 | Ga0068857_1002763582 | 342 |
| 454 | 3300005615 | Ga0070702_100042468 | Ga0070702_1000424682 | 342 |
| 455 | 3300005617 | Ga0068859_100011838 | Ga0068859_10001183810 | 342 |
| 456 | 3300005617 | Ga0068859_100140866 | Ga0068859_1001408661 | 342 |
| 457 | 3300005617 | Ga0068859_100535048 | Ga0068859_1005350482 | 342 |
| 458 | 3300005617 | Ga0068859_100589112 | Ga0068859_1005891122 | 342 |
| 459 | 3300005618 | Ga0068864_100253631 | Ga0068864_1002536312 | 342 |
| 460 | 3300005719 | Ga0068861_100052526 | Ga0068861_1000525266 | 342 |
| 461 | 3300005719 | Ga0068861_100093034 | Ga0068861_1000930342 | 342 |
| 462 | 3300005719 | Ga0068861_100369880 | Ga0068861_1003698801 | 342 |
| 463 | 3300005841 | Ga0068863_100024162 | Ga0068863_1000241626 | 342 |
| 464 | 3300005842 | Ga0068858_100037873 | Ga0068858_1000378737 | 342 |
| 465 | 3300005843 | Ga0068860_100298300 | Ga0068860_1002983002 | 342 |
| 466 | 3300005844 | Ga0068862_100149272 | Ga0068862_1001492722 | 342 |
| 467 | 3300005985 | Ga0081539_10002465 | Ga0081539_1000246515 | 342 |
| 468 | 3300006237 | Ga0097621_100121494 | Ga0097621_1001214942 | 342 |
| 469 | 3300006844 | Ga0075428_100060654 | Ga0075428_1000606543 | 342 |
| 470 | 3300006844 | Ga0075428_100088917 | Ga0075428_1000889172 | 342 |
| 471 | 3300006844 | Ga0075428_100093182 | Ga0075428_1000931825 | 342 |
| 472 | 3300006844 | Ga0075428_100233906 | Ga0075428_1002339062 | 342 |
| 473 | 3300006844 | Ga0075428_100468093 | Ga0075428_1004680932 | 342 |
| 474 | 3300006846 | Ga0075430_100122287 | Ga0075430_1001222872 | 342 |
| 475 | 3300006846 | Ga0075430_100277763 | Ga0075430_1002777632 | 342 |
| 476 | 3300006847 | Ga0075431_100071017 | Ga0075431_1000710172 | 342 |
| 477 | 3300006847 | Ga0075431_100200862 | Ga0075431_1002008621 | 342 |
| 478 | 3300006852 | Ga0075433_10005017 | Ga0075433_1000501712 | 342 |
| 479 | 3300006852 | Ga0075433_10010069 | Ga0075433_100100692 | 342 |
| 480 | 3300006852 | Ga0075433_10020245 | Ga0075433_100202455 | 342 |
| 481 | 3300006852 | Ga0075433_10140455 | Ga0075433_101404551 | 342 |
| 482 | 3300006871 | Ga0075434_100081914 | Ga0075434_1000819142 | 342 |
| 483 | 3300006880 | Ga0075429_100037564 | Ga0075429_1000375642 | 342 |
| 484 | 3300006931 | Ga0097620_100011838 | Ga0097620_10001183810 | 342 |
| 485 | 3300006931 | Ga0097620_100140870 | Ga0097620_1001408703 | 342 |
| 486 | 3300006931 | Ga0097620_100535108 | Ga0097620_1005351082 | 342 |
| 487 | 3300006931 | Ga0097620_100589138 | Ga0097620_1005891382 | 342 |
| 488 | 3300007265 | Ga0099794_10114755 | Ga0099794_101147552 | 342 |
| 489 | 3300009094 | Ga0111539_10009788 | Ga0111539_100097885 | 342 |
| 490 | 3300009094 | Ga0111539_10024520 | Ga0111539_100245206 | 342 |
| 491 | 3300009094 | Ga0111539_10074668 | Ga0111539_100746682 | 342 |
| 492 | 3300009101 | Ga0105247_10045574 | Ga0105247_100455742 | 342 |
| 493 | 3300009147 | Ga0114129_10004880 | Ga0114129_100048807 | 342 |
| 494 | 3300009147 | Ga0114129_10011151 | Ga0114129_1001115110 | 342 |
| 495 | 3300009147 | Ga0114129_10019919 | Ga0114129_100199193 | 342 |
| 496 | 3300009147 | Ga0114129_10025796 | Ga0114129_100257965 | 342 |
| 497 | 3300009147 | Ga0114129_10214249 | Ga0114129_102142492 | 342 |
| 498 | 3300009147 | Ga0114129_10263548 | Ga0114129_102635482 | 342 |
| 499 | 3300009147 | Ga0114129_10311223 | Ga0114129_103112232 | 342 |
| 500 | 3300009147 | Ga0114129_10349888 | Ga0114129_103498882 | 342 |
| 501 | 3300009147 | Ga0114129_10518574 | Ga0114129_105185742 | 342 |
| 502 | 3300009174 | Ga0105241_10199120 | Ga0105241_101991202 | 342 |
| 503 | 3300009176 | Ga0105242_10038649 | Ga0105242_100386492 | 342 |
| 504 | 3300009176 | Ga0105242_10176157 | Ga0105242_101761572 | 342 |
| 505 | 3300009177 | Ga0105248_10050265 | Ga0105248_100502651 | 342 |
| 506 | 3300009177 | Ga0105248_10098295 | Ga0105248_100982951 | 342 |
| 507 | 3300009551 | Ga0105238_10001168 | Ga0105238_1000116821 | 342 |
