F483500

General Info

Members Datasets Scaffolds Average Seq Length
852 440 1704 265

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10015649|Ga0207707_100156497
Length 319
Sequence MYNFNYHQAKNVDEAAKLVTGAEEGKLMAGGMTLIPTLKQRLAKPSDIVDLGKIADLKGIKKDGNAIVIGAMTRHFDVANSDVVKSAIPALAYLASHIGDPAVRNRGTMGGSVANNDPAADYPSAVLALNATVITNKRKIAADDFFKGMFETALEDGEIITSFSYPIPEKAAYMKFPNPASRYAIVGVFVAKTGGNIRVAVTGAGPVVFRQKDMEAALAKSFTADAIKSIAQKQDGLNSDIHASAEYRAHLVGRDGAARRGGRRRLTFGQSFLRGKGALAAPFFLHRAGVYAAPRNRLVPPAKGGHPLALIRIWGERRS

Samples

Sample ID Description Type Environment
1 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
124 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
194 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
200 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
201 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
202 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
203 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
204 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
205 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
206 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
207 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
208 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
209 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
212 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
213 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
214 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
218 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
219 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
220 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
221 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
223 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
224 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
225 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
226 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
227 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
228 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
229 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
233 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
234 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
237 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
239 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
240 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
243 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
244 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
245 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
246 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
247 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
248 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
249 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
250 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
251 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
252 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
253 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
254 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
255 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
256 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
260 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
261 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
262 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
263 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
264 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
265 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
266 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
267 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
268 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
269 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
273 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
274 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
275 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
276 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
277 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
278 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
279 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
280 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
281 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
282 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
283 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
284 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
285 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
286 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
287 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
290 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
291 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
292 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
293 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
294 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
295 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
298 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
299 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
300 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
301 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
302 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
303 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
317 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
318 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
319 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
320 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
336 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
337 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
338 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
339 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
340 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
341 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
342 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
343 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
344 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
345 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
346 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
347 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
348 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
349 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
353 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
354 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
355 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
356 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
357 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
358 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
359 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
360 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
361 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
362 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
363 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
364 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
365 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
366 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
367 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
368 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
369 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
370 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
371 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
372 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
373 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
374 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
375 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
376 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
377 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
378 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
379 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
380 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
381 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
382 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
383 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
384 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
385 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
386 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
387 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
388 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
389 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
390 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
391 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
392 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
393 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
394 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
395 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
396 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
397 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
398 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
399 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
400 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