| 508 | 3300009551 | Ga0105238_10230856 | Ga0105238_102308562 | 342 |
| 509 | 3300009553 | Ga0105249_10089815 | Ga0105249_100898152 | 342 |
| 510 | 3300009553 | Ga0105249_10153102 | Ga0105249_101531022 | 342 |
| 511 | 3300009553 | Ga0105249_10153223 | Ga0105249_101532232 | 342 |
| 512 | 3300010375 | Ga0105239_10143785 | Ga0105239_101437851 | 342 |
| 513 | 3300013296 | Ga0157374_10062419 | Ga0157374_100624192 | 342 |
| 514 | 3300013297 | Ga0157378_10031425 | Ga0157378_100314252 | 342 |
| 515 | 3300013297 | Ga0157378_10116415 | Ga0157378_101164152 | 342 |
| 516 | 3300013297 | Ga0157378_10155581 | Ga0157378_101555812 | 342 |
| 517 | 3300013297 | Ga0157378_10170340 | Ga0157378_101703401 | 342 |
| 518 | 3300013297 | Ga0157378_10247742 | Ga0157378_102477422 | 342 |
| 519 | 3300013297 | Ga0157378_10360115 | Ga0157378_103601152 | 342 |
| 520 | 3300013308 | Ga0157375_10032365 | Ga0157375_100323656 | 342 |
| 521 | 3300013308 | Ga0157375_10086496 | Ga0157375_100864963 | 342 |
| 522 | 3300013308 | Ga0157375_10242517 | Ga0157375_102425171 | 342 |
| 523 | 3300014325 | Ga0163163_10017600 | Ga0163163_100176003 | 342 |
| 524 | 3300014325 | Ga0163163_10224435 | Ga0163163_102244351 | 342 |
| 525 | 3300014326 | Ga0157380_10008560 | Ga0157380_100085609 | 342 |
| 526 | 3300014326 | Ga0157380_10025709 | Ga0157380_100257092 | 342 |
| 527 | 3300014326 | Ga0157380_10225930 | Ga0157380_102259302 | 342 |
| 528 | 3300014326 | Ga0157380_10311359 | Ga0157380_103113592 | 342 |
| 529 | 3300025899 | Ga0207642_10071003 | Ga0207642_100710031 | 342 |
| 530 | 3300025921 | Ga0207652_10305100 | Ga0207652_103051001 | 342 |
| 531 | 3300025922 | Ga0207646_10030456 | Ga0207646_100304565 | 342 |
| 532 | 3300025923 | Ga0207681_10006524 | Ga0207681_100065245 | 342 |
| 533 | 3300025923 | Ga0207681_10036958 | Ga0207681_100369581 | 342 |
| 534 | 3300025924 | Ga0207694_10022763 | Ga0207694_100227634 | 342 |
| 535 | 3300025925 | Ga0207650_10000001 | Ga0207650_100000011135 | 342 |
| 536 | 3300025925 | Ga0207650_10004340 | Ga0207650_100043407 | 342 |
| 537 | 3300025925 | Ga0207650_10028463 | Ga0207650_100284632 | 342 |
| 538 | 3300025926 | Ga0207659_10020047 | Ga0207659_100200472 | 342 |
| 539 | 3300025926 | Ga0207659_10056814 | Ga0207659_100568142 | 342 |
| 540 | 3300025932 | Ga0207690_10098613 | Ga0207690_100986132 | 342 |
| 541 | 3300025933 | Ga0207706_10029341 | Ga0207706_100293414 | 342 |
| 542 | 3300025934 | Ga0207686_10018600 | Ga0207686_100186004 | 342 |
| 543 | 3300025935 | Ga0207709_10022298 | Ga0207709_100222982 | 342 |
| 544 | 3300025936 | Ga0207670_10021386 | Ga0207670_100213864 | 342 |
| 545 | 3300025937 | Ga0207669_10212328 | Ga0207669_102123281 | 342 |
| 546 | 3300025941 | Ga0207711_10063758 | Ga0207711_100637583 | 342 |
| 547 | 3300025960 | Ga0207651_10000598 | Ga0207651_100005987 | 342 |
| 548 | 3300025960 | Ga0207651_10021160 | Ga0207651_100211604 | 342 |
| 549 | 3300025960 | Ga0207651_10031957 | Ga0207651_100319574 | 342 |
| 550 | 3300025960 | Ga0207651_10281958 | Ga0207651_102819582 | 342 |
| 551 | 3300025961 | Ga0207712_10018531 | Ga0207712_100185312 | 342 |
| 552 | 3300025961 | Ga0207712_10196191 | Ga0207712_101961912 | 342 |
| 553 | 3300025986 | Ga0207658_10008335 | Ga0207658_100083356 | 342 |
| 554 | 3300026035 | Ga0207703_10059248 | Ga0207703_100592482 | 342 |
| 555 | 3300026035 | Ga0207703_10140243 | Ga0207703_101402432 | 342 |
| 556 | 3300026041 | Ga0207639_10040254 | Ga0207639_100402542 | 342 |
| 557 | 3300026041 | Ga0207639_10168606 | Ga0207639_101686062 | 342 |
| 558 | 3300026075 | Ga0207708_10025165 | Ga0207708_100251657 | 342 |
| 559 | 3300026075 | Ga0207708_10045435 | Ga0207708_100454352 | 342 |
| 560 | 3300026075 | Ga0207708_10069850 | Ga0207708_100698502 | 342 |
| 561 | 3300026075 | Ga0207708_10132620 | Ga0207708_101326202 | 342 |
| 562 | 3300026075 | Ga0207708_10309700 | Ga0207708_103097002 | 342 |
| 563 | 3300026088 | Ga0207641_10008925 | Ga0207641_100089256 | 342 |
| 564 | 3300026088 | Ga0207641_10072291 | Ga0207641_100722913 | 342 |
| 565 | 3300026088 | Ga0207641_10088979 | Ga0207641_100889792 | 342 |
| 566 | 3300026089 | Ga0207648_10060104 | Ga0207648_100601045 | 342 |
| 567 | 3300026095 | Ga0207676_10128477 | Ga0207676_101284772 | 342 |
| 568 | 3300026095 | Ga0207676_10266820 | Ga0207676_102668201 | 342 |
| 569 | 3300026118 | Ga0207675_100024454 | Ga0207675_1000244543 | 342 |
| 570 | 3300026118 | Ga0207675_100224666 | Ga0207675_1002246662 | 342 |
| 571 | 3300027907 | Ga0207428_10001203 | Ga0207428_1000120311 | 342 |
| 572 | 3300027907 | Ga0207428_10064220 | Ga0207428_100642202 | 342 |
| 573 | 3300027907 | Ga0207428_10089947 | Ga0207428_100899472 | 342 |
| 574 | 3300028380 | Ga0268265_10011947 | Ga0268265_100119475 | 342 |
| 575 | 3300028380 | Ga0268265_10323921 | Ga0268265_103239212 | 342 |
| 576 | 3300028381 | Ga0268264_10011660 | Ga0268264_100116605 | 342 |
| 577 | 3300035091 | Ga0373951_0001697 | Ga0373951_0001697_2282_3328 | 342 |
| 578 | 3300035172 | Ga0373955_0082553 | Ga0373955_0082553_383_1426 | 342 |
| 579 | 3300037312 | Ga0395899_0140889 | Ga0395899_0140889_335_1369 | 342 |
| 580 | 3300045051 | Ga0451576_0140839 | Ga0451576_0140839_1424_2455 | 342 |
| 581 | 3300046512 | Ga0495610_0078973 | Ga0495610_0078973_346_1386 | 342 |
| 582 | 3300046525 | Ga0495663_0000880 | Ga0495663_0000880_1958_2998 | 342 |
| 583 | 3300046537 | Ga0495598_0000239 | Ga0495598_0000239_427_1467 | 342 |
| 584 | 3300046539 | Ga0495621_0001254 | Ga0495621_0001254_1382_2422 | 342 |
| 585 | 3300046689 | Ga0495613_0167917 | Ga0495613_0167917_194_1237 | 342 |
| 586 | 3300048907 | Ga0496104_0070865 | Ga0496104_0070865_1786_2826 | 342 |
| 587 | 3300049568 | Ga0501031_0074082 | Ga0501031_0074082_576_1607 | 342 |
| 588 | 3300049574 | Ga0501038_0123813 | Ga0501038_0123813_214_1245 | 342 |
| 589 | 3300049576 | Ga0501040_0035568 | Ga0501040_0035568_568_1599 | 342 |
| 590 | 3300049576 | Ga0501040_0143311 | Ga0501040_0143311_553_1593 | 342 |
| 591 | 3300049578 | Ga0501042_0031245 | Ga0501042_0031245_1407_2438 | 342 |
| 592 | 3300049582 | Ga0501048_0022363 | Ga0501048_0022363_364_1395 | 342 |
| 593 | 3300049585 | Ga0501069_0028851 | Ga0501069_0028851_1521_2552 | 342 |
| 594 | 3300049587 | Ga0501071_0135778 | Ga0501071_0135778_513_1544 | 342 |
| 595 | 3300049587 | Ga0501071_0169772 | Ga0501071_0169772_271_1302 | 342 |
| 596 | 3300049590 | Ga0501074_0210810 | Ga0501074_0210810_161_1192 | 342 |
| 597 | 3300049591 | Ga0501075_0017112 | Ga0501075_0017112_1555_2586 | 342 |
| 598 | 3300049591 | Ga0501075_0109007 | Ga0501075_0109007_76_1107 | 342 |
| 599 | 3300049592 | Ga0501076_0017789 | Ga0501076_0017789_1523_2554 | 342 |
| 600 | 3300049593 | Ga0501077_0019173 | Ga0501077_0019173_50_1081 | 342 |
| 601 | 3300049741 | Ga0501079_0012525 | Ga0501079_0012525_2850_3881 | 342 |
| 602 | 3300049741 | Ga0501079_0029871 | Ga0501079_0029871_276_1307 | 342 |
| 603 | 3300049742 | Ga0501080_0011951 | Ga0501080_0011951_1307_2338 | 342 |
| 604 | 3300049743 | Ga0501081_0021201 | Ga0501081_0021201_1577_2608 | 342 |
| 605 | 3300049744 | Ga0501083_0101595 | Ga0501083_0101595_348_1379 | 342 |
| 606 | 3300049822 | Ga0501035_0158318 | Ga0501035_0158318_148_1179 | 342 |
| 607 | 3300049824 | Ga0501045_0028872 | Ga0501045_0028872_1610_2641 | 342 |
| 608 | 3300050507 | nmdc:mga05p37_168018_c1 | nmdc:mga05p37_168018_c1_185_1237 | 342 |
| 609 | 3300050507 | nmdc:mga05p37_2065_c1 | nmdc:mga05p37_2065_c1_15559_16602 | 342 |
| 610 | 3300050507 | nmdc:mga05p37_268162_c1 | nmdc:mga05p37_268162_c1_184_1215 | 342 |
| 611 | 3300050507 | nmdc:mga05p37_29589_c1 | nmdc:mga05p37_29589_c1_2934_3992 | 342 |
| 612 | 3300050507 | nmdc:mga05p37_444794_c1 | nmdc:mga05p37_444794_c1_346_1386 | 342 |
| 613 | 3300050508 | nmdc:mga09592_59549_c1 | nmdc:mga09592_59549_c1_243_1274 | 342 |
| 614 | 3300050510 | nmdc:mga06r32_210121_c1 | nmdc:mga06r32_210121_c1_161_1192 | 342 |