401 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
402 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
403 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
404 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
405 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
406 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
407 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
408 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
409 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
410 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
411 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
412 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
413 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
414 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
415 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
416 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
417 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
418 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
419 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
420 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
421 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
422 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
423 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
424 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
425 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
426 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
427 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
428 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
429 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
430 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
431 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
432 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
433 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
434 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
435 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
436 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
437 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
438 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
439 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
440 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.37
Metatranscriptomes 0.82
Isolates 4.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.51
Nodule 3.99
Rhizoplane 2
Rhizosphere 81.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207707_10015649 3300025912 Bacteria 6607
2 JGI25151J46595_10000581 3300003187 Bacteria 32575
3 JGI25153J46596_10038973 3300003215 Bacteria 1490
4 JGI25160J50197_1012997 3300003354 Bacteria 2858
5 Ga0055540_1006370 3300003792 Bacteria 4699
6 Ga0055531_10000205 3300003794 Bacteria 65042
7 Ga0070658_10027472 3300005327 Bacteria 4566
8 Ga0070658_10175458 3300005327 Bacteria 1802
9 Ga0070658_10202452 3300005327 Bacteria 1675
10 Ga0070676_10174605 3300005328 Bacteria 1393
11 Ga0070676_10195709 3300005328 Bacteria 1322
12 Ga0070683_100097755 3300005329 Bacteria 2762
13 Ga0070690_100000993 3300005330 Bacteria 14445
14 Ga0070670_100078478 3300005331 Bacteria 2836
15 Ga0070670_100144274 3300005331 Bacteria 2059
16 Ga0070670_100346042 3300005331 Bacteria 1305
17 Ga0070670_100392517 3300005331 Bacteria 1224
18 Ga0068869_100003070 3300005334 Bacteria 10160
19 Ga0068869_100598493 3300005334 Bacteria 931
20 Ga0070666_10143370 3300005335 Bacteria 1664
21 Ga0070680_100002437 3300005336 Bacteria 13786
22 Ga0070680_100004645 3300005336 Bacteria 10326
23 Ga0070680_100042488 3300005336 Bacteria 3689
24 Ga0070680_100095828 3300005336 Bacteria 2460
25 Ga0070680_100119264 3300005336 Bacteria 2201
26 Ga0070680_100202239 3300005336 Bacteria 1675
27 Ga0070680_100285920 3300005336 Bacteria 1397
28 Ga0068868_100157473 3300005338 Bacteria 1874
29 Ga0068868_100523523 3300005338 Bacteria 1041
30 Ga0070660_100025112 3300005339 Bacteria 4427
31 Ga0070689_100001070 3300005340 Bacteria 17145
32 Ga0070689_100162142 3300005340 Bacteria 1808
33 Ga0070691_10000198 3300005341 Bacteria 20173
34 Ga0070691_10004632 3300005341 Bacteria 6253
35 Ga0070691_10037021 3300005341 Bacteria 2301
36 Ga0070687_100013313 3300005343 Bacteria 3662
37 Ga0070687_100035769 3300005343 Bacteria 2469
38 Ga0070661_100041839 3300005344 Bacteria 3344
39 Ga0070692_10037720 3300005345 Bacteria 2459
40 Ga0070669_100146442 3300005353 Bacteria 1825
41 Ga0070669_100173512 3300005353 Bacteria 1682
42 Ga0070669_100333787 3300005353 Bacteria 1227
43 Ga0070669_100401929 3300005353 Bacteria 1121
44 Ga0070675_100041829 3300005354 Bacteria 3743
45 Ga0070675_100042464 3300005354 Bacteria 3715
46 Ga0070675_100085634 3300005354 Bacteria 2633
47 Ga0070675_100422423 3300005354 Bacteria 1192
48 Ga0070671_100106902 3300005355 Bacteria 2349
49 Ga0070671_100109547 3300005355 Bacteria 2319
50 Ga0070671_100302212 3300005355 Bacteria 1363
51 Ga0070671_100444094 3300005355 Bacteria 1112
52 Ga0070674_100014481 3300005356 Bacteria 4903
53 Ga0070674_100071836 3300005356 Bacteria 2449
54 Ga0070673_100034415 3300005364 Bacteria 3834
55 Ga0070673_100370303 3300005364 Bacteria 1275
56 Ga0070673_100392474 3300005364 Bacteria 1239
57 Ga0070688_100160284 3300005365 Bacteria 1545
58 Ga0070659_100006542 3300005366 Bacteria 8416
59 Ga0070659_100158175 3300005366 Bacteria 1852
60 Ga0070659_100251560 3300005366 Bacteria 1464
61 Ga0070667_100012504 3300005367 Bacteria 7021
62 Ga0070667_100217006 3300005367 Bacteria 1702
63 Ga0070667_100434216 3300005367 Bacteria 1198
64 Ga0070667_100587091 3300005367 Bacteria 1026
65 Ga0070667_100681990 3300005367 Bacteria 950
66 Ga0070713_100158783 3300005436 Bacteria 2017
67 Ga0070701_10000075 3300005438 Bacteria 27473
68 Ga0070701_10034226 3300005438 Bacteria 2544
69 Ga0070711_100275835 3300005439 Bacteria 1328
70 Ga0070705_100036943 3300005440 Bacteria 2751
71 Ga0070700_100002507 3300005441 Bacteria 9355
72 Ga0070700_100057706 3300005441 Bacteria 2436
73 Ga0070700_100071135 3300005441 Bacteria 2220
74 Ga0070694_100008159 3300005444 Bacteria 6394
75 Ga0070708_100046726 3300005445 Bacteria 3820
76 Ga0070678_100060116 3300005456 Bacteria 2796
77 Ga0070662_100051128 3300005457 Bacteria 2983
78 Ga0070662_100063540 3300005457 Bacteria 2701
79 Ga0070681_10002137 3300005458 Bacteria 17962
80 Ga0070681_10002558 3300005458 Bacteria 16700
81 Ga0070681_10008342 3300005458 Bacteria 10148
82 Ga0070681_10058698 3300005458 Bacteria 3827
83 Ga0070681_10074615 3300005458 Bacteria 3353
84 Ga0070681_10116369 3300005458 Bacteria 2610
85 Ga0070681_10200092 3300005458 Bacteria 1916
86 Ga0070681_10569941 3300005458 Bacteria 1046
87 Ga0070681_10573808 3300005458 Bacteria 1042
88 Ga0068867_100000421 3300005459 Bacteria 28313
89 Ga0068867_100051934 3300005459 Bacteria 3024
90 Ga0068867_100222300 3300005459 Bacteria 1522
91 Ga0070706_100238536 3300005467 Bacteria 1698
92 Ga0070707_100383652 3300005468 Bacteria 1365
93 Ga0070698_100003981 3300005471 Bacteria 16258
94 Ga0070698_100054255 3300005471 Bacteria 4070
95 Ga0070698_100083208 3300005471 Bacteria 3190
96 Ga0070698_100303624 3300005471 Bacteria 1527
97 Ga0070698_100841274 3300005471 Bacteria 862
98 Ga0070699_100284425 3300005518 Bacteria 1482
99 Ga0070679_100003954 3300005530 Bacteria 13644
100 Ga0070679_100004261 3300005530 Bacteria 13201
101 Ga0070679_100017188 3300005530 Bacteria 6997
102 Ga0070679_100064110 3300005530 Bacteria 3662
103 Ga0070679_100102619 3300005530 Bacteria 2846
104 Ga0070679_100137729 3300005530 Bacteria 2422
105 Ga0070679_100264409 3300005530 Bacteria 1675
106 Ga0070684_100042463 3300005535 Bacteria 3925
107 Ga0070684_100505133 3300005535 Bacteria 1120
108 Ga0070697_100020296 3300005536 Bacteria 5255
109 Ga0070697_100251570 3300005536 Bacteria 1511
110 Ga0068853_100001762 3300005539 Bacteria 15900
111 Ga0070672_100065877 3300005543 Bacteria 2866
112 Ga0070672_100333142 3300005543 Bacteria 1291
113 Ga0070686_100000270 3300005544 Bacteria 35461
114 Ga0070695_100056903 3300005545 Bacteria 2525
115 Ga0070695_100446254 3300005545 Bacteria 990
116 Ga0070696_100003294 3300005546 Bacteria 10777
117 Ga0070696_100233624 3300005546 Bacteria 1384
118 Ga0070693_100001571 3300005547 Bacteria 10296
119 Ga0070665_100002531 3300005548 Bacteria 20087
120 Ga0070665_100157564 3300005548 Bacteria 2272
121 Ga0070665_100549650 3300005548 Bacteria 1167
122 Ga0070704_100066824 3300005549 Bacteria 2594
123 Ga0070704_100114552 3300005549 Bacteria 2058
124 Ga0068855_100005088 3300005563 Bacteria 16031
125 Ga0068855_100022196 3300005563 Bacteria 7606
126 Ga0068855_100121708 3300005563 Bacteria 2986
127 Ga0068855_100340451 3300005563 Bacteria 1654
128 Ga0068855_100758550 3300005563 Bacteria 1034
129 Ga0068855_100768800 3300005563 Bacteria 1026
130 Ga0070664_100033863 3300005564 Bacteria 4283
131 Ga0068857_100006255 3300005577 Bacteria 10182
132 Ga0068857_100012178 3300005577 Bacteria 7481
133 Ga0068857_100118282 3300005577 Bacteria 2385
134 Ga0068857_100227096 3300005577 Bacteria 1706
135 Ga0068854_100026505 3300005578 Bacteria 3984
136 Ga0068854_100135020 3300005578 Bacteria 1888
137 Ga0068854_100136497 3300005578 Bacteria 1878
138 Ga0070702_100000370 3300005615 Bacteria 15791