| 615 | 3300050510 | nmdc:mga06r32_32760_c1 | nmdc:mga06r32_32760_c1_2961_3992 | 342 |
| 616 | 3300050511 | nmdc:mga08y16_184618_c1 | nmdc:mga08y16_184618_c1_201_1232 | 342 |
| 617 | 3300050511 | nmdc:mga08y16_2321_c1 | nmdc:mga08y16_2321_c1_11231_12283 | 342 |
| 618 | 3300050511 | nmdc:mga08y16_256643_c1 | nmdc:mga08y16_256643_c1_653_1684 | 342 |
| 619 | 3300050512 | nmdc:mga0n895_37099_c1 | nmdc:mga0n895_37099_c1_1588_2619 | 342 |
| 620 | 3300050512 | nmdc:mga0n895_7573_c1 | nmdc:mga0n895_7573_c1_3456_4499 | 342 |
| 621 | 3300050515 | nmdc:mga0a205_220917_c1 | nmdc:mga0a205_220917_c1_272_1303 | 342 |
| 622 | 3300050515 | nmdc:mga0a205_314794_c1 | nmdc:mga0a205_314794_c1_363_1415 | 342 |
| 623 | 3300050515 | nmdc:mga0a205_4815_c1 | nmdc:mga0a205_4815_c1_805_1836 | 342 |
| 624 | 3300054114 | Ga0501084_0013070 | Ga0501084_0013070_5027_6058 | 342 |
| 625 | 3300054114 | Ga0501084_0034662 | Ga0501084_0034662_534_1565 | 342 |
| 626 | 3300054114 | Ga0501084_0072377 | Ga0501084_0072377_625_1662 | 342 |
| 627 | 3300054114 | Ga0501084_0281474 | Ga0501084_0281474_68_1108 | 342 |
| 628 | 3300060353 | Ga0501082_0015213 | Ga0501082_0015213_483_1514 | 342 |
| 629 | 3300060353 | Ga0501082_0036111 | Ga0501082_0036111_1458_2489 | 342 |
| 630 | 3300060353 | Ga0501082_0231460 | Ga0501082_0231460_295_1326 | 342 |
| 631 | 3300061734 | Ga0530510_0053621 | Ga0530510_0053621_1784_2815 | 342 |
| 632 | 3300005330 | Ga0070690_100001019 | Ga0070690_10000101911 | 343 |
| 633 | 3300005331 | Ga0070670_100001528 | Ga0070670_10000152810 | 343 |
| 634 | 3300005333 | Ga0070677_10098780 | Ga0070677_100987802 | 343 |
| 635 | 3300005338 | Ga0068868_100000238 | Ga0068868_10000023820 | 343 |
| 636 | 3300005344 | Ga0070661_100008110 | Ga0070661_1000081107 | 343 |
| 637 | 3300005347 | Ga0070668_100098853 | Ga0070668_1000988532 | 343 |
| 638 | 3300005354 | Ga0070675_100017185 | Ga0070675_1000171856 | 343 |
| 639 | 3300005355 | Ga0070671_100022400 | Ga0070671_1000224005 | 343 |
| 640 | 3300005364 | Ga0070673_100050859 | Ga0070673_1000508593 | 343 |
| 641 | 3300005367 | Ga0070667_100001127 | Ga0070667_10000112715 | 343 |
| 642 | 3300005434 | Ga0070709_10209482 | Ga0070709_102094822 | 343 |
| 643 | 3300005445 | Ga0070708_100094887 | Ga0070708_1000948872 | 343 |
| 644 | 3300005456 | Ga0070678_100164643 | Ga0070678_1001646432 | 343 |
| 645 | 3300005466 | Ga0070685_10107919 | Ga0070685_101079192 | 343 |
| 646 | 3300005467 | Ga0070706_100268017 | Ga0070706_1002680172 | 343 |
| 647 | 3300005467 | Ga0070706_100507618 | Ga0070706_1005076181 | 343 |
| 648 | 3300005471 | Ga0070698_100000398 | Ga0070698_10000039830 | 343 |
| 649 | 3300005543 | Ga0070672_100000998 | Ga0070672_1000009987 | 343 |
| 650 | 3300005544 | Ga0070686_100011105 | Ga0070686_1000111052 | 343 |
| 651 | 3300005564 | Ga0070664_100001082 | Ga0070664_1000010823 | 343 |
| 652 | 3300005618 | Ga0068864_100000368 | Ga0068864_10000036835 | 343 |
| 653 | 3300005841 | Ga0068863_100022102 | Ga0068863_1000221021 | 343 |
| 654 | 3300005841 | Ga0068863_100031683 | Ga0068863_1000316835 | 343 |
| 655 | 3300005842 | Ga0068858_100011012 | Ga0068858_1000110123 | 343 |
| 656 | 3300006173 | Ga0070716_100000046 | Ga0070716_10000004626 | 343 |
| 657 | 3300006358 | Ga0068871_100059286 | Ga0068871_1000592863 | 343 |
| 658 | 3300006358 | Ga0068871_100259361 | Ga0068871_1002593612 | 343 |
| 659 | 3300006844 | Ga0075428_100142765 | Ga0075428_1001427652 | 343 |
| 660 | 3300006847 | Ga0075431_100085225 | Ga0075431_1000852252 | 343 |
| 661 | 3300009148 | Ga0105243_10132597 | Ga0105243_101325972 | 343 |
| 662 | 3300009176 | Ga0105242_10053256 | Ga0105242_100532563 | 343 |
| 663 | 3300009177 | Ga0105248_10001606 | Ga0105248_1000160613 | 343 |
| 664 | 3300009553 | Ga0105249_10000030 | Ga0105249_10000030164 | 343 |
| 665 | 3300013296 | Ga0157374_10154521 | Ga0157374_101545212 | 343 |
| 666 | 3300013306 | Ga0163162_10000002 | Ga0163162_10000002163 | 343 |
| 667 | 3300013308 | Ga0157375_10000538 | Ga0157375_1000053817 | 343 |
| 668 | 3300013308 | Ga0157375_10260123 | Ga0157375_102601232 | 343 |
| 669 | 3300013308 | Ga0157375_10282936 | Ga0157375_102829362 | 343 |
| 670 | 3300014325 | Ga0163163_10013520 | Ga0163163_100135209 | 343 |
| 671 | 3300014325 | Ga0163163_10110201 | Ga0163163_101102012 | 343 |
| 672 | 3300014325 | Ga0163163_10146106 | Ga0163163_101461062 | 343 |
| 673 | 3300014745 | Ga0157377_10015473 | Ga0157377_100154732 | 343 |
| 674 | 3300014968 | Ga0157379_10102346 | Ga0157379_101023462 | 343 |
| 675 | 3300025903 | Ga0207680_10031052 | Ga0207680_100310522 | 343 |
| 676 | 3300025920 | Ga0207649_10026095 | Ga0207649_100260952 | 343 |
| 677 | 3300025922 | Ga0207646_10300274 | Ga0207646_103002741 | 343 |
| 678 | 3300025925 | Ga0207650_10001416 | Ga0207650_100014167 | 343 |
| 679 | 3300025934 | Ga0207686_10041054 | Ga0207686_100410543 | 343 |
| 680 | 3300025939 | Ga0207665_10000131 | Ga0207665_1000013116 | 343 |
| 681 | 3300025940 | Ga0207691_10002279 | Ga0207691_1000227911 | 343 |
| 682 | 3300025945 | Ga0207679_10004427 | Ga0207679_100044272 | 343 |
| 683 | 3300025960 | Ga0207651_10028764 | Ga0207651_100287643 | 343 |
| 684 | 3300025961 | Ga0207712_10000041 | Ga0207712_10000041120 | 343 |
| 685 | 3300025972 | Ga0207668_10097433 | Ga0207668_100974332 | 343 |
| 686 | 3300025986 | Ga0207658_10037469 | Ga0207658_100374693 | 343 |
| 687 | 3300026023 | Ga0207677_10000835 | Ga0207677_1000083510 | 343 |
| 688 | 3300026035 | Ga0207703_10014535 | Ga0207703_100145356 | 343 |
| 689 | 3300026088 | Ga0207641_10027252 | Ga0207641_100272525 | 343 |
| 690 | 3300026095 | Ga0207676_10001257 | Ga0207676_1000125711 | 343 |
| 691 | 3300032126 | Ga0307415_100107945 | Ga0307415_1001079452 | 343 |
| 692 | 3300035117 | Ga0373953_0034045 | Ga0373953_0034045_670_1713 | 343 |
| 693 | 3300036401 | Ga0373937_0004612 | Ga0373937_0004612_3237_4280 | 343 |
| 694 | 3300036401 | Ga0373937_0037580 | Ga0373937_0037580_102_1145 | 343 |
| 695 | 3300044673 | Ga0453683_0022885 | Ga0453683_0022885_113_1144 | 343 |
| 696 | 3300046454 | Ga0495592_0002030 | Ga0495592_0002030_7179_8222 | 343 |
| 697 | 3300046559 | Ga0495667_0001527 | Ga0495667_0001527_7476_8519 | 343 |
| 698 | 3300046642 | Ga0495634_0188231 | Ga0495634_0188231_88_1131 | 343 |
| 699 | 3300046675 | Ga0495657_0013716 | Ga0495657_0013716_4750_5793 | 343 |
| 700 | 3300047318 | Ga0495636_0016131 | Ga0495636_0016131_259_1302 | 343 |
| 701 | 3300047319 | Ga0495674_0041641 | Ga0495674_0041641_1970_3013 | 343 |
| 702 | 3300047319 | Ga0495674_0377534 | Ga0495674_0377534_65_1108 | 343 |
| 703 | 3300047444 | Ga0495675_0183057 | Ga0495675_0183057_60_1103 | 343 |
| 704 | 3300047471 | Ga0495684_0121397 | Ga0495684_0121397_873_1916 | 343 |
| 705 | 3300050515 | nmdc:mga0a205_35775_c1 | nmdc:mga0a205_35775_c1_1542_2591 | 343 |
| 706 | 3300053085 | Ga0495619_0027387 | Ga0495619_0027387_1775_2818 | 343 |
| 707 | 3300005293 | Ga0065715_10092350 | Ga0065715_100923503 | 344 |
| 708 | 3300005295 | Ga0065707_10002307 | Ga0065707_100023073 | 344 |
| 709 | 3300005334 | Ga0068869_100003484 | Ga0068869_1000034846 | 344 |
| 710 | 3300005334 | Ga0068869_100013921 | Ga0068869_1000139212 | 344 |
| 711 | 3300005444 | Ga0070694_100049593 | Ga0070694_1000495932 | 344 |
| 712 | 3300005467 | Ga0070706_100001884 | Ga0070706_1000018849 | 344 |
| 713 | 3300005467 | Ga0070706_100045247 | Ga0070706_1000452473 | 344 |
| 714 | 3300005471 | Ga0070698_100009908 | Ga0070698_1000099085 | 344 |
| 715 | 3300005471 | Ga0070698_100047297 | Ga0070698_1000472972 | 344 |
| 716 | 3300005471 | Ga0070698_100193495 | Ga0070698_1001934952 | 344 |
| 717 | 3300005536 | Ga0070697_100001655 | Ga0070697_10000165514 | 344 |
| 718 | 3300005546 | Ga0070696_100264924 | Ga0070696_1002649241 | 344 |
| 719 | 3300005546 | Ga0070696_100305668 | Ga0070696_1003056681 | 344 |
| 720 | 3300009148 | Ga0105243_10082410 | Ga0105243_100824103 | 344 |