139 Ga0070702_100046626 3300005615 Bacteria 2457
140 Ga0070702_100085227 3300005615 Bacteria 1902
141 Ga0068852_100009333 3300005616 Bacteria 7281
142 Ga0068852_100194976 3300005616 Bacteria 1913
143 Ga0068859_100008372 3300005617 Bacteria 10482
144 Ga0068859_100016233 3300005617 Bacteria 7481
145 Ga0068859_100226524 3300005617 Bacteria 1957
146 Ga0068859_100281175 3300005617 Bacteria 1757
147 Ga0068859_100355715 3300005617 Bacteria 1559
148 Ga0068859_100534335 3300005617 Bacteria 1267
149 Ga0068859_100750577 3300005617 Bacteria 1065
150 Ga0068864_100109023 3300005618 Bacteria 2464
151 Ga0068866_10000249 3300005718 Bacteria 25399
152 Ga0068866_10026604 3300005718 Bacteria 2734
153 Ga0068861_100005107 3300005719 Bacteria 8849
154 Ga0068861_100459377 3300005719 Bacteria 1143
155 Ga0068851_10028875 3300005834 Bacteria 2742
156 Ga0068863_100136353 3300005841 Bacteria 2345
157 Ga0068858_100010505 3300005842 Bacteria 8771
158 Ga0068858_100243912 3300005842 Bacteria 1705
159 Ga0068858_100359363 3300005842 Bacteria 1396
160 Ga0068860_100309804 3300005843 Bacteria 1548
161 Ga0068860_100343963 3300005843 Bacteria 1467
162 Ga0068860_100750349 3300005843 Bacteria 988
163 Ga0068862_100001761 3300005844 Bacteria 19572
164 Ga0068862_100055175 3300005844 Bacteria 3403
165 Ga0068862_100107662 3300005844 Bacteria 2444
166 Ga0081455_10003323 3300005937 Bacteria 18577
167 Ga0081455_10006621 3300005937 Bacteria 12395
168 Ga0081455_10009487 3300005937 Bacteria 10005
169 Ga0081455_10400814 3300005937 Bacteria 952
170 Ga0081538_10016756 3300005981 Bacteria 5601
171 Ga0081538_10121911 3300005981 Bacteria 1250
172 Ga0081539_10004821 3300005985 Bacteria 14466
173 Ga0081539_10132688 3300005985 Bacteria 1221
174 Ga0070717_10015233 3300006028 Bacteria 5933
175 Ga0070717_10228163 3300006028 Bacteria 1639
176 Ga0070717_10519149 3300006028 Bacteria 1077
177 Ga0075365_10025403 3300006038 Bacteria 3749
178 Ga0075365_10039511 3300006038 Bacteria 3073
179 Ga0075365_10202862 3300006038 Bacteria 1389
180 Ga0075363_100053182 3300006048 Bacteria 2163
181 Ga0070716_100164613 3300006173 Bacteria 1441
182 Ga0070712_100004370 3300006175 Bacteria 8719
183 Ga0070712_100007601 3300006175 Bacteria 6773
184 Ga0075362_10003442 3300006177 Bacteria 5529
185 Ga0075362_10019652 3300006177 Bacteria 2812
186 Ga0075362_10067503 3300006177 Bacteria 1627
187 Ga0075367_10116215 3300006178 Bacteria 1645
188 Ga0075369_10006384 3300006186 Bacteria 4456
189 Ga0075369_10012486 3300006186 Bacteria 3357
190 Ga0075369_10038635 3300006186 Bacteria 2037
191 Ga0075366_10059945 3300006195 Bacteria 2261
192 Ga0075366_10076888 3300006195 Bacteria 1992
193 Ga0097621_100001920 3300006237 Bacteria 14203
194 Ga0097621_100192732 3300006237 Bacteria 1766
195 Ga0097621_100221057 3300006237 Bacteria 1650
196 Ga0075370_10009458 3300006353 Bacteria 5063
197 Ga0075370_10101359 3300006353 Bacteria 1666
198 Ga0068871_100012239 3300006358 Bacteria 6318
199 Ga0068871_100074754 3300006358 Bacteria 2796
200 Ga0075431_100006873 3300006847 Bacteria 11303
201 Ga0068865_100009147 3300006881 Bacteria 6132
202 Ga0097620_100008372 3300006931 Bacteria 10482
203 Ga0097620_100016233 3300006931 Bacteria 7481
204 Ga0097620_100226515 3300006931 Bacteria 1957
205 Ga0097620_100281175 3300006931 Bacteria 1757
206 Ga0097620_100355724 3300006931 Bacteria 1559
207 Ga0097620_100534359 3300006931 Bacteria 1267
208 Ga0097620_100750554 3300006931 Bacteria 1065
209 Ga0099795_10052608 3300007788 Bacteria 1488
210 Ga0105240_10031426 3300009093 Bacteria 6886
211 Ga0105240_10075931 3300009093 Bacteria 4144
212 Ga0105240_10609131 3300009093 Bacteria 1201
213 Ga0105240_10696607 3300009093 Bacteria 1109
214 Ga0111539_10000450 3300009094 Bacteria 51598
215 Ga0111539_10055725 3300009094 Bacteria 4700
216 Ga0111539_10188308 3300009094 Bacteria 2409
217 Ga0111539_10687992 3300009094 Bacteria 1190
218 Ga0105245_10001133 3300009098 Bacteria 24100
219 Ga0114129_10204573 3300009147 Bacteria 2672
220 Ga0105243_10000923 3300009148 Bacteria 27536
221 Ga0105243_10130178 3300009148 Bacteria 2134
222 Ga0105242_10316141 3300009176 Bacteria 1431
223 Ga0105248_10031448 3300009177 Bacteria 5933
224 Ga0105248_10117808 3300009177 Bacteria 2995
225 Ga0105248_10182969 3300009177 Bacteria 2361
226 Ga0105248_10663696 3300009177 Bacteria 1176
227 Ga0105237_10017697 3300009545 Bacteria 7387
228 Ga0105237_10035864 3300009545 Bacteria 5017
229 Ga0105238_10008348 3300009551 Bacteria 10362
230 Ga0105238_10063704 3300009551 Bacteria 3687
231 Ga0105239_10006145 3300010375 Bacteria 13970
232 Ga0157373_10114880 3300013100 Bacteria 1893
233 Ga0157371_10198788 3300013102 Bacteria 1437
234 Ga0157370_10003797 3300013104 Bacteria 17620
235 Ga0157370_10005023 3300013104 Bacteria 14942
236 Ga0157370_10040954 3300013104 Bacteria 4471
237 Ga0157370_10200945 3300013104 Bacteria 1849
238 Ga0157369_10855325 3300013105 Bacteria 933
239 Ga0157374_10102692 3300013296 Bacteria 2742
240 Ga0157378_10001174 3300013297 Bacteria 23845
241 Ga0157378_10016742 3300013297 Bacteria 6423
242 Ga0157378_10095994 3300013297 Bacteria 2701
243 Ga0157378_10684767 3300013297 Bacteria 1043
244 Ga0163162_10098077 3300013306 Bacteria 3020
245 Ga0157372_10031749 3300013307 Bacteria 5786
246 Ga0157372_10168950 3300013307 Bacteria 2530
247 Ga0157372_10181499 3300013307 Bacteria 2436
248 Ga0157372_10189287 3300013307 Bacteria 2383
249 Ga0157372_10253999 3300013307 Bacteria 2041
250 Ga0157375_10039302 3300013308 Bacteria 4553
251 Ga0157375_10076567 3300013308 Bacteria 3373
252 Ga0157375_10077872 3300013308 Bacteria 3347
253 Ga0157375_10633727 3300013308 Bacteria 1226
254 Ga0157375_10689949 3300013308 Bacteria 1175
255 Ga0163163_10288025 3300014325 Bacteria 1694
256 Ga0157380_10402116 3300014326 Bacteria 1300
257 Ga0182008_10115008 3300014497 Bacteria 1334
258 Ga0157379_10223278 3300014968 Bacteria 1707
259 Ga0157376_10161777 3300014969 Bacteria 2030
260 Ga0157376_10219194 3300014969 Bacteria 1761
261 Ga0157376_10335831 3300014969 Bacteria 1441
262 Ga0163161_10142354 3300017792 Bacteria 1816
263 Ga0163161_10193103 3300017792 Bacteria 1566
264 Ga0197907_10899973 3300020069 Bacteria 1591
265 Ga0206356_10239614 3300020070 Bacteria 2194
266 Ga0206350_10974906 3300020080 Bacteria 1387
267 Ga0206353_10048251 3300020082 Bacteria 1325
268 Ga0206353_10327856 3300020082 Bacteria 1446
269 Ga0213872_10028776 3300021361 Bacteria 2548
270 Ga0213874_10043831 3300021377 Bacteria 1349
271 Ga0213876_10001938 3300021384 Bacteria 12409
272 Ga0213876_10237830 3300021384 Bacteria 968
273 Ga0213875_10008711 3300021388 Bacteria 5177
274 Ga0213875_10148721 3300021388 Bacteria 1097
275 Ga0213871_10002128 3300021441 Bacteria 3572
276 Ga0213871_10016836 3300021441 Bacteria 1768
277 Ga0224712_10046689 3300022467 Bacteria 1663
278 Ga0224712_10197279 3300022467 Bacteria 914
279 Ga0209148_1000268 3300025254 Bacteria 81728
280 Ga0209455_1001518 3300025272 Bacteria 10379
281 Ga0209673_1050415 3300025273 Bacteria 1106
282 Ga0209130_1000502 3300025284 Bacteria 39793
283 Ga0209130_1010355 3300025284 Bacteria 2574
284 Ga0209025_1000077 3300025294 Bacteria 271958
285 Ga0207426_1000576 3300025302 Bacteria 49162
286 Ga0207426_1014765 3300025302 Bacteria 2855
287 Ga0209051_1000310 3300025303 Bacteria 76181
288 Ga0209257_1000165 3300025304 Bacteria 172773
289 Ga0207656_10026144 3300025321 Bacteria 2376
290 Ga0207682_10002243 3300025893 Bacteria 8727
291 Ga0207642_10003143 3300025899 Bacteria 5178
292 Ga0207680_10019191 3300025903 Bacteria 3652
293 Ga0207680_10032431 3300025903 Bacteria 2970
294 Ga0207680_10052566 3300025903 Bacteria 2442
295 Ga0207685_10218323 3300025905 Bacteria 905
296 Ga0207699_10053259 3300025906 Bacteria 2398
297 Ga0207699_10078691 3300025906 Bacteria 2037
298 Ga0207699_10080514 3300025906 Bacteria 2018
299 Ga0207699_10437270 3300025906 Bacteria 937
300 Ga0207705_10000714 3300025909 Bacteria 27406
301 Ga0207705_10003763 3300025909 Bacteria 11556
302 Ga0207705_10326461 3300025909 Bacteria 1180
303 Ga0207684_10149915 3300025910 Bacteria 2006
304 Ga0207707_10001526 3300025912 Bacteria 21370
305 Ga0207707_10002213 3300025912 Bacteria 17582
306 Ga0207707_10016341 3300025912 Bacteria 6474
307 Ga0207707_10027081 3300025912 Bacteria 5011
308 Ga0207707_10049872 3300025912 Bacteria 3647
309 Ga0207707_10093743 3300025912 Bacteria 2623
310 Ga0207707_10417354 3300025912 Bacteria 1151
311 Ga0207707_10573626 3300025912 Bacteria 957
312 Ga0207707_10638402 3300025912 Bacteria 898
313 Ga0207695_10014722 3300025913 Bacteria 9249
314 Ga0207695_10306311 3300025913 Bacteria 1479
315 Ga0207695_10332057 3300025913 Bacteria 1409
316 Ga0207693_10003170 3300025915 Bacteria 14130
317 Ga0207693_10019311 3300025915 Bacteria 5423
318 Ga0207693_10070608 3300025915 Bacteria 2733
319 Ga0207660_10001236 3300025917 Bacteria 17105
320 Ga0207660_10007598 3300025917 Bacteria 7015
321 Ga0207660_10038214 3300025917 Bacteria 3350
322 Ga0207660_10082014 3300025917 Bacteria 2371
323 Ga0207660_10096220 3300025917 Bacteria 2204
324 Ga0207662_10027376 3300025918 Bacteria 3290
325 Ga0207657_10000554 3300025919 Bacteria 39853
326 Ga0207657_10152751 3300025919 Bacteria 1879
327 Ga0207657_10482859 3300025919 Bacteria 971
328 Ga0207652_10002084 3300025921 Bacteria 17192
329 Ga0207652_10002621 3300025921 Bacteria 15104