| 721 | 3300025910 | Ga0207684_10010854 | Ga0207684_100108541 | 344 |
| 722 | 3300025910 | Ga0207684_10012695 | Ga0207684_100126956 | 344 |
| 723 | 3300025922 | Ga0207646_10118038 | Ga0207646_101180382 | 344 |
| 724 | 3300025942 | Ga0207689_10005406 | Ga0207689_100054066 | 344 |
| 725 | 3300025942 | Ga0207689_10011776 | Ga0207689_100117762 | 344 |
| 726 | 3300031731 | Ga0307405_10223262 | Ga0307405_102232621 | 344 |
| 727 | 3300034816 | Ga0373930_0025405 | Ga0373930_0025405_86_1135 | 344 |
| 728 | 3300035112 | Ga0373932_0025122 | Ga0373932_0025122_119_1168 | 344 |
| 729 | 3300047320 | Ga0495672_0039395 | Ga0495672_0039395_1070_2122 | 344 |
| 730 | 3300050511 | nmdc:mga08y16_49419_c1 | nmdc:mga08y16_49419_c1_538_1587 | 344 |
| 731 | 3300050515 | nmdc:mga0a205_499_c1 | nmdc:mga0a205_499_c1_25166_26215 | 344 |
| 732 | 3300005468 | Ga0070707_100046596 | Ga0070707_1000465963 | 345 |
| 733 | 3300005471 | Ga0070698_100007201 | Ga0070698_1000072014 | 345 |
| 734 | 3300005518 | Ga0070699_100003914 | Ga0070699_1000039145 | 345 |
| 735 | 3300005718 | Ga0068866_10013594 | Ga0068866_100135943 | 345 |
| 736 | 3300025899 | Ga0207642_10003129 | Ga0207642_100031293 | 345 |
| 737 | 3300025922 | Ga0207646_10035462 | Ga0207646_100354621 | 345 |
| 738 | 3300025925 | Ga0207650_10362002 | Ga0207650_103620021 | 345 |
| 739 | 3300006844 | Ga0075428_100036992 | Ga0075428_1000369929 | 346 |
| 740 | 3300007265 | Ga0099794_10001085 | Ga0099794_100010852 | 346 |
| 741 | 3300009174 | Ga0105241_10293093 | Ga0105241_102930931 | 347 |
| 742 | 3300050507 | nmdc:mga05p37_190569_c1 | nmdc:mga05p37_190569_c1_288_1352 | 347 |
| 743 | 3300005545 | Ga0070695_100065565 | Ga0070695_1000655652 | 348 |
| 744 | 3300005546 | Ga0070696_100013630 | Ga0070696_1000136302 | 348 |
| 745 | 3300013306 | Ga0163162_10230964 | Ga0163162_102309642 | 348 |
| 746 | 3300050507 | nmdc:mga05p37_458728_c1 | nmdc:mga05p37_458728_c1_272_1435 | 348 |
| 747 | 3300013297 | Ga0157378_10167178 | Ga0157378_101671782 | 349 |
| 748 | 3300026118 | Ga0207675_100120881 | Ga0207675_1001208811 | 350 |
| 749 | 3300005468 | Ga0070707_100423219 | Ga0070707_1004232192 | 354 |
| 750 | 3300005468 | Ga0070707_100000612 | Ga0070707_10000061217 | 357 |
| 751 | 3300005546 | Ga0070696_100077786 | Ga0070696_1000777861 | 357 |
| 752 | 3300025922 | Ga0207646_10001205 | Ga0207646_1000120513 | 357 |
| 753 | 3300005289 | Ga0065704_10103121 | Ga0065704_101031213 | 358 |
| 754 | 3300005467 | Ga0070706_100079320 | Ga0070706_1000793202 | 358 |
| 755 | 3300005468 | Ga0070707_100080009 | Ga0070707_1000800093 | 358 |
| 756 | 3300005518 | Ga0070699_100301548 | Ga0070699_1003015481 | 358 |
| 757 | 3300025910 | Ga0207684_10043729 | Ga0207684_100437293 | 358 |
| 758 | 3300025922 | Ga0207646_10054762 | Ga0207646_100547623 | 358 |
| 759 | 3300009147 | Ga0114129_10108595 | Ga0114129_101085954 | 359 |
| 760 | 3300005549 | Ga0070704_100055081 | Ga0070704_1000550813 | 360 |
| 761 | 3300005330 | Ga0070690_100056793 | Ga0070690_1000567932 | 361 |
| 762 | 3300005364 | Ga0070673_100033143 | Ga0070673_1000331434 | 361 |
| 763 | 3300005444 | Ga0070694_100008789 | Ga0070694_1000087893 | 361 |
| 764 | 3300005471 | Ga0070698_100124185 | Ga0070698_1001241852 | 361 |
| 765 | 3300005842 | Ga0068858_100163243 | Ga0068858_1001632433 | 361 |
| 766 | 3300009148 | Ga0105243_10001062 | Ga0105243_100010628 | 361 |
| 767 | 3300009148 | Ga0105243_10001709 | Ga0105243_1000170914 | 361 |
| 768 | 3300009148 | Ga0105243_10224225 | Ga0105243_102242252 | 361 |
| 769 | 3300009174 | Ga0105241_10049962 | Ga0105241_100499622 | 361 |
| 770 | 3300009176 | Ga0105242_10000301 | Ga0105242_1000030114 | 361 |
| 771 | 3300009176 | Ga0105242_10000554 | Ga0105242_1000055416 | 361 |
| 772 | 3300013297 | Ga0157378_10000003 | Ga0157378_1000000326 | 361 |
| 773 | 3300013297 | Ga0157378_10071168 | Ga0157378_100711682 | 361 |
| 774 | 3300017792 | Ga0163161_10162238 | Ga0163161_101622382 | 361 |
| 775 | 3300025934 | Ga0207686_10000018 | Ga0207686_1000001866 | 361 |
| 776 | 3300025934 | Ga0207686_10000021 | Ga0207686_10000021124 | 361 |
| 777 | 3300025934 | Ga0207686_10000436 | Ga0207686_1000043610 | 361 |
| 778 | 3300025935 | Ga0207709_10000069 | Ga0207709_1000006927 | 361 |
| 779 | 3300025935 | Ga0207709_10002653 | Ga0207709_100026534 | 361 |
| 780 | 3300025935 | Ga0207709_10059971 | Ga0207709_100599712 | 361 |
| 781 | 3300046642 | Ga0495634_0069819 | Ga0495634_0069819_234_1346 | 361 |
| 782 | 3300048909 | Ga0496106_0000917 | Ga0496106_0000917_1142_2257 | 361 |
| 783 | 3300001432 | JGI24034J14986_100245 | JGI24034J14986_1002453 | 362 |
| 784 | 3300002074 | JGI24748J21848_1000010 | JGI24748J21848_100001068 | 362 |
| 785 | 3300002239 | JGI24034J26672_10000001 | JGI24034J26672_10000001614 | 362 |
| 786 | 3300005330 | Ga0070690_100056979 | Ga0070690_1000569792 | 362 |
| 787 | 3300005445 | Ga0070708_100105189 | Ga0070708_1001051892 | 362 |
| 788 | 3300005842 | Ga0068858_100000005 | Ga0068858_100000005125 | 362 |
| 789 | 3300006163 | Ga0070715_10000024 | Ga0070715_1000002440 | 362 |
| 790 | 3300009101 | Ga0105247_10000002 | Ga0105247_10000002381 | 362 |
| 791 | 3300025223 | Ga0207672_1000317 | Ga0207672_10003176 | 362 |
| 792 | 3300025900 | Ga0207710_10000002 | Ga0207710_10000002381 | 362 |
| 793 | 3300025905 | Ga0207685_10000018 | Ga0207685_1000001837 | 362 |
| 794 | 3300025931 | Ga0207644_10004396 | Ga0207644_100043963 | 362 |
| 795 | 3300026035 | Ga0207703_10000150 | Ga0207703_1000015023 | 362 |
| 796 | 3300026118 | Ga0207675_100224028 | Ga0207675_1002240281 | 362 |
| 797 | 3300005334 | Ga0068869_100237150 | Ga0068869_1002371501 | 363 |
| 798 | 3300005343 | Ga0070687_100102570 | Ga0070687_1001025702 | 363 |
| 799 | 3300005406 | Ga0070703_10000015 | Ga0070703_1000001545 | 363 |
| 800 | 3300005441 | Ga0070700_100005323 | Ga0070700_1000053236 | 363 |
| 801 | 3300005445 | Ga0070708_100040287 | Ga0070708_1000402872 | 363 |
| 802 | 3300005468 | Ga0070707_100014740 | Ga0070707_1000147405 | 363 |
| 803 | 3300005536 | Ga0070697_100033785 | Ga0070697_1000337852 | 363 |
| 804 | 3300005544 | Ga0070686_100061035 | Ga0070686_1000610351 | 363 |
| 805 | 3300005615 | Ga0070702_100204413 | Ga0070702_1002044131 | 363 |
| 806 | 3300005618 | Ga0068864_100026211 | Ga0068864_1000262112 | 363 |
| 807 | 3300005842 | Ga0068858_100102209 | Ga0068858_1001022092 | 363 |
| 808 | 3300006237 | Ga0097621_100088971 | Ga0097621_1000889713 | 363 |
| 809 | 3300006914 | Ga0075436_100000002 | Ga0075436_100000002358 | 363 |
| 810 | 3300007076 | Ga0075435_100000687 | Ga0075435_10000068711 | 363 |
| 811 | 3300009101 | Ga0105247_10127938 | Ga0105247_101279382 | 363 |
| 812 | 3300009147 | Ga0114129_10024266 | Ga0114129_100242665 | 363 |
| 813 | 3300009176 | Ga0105242_10017871 | Ga0105242_100178714 | 363 |
| 814 | 3300025885 | Ga0207653_10000007 | Ga0207653_10000007117 | 363 |
| 815 | 3300025918 | Ga0207662_10033491 | Ga0207662_100334913 | 363 |
| 816 | 3300025922 | Ga0207646_10014963 | Ga0207646_100149633 | 363 |
| 817 | 3300025934 | Ga0207686_10000132 | Ga0207686_1000013221 | 363 |
| 818 | 3300025942 | Ga0207689_10066328 | Ga0207689_100663283 | 363 |
| 819 | 3300026035 | Ga0207703_10034451 | Ga0207703_100344513 | 363 |
| 820 | 3300026075 | Ga0207708_10017022 | Ga0207708_100170225 | 363 |
| 821 | 3300028381 | Ga0268264_10287206 | Ga0268264_102872062 | 363 |
| 822 | 3300050507 | nmdc:mga05p37_190944_c1 | nmdc:mga05p37_190944_c1_826_1947 | 363 |
| 823 | 3300050513 | nmdc:mga0rr50_377_c1 | nmdc:mga0rr50_377_c1_11130_12227 | 363 |
| 824 | 3300050514 | nmdc:mga08x19_9_c1 | nmdc:mga08x19_9_c1_281_1378 | 363 |
| 825 | 3300006852 | Ga0075433_10160634 | Ga0075433_101606341 | 365 |
| 826 | 3300014968 | Ga0157379_10233713 | Ga0157379_102337132 | 366 |
| 827 | 3300005334 | Ga0068869_100021791 | Ga0068869_1000217915 | 369 |
| 828 | 3300005338 | Ga0068868_100024174 | Ga0068868_1000241744 | 369 |