330 Ga0207652_10081935 3300025921 Bacteria 2823
331 Ga0207652_10358883 3300025921 Bacteria 1315
332 Ga0207652_10471214 3300025921 Bacteria 1131
333 Ga0207646_10031412 3300025922 Bacteria 4808
334 Ga0207646_10542279 3300025922 Bacteria 1046
335 Ga0207681_10147730 3300025923 Bacteria 1758
336 Ga0207681_10296968 3300025923 Bacteria 1277
337 Ga0207694_10008861 3300025924 Bacteria 7590
338 Ga0207694_10043329 3300025924 Bacteria 3473
339 Ga0207694_10482601 3300025924 Bacteria 1037
340 Ga0207650_10054109 3300025925 Bacteria 2976
341 Ga0207650_10151267 3300025925 Bacteria 1832
342 Ga0207650_10301960 3300025925 Bacteria 1308
343 Ga0207650_10458776 3300025925 Bacteria 1061
344 Ga0207659_10004576 3300025926 Bacteria 8364
345 Ga0207659_10009302 3300025926 Bacteria 6136
346 Ga0207659_10039743 3300025926 Bacteria 3284
347 Ga0207659_10415904 3300025926 Bacteria 1127
348 Ga0207687_10001219 3300025927 Bacteria 17600
349 Ga0207687_10434099 3300025927 Bacteria 1086
350 Ga0207687_10560973 3300025927 Bacteria 959
351 Ga0207700_10028357 3300025928 Bacteria 3935
352 Ga0207700_10158135 3300025928 Bacteria 1880
353 Ga0207700_10727687 3300025928 Bacteria 886
354 Ga0207664_10069875 3300025929 Bacteria 2824
355 Ga0207644_10059554 3300025931 Bacteria 2762
356 Ga0207644_10115785 3300025931 Bacteria 2033
357 Ga0207644_10325039 3300025931 Bacteria 1244
358 Ga0207690_10009385 3300025932 Bacteria 5810
359 Ga0207690_10072916 3300025932 Bacteria 2372
360 Ga0207706_10113911 3300025933 Bacteria 2379
361 Ga0207686_10137112 3300025934 Bacteria 1686
362 Ga0207709_10011909 3300025935 Bacteria 4796
363 Ga0207670_10605820 3300025936 Bacteria 900
364 Ga0207669_10153820 3300025937 Bacteria 1615
365 Ga0207669_10209518 3300025937 Bacteria 1421
366 Ga0207704_10001122 3300025938 Bacteria 11913
367 Ga0207665_10153884 3300025939 Bacteria 1649
368 Ga0207691_10002172 3300025940 Bacteria 19178
369 Ga0207691_10026903 3300025940 Bacteria 5397
370 Ga0207691_10082777 3300025940 Bacteria 2882
371 Ga0207711_10131630 3300025941 Bacteria 2243
372 Ga0207689_10001864 3300025942 Bacteria 19957
373 Ga0207689_10029957 3300025942 Bacteria 4538
374 Ga0207689_10230450 3300025942 Bacteria 1531
375 Ga0207689_10326940 3300025942 Bacteria 1273
376 Ga0207661_10557089 3300025944 Bacteria 1050
377 Ga0207679_10059987 3300025945 Bacteria 2824
378 Ga0207667_10014788 3300025949 Bacteria 8879
379 Ga0207667_10034440 3300025949 Bacteria 5437
380 Ga0207667_10106521 3300025949 Bacteria 2892
381 Ga0207651_10400543 3300025960 Bacteria 1167
382 Ga0207668_10243654 3300025972 Bacteria 1456
383 Ga0207668_10381495 3300025972 Bacteria 1187
384 Ga0207640_10051216 3300025981 Bacteria 2683
385 Ga0207640_10232307 3300025981 Bacteria 1420
386 Ga0207640_10333769 3300025981 Bacteria 1212
387 Ga0207658_10064281 3300025986 Bacteria 2752
388 Ga0207658_10317673 3300025986 Bacteria 1347
389 Ga0207658_10583269 3300025986 Bacteria 1003
390 Ga0207677_10642135 3300026023 Bacteria 936
391 Ga0207703_10026898 3300026035 Bacteria 4530
392 Ga0207703_10074623 3300026035 Bacteria 2809
393 Ga0207703_10136939 3300026035 Bacteria 2120
394 Ga0207703_10157254 3300026035 Bacteria 1987
395 Ga0207639_10002688 3300026041 Bacteria 11930
396 Ga0207639_10370068 3300026041 Bacteria 1285
397 Ga0207639_10534975 3300026041 Bacteria 1074
398 Ga0207708_10005526 3300026075 Bacteria 9326
399 Ga0207708_10007313 3300026075 Bacteria 8162
400 Ga0207708_10095815 3300026075 Bacteria 2292
401 Ga0207708_10184778 3300026075 Bacteria 1656
402 Ga0207702_10090140 3300026078 Bacteria 2683
403 Ga0207702_10390982 3300026078 Bacteria 1339
404 Ga0207641_10229358 3300026088 Bacteria 1725
405 Ga0207648_10030105 3300026089 Bacteria 4811
406 Ga0207648_10067938 3300026089 Bacteria 3106
407 Ga0207676_10145747 3300026095 Bacteria 2033
408 Ga0207676_10372504 3300026095 Bacteria 1327
409 Ga0207674_10026028 3300026116 Bacteria 6225
410 Ga0207674_10027483 3300026116 Bacteria 6017
411 Ga0207674_10032578 3300026116 Bacteria 5465
412 Ga0207674_10136898 3300026116 Bacteria 2410
413 Ga0207674_10342544 3300026116 Bacteria 1445
414 Ga0207675_100000234 3300026118 Bacteria 52634
415 Ga0207675_100043375 3300026118 Bacteria 4200
416 Ga0207683_10000189 3300026121 Bacteria 52818
417 Ga0207683_10010770 3300026121 Bacteria 7797
418 Ga0207683_10446670 3300026121 Bacteria 1192
419 Ga0207698_10059368 3300026142 Bacteria 2970
420 Ga0207698_10110170 3300026142 Bacteria 2305
421 Ga0209969_1000495 3300027360 Bacteria 5283
422 Ga0209967_1002629 3300027364 Bacteria 2337
423 Ga0209984_1014159 3300027424 Bacteria 1051
424 Ga0210000_1006363 3300027462 Bacteria 1719
425 Ga0209995_1002913 3300027471 Bacteria 2714
426 Ga0209999_1001275 3300027543 Bacteria 4327
427 Ga0209970_1015123 3300027614 Bacteria 1283
428 Ga0209813_10059801 3300027866 Bacteria 1214
429 Ga0209974_10002954 3300027876 Bacteria 6172
430 Ga0207428_10000169 3300027907 Bacteria 90667
431 Ga0207428_10221092 3300027907 Bacteria 1419
432 Ga0268266_10103680 3300028379 Bacteria 2510
433 Ga0268266_10847951 3300028379 Bacteria 883
434 Ga0268265_10334580 3300028380 Bacteria 1376
435 Ga0268265_10359675 3300028380 Bacteria 1332
436 Ga0268264_10263045 3300028381 Bacteria 1608
437 Ga0268264_10358454 3300028381 Bacteria 1390
438 Ga0268264_10423092 3300028381 Bacteria 1285
439 Ga0265326_10046553 3300028558 Bacteria 1230
440 Ga0265338_10230119 3300028800 Bacteria 1379
441 Ga0265338_10255007 3300028800 Bacteria 1292
442 Ga0307511_10018066 3300030521 Bacteria 6748
443 Ga0265330_10035395 3300031235 Bacteria 2228
444 Ga0265332_10008217 3300031238 Bacteria 4692
445 Ga0265332_10065391 3300031238 Bacteria 1553
446 Ga0265328_10003968 3300031239 Bacteria 6505
447 Ga0265329_10022657 3300031242 Bacteria 2099
448 Ga0265340_10095182 3300031247 Bacteria 1389
449 Ga0265331_10005807 3300031250 Bacteria 7394
450 Ga0265331_10015988 3300031250 Bacteria 3948
451 Ga0265327_10022910 3300031251 Bacteria 3715
452 Ga0265316_10235168 3300031344 Bacteria 1348
453 Ga0307408_100074379 3300031548 Bacteria 2521
454 Ga0265313_10019402 3300031595 Bacteria 3784
455 Ga0316575_10029533 3300031665 Bacteria 2141
456 Ga0265314_10001600 3300031711 Bacteria 24910
457 Ga0265342_10037861 3300031712 Bacteria 2939
458 Ga0307409_100472922 3300031995 Bacteria 1214
459 Ga0307416_100161965 3300032002 Bacteria 2069
460 Ga0307416_100224851 3300032002 Bacteria 1804
461 Ga0307414_10107183 3300032004 Bacteria 2117
462 Ga0307411_10266792 3300032005 Bacteria 1355
463 Ga0307510_10005450 3300033180 Bacteria 15156
464 Ga0373926_0006701 3300035083 Bacteria 3825
465 Ga0373926_0035404 3300035083 Bacteria 1771
466 Ga0373926_0083093 3300035083 Bacteria 1186
467 Ga0373923_0028341 3300035111 Bacteria 2240
468 Ga0373923_0076139 3300035111 Bacteria 1448
469 Ga0373932_0062101 3300035112 Bacteria 1138
470 Ga0373932_0119650 3300035112 Bacteria 877
471 Ga0373953_0002942 3300035117 Bacteria 5205
472 Ga0373954_0005019 3300035118 Bacteria 5712
473 Ga0373957_0026824 3300035120 Bacteria 2087
474 Ga0373946_0020214 3300035171 Bacteria 2572
475 Ga0373955_0025284 3300035172 Bacteria 3047
476 Ga0373961_0000005 3300035241 Bacteria 146538
477 Ga0373924_0067809 3300035410 Bacteria 1501
478 Ga0373931_0210651 3300035691 Bacteria 1165
479 Ga0373935_0090574 3300035692 Bacteria 2002
480 Ga0373935_0147227 3300035692 Bacteria 1595
481 Ga0373927_0090614 3300035695 Bacteria 1986
482 Ga0373927_0092990 3300035695 Bacteria 1959
483 Ga0373927_0114880 3300035695 Bacteria 1755
484 Ga0373933_0010069 3300035724 Bacteria 5175
485 Ga0373933_0038465 3300035724 Bacteria 2810
486 Ga0373933_0175211 3300035724 Bacteria 1366
487 Ga0373947_0032416 3300035725 Bacteria 3079
488 Ga0373937_0036511 3300036401 Bacteria 4478
489 Ga0373937_0037501 3300036401 Bacteria 4417
490 Ga0373937_0049639 3300036401 Bacteria 3842
491 Ga0373937_0057104 3300036401 Bacteria 3585
492 Ga0373937_0129683 3300036401 Bacteria 2355
493 Ga0373937_0377201 3300036401 Bacteria 1345
494 Ga0373937_0647004 3300036401 Bacteria 1002
495 Ga0316582_0265613 3300036647 Bacteria 1177
496 Ga0373925_0008070 3300037068 Bacteria 7669
497 Ga0373925_0038518 3300037068 Bacteria 3535
498 Ga0395899_0026633 3300037312 Bacteria 4362
499 Ga0395899_0266641 3300037312 Bacteria 1169
500 Ga0395900_0001993 3300037418 Bacteria 23054
501 Ga0395900_0013646 3300037418 Bacteria 8294
502 Ga0395900_0431173 3300037418 Bacteria 1277
503 Ga0395900_0638852 3300037418 Bacteria 1002
504 Ga0395898_0003319 3300037466 Bacteria 18072
505 Ga0395898_0047599 3300037466 Bacteria 4207
506 Ga0395905_0000043 3300037471 Bacteria 247469
507 Ga0395905_0004055 3300037471 Bacteria 15358
508 Ga0436364_0749911 3300037853 Bacteria 1993
509 Ga0436364_0891296 3300037853 Bacteria 1856
510 Ga0436364_1360422 3300037853 Bacteria 15324
511 Ga0395901_0024450 3300038443 Bacteria 6200
512 Ga0395901_0231803 3300038443 Bacteria 1927
513 Ga0395901_0381012 3300038443 Bacteria 1451
514 Ga0400483_220694 3300039062 Bacteria 6582
515 Ga0436365_0065739 3300039437 Bacteria 19976
516 Ga0436365_0202658 3300039437 Bacteria 4473
517 Ga0436365_0801734 3300039437 Bacteria 1199
518 Ga0436365_1116753 3300039437 Bacteria 5499
519 Ga0436360_0375286 3300039438 Bacteria 2491
520 Ga0436360_0401373 3300039438 Bacteria 6508
521 Ga0436360_0569429 3300039438 Bacteria 1127
522 Ga0436360_0675016 3300039438 Bacteria 2684
523 Ga0436360_0696399 3300039438 Bacteria 19859
524 Ga0436360_0734197 3300039438 Bacteria 1476
525 Ga0436360_0871428 3300039438 Bacteria 3201
526 Ga0436360_1220716 3300039438 Bacteria 3658
527 Ga0436361_0320193 3300039447 Bacteria 6759
528 Ga0436361_0446953 3300039447 Bacteria 4784
529 Ga0436361_0522153 3300039447 Bacteria 6431
530 Ga0436361_1150595 3300039447 Bacteria 1644
531 Ga0436361_1170458 3300039447 Bacteria 14146
532 Ga0436363_0199441 3300039450 Bacteria 3442
533 Ga0436363_1076006 3300039450 Bacteria 4620
534 Ga0436362_0666097 3300039453 Bacteria 1104
535 Ga0436362_1262338 3300039453 Bacteria 2015
536 Ga0439431_0018837 3300041997 Bacteria 1637
537 Ga0439446_0112096 3300042156 Bacteria 871
538 Ga0439435_0070844 3300042436 Bacteria 1032
539 Ga0450893_0003697 3300042532 Bacteria 2419
540 Ga0451577_0276173 3300042876 Bacteria 1522
541 Ga0451577_0340420 3300042876 Bacteria 1360
542 Ga0451577_0509393 3300042876 Bacteria 1093
543 Ga0453684_0582146 3300044712 Bacteria 1229
544 Ga0466957_0024982 3300044842 Bacteria 3539
545 Ga0451576_0001697 3300045051 Bacteria 36405
546 Ga0451576_0580753 3300045051 Bacteria 1178
547 Ga0466967_0324809 3300045976 Bacteria 1485
548 Ga0466967_0649096 3300045976 Bacteria 1043
549 Ga0495592_0089761 3300046454 Bacteria 2206
550 Ga0495592_0176632 3300046454 Bacteria 1458
551 Ga0495603_0128503 3300046455 Bacteria 1476
552 Ga0495591_025637 3300046458 Bacteria 1846
553 Ga0495638_0000635 3300046460 Bacteria 38563
554 Ga0495638_0002699 3300046460 Bacteria 14280
555 Ga0495641_0044532 3300046461 Bacteria 2046
556 Ga0495653_0092015 3300046463 Bacteria 2215
557 Ga0495650_0033642 3300046471 Bacteria 2279
558 Ga0495580_0038311 3300046472 Bacteria 3434
559 Ga0495580_0347028 3300046472 Bacteria 1006
560 Ga0495605_0000862 3300046474 Bacteria 21029
561 Ga0495639_0013338 3300046475 Bacteria 3547
562 Ga0495662_0018435 3300046476 Bacteria 3378
563 Ga0495664_0024843 3300046477 Bacteria 3484
564 Ga0495585_0020821 3300046492 Bacteria 3769
565 Ga0495585_0042471 3300046492 Bacteria 2546
566 Ga0495607_0024538 3300046501 Bacteria 3758
567 Ga0495608_0025250 3300046511 Bacteria 4055
568 Ga0495610_0035969 3300046512 Bacteria 2536
569 Ga0495610_0066217 3300046512 Bacteria 1702
570 Ga0495628_0016038 3300046516 Bacteria 6251
571 Ga0495630_0025383 3300046517 Bacteria 4381
572 Ga0495631_0079937 3300046518 Bacteria 1411
573 Ga0495644_0040755 3300046523 Bacteria 1750
574 Ga0495666_0014543 3300046526 Bacteria 3919
575 Ga0495642_0061605 3300046528 Bacteria 1557
576 Ga0495652_0085979 3300046529 Bacteria 2583
577 Ga0495640_0021018 3300046533 Bacteria 4797
578 Ga0495586_0099910 3300046535 Bacteria 1609
579 Ga0495586_0316325 3300046535 Bacteria 895
580 Ga0495587_0013952 3300046536 Bacteria 5045
581 Ga0495598_0031141 3300046537 Bacteria 1499
582 Ga0495609_0118166 3300046538 Bacteria 1141
583 Ga0495633_0110249 3300046558 Bacteria 1276
584 Ga0495667_0038220 3300046559 Bacteria 3196
585 Ga0495667_0079428 3300046559 Bacteria 2133
586 Ga0495668_0056547 3300046616 Bacteria 2165
587 Ga0495634_0016612 3300046642 Bacteria 5260
588 Ga0495635_0063453 3300046663 Bacteria 2537
589 Ga0495635_0089090 3300046663 Bacteria 2111
590 Ga0495661_0077924 3300046665 Bacteria 1919
591 Ga0495661_0113524 3300046665 Bacteria 1507
592 Ga0495657_0004212 3300046675 Bacteria 11512
593 Ga0495599_0005873 3300046678 Bacteria 7373
594 Ga0495599_0047278 3300046678 Bacteria 2697
595 Ga0495647_0012203 3300046681 Bacteria 2956
596 Ga0495658_0045710 3300046683 Bacteria 2458
597 Ga0495658_0070327 3300046683 Bacteria 2030
598 Ga0495669_0001975 3300046684 Bacteria 8418
599 Ga0495670_0001012 3300046691 Bacteria 13669
600 Ga0495589_0000736 3300046794 Bacteria 21110
601 Ga0495600_0037442 3300046809 Bacteria 3153
602 Ga0495600_0052340 3300046809 Bacteria 2666
603 Ga0495680_0109312 3300047322 Bacteria 2050
604 Ga0495675_0003519 3300047444 Bacteria 9440
605 Ga0495679_049887 3300047446 Bacteria 1261
606 Ga0496100_0051897 3300048903 Bacteria 2664
607 Ga0496102_0028584 3300048905 Bacteria 4981
608 Ga0496102_0203346 3300048905 Bacteria 1867
609 Ga0496103_0005688 3300048906 Bacteria 7450
610 Ga0496103_0152077 3300048906 Bacteria 1482
611 Ga0496104_0005443 3300048907 Bacteria 11145
612 Ga0496104_0174928 3300048907 Bacteria 2057
613 Ga0496106_0047743 3300048909 Bacteria 3223
614 Ga0496107_0013654 3300048910 Bacteria 5678
615 Ga0496108_0011478 3300048911 Bacteria 7201
616 Ga0496109_0561951 3300048912 Bacteria 1076
617 Ga0496110_0015076 3300048913 Bacteria 6427
618 Ga0496110_0209542 3300048913 Bacteria 1772
619 Ga0496111_0022762 3300048914 Bacteria 4391
620 Ga0496113_0448431 3300048916 Bacteria 1037
621 Ga0496113_0460851 3300048916 Bacteria 1021
622 Ga0496114_0257357 3300048917 Bacteria 1536
623 Ga0496119_0052118 3300048922 Bacteria 2509
624 Ga0496119_0104002 3300048922 Bacteria 1589
625 Ga0496120_0045785 3300048923 Bacteria 2532
626 Ga0496121_0053116 3300048924 Bacteria 3396
627 Ga0496121_0193569 3300048924 Bacteria 1456
628 Ga0496126_0113234 3300048929 Bacteria 2362
629 Ga0501031_0119705 3300049568 Bacteria 1720
630 Ga0501032_0199530 3300049569 Bacteria 1306
631 Ga0501032_0250360 3300049569 Bacteria 1150
632 Ga0501033_0224465 3300049570 Bacteria 1336
633 Ga0501034_0002928 3300049571 Bacteria 19795
634 Ga0501034_0044434 3300049571 Bacteria 4494
635 Ga0501034_0411371 3300049571 Bacteria 1275
636 Ga0501034_0656926 3300049571 Bacteria 950
637 Ga0501036_0088895 3300049572 Bacteria 2610
638 Ga0501036_0093961 3300049572 Bacteria 2534
639 Ga0501036_0123251 3300049572 Bacteria 2189
640 Ga0501036_0421246 3300049572 Bacteria 1113
641 Ga0501037_0032710 3300049573 Bacteria 3842
642 Ga0501037_0089750 3300049573 Bacteria 2224
643 Ga0501037_0107131 3300049573 Bacteria 2014
644 Ga0501037_0160141 3300049573 Bacteria 1605
645 Ga0501037_0190844 3300049573 Bacteria 1451
646 Ga0501038_0043380 3300049574 Bacteria 3911
647 Ga0501038_0077112 3300049574 Bacteria 2814
648 Ga0501038_0233394 3300049574 Bacteria 1463
649 Ga0501039_0002641 3300049575 Bacteria 13393
650 Ga0501039_0014487 3300049575 Bacteria 6037
651 Ga0501039_0069442 3300049575 Bacteria 2736
652 Ga0501039_0262018 3300049575 Bacteria 1359
653 Ga0501040_0015316 3300049576 Bacteria 5070
654 Ga0501040_0020278 3300049576 Bacteria 4430
655 Ga0501040_0315472 3300049576 Bacteria 1118
656 Ga0501041_0002700 3300049577 Bacteria 10122
657 Ga0501041_0005228 3300049577 Bacteria 7580
658 Ga0501041_0014311 3300049577 Bacteria 4709
659 Ga0501041_0024556 3300049577 Bacteria 3619
660 Ga0501042_0010930 3300049578 Bacteria 6112
661 Ga0501042_0048508 3300049578 Bacteria 3028
662 Ga0501042_0095921 3300049578 Bacteria 2131
663 Ga0501043_0028245 3300049579 Bacteria 4403
664 Ga0501043_0187052 3300049579 Bacteria 1612
665 Ga0501043_0496979 3300049579 Bacteria 912
666 Ga0501046_0023006 3300049580 Bacteria 5131
667 Ga0501046_0083389 3300049580 Bacteria 2468
668 Ga0501046_0111591 3300049580 Bacteria 2088
669 Ga0501046_0374667 3300049580 Bacteria 1031
670 Ga0501047_0051548 3300049581 Bacteria 3977
671 Ga0501047_0167250 3300049581 Bacteria 2069
672 Ga0501047_0367260 3300049581 Bacteria 1274
673 Ga0501048_0006462 3300049582 Bacteria 8910
674 Ga0501048_0083437 3300049582 Bacteria 2253
675 Ga0501048_0210730 3300049582 Bacteria 1378
676 Ga0501067_0035467 3300049583 Bacteria 2769
677 Ga0501068_0188600 3300049584 Bacteria 1305
678 Ga0501069_0121219 3300049585 Bacteria 1494
679 Ga0501070_0000033 3300049586 Bacteria 128626
680 Ga0501070_0127126 3300049586 Bacteria 2106
681 Ga0501070_0172523 3300049586 Bacteria 1781
682 Ga0501070_0407750 3300049586 Bacteria 1099
683 Ga0501071_0003718 3300049587 Bacteria 9582
684 Ga0501071_0021107 3300049587 Bacteria 4535
685 Ga0501071_0047761 3300049587 Bacteria 3075
686 Ga0501072_0003456 3300049588 Bacteria 11901
687 Ga0501072_0030407 3300049588 Bacteria 4223
688 Ga0501072_0043434 3300049588 Bacteria 3532
689 Ga0501072_0060051 3300049588 Bacteria 2998
690 Ga0501073_0039675 3300049589 Bacteria 3334
691 Ga0501073_0048482 3300049589 Bacteria 2981
692 Ga0501073_0286798 3300049589 Bacteria 1136
693 Ga0501073_0362019 3300049589 Bacteria 1002
694 Ga0501073_0484753 3300049589 Bacteria 855
695 Ga0501074_0039505 3300049590 Bacteria 3418
696 Ga0501075_0009891 3300049591 Bacteria 6683
697 Ga0501075_0053365 3300049591 Bacteria 3040
698 Ga0501075_0187531 3300049591 Bacteria 1577
699 Ga0501076_0006358 3300049592 Bacteria 8565
700 Ga0501076_0008071 3300049592 Bacteria 7693
701 Ga0501076_0018226 3300049592 Bacteria 5348
702 Ga0501076_0035381 3300049592 Bacteria 3908
703 Ga0501077_0008361 3300049593 Bacteria 6407
704 Ga0501077_0034366 3300049593 Bacteria 3227
705 Ga0501077_0090319 3300049593 Bacteria 1941
706 Ga0501077_0235766 3300049593 Bacteria 1163
707 Ga0501079_0006027 3300049741 Bacteria 9082
708 Ga0501079_0007033 3300049741 Bacteria 8489
709 Ga0501079_0011467 3300049741 Bacteria 6766
710 Ga0501080_0003821 3300049742 Bacteria 13311
711 Ga0501080_0054137 3300049742 Bacteria 3737
712 Ga0501080_0124520 3300049742 Bacteria 2387
713 Ga0501080_0192262 3300049742 Bacteria 1875
714 Ga0501080_0274094 3300049742 Bacteria 1535
715 Ga0501080_0283212 3300049742 Bacteria 1506
716 Ga0501080_0351802 3300049742 Bacteria 1330
717 Ga0501081_0014806 3300049743 Bacteria 5148
718 Ga0501081_0124456 3300049743 Bacteria 1838
719 Ga0501081_0429550 3300049743 Bacteria 980
720 Ga0501081_0447094 3300049743 Bacteria 960
721 Ga0501083_0160261 3300049744 Bacteria 1472
722 Ga0501035_0009931 3300049822 Bacteria 8838
723 Ga0501035_0041274 3300049822 Bacteria 4167
724 Ga0501035_0066532 3300049822 Bacteria 3198
725 Ga0501035_0551476 3300049822 Bacteria 944
726 Ga0501044_0000140 3300049823 Bacteria 88672
727 Ga0501044_0006810 3300049823 Bacteria 12593
728 Ga0501044_0105892 3300049823 Bacteria 2825
729 Ga0501044_0107643 3300049823 Bacteria 2799
730 Ga0501044_0109780 3300049823 Bacteria 2767
731 Ga0501044_0165715 3300049823 Bacteria 2184
732 Ga0501044_0231248 3300049823 Bacteria 1796
733 Ga0501045_0006104 3300049824 Bacteria 8344
734 Ga0501045_0011319 3300049824 Bacteria 6263
735 Ga0501045_0049915 3300049824 Bacteria 3052
736 nmdc:mga03683_28684_c1 3300050489 Bacteria 2215
737 nmdc:mga03683_9105_c1 3300050489 Bacteria 3517
738 nmdc:mga03n38_41205_c1 3300050490 Bacteria 2011
739 nmdc:mga0yw44_19567_c1 3300050492 Bacteria 3736
740 nmdc:mga0yw44_28226_c1 3300050492 Bacteria 3226
741 nmdc:mga0yw44_3416_c1 3300050492 Bacteria 7051
742 nmdc:mga0k408_17471_c2 3300050493 Bacteria 3132
743 nmdc:mga0k408_31758_c1 3300050493 Bacteria 3017
744 nmdc:mga06z11_110122_c1 3300050494 Bacteria 1524
745 nmdc:mga06z11_122457_c1 3300050494 Bacteria 1452
746 nmdc:mga04h51_30041_c1 3300050495 Bacteria 1707
747 nmdc:mga07m45_21233_c1 3300050496 Bacteria 2919
748 nmdc:mga07m45_47426_c1 3300050496 Bacteria 2415
749 nmdc:mga05p37_133005_c1 3300050507 Bacteria 3051
750 nmdc:mga08y16_14765_c1 3300050511 Bacteria 8212
751 nmdc:mga08y16_183864_c1 3300050511 Bacteria 2169
752 nmdc:mga08y16_199913_c1 3300050511 Bacteria 2071
753 nmdc:mga08y16_34_c1 3300050511 Bacteria 164092
754 nmdc:mga08x19_190523_c1 3300050514 Bacteria 1403
755 nmdc:mga0sz30_43099_c1 3300050516 Bacteria 1899
756 nmdc:mga0sz30_7389_c1 3300050516 Bacteria 4117
757 Ga0495601_0023238 3300053077 Bacteria 3809
758 Ga0495601_0062388 3300053077 Bacteria 2367
759 Ga0495601_0176906 3300053077 Bacteria 1395
760 Ga0495595_0024502 3300053084 Bacteria 2666
761 Ga0495595_0032645 3300053084 Bacteria 2345
762 Ga0495619_0006383 3300053085 Bacteria 7472
763 Ga0495619_0017391 3300053085 Bacteria 4552
764 Ga0500643_000055 3300053087 Bacteria 134904
765 Ga0500646_0001193 3300053090 Bacteria 6985
766 Ga0500646_0053058 3300053090 Bacteria 1175
767 Ga0500583_0021676 3300053092 Bacteria 2677
768 Ga0500651_0145463 3300053093 Bacteria 1426
769 Ga0500566_0000041 3300053094 Bacteria 65580
770 Ga0500640_046848 3300053095 Bacteria 1895
771 Ga0500641_0002772 3300053096 Bacteria 6198
772 Ga0500641_0051903 3300053096 Bacteria 1689
773 Ga0500650_0225184 3300053098 Bacteria 847
774 Ga0500555_002542 3300053103 Bacteria 5261
775 Ga0500557_000017 3300053105 Bacteria 96699
776 Ga0500569_001055 3300053109 Bacteria 5013
777 Ga0500572_044574 3300053111 Bacteria 1300
778 Ga0500594_0012816 3300053118 Bacteria 1984
779 Ga0500607_011787 3300053121 Bacteria 5158
780 Ga0500642_0000256 3300053130 Bacteria 19927
781 Ga0500642_0042877 3300053130 Bacteria 1963
782 Ga0500642_0078554 3300053130 Bacteria 1512
783 Ga0500652_058621 3300053131 Bacteria 1582
784 Ga0500655_003517 3300053133 Bacteria 2830
785 Ga0500655_024347 3300053133 Bacteria 1146
786 Ga0500559_0004313 3300053136 Bacteria 6791
787 Ga0500564_093418 3300053138 Bacteria 1337
788 Ga0500589_049178 3300053147 Bacteria 1959
789 Ga0500604_0004311 3300053151 Bacteria 3776
790 Ga0500616_0000757 3300053153 Bacteria 37213
791 Ga0500620_016705 3300053155 Bacteria 2103
792 Ga0500638_184640 3300053162 Bacteria 896
793 Ga0500636_0000389 3300053177 Bacteria 24251
794 Ga0500637_0046381 3300053178 Bacteria 2467
795 Ga0500625_037436 3300053729 Bacteria 2293
796 Ga0500645_074449 3300053730 Bacteria 973
797 Ga0500599_000235 3300053736 Bacteria 5232
798 Ga0500601_000091 3300053737 Bacteria 18928
799 Ga0501084_0064778 3300054114 Bacteria 3058
800 Ga0501084_0087470 3300054114 Bacteria 2616
801 Ga0501084_0091008 3300054114 Bacteria 2561
802 Ga0501084_0155953 3300054114 Bacteria 1925
803 Ga0501084_0167359 3300054114 Bacteria 1855
804 Ga0501082_0014435 3300060353 Bacteria 6798
805 Ga0501082_0041695 3300060353 Bacteria 3957
806 Ga0501082_0045391 3300060353 Bacteria 3790
807 Ga0501082_0095123 3300060353 Bacteria 2574
808 Ga0530510_0007292 3300061734 Bacteria 7693
809 Ga0530510_0008880 3300061734 Bacteria 7035
810 Ga0530510_0066403 3300061734 Bacteria 2615
811 Ga0530510_0189350 3300061734 Bacteria 1527
812 2507511211 2507262055 Bacteria 8048963
813 2508545020 2508501009 Bacteria 7784016
814 2821449621 2821443989 Bacteria 7658172
815 2844538776 2844533157 Bacteria 7517899
816 2874597951 2874590934 Bacteria 8299676
817 2876776551 2876771140 Bacteria 8287509
818 2876824859 2876818435 Bacteria 8274608
819 2879081586 2879074833 Bacteria 8279565
820 2883294178 2883291878 Bacteria 5894118
821 2897805617 2897803580 Bacteria 7000062
822 2906630756 2906626472 Bacteria 8826946
823 2906645993 2906643746 Bacteria 8722424
824 2932836161 2932828146 Bacteria 9745859
825 2935612559 2935608549 Bacteria 8203142
826 2935616905 2935616580 Bacteria 9032984
827 2935641770 2935638405 Bacteria 10015038
828 2935671639 2935665750 Bacteria 9571747
829 2935705539 2935703347 Bacteria 10242284
830 2935802522 2935801545 Bacteria 9301974
831 2935824048 2935819856 Bacteria 8261050
832 2935829937 2935827899 Bacteria 10038562
833 2935837847 2935837841 Bacteria 9454360
834 2935852805 2935847175 Bacteria 8228321
835 2935855529 2935855204 Bacteria 9035059
836 2935867226 2935864058 Bacteria 9784707
837 2935875954 2935873716 Bacteria 9632195
838 2935912044 2935908558 Bacteria 8568796
839 2935922255 2935916978 Bacteria 9113783
840 2935929073 2935926038 Bacteria 8601059
841 2935935704 2935934488 Bacteria 8602579
842 2935947270 2935942939 Bacteria 8599779
843 2935953636 2935951376 Bacteria 8602333
844 2935961811 2935959822 Bacteria 7869783
845 2935968662 2935967501 Bacteria 8603075
846 2935996623 2935992306 Bacteria 9802711
847 2936003896 2936002035 Bacteria 9362176
848 2941539487 2941538514 Bacteria 9402094
849 3005507932 3005506211 Bacteria 6943378
850 8016588874 8016583857 Bacteria 10421953
851 8017063972 8017057580 Bacteria 10023680
852 8019694332 8019687851 Bacteria 8712826
853 Ga0207707_10015649
854 JGI25151J46595_10000581
855 JGI25153J46596_10038973
856 JGI25160J50197_1012997
857 Ga0055540_1006370
858 Ga0055531_10000205
859 Ga0070658_10027472
860 Ga0070658_10175458
861 Ga0070658_10202452
862 Ga0070676_10174605
863 Ga0070676_10195709
864 Ga0070683_100097755
865 Ga0070690_100000993
866 Ga0070670_100078478
867 Ga0070670_100144274
868 Ga0070670_100346042
869 Ga0070670_100392517
870 Ga0068869_100003070
871 Ga0068869_100598493
872 Ga0070666_10143370
873 Ga0070680_100002437
874 Ga0070680_100004645
875 Ga0070680_100042488
876 Ga0070680_100095828
877 Ga0070680_100119264
878 Ga0070680_100202239
879 Ga0070680_100285920
880 Ga0068868_100157473
881 Ga0068868_100523523
882 Ga0070660_100025112
883 Ga0070689_100001070
884 Ga0070689_100162142
885 Ga0070691_10000198
886 Ga0070691_10004632
887 Ga0070691_10037021
888 Ga0070687_100013313
889 Ga0070687_100035769
890 Ga0070661_100041839
891 Ga0070692_10037720
892 Ga0070669_100146442
893 Ga0070669_100173512
894 Ga0070669_100333787
895 Ga0070669_100401929
896 Ga0070675_100041829
897 Ga0070675_100042464
898 Ga0070675_100085634
899 Ga0070675_100422423
900 Ga0070671_100106902
901 Ga0070671_100109547
902 Ga0070671_100302212
903 Ga0070671_100444094
904 Ga0070674_100014481
905 Ga0070674_100071836
906 Ga0070673_100034415
907 Ga0070673_100370303
908 Ga0070673_100392474
909 Ga0070688_100160284
910 Ga0070659_100006542
911 Ga0070659_100158175
912 Ga0070659_100251560
913 Ga0070667_100012504
914 Ga0070667_100217006
915 Ga0070667_100434216
916 Ga0070667_100587091
917 Ga0070667_100681990
918 Ga0070713_100158783
919 Ga0070701_10000075
920 Ga0070701_10034226
921 Ga0070711_100275835
922 Ga0070705_100036943
923 Ga0070700_100002507
924 Ga0070700_100057706
925 Ga0070700_100071135
926 Ga0070694_100008159
927 Ga0070708_100046726
928 Ga0070678_100060116
929 Ga0070662_100051128
930 Ga0070662_100063540
931 Ga0070681_10002137
932 Ga0070681_10002558
933 Ga0070681_10008342
934 Ga0070681_10058698
935 Ga0070681_10074615
936 Ga0070681_10116369
937 Ga0070681_10200092
938 Ga0070681_10569941
939 Ga0070681_10573808
940 Ga0068867_100000421
941 Ga0068867_100051934
942 Ga0068867_100222300
943 Ga0070706_100238536
944 Ga0070707_100383652
945 Ga0070698_100003981
946 Ga0070698_100054255
947 Ga0070698_100083208
948 Ga0070698_100303624
949 Ga0070698_100841274
950 Ga0070699_100284425
951 Ga0070679_100003954
952 Ga0070679_100004261
953 Ga0070679_100017188
954 Ga0070679_100064110
955 Ga0070679_100102619
956 Ga0070679_100137729
957 Ga0070679_100264409
958 Ga0070684_100042463
959 Ga0070684_100505133
960 Ga0070697_100020296
961 Ga0070697_100251570
962 Ga0068853_100001762
963 Ga0070672_100065877
964 Ga0070672_100333142
965 Ga0070686_100000270
966 Ga0070695_100056903
967 Ga0070695_100446254
968 Ga0070696_100003294
969 Ga0070696_100233624
970 Ga0070693_100001571
971 Ga0070665_100002531
972 Ga0070665_100157564
973 Ga0070665_100549650
974 Ga0070704_100066824
975 Ga0070704_100114552
976 Ga0068855_100005088
977 Ga0068855_100022196
978 Ga0068855_100121708
979 Ga0068855_100340451
980 Ga0068855_100758550
981 Ga0068855_100768800
982 Ga0070664_100033863
983 Ga0068857_100006255
984 Ga0068857_100012178
985 Ga0068857_100118282
986 Ga0068857_100227096
987 Ga0068854_100026505
988 Ga0068854_100135020
989 Ga0068854_100136497
990 Ga0070702_100000370
991 Ga0070702_100046626
992 Ga0070702_100085227
993 Ga0068852_100009333
994 Ga0068852_100194976
995 Ga0068859_100008372
996 Ga0068859_100016233
997 Ga0068859_100226524
998 Ga0068859_100281175
999 Ga0068859_100355715
1000 Ga0068859_100534335
1001 Ga0068859_100750577
1002 Ga0068864_100109023
1003 Ga0068866_10000249
1004 Ga0068866_10026604
1005 Ga0068861_100005107
1006 Ga0068861_100459377
1007 Ga0068851_10028875
1008 Ga0068863_100136353
1009 Ga0068858_100010505
1010 Ga0068858_100243912
1011 Ga0068858_100359363
1012 Ga0068860_100309804
1013 Ga0068860_100343963
1014 Ga0068860_100750349
1015 Ga0068862_100001761
1016 Ga0068862_100055175
1017 Ga0068862_100107662
1018 Ga0081455_10003323
1019 Ga0081455_10006621
1020 Ga0081455_10009487
1021 Ga0081455_10400814
1022 Ga0081538_10016756
1023 Ga0081538_10121911
1024 Ga0081539_10004821
1025 Ga0081539_10132688
1026 Ga0070717_10015233
1027 Ga0070717_10228163
1028 Ga0070717_10519149
1029 Ga0075365_10025403
1030 Ga0075365_10039511
1031 Ga0075365_10202862
1032 Ga0075363_100053182
1033 Ga0070716_100164613
1034 Ga0070712_100004370
1035 Ga0070712_100007601
1036 Ga0075362_10003442
1037 Ga0075362_10019652
1038 Ga0075362_10067503
1039 Ga0075367_10116215
1040 Ga0075369_10006384
1041 Ga0075369_10012486
1042 Ga0075369_10038635
1043 Ga0075366_10059945
1044 Ga0075366_10076888
1045 Ga0097621_100001920
1046 Ga0097621_100192732
1047 Ga0097621_100221057
1048 Ga0075370_10009458
1049 Ga0075370_10101359
1050 Ga0068871_100012239
1051 Ga0068871_100074754
1052 Ga0075431_100006873
1053 Ga0068865_100009147
1054 Ga0097620_100008372
1055 Ga0097620_100016233
1056 Ga0097620_100226515
1057 Ga0097620_100281175
1058 Ga0097620_100355724
1059 Ga0097620_100534359
1060 Ga0097620_100750554
1061 Ga0099795_10052608
1062 Ga0105240_10031426
1063 Ga0105240_10075931
1064 Ga0105240_10609131
1065 Ga0105240_10696607
1066 Ga0111539_10000450
1067 Ga0111539_10055725
1068 Ga0111539_10188308
1069 Ga0111539_10687992
1070 Ga0105245_10001133
1071 Ga0114129_10204573
1072 Ga0105243_10000923
1073 Ga0105243_10130178
1074 Ga0105242_10316141
1075 Ga0105248_10031448
1076 Ga0105248_10117808
1077 Ga0105248_10182969
1078 Ga0105248_10663696
1079 Ga0105237_10017697
1080 Ga0105237_10035864
1081 Ga0105238_10008348
1082 Ga0105238_10063704
1083 Ga0105239_10006145
1084 Ga0157373_10114880
1085 Ga0157371_10198788
1086 Ga0157370_10003797
1087 Ga0157370_10005023
1088 Ga0157370_10040954
1089 Ga0157370_10200945
1090 Ga0157369_10855325
1091 Ga0157374_10102692
1092 Ga0157378_10001174
1093 Ga0157378_10016742
1094 Ga0157378_10095994
1095 Ga0157378_10684767
1096 Ga0163162_10098077
1097 Ga0157372_10031749
1098 Ga0157372_10168950
1099 Ga0157372_10181499
1100 Ga0157372_10189287
1101 Ga0157372_10253999
1102 Ga0157375_10039302
1103 Ga0157375_10076567
1104 Ga0157375_10077872
1105 Ga0157375_10633727
1106 Ga0157375_10689949
1107 Ga0163163_10288025
1108 Ga0157380_10402116
1109 Ga0182008_10115008
1110 Ga0157379_10223278
1111 Ga0157376_10161777
1112 Ga0157376_10219194
1113 Ga0157376_10335831
1114 Ga0163161_10142354
1115 Ga0163161_10193103
1116 Ga0197907_10899973
1117 Ga0206356_10239614
1118 Ga0206350_10974906
1119 Ga0206353_10048251
1120 Ga0206353_10327856
1121 Ga0213872_10028776
1122 Ga0213874_10043831
1123 Ga0213876_10001938
1124 Ga0213876_10237830
1125 Ga0213875_10008711
1126 Ga0213875_10148721
1127 Ga0213871_10002128
1128 Ga0213871_10016836
1129 Ga0224712_10046689
1130 Ga0224712_10197279
1131 Ga0209148_1000268
1132 Ga0209455_1001518
1133 Ga0209673_1050415
1134 Ga0209130_1000502
1135 Ga0209130_1010355
1136 Ga0209025_1000077
1137 Ga0207426_1000576
1138 Ga0207426_1014765
1139 Ga0209051_1000310
1140 Ga0209257_1000165
1141 Ga0207656_10026144
1142 Ga0207682_10002243
1143 Ga0207642_10003143
1144 Ga0207680_10019191
1145 Ga0207680_10032431
1146 Ga0207680_10052566
1147 Ga0207685_10218323
1148 Ga0207699_10053259
1149 Ga0207699_10078691
1150 Ga0207699_10080514
1151 Ga0207699_10437270
1152 Ga0207705_10000714
1153 Ga0207705_10003763
1154 Ga0207705_10326461
1155 Ga0207684_10149915
1156 Ga0207707_10001526
1157 Ga0207707_10002213
1158 Ga0207707_10016341
1159 Ga0207707_10027081
1160 Ga0207707_10049872
1161 Ga0207707_10093743
1162 Ga0207707_10417354
1163 Ga0207707_10573626
1164 Ga0207707_10638402
1165 Ga0207695_10014722
1166 Ga0207695_10306311
1167 Ga0207695_10332057
1168 Ga0207693_10003170
1169 Ga0207693_10019311
1170 Ga0207693_10070608
1171 Ga0207660_10001236
1172 Ga0207660_10007598
1173 Ga0207660_10038214
1174 Ga0207660_10082014
1175 Ga0207660_10096220
1176 Ga0207662_10027376
1177 Ga0207657_10000554
1178 Ga0207657_10152751
1179 Ga0207657_10482859
1180 Ga0207652_10002084
1181 Ga0207652_10002621
1182 Ga0207652_10081935
1183 Ga0207652_10358883
1184 Ga0207652_10471214
1185 Ga0207646_10031412
1186 Ga0207646_10542279
1187 Ga0207681_10147730
1188 Ga0207681_10296968
1189 Ga0207694_10008861
1190 Ga0207694_10043329
1191 Ga0207694_10482601
1192 Ga0207650_10054109
1193 Ga0207650_10151267
1194 Ga0207650_10301960
1195 Ga0207650_10458776
1196 Ga0207659_10004576
1197 Ga0207659_10009302
1198 Ga0207659_10039743
1199 Ga0207659_10415904
1200 Ga0207687_10001219
1201 Ga0207687_10434099
1202 Ga0207687_10560973
1203 Ga0207700_10028357
1204 Ga0207700_10158135
1205 Ga0207700_10727687
1206 Ga0207664_10069875
1207 Ga0207644_10059554
1208 Ga0207644_10115785
1209 Ga0207644_10325039
1210 Ga0207690_10009385
1211 Ga0207690_10072916
1212 Ga0207706_10113911
1213 Ga0207686_10137112
1214 Ga0207709_10011909
1215 Ga0207670_10605820
1216 Ga0207669_10153820
1217 Ga0207669_10209518
1218 Ga0207704_10001122
1219 Ga0207665_10153884
1220 Ga0207691_10002172
1221 Ga0207691_10026903
1222 Ga0207691_10082777
1223 Ga0207711_10131630
1224 Ga0207689_10001864
1225 Ga0207689_10029957
1226 Ga0207689_10230450
1227 Ga0207689_10326940
1228 Ga0207661_10557089
1229 Ga0207679_10059987
1230 Ga0207667_10014788
1231 Ga0207667_10034440
1232 Ga0207667_10106521
1233 Ga0207651_10400543
1234 Ga0207668_10243654
1235 Ga0207668_10381495
1236 Ga0207640_10051216
1237 Ga0207640_10232307
1238 Ga0207640_10333769
1239 Ga0207658_10064281
1240 Ga0207658_10317673
1241 Ga0207658_10583269
1242 Ga0207677_10642135
1243 Ga0207703_10026898
1244 Ga0207703_10074623
1245 Ga0207703_10136939
1246 Ga0207703_10157254
1247 Ga0207639_10002688
1248 Ga0207639_10370068
1249 Ga0207639_10534975
1250 Ga0207708_10005526
1251 Ga0207708_10007313
1252 Ga0207708_10095815
1253 Ga0207708_10184778
1254 Ga0207702_10090140
1255 Ga0207702_10390982
1256 Ga0207641_10229358
1257 Ga0207648_10030105
1258 Ga0207648_10067938
1259 Ga0207676_10145747
1260 Ga0207676_10372504
1261 Ga0207674_10026028
1262 Ga0207674_10027483
1263 Ga0207674_10032578
1264 Ga0207674_10136898
1265 Ga0207674_10342544
1266 Ga0207675_100000234
1267 Ga0207675_100043375
1268 Ga0207683_10000189
1269 Ga0207683_10010770
1270 Ga0207683_10446670
1271 Ga0207698_10059368
1272 Ga0207698_10110170
1273 Ga0209969_1000495
1274 Ga0209967_1002629
1275 Ga0209984_1014159
1276 Ga0210000_1006363
1277 Ga0209995_1002913
1278 Ga0209999_1001275
1279 Ga0209970_1015123
1280 Ga0209813_10059801
1281 Ga0209974_10002954
1282 Ga0207428_10000169
1283 Ga0207428_10221092
1284 Ga0268266_10103680
1285 Ga0268266_10847951
1286 Ga0268265_10334580
1287 Ga0268265_10359675
1288 Ga0268264_10263045
1289 Ga0268264_10358454
1290 Ga0268264_10423092
1291 Ga0265326_10046553
1292 Ga0265338_10230119
1293 Ga0265338_10255007
1294 Ga0307511_10018066
1295 Ga0265330_10035395
1296 Ga0265332_10008217
1297 Ga0265332_10065391
1298 Ga0265328_10003968
1299 Ga0265329_10022657
1300 Ga0265340_10095182
1301 Ga0265331_10005807
1302 Ga0265331_10015988
1303 Ga0265327_10022910
1304 Ga0265316_10235168
1305 Ga0307408_100074379
1306 Ga0265313_10019402
1307 Ga0316575_10029533
1308 Ga0265314_10001600
1309 Ga0265342_10037861
1310 Ga0307409_100472922
1311 Ga0307416_100161965
1312 Ga0307416_100224851
1313 Ga0307414_10107183
1314 Ga0307411_10266792
1315 Ga0307510_10005450
1316 Ga0373926_0006701
1317 Ga0373926_0035404
1318 Ga0373926_0083093
1319 Ga0373923_0028341
1320 Ga0373923_0076139
1321 Ga0373932_0062101
1322 Ga0373932_0119650
1323 Ga0373953_0002942
1324 Ga0373954_0005019
1325 Ga0373957_0026824
1326 Ga0373946_0020214
1327 Ga0373955_0025284
1328 Ga0373961_0000005
1329 Ga0373924_0067809
1330 Ga0373931_0210651
1331 Ga0373935_0090574
1332 Ga0373935_0147227
1333 Ga0373927_0090614
1334 Ga0373927_0092990
1335 Ga0373927_0114880
1336 Ga0373933_0010069
1337 Ga0373933_0038465
1338 Ga0373933_0175211
1339 Ga0373947_0032416
1340 Ga0373937_0036511
1341 Ga0373937_0037501
1342 Ga0373937_0049639
1343 Ga0373937_0057104
1344 Ga0373937_0129683
1345 Ga0373937_0377201
1346 Ga0373937_0647004
1347 Ga0316582_0265613
1348 Ga0373925_0008070
1349 Ga0373925_0038518
1350 Ga0395899_0026633
1351 Ga0395899_0266641
1352 Ga0395900_0001993
1353 Ga0395900_0013646
1354 Ga0395900_0431173
1355 Ga0395900_0638852
1356 Ga0395898_0003319
1357 Ga0395898_0047599
1358 Ga0395905_0000043
1359 Ga0395905_0004055
1360 Ga0436364_0749911
1361 Ga0436364_0891296
1362 Ga0436364_1360422
1363 Ga0395901_0024450
1364 Ga0395901_0231803
1365 Ga0395901_0381012
1366 Ga0400483_220694
1367 Ga0436365_0065739
1368 Ga0436365_0202658
1369 Ga0436365_0801734
1370 Ga0436365_1116753
1371 Ga0436360_0375286
1372 Ga0436360_0401373
1373 Ga0436360_0569429
1374 Ga0436360_0675016
1375 Ga0436360_0696399
1376 Ga0436360_0734197
1377 Ga0436360_0871428
1378 Ga0436360_1220716
1379 Ga0436361_0320193
1380 Ga0436361_0446953
1381 Ga0436361_0522153
1382 Ga0436361_1150595
1383 Ga0436361_1170458
1384 Ga0436363_0199441
1385 Ga0436363_1076006
1386 Ga0436362_0666097
1387 Ga0436362_1262338
1388 Ga0439431_0018837
1389 Ga0439446_0112096
1390 Ga0439435_0070844
1391 Ga0450893_0003697
1392 Ga0451577_0276173
1393 Ga0451577_0340420
1394 Ga0451577_0509393
1395 Ga0453684_0582146
1396 Ga0466957_0024982
1397 Ga0451576_0001697
1398 Ga0451576_0580753
1399 Ga0466967_0324809
1400 Ga0466967_0649096
1401 Ga0495592_0089761
1402 Ga0495592_0176632
1403 Ga0495603_0128503
1404 Ga0495591_025637
1405 Ga0495638_0000635
1406 Ga0495638_0002699
1407 Ga0495641_0044532
1408 Ga0495653_0092015
1409 Ga0495650_0033642
1410 Ga0495580_0038311
1411 Ga0495580_0347028
1412 Ga0495605_0000862
1413 Ga0495639_0013338
1414 Ga0495662_0018435
1415 Ga0495664_0024843
1416 Ga0495585_0020821
1417 Ga0495585_0042471
1418 Ga0495607_0024538
1419 Ga0495608_0025250
1420 Ga0495610_0035969
1421 Ga0495610_0066217
1422 Ga0495628_0016038
1423 Ga0495630_0025383
1424 Ga0495631_0079937
1425 Ga0495644_0040755
1426 Ga0495666_0014543
1427 Ga0495642_0061605
1428 Ga0495652_0085979
1429 Ga0495640_0021018
1430 Ga0495586_0099910
1431 Ga0495586_0316325
1432 Ga0495587_0013952
1433 Ga0495598_0031141
1434 Ga0495609_0118166
1435 Ga0495633_0110249
1436 Ga0495667_0038220
1437 Ga0495667_0079428
1438 Ga0495668_0056547
1439 Ga0495634_0016612
1440 Ga0495635_0063453
1441 Ga0495635_0089090
1442 Ga0495661_0077924
1443 Ga0495661_0113524
1444 Ga0495657_0004212
1445 Ga0495599_0005873
1446 Ga0495599_0047278
1447 Ga0495647_0012203
1448 Ga0495658_0045710
1449 Ga0495658_0070327
1450 Ga0495669_0001975
1451 Ga0495670_0001012
1452 Ga0495589_0000736
1453 Ga0495600_0037442
1454 Ga0495600_0052340
1455 Ga0495680_0109312
1456 Ga0495675_0003519
1457 Ga0495679_049887
1458 Ga0496100_0051897
1459 Ga0496102_0028584
1460 Ga0496102_0203346
1461 Ga0496103_0005688
1462 Ga0496103_0152077
1463 Ga0496104_0005443
1464 Ga0496104_0174928
1465 Ga0496106_0047743
1466 Ga0496107_0013654
1467 Ga0496108_0011478
1468 Ga0496109_0561951
1469 Ga0496110_0015076
1470 Ga0496110_0209542
1471 Ga0496111_0022762
1472 Ga0496113_0448431
1473 Ga0496113_0460851
1474 Ga0496114_0257357
1475 Ga0496119_0052118
1476 Ga0496119_0104002
1477 Ga0496120_0045785
1478 Ga0496121_0053116
1479 Ga0496121_0193569
1480 Ga0496126_0113234
1481 Ga0501031_0119705
1482 Ga0501032_0199530
1483 Ga0501032_0250360
1484 Ga0501033_0224465
1485 Ga0501034_0002928
1486 Ga0501034_0044434
1487 Ga0501034_0411371
1488 Ga0501034_0656926
1489 Ga0501036_0088895
1490 Ga0501036_0093961
1491 Ga0501036_0123251
1492 Ga0501036_0421246
1493 Ga0501037_0032710
1494 Ga0501037_0089750
1495 Ga0501037_0107131
1496 Ga0501037_0160141
1497 Ga0501037_0190844
1498 Ga0501038_0043380
1499 Ga0501038_0077112
1500 Ga0501038_0233394
1501 Ga0501039_0002641
1502 Ga0501039_0014487
1503 Ga0501039_0069442
1504 Ga0501039_0262018
1505 Ga0501040_0015316
1506 Ga0501040_0020278
1507 Ga0501040_0315472
1508 Ga0501041_0002700
1509 Ga0501041_0005228
1510 Ga0501041_0014311
1511 Ga0501041_0024556
1512 Ga0501042_0010930
1513 Ga0501042_0048508
1514 Ga0501042_0095921
1515 Ga0501043_0028245
1516 Ga0501043_0187052
1517 Ga0501043_0496979
1518 Ga0501046_0023006
1519 Ga0501046_0083389
1520 Ga0501046_0111591
1521 Ga0501046_0374667
1522 Ga0501047_0051548
1523 Ga0501047_0167250
1524 Ga0501047_0367260
1525 Ga0501048_0006462
1526 Ga0501048_0083437
1527 Ga0501048_0210730
1528 Ga0501067_0035467
1529 Ga0501068_0188600
1530 Ga0501069_0121219
1531 Ga0501070_0000033
1532 Ga0501070_0127126
1533 Ga0501070_0172523
1534 Ga0501070_0407750
1535 Ga0501071_0003718
1536 Ga0501071_0021107
1537 Ga0501071_0047761
1538 Ga0501072_0003456
1539 Ga0501072_0030407
1540 Ga0501072_0043434
1541 Ga0501072_0060051
1542 Ga0501073_0039675
1543 Ga0501073_0048482
1544 Ga0501073_0286798
1545 Ga0501073_0362019
1546 Ga0501073_0484753
1547 Ga0501074_0039505
1548 Ga0501075_0009891
1549 Ga0501075_0053365
1550 Ga0501075_0187531
1551 Ga0501076_0006358
1552 Ga0501076_0008071
1553 Ga0501076_0018226
1554 Ga0501076_0035381
1555 Ga0501077_0008361
1556 Ga0501077_0034366
1557 Ga0501077_0090319
1558 Ga0501077_0235766
1559 Ga0501079_0006027
1560 Ga0501079_0007033
1561 Ga0501079_0011467
1562 Ga0501080_0003821
1563 Ga0501080_0054137
1564 Ga0501080_0124520
1565 Ga0501080_0192262
1566 Ga0501080_0274094
1567 Ga0501080_0283212
1568 Ga0501080_0351802
1569 Ga0501081_0014806
1570 Ga0501081_0124456
1571 Ga0501081_0429550
1572 Ga0501081_0447094
1573 Ga0501083_0160261
1574 Ga0501035_0009931
1575 Ga0501035_0041274
1576 Ga0501035_0066532
1577 Ga0501035_0551476
1578 Ga0501044_0000140
1579 Ga0501044_0006810
1580 Ga0501044_0105892
1581 Ga0501044_0107643
1582 Ga0501044_0109780
1583 Ga0501044_0165715
1584 Ga0501044_0231248
1585 Ga0501045_0006104
1586 Ga0501045_0011319
1587 Ga0501045_0049915
1588 nmdc:mga03683_28684_c1
1589 nmdc:mga03683_9105_c1
1590 nmdc:mga03n38_41205_c1
1591 nmdc:mga0yw44_19567_c1
1592 nmdc:mga0yw44_28226_c1
1593 nmdc:mga0yw44_3416_c1
1594 nmdc:mga0k408_17471_c2
1595 nmdc:mga0k408_31758_c1
1596 nmdc:mga06z11_110122_c1
1597 nmdc:mga06z11_122457_c1
1598 nmdc:mga04h51_30041_c1
1599 nmdc:mga07m45_21233_c1
1600 nmdc:mga07m45_47426_c1
1601 nmdc:mga05p37_133005_c1
1602 nmdc:mga08y16_14765_c1
1603 nmdc:mga08y16_183864_c1
1604 nmdc:mga08y16_199913_c1
1605 nmdc:mga08y16_34_c1
1606 nmdc:mga08x19_190523_c1
1607 nmdc:mga0sz30_43099_c1
1608 nmdc:mga0sz30_7389_c1
1609 Ga0495601_0023238
1610 Ga0495601_0062388
1611 Ga0495601_0176906
1612 Ga0495595_0024502
1613 Ga0495595_0032645
1614 Ga0495619_0006383
1615 Ga0495619_0017391
1616 Ga0500643_000055
1617 Ga0500646_0001193
1618 Ga0500646_0053058
1619 Ga0500583_0021676
1620 Ga0500651_0145463
1621 Ga0500566_0000041
1622 Ga0500640_046848
1623 Ga0500641_0002772
1624 Ga0500641_0051903
1625 Ga0500650_0225184
1626 Ga0500555_002542
1627 Ga0500557_000017
1628 Ga0500569_001055
1629 Ga0500572_044574
1630 Ga0500594_0012816
1631 Ga0500607_011787
1632 Ga0500642_0000256
1633 Ga0500642_0042877
1634 Ga0500642_0078554
1635 Ga0500652_058621
1636 Ga0500655_003517
1637 Ga0500655_024347
1638 Ga0500559_0004313
1639 Ga0500564_093418
1640 Ga0500589_049178
1641 Ga0500604_0004311
1642 Ga0500616_0000757
1643 Ga0500620_016705
1644 Ga0500638_184640
1645 Ga0500636_0000389
1646 Ga0500637_0046381
1647 Ga0500625_037436
1648 Ga0500645_074449
1649 Ga0500599_000235
1650 Ga0500601_000091
1651 Ga0501084_0064778
1652 Ga0501084_0087470
1653 Ga0501084_0091008
1654 Ga0501084_0155953
1655 Ga0501084_0167359
1656 Ga0501082_0014435
1657 Ga0501082_0041695
1658 Ga0501082_0045391
1659 Ga0501082_0095123
1660 Ga0530510_0007292
1661 Ga0530510_0008880
1662 Ga0530510_0066403
1663 Ga0530510_0189350
1664 2507511211
1665 2508545020
1666 2821449621
1667 2844538776
1668 2874597951
1669 2876776551
1670 2876824859
1671 2879081586
1672 2883294178
1673 2897805617
1674 2906630756
1675 2906645993
1676 2932836161
1677 2935612559
1678 2935616905
1679 2935641770
1680 2935671639
1681 2935705539
1682 2935802522
1683 2935824048
1684 2935829937
1685 2935837847
1686 2935852805
1687 2935855529
1688 2935867226
1689 2935875954
1690 2935912044
1691 2935922255
1692 2935929073
1693 2935935704
1694 2935947270
1695 2935953636
1696 2935961811
1697 2935968662
1698 2935996623
1699 2936003896
1700 2941539487
1701 3005507932
1702 8016588874
1703 8017063972
1704 8019694332

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

2

168

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.903 3 264
1ffu-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor 0.9021 4 264
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.8952 4 264
1n5w-assembly1.cif.gz_C crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.8937 1 264
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.89 3 264
ID Description Score Start End Superfamily
af_I6Y7N2_57_165_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9475 68 166 3.30.465.10
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9463 57 166 3.30.465.10
1t3qF02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9434 56 168 3.30.465.10
1ffuF01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9389 4 51 3.30.43.10
af_P77324_1_53_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9375 1 53 3.30.43.10
ID Description Score Start End GO Terms
AF-A0A431NS82-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.987 1 265 GO:0016491
GO:0071949
AF-A0A1H8YRK0-F1-model_v4 Carbon-monoxide dehydrogenase medium subunit 0.9839 168 265
AF-A0A537V8Z3-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9838 1 265 GO:0016491
GO:0071949
AF-A0A6L7YY57-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.9837 1 231 GO:0016491
GO:0071949
AF-A0A6G6YVB9-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9833 1 262 GO:0016491
GO:0071949

Map