| 829 | 3300005578 | Ga0068854_100104550 | Ga0068854_1001045503 | 369 |
| 830 | 3300006852 | Ga0075433_10146272 | Ga0075433_101462722 | 369 |
| 831 | 3300006871 | Ga0075434_100038179 | Ga0075434_1000381794 | 369 |
| 832 | 3300009098 | Ga0105245_10038382 | Ga0105245_100383823 | 369 |
| 833 | 3300009553 | Ga0105249_10006291 | Ga0105249_100062914 | 369 |
| 834 | 3300010375 | Ga0105239_10411349 | Ga0105239_104113492 | 369 |
| 835 | 3300013297 | Ga0157378_10005802 | Ga0157378_100058026 | 369 |
| 836 | 3300013297 | Ga0157378_10034039 | Ga0157378_100340393 | 369 |
| 837 | 3300025918 | Ga0207662_10074213 | Ga0207662_100742132 | 369 |
| 838 | 3300025942 | Ga0207689_10027730 | Ga0207689_100277302 | 369 |
| 839 | 3300026118 | Ga0207675_100001831 | Ga0207675_10000183110 | 369 |
| 840 | 3300044673 | Ga0453683_0009301 | Ga0453683_0009301_3341_4483 | 369 |
| 841 | 3300044712 | Ga0453684_0293472 | Ga0453684_0293472_634_1776 | 369 |
| 842 | 3300045051 | Ga0451576_0390179 | Ga0451576_0390179_181_1323 | 369 |
| 843 | 3300050512 | nmdc:mga0n895_46685_c1 | nmdc:mga0n895_46685_c1_604_1746 | 369 |
| 844 | 3300050515 | nmdc:mga0a205_46989_c1 | nmdc:mga0a205_46989_c1_665_1807 | 369 |
| 845 | 3300006852 | Ga0075433_10022933 | Ga0075433_100229334 | 371 |
| 846 | 3300050515 | nmdc:mga0a205_157987_c1 | nmdc:mga0a205_157987_c1_189_1352 | 371 |
| 847 | 3300050515 | nmdc:mga0a205_18848_c1 | nmdc:mga0a205_18848_c1_652_1833 | 371 |
| 848 | 3300009177 | Ga0105248_10380932 | Ga0105248_103809321 | 376 |
| 849 | 3300014325 | Ga0163163_10152334 | Ga0163163_101523343 | 376 |
| 850 | 2162886006 | SwRhRL3b_contig_3391401 | SwRhRL3b_0232.00000400 | 378 |
| 851 | 3300005617 | Ga0068859_100003569 | Ga0068859_1000035699 | 378 |
| 852 | 3300006931 | Ga0097620_100003568 | Ga0097620_1000035689 | 378 |
| 853 | 3300009094 | Ga0111539_10022812 | Ga0111539_100228123 | 378 |
| 854 | 3300050508 | nmdc:mga09592_91985_c1 | nmdc:mga09592_91985_c1_98_1234 | 378 |
| 855 | 3300050511 | nmdc:mga08y16_14312_c1 | nmdc:mga08y16_14312_c1_459_1595 | 378 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lwb-assembly1.cif.gz_B | crystal structure of apo d-alanine:d-alanine ligase (ddl) from mycobacterium tuberculosis | 0.867 | 43 | 378 |
| 3r5x-assembly2.cif.gz_C | crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp | 0.8645 | 44 | 378 |
| 3r5x-assembly1.cif.gz_B | crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp | 0.8643 | 44 | 373 |
| 3lwb-assembly1.cif.gz_B | crystal structure of apo d-alanine:d-alanine ligase (ddl) from mycobacterium tuberculosis | 0.8616 | 43 | 378 |
| 5d8d-assembly3.cif.gz_D | crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii | 0.8538 | 38 | 369 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3q1kB02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.908 | 142 | 372 | 3.30.470.20 |
| af_P9WP31_140_368_3.40.50.20 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8941 | 142 | 372 | 3.40.50.20 |
| 2i8cA02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.8927 | 238 | 370 | 3.30.470.20 |
| 3i12A02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.8891 | 142 | 372 | 3.30.470.20 |
| 1ehiA02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.8864 | 237 | 371 | 3.30.470.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8PF42-F1-model_v4 | ATP-grasp domain-containing protein | 0.9975 | 233 | 378 |
GO:0005524
GO:0008716 GO:0046872 |
| AF-A0A2V8PF42-F1-model_v4 | ATP-grasp domain-containing protein | 0.9775 | 233 | 378 |
GO:0005524
GO:0008716 GO:0046872 |
| AF-A0A2V9MLS0-F1-model_v4 | D-alanine--D-alanine ligase | 0.9734 | 36 | 183 |
GO:0016874
|
| AF-A0A7W0GS63-F1-model_v4 | ATP-grasp domain-containing protein | 0.9723 | 180 | 378 |
GO:0005524
GO:0008716 GO:0046872 |
| AF-A0A524KLL9-F1-model_v4 | D-alanine--D-alanine ligase | 0.972 | 41 | 376 |
GO:0005524
GO:0008716 GO:0046872 GO:0071555 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar