F483476

General Info

Members Datasets Scaffolds Average Seq Length
851 561 651 565

Family's Representative Sequence

Representative Sequence 3300048923|Ga0496120_0040413|Ga0496120_0040413_936_2729
Length 597
Sequence LLSPEQEKSTVLTIKQTDRFLIERKMYKMSFQMSRRQYADMFGPTVGDAVRLADTELFIEIEKDFTTYGDEVKFGGGKVIRDGMGQHPLATRSEAADLVLTNAIIVDYTGIYKADIGIKDGLIQTIGKAGNPLLMDEVDIIIGASTEVIAAEGKIVTAGGIDAHIHFICPQQIETALASGVTTMIGGGTGPATGTKATTCTPGAWHIERMLEAAEAFPMNIGFLGKGNASAKEPLIEQIEAGAIGLKLHEDWGTTASAIDTSLQVADEYDVQIAIHTDTLNEGGFVEDTIAAIGDRVIHTYHTEGAGGGHAPDIMEMASFPNVLPSSTNPTRPYTVNTLEEHLDMLMVCHHLDPSVPEDIAFADSRIRKETIAAEDILHDLGVFSMISSDSQAMGRVGEVITRTWQTADKMKKQRGKLDGDSEAGDNARVKRYVAKYTINPAIAHGISEYVGSVETGKMADLVLWEPAFFGIKPDLIVKGGLIAHSLMGDPNASIPTPQPVLYRPMFASYGKARAKTSFTFVSRAAYENKVGEKLGLQKLLKPVKNIRQLKKTDMKLNGEMPKIEVDPQTYEVKVDGQMITCEAAEVVPMAQRYFLF

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
5 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
6 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
9 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
10 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
11 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
12 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
13 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
14 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
15 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
16 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
17 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
18 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
19 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
20 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
21 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
22 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
23 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
24 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
25 2519899620 Rhizobium sp. Pop5 Isolate Nodule
26 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
27 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
28 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
29 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
30 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
31 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
32 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
33 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
34 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
35 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
36 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
37 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
38 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
39 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
40 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
41 2643221658 Variovorax sp. Root411 Isolate Unclassified
42 2643221672 Variovorax sp. Root434 Isolate Unclassified
43 2643221674 Devosia sp. Root436 Isolate Unclassified
44 2643221718 Rhizobium sp. Root268 Isolate Unclassified
45 2643221731 Bacillus sp. Root147 Isolate Unclassified
46 2643221732 Bacillus sp. Root239 Isolate Unclassified
47 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
48 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
49 2718217927 Rhizobium sp. N324 Isolate Nodule
50 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
51 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
52 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
53 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
54 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
55 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
56 2718218423 Rhizobium sp. N941 Isolate Nodule
57 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
58 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
59 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
60 2721755809 Rhizobium sp. N541 Isolate Nodule
61 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
62 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
63 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
64 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
65 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
66 2738541277 Variovorax sp. GV051 Isolate Unclassified
67 2738541297 Duganella sp. GV083 Isolate Unclassified
68 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
69 2738541357 Duganella sp. GV053 Isolate Unclassified
70 2738543003 Duganella sp. GV066 Isolate Unclassified
71 2738543013 Variovorax sp. BT01 Isolate Unclassified
72 2738543019 Variovorax sp. GV040 Isolate Unclassified
73 2738543026 Duganella sp. GV089 Isolate Unclassified
74 2738543029 Duganella sp. GV039 Isolate Unclassified
75 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
76 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
77 2791355256 Rhizobium sp. M10 Isolate Nodule
78 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
79 2791355260 Rhizobium sp. L9 Isolate Nodule
80 2791355262 Rhizobium sp. M1 Isolate Nodule
81 2791355263 Rhizobium chutanense C5 Isolate Nodule
82 2791355265 Rhizobium sp. H4 Isolate Nodule
83 2791355266 Rhizobium sp. L43 Isolate Nodule
84 2791355267 Rhizobium sp. L18 Isolate Nodule
85 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
86 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
87 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
88 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
89 2802429633 Rhizobium anhuiense J3 Isolate Nodule
90 2802429634 Rhizobium anhuiense S10 Isolate Nodule
91 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
92 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
93 2802429637 Rhizobium anhuiense C15 Isolate Nodule
94 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
95 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
96 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
97 2818991446 Variovorax sp. 1180 Isolate Unclassified
98 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
99 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
100 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
101 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
102 2857564685 Duganella sp. R-74599 Isolate Unclassified
103 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
104 2885211737 Variovorax sp. 553 Isolate Unclassified
105 2899924645 Variovorax sp. 369 Isolate Unclassified
106 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
107 2904456579 Variovorax sp. 2002 Isolate Unclassified
108 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
109 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
110 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
111 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
112 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
113 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
114 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
115 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
116 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
117 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
118 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
119 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
120 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
121 2919720352 Priestia megaterium 4340 Isolate Unclassified
122 2928037797 Variovorax sp. 1126 Isolate Unclassified
123 2928044640 Variovorax sp. 1128 Isolate Unclassified
124 2928051484 Variovorax sp. 1133 Isolate Unclassified
125 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
126 2928070936 Variovorax gossypii 1167 Isolate Unclassified
127 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
128 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
129 2929004312 Priestia megaterium 1104 Isolate Unclassified
130 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
131 2929520902 Variovorax beijingensis 502 Isolate Unclassified
132 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
133 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
134 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
135 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
136 2933599457 Rhizobium phaseoli M3 Isolate Nodule
137 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
138 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
139 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
140 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
141 2936381700 Rhizobium chutanense C16 Isolate Unclassified
142 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
143 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
144 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
145 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
146 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
147 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
148 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
149 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
150 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
151 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
152 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
153 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
154 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
155 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
156 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
157 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
158 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
159 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
160 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
161 2996893221 Rhizobium sp. R635 Isolate Nodule
162 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
163 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
164 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
165 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
166 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
167 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
168 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
169 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
170 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
171 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
172 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
173 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
174 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
175 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
176 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
177 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
178 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
179 3300003396 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM Metagenome Rhizosphere
180 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
181 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
182 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
183 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
184 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
185 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
186 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
187 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
188 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
189 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
190 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
191 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
192 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
193 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
194 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
195 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
196 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
197 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
198 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
199 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
200 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
201 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
202 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
203 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
204 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
205 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
206 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
207 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
208 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
209 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
210 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
211 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
212 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
213 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
214 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
215 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
216 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
217 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
218 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
219 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
220 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
221 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
222 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
223 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
224 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
225 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
226 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
227 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
228 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
229 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
230 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
231 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
232 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
233 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
234 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
235 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
236 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
237 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
238 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
239 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
240 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
241 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
242 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
243 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
244 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
245 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
246 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
247 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
248 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
249 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
250 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
251 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
252 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
253 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
254 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
255 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
256 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
257 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
258 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
259 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
260 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
261 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
262 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
263 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
264 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
265 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
266 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
267 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
268 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
269 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
270 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
271 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
272 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
273 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
274 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
275 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
276 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
277 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
278 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
279 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
280 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
281 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
282 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
283 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
284 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
285 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
286 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
287 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
288 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
291 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
293 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
294 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
296 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
297 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
298 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
299 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
300 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
301 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
302 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
303 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
305 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
306 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
307 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
308 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
309 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
310 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
312 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
352 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
353 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
354 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
355 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
356 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
357 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
358 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
359 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
360 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
361 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
362 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
363 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
364 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
365 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
366 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
367 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
368 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
372 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
373 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
374 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
375 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
376 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
377 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
378 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
379 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
380 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
381 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
382 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
383 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
384 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
385 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
386 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
387 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
388 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
389 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
390 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
391 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
392 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
393 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
394 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
395 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
396 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
397 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
398 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
399 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
400 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
401 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
402 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
403 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
404 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
405 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
406 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
407 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
408 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
409 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
410 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
411 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
412 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
413 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
414 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
415 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
416 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
417 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
418 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
419 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
420 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
421 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
422 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
423 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
424 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
425 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
426 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
427 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
428 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
429 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
430 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
431 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
432 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
433 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
434 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
435 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
436 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
437 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
438 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
439 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
440 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
441 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
442 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
443 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
444 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
445 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
446 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
447 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
448 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
449 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
450 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
451 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
452 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
453 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
454 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
455 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
456 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
457 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
458 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
459 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
460 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
461 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
463 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
464 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
469 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
470 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
471 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
472 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
474 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
475 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
476 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
477 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
479 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
480 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
481 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
482 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
483 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
484 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
485 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
486 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
487 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
488 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
489 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
490 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
491 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
492 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
493 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
494 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
495 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
496 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
497 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
498 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
499 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
500 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
501 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
502 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
503 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
504 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
505 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
506 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
507 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
508 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
509 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
510 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
511 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
512 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
513 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
514 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
515 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
516 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
517 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
518 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
519 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
520 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
521 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
522 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
523 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
524 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
525 639633007 Azoarcus olearius BH72 Isolate Unclassified
526 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
527 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
528 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
529 8005275841 Rhizobium sp. N4311 Isolate Nodule
530 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
531 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
532 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
533 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
534 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
535 8005382845 Rhizobium sp. R634 Isolate Nodule
536 8005395548 Rhizobium sp. R339 Isolate Nodule
537 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
538 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
539 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
540 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
541 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
542 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
543 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
544 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
545 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
546 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
547 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
548 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
549 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
550 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
551 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
552 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
553 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
554 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
555 8024501048 Rhizobium sp. H4 Isolate Nodule
556 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
557 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
558 8056382006 Rhizobium croatiense 13T Isolate Nodule
559 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
560 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule
561 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 76.26
Metatranscriptomes 0.24
Isolates 23.5

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 14.81
Nodule 11.4
Rhizoplane 3.17
Rhizosphere 59.93
Stem 0
Stem Tuber 0
Unclassified 10.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1000393 3300001976 Bacteria 6049
2 JGI24740J21852_10008372 3300001979 Bacteria 4123
3 JGI24750J21931_1000712 3300002070 Bacteria 4796
4 JGI24748J21848_1000111 3300002074 Bacteria 17189
5 JGI24749J21850_1000026 3300002076 Bacteria 28143
6 JGI24034J26672_10000089 3300002239 Bacteria 17189
7 JGI24751J29686_10000128 3300002459 Bacteria 38241
8 JGI25162J39368_1000149 3300002737 Bacteria 76227
9 JGI25157J39369_1000568 3300002741 Bacteria 22087
10 JGI25152J39213_1002125 3300002773 Bacteria 7773
11 JGI25152J39213_1002132 3300002773 Bacteria 7761
12 JGI25151J46595_10009751 3300003187 Bacteria 4523
13 JGI25151J46595_10009754 3300003187 Bacteria 4522
14 JGI25151J46595_10023784 3300003187 Bacteria 2516
15 JGI25165J46597_1000038 3300003214 Bacteria 283664
16 JGI25165J46597_1001553 3300003214 Bacteria 11382
17 JGI25153J46596_10002731 3300003215 Bacteria 10057
18 JGI25153J46596_10012555 3300003215 Bacteria 3645
19 JGI25160J50197_1000766 3300003354 Bacteria 17317
20 JGI25161J50226_1002967 3300003374 Bacteria 4093
21 JGI26137J50245_100046 3300003396 Archaea 6146
22 JGI26138J51218_100133 3300003504 Unclassified 3461
23 Ga0006562J51391_1018249 3300003578 Bacteria 4390
24 Ga0055535_1000087 3300003761 Bacteria 102655
25 Ga0055535_1000221 3300003761 Bacteria 60185
26 Ga0055542_1000129 3300003762 Bacteria 99542
27 Ga0055529_1000015 3300003763 Bacteria 366950
28 Ga0055529_1000139 3300003763 Bacteria 102943
29 Ga0055524_1007009 3300003775 Bacteria 4841
30 Ga0055536_1005987 3300003781 Bacteria 5788
31 Ga0055528_1007169 3300003790 Bacteria 4967
32 Ga0055528_1016382 3300003790 Bacteria 2624
33 Ga0055530_10000091 3300003791 Bacteria 78039
34 Ga0055530_10000809 3300003791 Bacteria 26010
35 Ga0055530_10013423 3300003791 Bacteria 2798
36 Ga0055540_1009468 3300003792 Bacteria 3357
37 Ga0055531_10000543 3300003794 Bacteria 33406
38 Ga0055531_10006609 3300003794 Bacteria 6536
39 Ga0055531_10010980 3300003794 Bacteria 4431
40 JGI25405J52794_10000912 3300003911 Unclassified 4627
41 JGI25405J52794_10009060 3300003911 Bacteria 1872
42 Ga0055543_1000108 3300004625 Bacteria 71519
43 Ga0065714_10007852 3300005288 Bacteria 2729
44 Ga0065704_10072996 3300005289 Bacteria 7699
45 Ga0065707_10003225 3300005295 Archaea 3860
46 Ga0065707_10097340 3300005295 Bacteria 3183
47 Ga0070658_10047454 3300005327 Bacteria 3476
48 Ga0070658_10085823 3300005327 Bacteria 2589
49 Ga0070676_10007377 3300005328 Archaea 5900
50 Ga0070676_10012779 3300005328 Bacteria 4593
51 Ga0070670_100000044 3300005331 Bacteria 140263
52 Ga0070670_100000282 3300005331 Bacteria 44780
53 Ga0070670_100085668 3300005331 Bacteria 2707
54 Ga0070670_100098502 3300005331 Bacteria 2516
55 Ga0070677_10005311 3300005333 Unclassified 4243
56 Ga0068869_100000041 3300005334 Bacteria 52640
57 Ga0070666_10001085 3300005335 Bacteria 16621
58 Ga0070680_100025088 3300005336 Unclassified 4764
59 Ga0070680_100110657 3300005336 Archaea 2286
60 Ga0070687_100008608 3300005343 Unclassified 4331
61 Ga0070687_100022165 3300005343 Unclassified 2998
62 Ga0070661_100015515 3300005344 Archaea 5377
63 Ga0070668_100000300 3300005347 Bacteria 32482
64 Ga0070668_100010408 3300005347 Bacteria 6912
65 Ga0070668_100042657 3300005347 Bacteria 3477
66 Ga0070669_100011121 3300005353 Bacteria 6388
67 Ga0070669_100046547 3300005353 Bacteria 3163
68 Ga0070675_100125215 3300005354 Bacteria 2186
69 Ga0070671_100000604 3300005355 Bacteria 25648
70 Ga0070671_100001700 3300005355 Bacteria 16701
71 Ga0070673_100011960 3300005364 Bacteria 5942
72 Ga0070673_100021793 3300005364 Archaea 4654
73 Ga0070688_100072642 3300005365 Bacteria 2205
74 Ga0070659_100017343 3300005366 Bacteria 5416
75 Ga0070667_100000019 3300005367 Bacteria 224710
76 Ga0070667_100000442 3300005367 Bacteria 43103
77 Ga0070667_100002314 3300005367 Bacteria 16701
78 Ga0070667_100012664 3300005367 Bacteria 6974
79 Ga0070701_10005612 3300005438 Archaea 5201
80 Ga0070705_100000010 3300005440 Bacteria 102079
81 Ga0070700_100015893 3300005441 Archaea 4277
82 Ga0070694_100007490 3300005444 Bacteria 6658
83 Ga0070681_10015235 3300005458 Bacteria 7649
84 Ga0068867_100022813 3300005459 Unclassified 4478
85 Ga0070706_100089664 3300005467 Bacteria 2851
86 Ga0070706_100126604 3300005467 Bacteria 2382
87 Ga0070707_100003974 3300005468 Bacteria 13925
88 Ga0070707_100119488 3300005468 Bacteria 2558
89 Ga0070698_100004704 3300005471 Bacteria 14997
90 Ga0070698_100008743 3300005471 Archaea 10903
91 Ga0070698_100023650 3300005471 Bacteria 6419
92 Ga0070699_100001267 3300005518 Bacteria 23288
93 Ga0070699_100016619 3300005518 Bacteria 6316
94 Ga0070697_100004306 3300005536 Archaea 10920
95 Ga0070697_100011488 3300005536 Archaea 6923
96 Ga0070697_100036682 3300005536 Bacteria 3960
97 Ga0068853_100003649 3300005539 Bacteria 11806
98 Ga0068853_100005761 3300005539 Bacteria 9755
99 Ga0070672_100090694 3300005543 Bacteria 2465
100 Ga0070686_100000951 3300005544 Bacteria 16701
101 Ga0070695_100020736 3300005545 Bacteria 4015
102 Ga0070696_100000088 3300005546 Bacteria 45502
103 Ga0070696_100045467 3300005546 Archaea 3042
104 Ga0070693_100027841 3300005547 Archaea 3067
105 Ga0070665_100000144 3300005548 Bacteria 132302
106 Ga0070665_100000901 3300005548 Bacteria 38176
107 Ga0070665_100215537 3300005548 Bacteria 1921
108 Ga0070704_100005789 3300005549 Archaea 7232
109 Ga0070704_100007022 3300005549 Bacteria 6679
110 Ga0068855_100000272 3300005563 Bacteria 64125
111 Ga0070664_100016032 3300005564 Archaea 6140
112 Ga0068864_100000061 3300005618 Bacteria 123373
113 Ga0068864_100000289 3300005618 Bacteria 44780
114 Ga0068864_100002032 3300005618 Bacteria 16701
115 Ga0068864_100006029 3300005618 Bacteria 9951
116 Ga0068861_100004465 3300005719 Bacteria 9391
117 Ga0068861_100007893 3300005719 Bacteria 7324
118 Ga0068851_10016489 3300005834 Bacteria 3535
119 Ga0068870_10000099 3300005840 Archaea 28783
120 Ga0068870_10002337 3300005840 Archaea 7890
121 Ga0068870_10003189 3300005840 Archaea 6918
122 Ga0068870_10006636 3300005840 Archaea 5111
123 Ga0068863_100005272 3300005841 Bacteria 12761
124 Ga0068863_100008487 3300005841 Bacteria 10034
125 Ga0068863_100023115 3300005841 Bacteria 5941
126 Ga0068858_100011563 3300005842 Bacteria 8328
127 Ga0068858_100030355 3300005842 Bacteria 5019
128 Ga0068860_100000042 3300005843 Bacteria 227404
129 Ga0068860_100000122 3300005843 Bacteria 125178
130 Ga0068860_100000183 3300005843 Bacteria 100738
131 Ga0068860_100003263 3300005843 Bacteria 16701
132 Ga0068860_100067955 3300005843 Archaea 3386
133 Ga0068860_100141147 3300005843 Unclassified 2315
134 Ga0068862_100000073 3300005844 Bacteria 119632
135 Ga0068862_100000175 3300005844 Bacteria 71556
136 Ga0068862_100000484 3300005844 Bacteria 42509
137 Ga0068862_100000699 3300005844 Bacteria 34289
138 Ga0068862_100002484 3300005844 Bacteria 16321
139 Ga0081455_10000194 3300005937 Bacteria 77128
140 Ga0081455_10005199 3300005937 Bacteria 14316
141 Ga0081538_10012622 3300005981 Bacteria 6762
142 Ga0081540_1000162 3300005983 Bacteria 68999
143 Ga0081540_1000379 3300005983 Bacteria 44561
144 Ga0081540_1001802 3300005983 Bacteria 17960
145 Ga0081540_1008109 3300005983 Bacteria 7374
146 Ga0081539_10006832 3300005985 Bacteria 10676
147 Ga0070717_10014585 3300006028 Bacteria 6049
148 Ga0075365_10002545 3300006038 Bacteria 8990
149 Ga0075368_10000094 3300006042 Bacteria 22408
150 Ga0075362_10001438 3300006177 Bacteria 7606
151 Ga0075362_10005230 3300006177 Bacteria 4733
152 Ga0075367_10004415 3300006178 Bacteria 6869
153 Ga0075366_10002595 3300006195 Bacteria 9288
154 Ga0075366_10031399 3300006195 Bacteria 3125
155 Ga0097621_100002902 3300006237 Bacteria 11773
156 Ga0075370_10000296 3300006353 Bacteria 17852
157 Ga0075370_10010973 3300006353 Bacteria 4750
158 Ga0075428_100036383 3300006844 Archaea 5422
159 Ga0075428_100055641 3300006844 Bacteria 4335
160 Ga0075428_100115340 3300006844 Unclassified 2926
161 Ga0075428_100141534 3300006844 Bacteria 2615
162 Ga0075431_100004278 3300006847 Bacteria 13986
163 Ga0075431_100030753 3300006847 Bacteria 5531
164 Ga0075431_100066395 3300006847 Bacteria 3725
165 Ga0075431_100153338 3300006847 Unclassified 2371
166 Ga0075433_10132950 3300006852 Unclassified 2211
167 Ga0075434_100048056 3300006871 Bacteria 4235
168 Ga0075429_100014977 3300006880 Bacteria 6726
169 Ga0079104_1004975 3300006946 Bacteria 5467
170 Ga0075435_100024815 3300007076 Bacteria 4659
171 Ga0075435_100035528 3300007076 Bacteria 3955
172 Ga0099794_10050939 3300007265 Bacteria 1993
173 Ga0105244_10008055 3300009036 Bacteria 6626
174 Ga0105240_10000026 3300009093 Bacteria 355569
175 Ga0111539_10043823 3300009094 Bacteria 5363
176 Ga0105247_10060273 3300009101 Bacteria 2351
177 Ga0114129_10005078 3300009147 Bacteria 18526
178 Ga0114129_10115745 3300009147 Bacteria 3695
179 Ga0105243_10009514 3300009148 Bacteria 7399
180 Ga0105243_10013142 3300009148 Bacteria 6258
181 Ga0105242_10032642 3300009176 Unclassified 4164
182 Ga0105248_10000493 3300009177 Bacteria 44891
183 Ga0105248_10004062 3300009177 Bacteria 16169
184 Ga0105248_10049694 3300009177 Bacteria 4703
185 Ga0105248_10158469 3300009177 Bacteria 2554
186 Ga0105237_10069600 3300009545 Bacteria 3514
187 Ga0105249_10002201 3300009553 Bacteria 16890
188 Ga0105249_10010504 3300009553 Bacteria 8135
189 Ga0105249_10012546 3300009553 Bacteria 7468
190 Ga0105249_10063805 3300009553 Unclassified 3385
191 Ga0123341_1000018 3300009765 Bacteria 81421
192 Ga0123342_1021409 3300009766 Bacteria 4547
193 Ga0105246_10011861 3300011119 Archaea 5420
194 Ga0157373_10042672 3300013100 Unclassified 3241
195 Ga0157373_10090937 3300013100 Bacteria 2149
196 Ga0157370_10004419 3300013104 Bacteria 16110
197 Ga0157370_10014496 3300013104 Bacteria 8057
198 Ga0157374_10025151 3300013296 Bacteria 5342
199 Ga0157378_10011041 3300013297 Archaea 7905
200 Ga0157372_10023267 3300013307 Bacteria 6715
201 Ga0157372_10123210 3300013307 Bacteria 2980
202 Ga0163163_10007941 3300014325 Bacteria 9383
203 Ga0163163_10012210 3300014325 Bacteria 7818
204 Ga0182008_10006332 3300014497 Bacteria 6629
205 Ga0157379_10021714 3300014968 Bacteria 5685
206 Ga0182007_10005272 3300015262 Bacteria 5705
207 Ga0182005_1000012 3300015265 Bacteria 396944
208 Ga0183362_10005 3300015683 Bacteria 437616
209 Ga0163161_10000099 3300017792 Bacteria 83318
210 Ga0163161_10001564 3300017792 Bacteria 16890
211 Ga0163161_10046984 3300017792 Bacteria 3116
212 Ga0213874_10002139 3300021377 Bacteria 4193
213 Ga0209672_101776 3300025228 Bacteria 6700
214 Ga0209147_100111 3300025229 Bacteria 145185
215 Ga0209147_100209 3300025229 Bacteria 62805
216 Ga0209437_100058 3300025233 Bacteria 357279
217 Ga0209258_100044 3300025242 Bacteria 376336
218 Ga0209258_100240 3300025242 Bacteria 100990
219 Ga0207425_1003377 3300025245 Bacteria 5131
220 Ga0207425_1005468 3300025245 Bacteria 3616
221 Ga0209026_1000151 3300025250 Bacteria 110338
222 Ga0209026_1001707 3300025250 Bacteria 9153
223 Ga0209148_1000033 3300025254 Bacteria 555508
224 Ga0209759_1000350 3300025256 Bacteria 60056
225 Ga0209759_1001278 3300025256 Bacteria 15072
226 Ga0209759_1010318 3300025256 Bacteria 2745
227 Ga0209129_1000068 3300025258 Bacteria 217385
228 Ga0209129_1000702 3300025258 Bacteria 21824
229 Ga0209129_1001400 3300025258 Bacteria 13490
230 Ga0209129_1001676 3300025258 Bacteria 12000
231 Ga0209233_1000042 3300025261 Bacteria 510519
232 Ga0209233_1000149 3300025261 Bacteria 181183
233 Ga0209455_1000048 3300025272 Bacteria 376260
234 Ga0209673_1000256 3300025273 Bacteria 100514
235 Ga0209673_1001106 3300025273 Bacteria 30133
236 Ga0209673_1001124 3300025273 Bacteria 29604
237 Ga0209673_1016135 3300025273 Bacteria 2806
238 Ga0209130_1000709 3300025284 Bacteria 29714
239 Ga0209130_1001033 3300025284 Bacteria 21324
240 Ga0209130_1002096 3300025284 Bacteria 10681
241 Ga0207673_1002416 3300025290 Bacteria 2129
242 Ga0209675_1001420 3300025291 Bacteria 13848
243 Ga0209675_1002065 3300025291 Bacteria 10696
244 Ga0209675_1008939 3300025291 Bacteria 3601
245 Ga0209676_1000048 3300025292 Bacteria 403716
246 Ga0209676_1002368 3300025292 Bacteria 13566
247 Ga0209025_1000045 3300025294 Bacteria 349118
248 Ga0209025_1000348 3300025294 Bacteria 100228
249 Ga0209025_1000537 3300025294 Bacteria 71838
250 Ga0209025_1000906 3300025294 Bacteria 45842
251 Ga0209025_1001251 3300025294 Bacteria 35202
252 Ga0209025_1002361 3300025294 Bacteria 20248
253 Ga0209025_1002941 3300025294 Bacteria 16947
254 Ga0209025_1022147 3300025294 Bacteria 3385
255 Ga0209564_1000259 3300025295 Bacteria 112570
256 Ga0209564_1000778 3300025295 Bacteria 44316
257 Ga0209564_1002025 3300025295 Bacteria 17599
258 Ga0209564_1002686 3300025295 Bacteria 13475
259 Ga0209758_1000034 3300025297 Bacteria 467637
260 Ga0209758_1001847 3300025297 Bacteria 23247
261 Ga0209758_1001921 3300025297 Bacteria 22607
262 Ga0209758_1002042 3300025297 Bacteria 21647
263 Ga0209050_1000012 3300025298 Bacteria 813717
264 Ga0209050_1000029 3300025298 Bacteria 465801
265 Ga0209050_1001075 3300025298 Bacteria 33506
266 Ga0209050_1002064 3300025298 Bacteria 18478
267 Ga0209256_1000283 3300025299 Bacteria 89387
268 Ga0209256_1000669 3300025299 Bacteria 46351
269 Ga0209256_1002499 3300025299 Bacteria 14841
270 Ga0209256_1002780 3300025299 Bacteria 13456
271 Ga0207426_1000058 3300025302 Bacteria 363857
272 Ga0207426_1000067 3300025302 Bacteria 342108
273 Ga0207426_1000198 3300025302 Bacteria 146241
274 Ga0209051_1000019 3300025303 Bacteria 511268
275 Ga0209051_1000099 3300025303 Bacteria 165161
276 Ga0209051_1000221 3300025303 Bacteria 96174
277 Ga0209051_1002537 3300025303 Bacteria 12902
278 Ga0209257_1000024 3300025304 Bacteria 726068
279 Ga0209257_1000057 3300025304 Bacteria 396985
280 Ga0209257_1000271 3300025304 Bacteria 118632
281 Ga0209257_1000451 3300025304 Bacteria 77246
282 Ga0207697_10001103 3300025315 Bacteria 14886
283 Ga0207697_10004142 3300025315 Bacteria 6994
284 Ga0207696_1006850 3300025711 Bacteria 4534
285 Ga0207655_1002336 3300025728 Bacteria 15532
286 Ga0207655_1004596 3300025728 Bacteria 9716
287 Ga0207682_10010055 3300025893 Unclassified 3714
288 Ga0207680_10000608 3300025903 Bacteria 16898
289 Ga0207645_10001502 3300025907 Bacteria 19097
290 Ga0207645_10008666 3300025907 Archaea 7085
291 Ga0207645_10025356 3300025907 Archaea 3837
292 Ga0207643_10000237 3300025908 Archaea 38558
293 Ga0207643_10005256 3300025908 Archaea 6924
294 Ga0207705_10005109 3300025909 Bacteria 9840
295 Ga0207684_10008538 3300025910 Bacteria 9111
296 Ga0207684_10017509 3300025910 Bacteria 6146
297 Ga0207707_10075607 3300025912 Archaea 2939
298 Ga0207695_10000046 3300025913 Bacteria 430344
299 Ga0207695_10025575 3300025913 Bacteria 6605
300 Ga0207660_10007073 3300025917 Bacteria 7269
301 Ga0207660_10021118 3300025917 Unclassified 4376
302 Ga0207662_10020956 3300025918 Unclassified 3731
303 Ga0207646_10001678 3300025922 Bacteria 26971
304 Ga0207681_10001304 3300025923 Bacteria 16067
305 Ga0207681_10002964 3300025923 Archaea 10695
306 Ga0207694_10001688 3300025924 Bacteria 18504
307 Ga0207650_10000029 3300025925 Bacteria 236660
308 Ga0207650_10000065 3300025925 Bacteria 140452
309 Ga0207650_10001249 3300025925 Bacteria 18464
310 Ga0207650_10014576 3300025925 Bacteria 5460
311 Ga0207650_10026882 3300025925 Unclassified 4111
312 Ga0207650_10032555 3300025925 Bacteria 3771
313 Ga0207644_10001158 3300025931 Bacteria 16898
314 Ga0207644_10012169 3300025931 Bacteria 5710
315 Ga0207644_10016311 3300025931 Bacteria 4997
316 Ga0207709_10001218 3300025935 Bacteria 18493
317 Ga0207704_10001351 3300025938 Bacteria 10950
318 Ga0207704_10022050 3300025938 Unclassified 3404
319 Ga0207691_10003587 3300025940 Bacteria 15089
320 Ga0207691_10038791 3300025940 Unclassified 4408
321 Ga0207711_10000541 3300025941 Bacteria 38660
322 Ga0207711_10111920 3300025941 Bacteria 2429
323 Ga0207689_10000510 3300025942 Bacteria 36782
324 Ga0207667_10000376 3300025949 Bacteria 60436
325 Ga0207651_10023039 3300025960 Unclassified 3822
326 Ga0207651_10037433 3300025960 Bacteria 3178
327 Ga0207712_10001334 3300025961 Bacteria 16898
328 Ga0207712_10001384 3300025961 Bacteria 16603
329 Ga0207712_10002216 3300025961 Bacteria 12663
330 Ga0207668_10000032 3300025972 Bacteria 122020
331 Ga0207668_10000270 3300025972 Bacteria 34548
332 Ga0207668_10057755 3300025972 Unclassified 2709
333 Ga0207640_10050114 3300025981 Archaea 2707
334 Ga0207658_10000002 3300025986 Bacteria 1364188
335 Ga0207658_10000550 3300025986 Bacteria 33998
336 Ga0207658_10000727 3300025986 Bacteria 28461
337 Ga0207658_10003762 3300025986 Bacteria 10684
338 Ga0207658_10061770 3300025986 Unclassified 2801
339 Ga0207703_10004487 3300026035 Bacteria 11458
340 Ga0207678_10018939 3300026067 Bacteria 6049
341 Ga0207708_10031040 3300026075 Unclassified 4055
342 Ga0207702_10107610 3300026078 Bacteria 2473
343 Ga0207641_10000207 3300026088 Bacteria 77525
344 Ga0207641_10000665 3300026088 Bacteria 37469
345 Ga0207641_10000820 3300026088 Bacteria 33016
346 Ga0207641_10001126 3300026088 Bacteria 26877
347 Ga0207641_10003626 3300026088 Bacteria 13620
348 Ga0207648_10003447 3300026089 Archaea 16589
349 Ga0207676_10000059 3300026095 Bacteria 119553
350 Ga0207676_10000062 3300026095 Bacteria 112045
351 Ga0207676_10000112 3300026095 Bacteria 73166
352 Ga0207676_10037411 3300026095 Bacteria 3698
353 Ga0207674_10006059 3300026116 Archaea 14304
354 Ga0207675_100004219 3300026118 Bacteria 13909
355 Ga0207683_10003862 3300026121 Bacteria 13005
356 Ga0209281_1011381 3300027111 Bacteria 1996
357 Ga0209969_1000082 3300027360 Archaea 11724
358 Ga0209967_1000794 3300027364 Archaea 4047
359 Ga0209996_1000969 3300027395 Unclassified 3409
360 Ga0210000_1000841 3300027462 Unclassified 4258
361 Ga0209995_1000317 3300027471 Archaea 7578
362 Ga0209968_1000295 3300027526 Archaea 8451
363 Ga0209982_1000024 3300027552 Archaea 13516
364 Ga0209982_1000199 3300027552 Archaea 6971
365 Ga0209970_1001209 3300027614 Unclassified 4548
366 Ga0210002_1000307 3300027617 Archaea 6744
367 Ga0209983_1001673 3300027665 Archaea 4914
368 Ga0209971_1001320 3300027682 Archaea 6164
369 Ga0209971_1002712 3300027682 Archaea 4234
370 Ga0209966_1001021 3300027695 Archaea 5214
371 Ga0209998_10001830 3300027717 Archaea 5039
372 Ga0209813_10000202 3300027866 Bacteria 18474
373 Ga0209974_10000060 3300027876 Archaea 28862
374 Ga0209974_10001948 3300027876 Archaea 7538
375 Ga0207428_10002822 3300027907 Archaea 17254
376 Ga0268266_10000003 3300028379 Bacteria 1701703
377 Ga0268266_10000310 3300028379 Bacteria 77329
378 Ga0268265_10000018 3300028380 Bacteria 285651
379 Ga0268265_10000510 3300028380 Bacteria 39909
380 Ga0268265_10000658 3300028380 Bacteria 34307
381 Ga0268265_10002000 3300028380 Bacteria 16092
382 Ga0268264_10000001 3300028381 Bacteria 1221000
383 Ga0268264_10000172 3300028381 Bacteria 140393
384 Ga0268264_10000545 3300028381 Bacteria 47296
385 Ga0268264_10002306 3300028381 Bacteria 16898
386 Ga0268264_10029848 3300028381 Unclassified 4469
387 Ga0268264_10156651 3300028381 Bacteria 2048
388 Ga0265319_1004164 3300028563 Bacteria 7243
389 Ga0265323_10008419 3300028653 Bacteria 4251
390 Ga0265336_10000053 3300028666 Bacteria 113034
391 Ga0307515_10000040 3300028794 Bacteria 322704
392 Ga0307515_10016158 3300028794 Bacteria 13688
393 Ga0265324_10000132 3300029957 Bacteria 58866
394 Ga0265330_10008204 3300031235 Bacteria 5038
395 Ga0265332_10001555 3300031238 Bacteria 12620
396 Ga0265331_10020698 3300031250 Bacteria 3374
397 Ga0265331_10024577 3300031250 Bacteria 3046
398 Ga0265327_10014470 3300031251 Bacteria 5158
399 Ga0307408_100000062 3300031548 Bacteria 127855
400 Ga0307408_100001177 3300031548 Bacteria 19819
401 Ga0307408_100003847 3300031548 Bacteria 10215
402 Ga0307408_100016239 3300031548 Bacteria 4965
403 Ga0307508_10002456 3300031616 Bacteria 19542
404 Ga0265314_10011758 3300031711 Bacteria 7200
405 Ga0265314_10015847 3300031711 Bacteria 5970
406 Ga0316576_10000782 3300031727 Bacteria 15952
407 Ga0316576_10040284 3300031727 Bacteria 3357
408 Ga0307516_10000445 3300031730 Bacteria 54452
409 Ga0307405_10004857 3300031731 Bacteria 6417
410 Ga0307405_10021709 3300031731 Bacteria 3614
411 Ga0307410_10016013 3300031852 Bacteria 4460
412 Ga0307406_10000741 3300031901 Bacteria 18289
413 Ga0307412_10015598 3300031911 Bacteria 4509
414 Ga0307416_100015543 3300032002 Bacteria 5261
415 Ga0307416_100072967 3300032002 Bacteria 2859
416 Ga0307416_100136192 3300032002 Bacteria 2222
417 Ga0307415_100004143 3300032126 Archaea 7476
418 Ga0307510_10040256 3300033180 Bacteria 5134
419 Ga0395900_0007909 3300037418 Bacteria 10950
420 Ga0395900_0029284 3300037418 Bacteria 5649
421 Ga0395900_0079269 3300037418 Bacteria 3374
422 Ga0395905_0000096 3300037471 Bacteria 146075
423 Ga0395905_0000455 3300037471 Bacteria 57161
424 Ga0436364_0423441 3300037853 Bacteria 2333
425 Ga0395901_0027577 3300038443 Bacteria 5837
426 Ga0395901_0050191 3300038443 Bacteria 4335
427 Ga0395901_0142178 3300038443 Bacteria 2522
428 Ga0436365_1090173 3300039437 Bacteria 2597
429 Ga0436360_1007958 3300039438 Bacteria 2165
430 Ga0436361_1139987 3300039447 Bacteria 3266
431 Ga0439436_0003741 3300041404 Bacteria 4642
432 Ga0439436_0017761 3300041404 Bacteria 2128
433 Ga0439466_0004200 3300041411 Bacteria 5558
434 Ga0439465_0007082 3300041413 Bacteria 3564
435 Ga0451807_1206156 3300041486 Bacteria 14170
436 Ga0451837_0336576 3300041494 Bacteria 2025
437 Ga0439433_0001384 3300041999 Bacteria 4980
438 Ga0439432_001342 3300042006 Bacteria 9315
439 Ga0439432_001947 3300042006 Bacteria 7794
440 Ga0439449_0002099 3300042007 Bacteria 7835
441 Ga0439457_002233 3300042014 Bacteria 5599
442 Ga0439462_0010702 3300042015 Bacteria 2327
443 Ga0439463_010268 3300042016 Archaea 2301
444 Ga0439446_0005500 3300042156 Archaea 3261
445 Ga0439446_0006774 3300042156 Archaea 2999
446 Ga0439444_0000586 3300042437 Archaea 4174
447 Ga0439440_0001141 3300042993 Archaea 4752
448 Ga0439440_0002103 3300042993 Archaea 3721
449 Ga0466969_0007912 3300044656 Bacteria 5642
450 Ga0453683_0086173 3300044673 Unclassified 1968
451 Ga0466964_0007314 3300044706 Bacteria 4131
452 Ga0453684_0000019 3300044712 Bacteria 908702
453 Ga0453684_0004505 3300044712 Bacteria 29272
454 Ga0453684_0039740 3300044712 Bacteria 6402
455 Ga0453684_0075444 3300044712 Bacteria 4238
456 Ga0466959_0002098 3300045049 Bacteria 12608
457 Ga0451576_0009293 3300045051 Bacteria 11419
458 Ga0495629_0025021 3300046459 Bacteria 4247
459 Ga0495638_0076440 3300046460 Bacteria 2040
460 Ga0495650_0000044 3300046471 Bacteria 355139
461 Ga0495650_0000278 3300046471 Bacteria 97767
462 Ga0495650_0000845 3300046471 Bacteria 36844
463 Ga0495650_0005257 3300046471 Bacteria 8479
464 Ga0495580_0006570 3300046472 Bacteria 9453
465 Ga0495606_0000015 3300046507 Bacteria 288808
466 Ga0495606_0001662 3300046507 Bacteria 28894
467 Ga0495610_0000008 3300046512 Bacteria 622732
468 Ga0495620_0029620 3300046515 Bacteria 2531
469 Ga0495631_0000073 3300046518 Bacteria 64358
470 Ga0495643_0000950 3300046522 Bacteria 29967
471 Ga0495648_0017900 3300046524 Bacteria 5046
472 Ga0495654_0005977 3300046530 Bacteria 6993
473 Ga0495586_0005273 3300046535 Bacteria 6915
474 Ga0495625_0043440 3300046660 Bacteria 3259
475 Ga0495588_0007690 3300046674 Bacteria 4921
476 Ga0495588_0012491 3300046674 Bacteria 4016
477 Ga0495670_0005795 3300046691 Bacteria 6052
478 Ga0495671_0000002 3300046692 Bacteria 1136189
479 Ga0495671_0063832 3300046692 Bacteria 1814
480 Ga0495660_0029454 3300046810 Bacteria 3097
481 Ga0495673_0000064 3300047469 Bacteria 225793
482 Ga0495686_0000772 3300047472 Bacteria 42035
483 Ga0495686_0001427 3300047472 Bacteria 26117
484 Ga0495593_0014971 3300047673 Bacteria 4403
485 Ga0496100_0038917 3300048903 Bacteria 3016
486 Ga0496101_0015408 3300048904 Bacteria 5151
487 Ga0496102_0005863 3300048905 Bacteria 10455
488 Ga0496102_0028193 3300048905 Bacteria 5014
489 Ga0496102_0066853 3300048905 Bacteria 3295
490 Ga0496102_0124112 3300048905 Bacteria 2413
491 Ga0496102_0237271 3300048905 Bacteria 1719
492 Ga0496103_0003692 3300048906 Bacteria 9302
493 Ga0496103_0016807 3300048906 Bacteria 4369
494 Ga0496105_0001832 3300048908 Bacteria 15215
495 Ga0496106_0000693 3300048909 Bacteria 24211
496 Ga0496106_0101760 3300048909 Bacteria 2228
497 Ga0496107_0000187 3300048910 Bacteria 32256
498 Ga0496107_0043350 3300048910 Bacteria 3232
499 Ga0496107_0105785 3300048910 Bacteria 2066
500 Ga0496108_0129066 3300048911 Bacteria 2172
501 Ga0496109_0004265 3300048912 Bacteria 11941
502 Ga0496110_0027024 3300048913 Bacteria 4917
503 Ga0496111_0007280 3300048914 Bacteria 7242
504 Ga0496112_0011757 3300048915 Bacteria 8014
505 Ga0496112_0114592 3300048915 Bacteria 2666
506 Ga0496113_0005238 3300048916 Bacteria 8074
507 Ga0496115_0003355 3300048918 Bacteria 11493
508 Ga0496116_0012796 3300048919 Bacteria 6817
509 Ga0496117_0021324 3300048920 Bacteria 5246
510 Ga0496119_0027011 3300048922 Bacteria 3961
511 Ga0496120_0040413 3300048923 Bacteria 2741
512 Ga0496122_0026471 3300048925 Bacteria 4997
513 Ga0496124_0126391 3300048927 Bacteria 2036
514 Ga0496125_0016404 3300048928 Bacteria 7115
515 Ga0496125_0026960 3300048928 Bacteria 5217
516 Ga0496126_0015868 3300048929 Bacteria 7564
517 Ga0501306_002834 3300049127 Bacteria 1816
518 Ga0495678_003089 3300049459 Bacteria 10555
519 Ga0501300_005079 3300049523 Bacteria 1945
520 Ga0501031_0018972 3300049568 Bacteria 4477
521 Ga0501031_0024015 3300049568 Bacteria 3975
522 Ga0501031_0038163 3300049568 Archaea 3135
523 Ga0501031_0086026 3300049568 Bacteria 2050
524 Ga0501032_0000292 3300049569 Bacteria 42003
525 Ga0501032_0006773 3300049569 Bacteria 8408
526 Ga0501032_0019362 3300049569 Bacteria 4761
527 Ga0501033_0001436 3300049570 Bacteria 21146
528 Ga0501033_0001894 3300049570 Bacteria 18196
529 Ga0501033_0070890 3300049570 Bacteria 2560
530 Ga0501034_0000075 3300049571 Bacteria 175296
531 Ga0501034_0002517 3300049571 Bacteria 21984
532 Ga0501034_0036472 3300049571 Bacteria 4981
533 Ga0501034_0096718 3300049571 Bacteria 2948
534 Ga0501036_0001559 3300049572 Bacteria 17695
535 Ga0501036_0025161 3300049572 Bacteria 5021
536 Ga0501036_0037725 3300049572 Archaea 4088
537 Ga0501036_0037746 3300049572 Bacteria 4086
538 Ga0501036_0060084 3300049572 Archaea 3220
539 Ga0501036_0067583 3300049572 Bacteria 3024
540 Ga0501037_0014524 3300049573 Bacteria 5792
541 Ga0501037_0023747 3300049573 Bacteria 4533
542 Ga0501037_0030396 3300049573 Archaea 3992
543 Ga0501038_0000047 3300049574 Bacteria 104311
544 Ga0501038_0017494 3300049574 Bacteria 6479
545 Ga0501038_0094256 3300049574 Bacteria 2503
546 Ga0501038_0104153 3300049574 Archaea 2358
547 Ga0501039_0000038 3300049575 Bacteria 119484
548 Ga0501039_0005233 3300049575 Archaea 9827
549 Ga0501039_0029122 3300049575 Bacteria 4252
550 Ga0501039_0068991 3300049575 Bacteria 2745
551 Ga0501039_0078491 3300049575 Bacteria 2569
552 Ga0501039_0096391 3300049575 Archaea 2306
553 Ga0501040_0000247 3300049576 Archaea 31740
554 Ga0501040_0025687 3300049576 Archaea 3962
555 Ga0501040_0033569 3300049576 Archaea 3477
556 Ga0501041_0006353 3300049577 Archaea 6915
557 Ga0501041_0006447 3300049577 Archaea 6869
558 Ga0501041_0054246 3300049577 Archaea 2445
559 Ga0501042_0000550 3300049578 Archaea 19749
560 Ga0501042_0021305 3300049578 Archaea 4515
561 Ga0501043_0000131 3300049579 Bacteria 69743
562 Ga0501043_0005982 3300049579 Bacteria 9779
563 Ga0501043_0050614 3300049579 Archaea 3265
564 Ga0501043_0106375 3300049579 Bacteria 2203
565 Ga0501046_0000123 3300049580 Bacteria 82426
566 Ga0501046_0006134 3300049580 Archaea 10678
567 Ga0501046_0017614 3300049580 Archaea 5958
568 Ga0501046_0019090 3300049580 Bacteria 5687
569 Ga0501046_0041422 3300049580 Bacteria 3675
570 Ga0501046_0047824 3300049580 Bacteria 3390
571 Ga0501047_0003356 3300049581 Bacteria 15165
572 Ga0501047_0056812 3300049581 Bacteria 3785
573 Ga0501048_0007473 3300049582 Archaea 8280
574 Ga0501048_0009801 3300049582 Archaea 7182
575 Ga0501048_0102005 3300049582 Bacteria 2024
576 Ga0501068_0020202 3300049584 Bacteria 3878
577 Ga0501070_0000158 3300049586 Bacteria 62570
578 Ga0501070_0010652 3300049586 Bacteria 7773
579 Ga0501071_0000120 3300049587 Archaea 31276
580 Ga0501071_0002565 3300049587 Archaea 11082
581 Ga0501071_0114297 3300049587 Archaea 1997
582 Ga0501072_0001202 3300049588 Archaea 19316
583 Ga0501072_0022257 3300049588 Archaea 4917
584 Ga0501075_0000234 3300049591 Archaea 29814
585 Ga0501075_0043112 3300049591 Archaea 3384
586 Ga0501075_0058938 3300049591 Archaea 2892
587 Ga0501076_0000063 3300049592 Archaea 53782
588 Ga0501077_0001160 3300049593 Archaea 15911
589 Ga0501257_000123 3300049686 Bacteria 17830
590 Ga0501079_0006499 3300049741 Bacteria 8781
591 Ga0501079_0007106 3300049741 Archaea 8448
592 Ga0501080_0019428 3300049742 Bacteria 6294
593 Ga0501080_0023819 3300049742 Archaea 5674
594 Ga0501080_0096702 3300049742 Bacteria 2742
595 Ga0501081_0000569 3300049743 Archaea 21017
596 Ga0501081_0017425 3300049743 Archaea 4754
597 Ga0501035_0000168 3300049822 Bacteria 80065
598 Ga0501035_0047125 3300049822 Bacteria 3871
599 Ga0501035_0058886 3300049822 Bacteria 3421
600 Ga0501035_0183355 3300049822 Bacteria 1802
601 Ga0501044_0000025 3300049823 Bacteria 187867
602 Ga0501044_0001132 3300049823 Bacteria 31684
603 Ga0501044_0012550 3300049823 Bacteria 9177
604 Ga0501044_0132311 3300049823 Bacteria 2488
605 Ga0501045_0000843 3300049824 Bacteria 19892
606 Ga0501045_0002594 3300049824 Archaea 12331
607 Ga0501045_0068597 3300049824 Archaea 2605
608 Ga0501212_001390 3300049851 Bacteria 2715
609 nmdc:mga03683_159_c1 3300050489 Bacteria 22644
610 nmdc:mga00v17_25919_c1 3300050491 Bacteria 3411
611 nmdc:mga00v17_61133_c1 3300050491 Bacteria 2315
612 nmdc:mga0yw44_26504_c1 3300050492 Bacteria 3312
613 nmdc:mga06z11_266_c1 3300050494 Bacteria 20295
614 nmdc:mga04h51_4635_c1 3300050495 Bacteria 3438
615 nmdc:mga07m45_7_c1 3300050496 Bacteria 223540
616 nmdc:mga05p37_150874_c1 3300050507 Unclassified 2843
617 nmdc:mga05p37_20518_c1 3300050507 Bacteria 7994
618 nmdc:mga05p37_43754_c1 3300050507 Bacteria 5510
619 nmdc:mga09592_10123_c1 3300050508 Bacteria 7670
620 nmdc:mga09592_116115_c1 3300050508 Unclassified 2297
621 nmdc:mga09592_45846_c1 3300050508 Archaea 3683
622 nmdc:mga0qj67_10103_c1 3300050509 Archaea 7044
623 nmdc:mga06r32_138337_c1 3300050510 Unclassified 2410
624 nmdc:mga08y16_18684_c1 3300050511 Archaea 7302
625 nmdc:mga08y16_68682_c1 3300050511 Bacteria 3695
626 nmdc:mga0n895_124048_c1 3300050512 Unclassified 2605
627 nmdc:mga0n895_42062_c1 3300050512 Bacteria 4445
628 nmdc:mga0n895_46721_c1 3300050512 Bacteria 4231
629 nmdc:mga0rr50_10537_c1 3300050513 Bacteria 5872
630 nmdc:mga0a205_111268_c1 3300050515 Bacteria 2638
631 nmdc:mga0sz30_607_c1 3300050516 Bacteria 13285
632 Ga0500610_0000329 3300053079 Bacteria 14347
633 Ga0500651_0000223 3300053093 Bacteria 35661
634 Ga0500572_002946 3300053111 Bacteria 3991
635 Ga0500607_000831 3300053121 Bacteria 29726
636 Ga0500608_027482 3300053122 Bacteria 2681
637 Ga0500655_002702 3300053133 Bacteria 3213
638 Ga0500658_0001544 3300053134 Bacteria 9206
639 Ga0500658_0004395 3300053134 Bacteria 5279
640 Ga0500559_0005939 3300053136 Bacteria 5550
641 Ga0500590_000393 3300053148 Bacteria 14572
642 Ga0500616_0000042 3300053153 Bacteria 351293
643 Ga0500616_0064772 3300053153 Bacteria 1881
644 Ga0500622_0007819 3300053156 Bacteria 6026
645 Ga0500636_0000443 3300053177 Bacteria 22859
646 Ga0500611_000013 3300053727 Bacteria 135447
647 Ga0501084_0003507 3300054114 Bacteria 12748
648 Ga0501084_0008330 3300054114 Archaea 8558
649 Ga0501082_0000455 3300060353 Archaea 36269
650 Ga0530510_0016352 3300061734 Archaea 5249
651 Ga0530510_0020016 3300061734 Archaea 4757

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049577 Ga0501041_0054246 Ga0501041_0054246_915_2402 476
2 3300049824 Ga0501045_0068597 Ga0501045_0068597_47_1534 476
3 3300048905 Ga0496102_0237271 Ga0496102_0237271_142_1686 481
4 3300049582 Ga0501048_0102005 Ga0501048_0102005_501_2009 486
5 3300049127 Ga0501306_002834 Ga0501306_002834_220_1773 493
6 3300046460 Ga0495638_0076440 Ga0495638_0076440_23_1579 498
7 3300050491 nmdc:mga00v17_61133_c1 nmdc:mga00v17_61133_c1_745_2304 501
8 3300028381 Ga0268264_10156651 Ga0268264_101566512 502
9 3300046692 Ga0495671_0063832 Ga0495671_0063832_88_1704 506
10 3300046691 Ga0495670_0005795 Ga0495670_0005795_475_2235 513
11 3300009553 Ga0105249_10063805 Ga0105249_100638054 515
12 3300005334 Ga0068869_100000041 Ga0068869_10000004129 516
13 3300006237 Ga0097621_100002902 Ga0097621_1000029027 516
14 3300025938 Ga0207704_10001351 Ga0207704_100013514 516
15 3300025942 Ga0207689_10000510 Ga0207689_1000051034 516
16 3300005328 Ga0070676_10012779 Ga0070676_100127794 522
17 3300005353 Ga0070669_100046547 Ga0070669_1000465472 522
18 3300005364 Ga0070673_100011960 Ga0070673_1000119601 522
19 3300005543 Ga0070672_100090694 Ga0070672_1000906942 522
20 3300005548 Ga0070665_100215537 Ga0070665_1002155372 522
21 3300025290 Ga0207673_1002416 Ga0207673_10024161 522
22 3300025728 Ga0207655_1004596 Ga0207655_100459611 522
23 3300025907 Ga0207645_10001502 Ga0207645_1000150211 522
24 3300025940 Ga0207691_10003587 Ga0207691_1000358715 522
25 3300025960 Ga0207651_10037433 Ga0207651_100374333 522
26 3300026121 Ga0207683_10003862 Ga0207683_100038628 522
27 3300039447 Ga0436361_1139987 Ga0436361_1139987_1279_2979 522
28 3300025925 Ga0207650_10032555 Ga0207650_100325553 527
29 3300025918 Ga0207662_10020956 Ga0207662_100209561 529
30 3300005843 Ga0068860_100000183 Ga0068860_1000001838 532
31 3300006847 Ga0075431_100066395 Ga0075431_1000663952 532
32 3300009094 Ga0111539_10043823 Ga0111539_100438231 532
33 3300028381 Ga0268264_10000545 Ga0268264_1000054544 532
34 3300053153 Ga0500616_0064772 Ga0500616_0064772_11_1666 532
35 3300037853 Ga0436364_0423441 Ga0436364_0423441_229_1929 534
36 3300049569 Ga0501032_0006773 Ga0501032_0006773_1434_3164 535
37 3300049571 Ga0501034_0000075 Ga0501034_0000075_165602_167332 535
38 3300049574 Ga0501038_0094256 Ga0501038_0094256_754_2484 535
39 3300044673 Ga0453683_0086173 Ga0453683_0086173_201_1880 536
40 3300003791 Ga0055530_10013423 Ga0055530_100134233 537
41 3300025298 Ga0209050_1002064 Ga0209050_100206415 537
42 3300003911 JGI25405J52794_10000912 JGI25405J52794_100009126 538
43 3300005937 Ga0081455_10005199 Ga0081455_100051997 538
44 3300005981 Ga0081538_10012622 Ga0081538_100126224 538
45 3300005983 Ga0081540_1008109 Ga0081540_10081095 538
46 3300006847 Ga0075431_100153338 Ga0075431_1001533383 538
47 3300006852 Ga0075433_10132950 Ga0075433_101329502 538
48 3300006880 Ga0075429_100014977 Ga0075429_1000149775 538
49 3300050507 nmdc:mga05p37_43754_c1 nmdc:mga05p37_43754_c1_2145_3860 538
50 3300050508 nmdc:mga09592_10123_c1 nmdc:mga09592_10123_c1_5758_7473 538
51 3300050510 nmdc:mga06r32_138337_c1 nmdc:mga06r32_138337_c1_638_2353 538
52 3300006844 Ga0075428_100115340 Ga0075428_1001153403 539
53 3300006847 Ga0075431_100030753 Ga0075431_1000307535 539
54 3300037471 Ga0395905_0000096 Ga0395905_0000096_18761_20491 539
55 3300046471 Ga0495650_0000044 Ga0495650_0000044_267179_268846 539
56 3300046507 Ga0495606_0001662 Ga0495606_0001662_2714_4381 539
57 3300050508 nmdc:mga09592_116115_c1 nmdc:mga09592_116115_c1_26_1741 539
58 3300050512 nmdc:mga0n895_124048_c1 nmdc:mga0n895_124048_c1_584_2299 539
59 3300013100 Ga0157373_10090937 Ga0157373_100909372 540
60 3300015265 Ga0182005_1000012 Ga0182005_100001290 540
61 3300041486 Ga0451807_1206156 Ga0451807_1206156_11952_13631 540
62 3300049568 Ga0501031_0018972 Ga0501031_0018972_915_2585 540
63 3300049568 Ga0501031_0024015 Ga0501031_0024015_497_2167 540
64 3300049569 Ga0501032_0019362 Ga0501032_0019362_118_1788 540
65 3300049570 Ga0501033_0001894 Ga0501033_0001894_16412_18082 540
66 3300049570 Ga0501033_0070890 Ga0501033_0070890_166_1836 540
67 3300049572 Ga0501036_0037746 Ga0501036_0037746_2128_3798 540
68 3300049573 Ga0501037_0014524 Ga0501037_0014524_724_2394 540
69 3300049574 Ga0501038_0017494 Ga0501038_0017494_1758_3428 540
70 3300049575 Ga0501039_0029122 Ga0501039_0029122_690_2360 540
71 3300049579 Ga0501043_0106375 Ga0501043_0106375_410_2080 540
72 3300049580 Ga0501046_0041422 Ga0501046_0041422_1483_3153 540
73 3300049580 Ga0501046_0047824 Ga0501046_0047824_57_1727 540
74 3300049584 Ga0501068_0020202 Ga0501068_0020202_16_1686 540
75 3300049822 Ga0501035_0047125 Ga0501035_0047125_776_2446 540
76 3300049822 Ga0501035_0058886 Ga0501035_0058886_1323_2999 540
77 3300049822 Ga0501035_0183355 Ga0501035_0183355_108_1778 540
78 3300049824 Ga0501045_0000843 Ga0501045_0000843_12477_14147 540
79 3300014325 Ga0163163_10007941 Ga0163163_100079417 541
80 3300037418 Ga0395900_0007909 Ga0395900_0007909_7314_9032 541
81 3300038443 Ga0395901_0050191 Ga0395901_0050191_460_2178 541
82 3300049742 Ga0501080_0096702 Ga0501080_0096702_614_2290 541
83 3300005467 Ga0070706_100089664 Ga0070706_1000896642 542
84 3300005471 Ga0070698_100004704 Ga0070698_10000470413 542
85 3300046522 Ga0495643_0000950 Ga0495643_0000950_587_2314 542
86 3300005331 Ga0070670_100098502 Ga0070670_1000985022 543
87 3300031548 Ga0307408_100003847 Ga0307408_10000384710 543
88 3300048905 Ga0496102_0066853 Ga0496102_0066853_67_1806 543
89 3300048906 Ga0496103_0016807 Ga0496103_0016807_430_2169 543
90 3300005327 Ga0070658_10047454 Ga0070658_100474545 544
91 3300005467 Ga0070706_100126604 Ga0070706_1001266043 544
92 3300005468 Ga0070707_100119488 Ga0070707_1001194882 544
93 3300005471 Ga0070698_100023650 Ga0070698_1000236507 544
94 3300007076 Ga0075435_100024815 Ga0075435_1000248154 544
95 3300025909 Ga0207705_10005109 Ga0207705_100051095 544
96 3300050512 nmdc:mga0n895_46721_c1 nmdc:mga0n895_46721_c1_1327_3033 544
97 3300047673 Ga0495593_0014971 Ga0495593_0014971_565_2334 546
98 iso_pu_bacteria 2510065053 2510284229 546
99 iso_pu_bacteria 2510065055 2510293087 546
100 iso_pu_bacteria 2510065058 2510312588 546
101 iso_pu_bacteria 2738541297 2738828607 546
102 iso_pu_bacteria 2738541357 2739152403 546
103 iso_pu_bacteria 2738543003 2739194323 546
104 iso_pu_bacteria 2738543026 2739320799 546
105 iso_pu_bacteria 2738543029 2739339040 546
106 iso_pu_bacteria 2773857672 2774131443 546
107 iso_pu_bacteria 2857564685 2857568762 546
108 iso_pu_bacteria 2857740372 2857743132 546
109 iso_pu_bacteria 2904497146 2904497303 546
110 iso_pu_bacteria 2904776348 2904780420 546
111 iso_pu_bacteria 2910809715 2910812521 546
112 iso_pu_bacteria 2919034639 2919038401 546
113 iso_pu_bacteria 2919059106 2919063446 546
114 iso_pu_bacteria 2919538618 2919540050 546
115 iso_pu_bacteria 2932426870 2932428903 546
116 iso_pu_bacteria 2933418574 2933421829 546
117 iso_pu_bacteria 2939647034 2939647801 546
118 iso_pu_bacteria 2939674588 2939678142 546
119 iso_pu_bacteria 2974298342 2974301644 546
120 iso_pu_bacteria 2984499530 2984500781 546
121 iso_pu_bacteria 2998344455 2998347741 546
122 iso_pu_bacteria 639633007 639788670 546
123 3300005842 Ga0068858_100030355 Ga0068858_1000303554 547
124 3300007265 Ga0099794_10050939 Ga0099794_100509392 547
125 3300025711 Ga0207696_1006850 Ga0207696_10068501 547
126 3300031548 Ga0307408_100016239 Ga0307408_1000162395 547
127 3300049851 Ga0501212_001390 Ga0501212_001390_716_2413 547
128 iso_pu_bacteria 2554235227 2555230018 547
129 iso_pu_bacteria 2643221731 2644717310 547
130 iso_pu_bacteria 2643221732 2644726123 547
131 iso_pu_bacteria 2654587600 2655032735 547
132 iso_pu_bacteria 2690315906 2691512337 547
133 iso_pu_bacteria 2808606366 2808876741 547
134 iso_pu_bacteria 2808606370 2808893852 547
135 iso_pu_bacteria 2808606371 2808898253 547
136 iso_pu_bacteria 2818991465 2819710727 547
137 iso_pu_bacteria 2904524088 2904526109 547
138 iso_pu_bacteria 2919143609 2919145298 547
139 iso_pu_bacteria 2919391150 2919392037 547
140 iso_pu_bacteria 2919517244 2919520486 547
141 iso_pu_bacteria 2919720352 2919721619 547
142 iso_pu_bacteria 2928093941 2928094622 547
143 iso_pu_bacteria 2929004312 2929006855 547
144 iso_pu_bacteria 2945956166 2945956712 547
145 iso_pu_bacteria 2946787523 2946791113 547
146 iso_pu_bacteria 2956897341 2956900521 547
147 iso_pu_bacteria 2960319331 2960324519 547
148 iso_pu_bacteria 2960375949 2960376171 547
149 iso_pu_bacteria 2971410472 2971415834 547
150 iso_pu_bacteria 8004021418 8004024688 547
151 iso_pu_bacteria 8004025490 8004029506 547
152 iso_pu_bacteria 8022893055 8022893373 547
153 iso_pu_bacteria 8022914991 8022920300 547
154 iso_pu_bacteria 8056533031 8056537273 547
155 iso_pu_bacteria 8057977335 8057979287 547
156 3300005343 Ga0070687_100022165 Ga0070687_1000221653 548
157 3300005353 Ga0070669_100011121 Ga0070669_1000111216 548
158 3300005365 Ga0070688_100072642 Ga0070688_1000726422 548
159 3300005367 Ga0070667_100012664 Ga0070667_1000126647 548
160 3300005518 Ga0070699_100016619 Ga0070699_1000166192 548
161 3300005841 Ga0068863_100023115 Ga0068863_1000231155 548
162 3300005842 Ga0068858_100011563 Ga0068858_1000115632 548
163 3300005843 Ga0068860_100141147 Ga0068860_1001411473 548
164 3300005985 Ga0081539_10006832 Ga0081539_100068323 548
165 3300009147 Ga0114129_10005078 Ga0114129_100050786 548
166 3300009177 Ga0105248_10004062 Ga0105248_100040622 548
167 3300014968 Ga0157379_10021714 Ga0157379_100217142 548
168 3300021377 Ga0213874_10002139 Ga0213874_100021392 548
169 3300025923 Ga0207681_10001304 Ga0207681_100013043 548
170 3300025931 Ga0207644_10012169 Ga0207644_100121695 548
171 3300025940 Ga0207691_10038791 Ga0207691_100387914 548
172 3300025960 Ga0207651_10023039 Ga0207651_100230394 548
173 3300025986 Ga0207658_10061770 Ga0207658_100617704 548
174 3300026088 Ga0207641_10001126 Ga0207641_1000112610 548
175 3300048905 Ga0496102_0005863 Ga0496102_0005863_1197_2981 548
176 3300048905 Ga0496102_0124112 Ga0496102_0124112_248_1948 548
177 3300048906 Ga0496103_0003692 Ga0496103_0003692_4059_5843 548
178 3300048909 Ga0496106_0101760 Ga0496106_0101760_215_2017 548
179 3300050511 nmdc:mga08y16_68682_c1 nmdc:mga08y16_68682_c1_1822_3528 548
180 3300053153 Ga0500616_0000042 Ga0500616_0000042_39240_40943 548
181 iso_pu_bacteria 2513020051 2513229140 548
182 iso_pu_bacteria 2599185214 2599623440 548
183 iso_pu_bacteria 2599185226 2599675342 548
184 iso_pu_bacteria 2599185227 2599681045 548
185 iso_pu_bacteria 2599185229 2599693060 548
186 iso_pu_bacteria 2643221551 2643777674 548
187 iso_pu_bacteria 2643221555 2643796122 548
188 iso_pu_bacteria 2643221658 2644325598 548
189 iso_pu_bacteria 2643221672 2644399317 548
190 iso_pu_bacteria 2643221674 2644411466 548
191 iso_pu_bacteria 2738541277 2738718157 548
192 iso_pu_bacteria 2738543013 2739247998 548
193 iso_pu_bacteria 2738543019 2739281344 548
194 iso_pu_bacteria 2818991446 2819600616 548
195 iso_pu_bacteria 2885211737 2885211747 548
196 iso_pu_bacteria 2899924645 2899928236 548
197 iso_pu_bacteria 2904449895 2904452479 548
198 iso_pu_bacteria 2904456579 2904460921 548
199 iso_pu_bacteria 2904541872 2904545175 548
200 iso_pu_bacteria 2928037797 2928041187 548
201 iso_pu_bacteria 2928044640 2928048029 548
202 iso_pu_bacteria 2928051484 2928055870 548
203 iso_pu_bacteria 2928064002 2928066648 548
204 iso_pu_bacteria 2928070936 2928077198 548
205 iso_pu_bacteria 2928084124 2928087499 548
206 iso_pu_bacteria 2929160207 2929165352 548
207 iso_pu_bacteria 2929520902 2929522904 548
208 iso_pu_bacteria 2939631187 2939635894 548
209 iso_pu_bacteria 2945909444 2945910045 548
210 iso_pu_bacteria 2945984333 2945987938 548
211 iso_pu_bacteria 2954767861 2954768935 548
212 iso_pu_bacteria 8039098773 8039099336 548
213 3300005347 Ga0070668_100042657 Ga0070668_1000426572 549
214 3300028653 Ga0265323_10008419 Ga0265323_100084196 549
215 3300031235 Ga0265330_10008204 Ga0265330_100082043 549
216 3300031238 Ga0265332_10001555 Ga0265332_1000155512 549
217 3300031250 Ga0265331_10024577 Ga0265331_100245773 549
218 3300031251 Ga0265327_10014470 Ga0265327_100144705 549
219 3300031616 Ga0307508_10002456 Ga0307508_1000245614 549
220 3300031711 Ga0265314_10011758 Ga0265314_100117585 549
221 3300039438 Ga0436360_1007958 Ga0436360_1007958_98_1798 549
222 3300044712 Ga0453684_0004505 Ga0453684_0004505_14812_16509 549
223 3300046459 Ga0495629_0025021 Ga0495629_0025021_2067_3851 549
224 3300046535 Ga0495586_0005273 Ga0495586_0005273_3213_5018 549
225 3300046674 Ga0495588_0007690 Ga0495588_0007690_1191_2936 549
226 3300049571 Ga0501034_0036472 Ga0501034_0036472_3243_4949 549
227 3300050507 nmdc:mga05p37_20518_c1 nmdc:mga05p37_20518_c1_5659_7374 549
228 iso_pu_bacteria 2509276021 2509390144 549
229 iso_pu_bacteria 2509276033 2509447569 549
230 iso_pu_bacteria 2510065019 2510134399 549
231 iso_pu_bacteria 2510461076 2510895823 549
232 iso_pu_bacteria 2510917030 2511195282 549
233 iso_pu_bacteria 2513237084 2513567488 549
234 iso_pu_bacteria 2513237085 2513577823 549
235 iso_pu_bacteria 2513237093 2513632031 549
236 iso_pu_bacteria 2513237103 2513712499 549
237 iso_pu_bacteria 2513237162 2514017870 549
238 iso_pu_bacteria 2515075009 2515113561 549
239 iso_pu_bacteria 2515154113 2515635275 549
240 iso_pu_bacteria 2515154114 2515643819 549
241 iso_pu_bacteria 2515154116 2515654907 549
242 iso_pu_bacteria 2515154134 2515739918 549
243 iso_pu_bacteria 2516653077 2517037177 549
244 iso_pu_bacteria 2516653085 2517077515 549
245 iso_pu_bacteria 2517093000 2517096285 549
246 iso_pu_bacteria 2517287029 2517408144 549
247 iso_pu_bacteria 2517487022 2517570638 549
248 iso_pu_bacteria 2519899620 2520381983 549
249 iso_pu_bacteria 2529292951 2530646357 549
250 iso_pu_bacteria 2582581298 2585225224 549
251 iso_pu_bacteria 2585427526 2585524944 549
252 iso_pu_bacteria 2585427528 2585542753 549
253 iso_pu_bacteria 2585427529 2585547780 549
254 iso_pu_bacteria 2585427593 2585841395 549
255 iso_pu_bacteria 2615840624 2616296623 549
256 iso_pu_bacteria 2643221637 2644208661 549
257 iso_pu_bacteria 2643221718 2644652191 549
258 iso_pu_bacteria 2718217927 2719386868 549
259 iso_pu_bacteria 2718217997 2719666604 549
260 iso_pu_bacteria 2718218199 2720493024 549
261 iso_pu_bacteria 2718218232 2720614503 549
262 iso_pu_bacteria 2718218233 2720621277 549
263 iso_pu_bacteria 2718218235 2720632603 549
264 iso_pu_bacteria 2718218269 2720776327 549
265 iso_pu_bacteria 2718218423 2721400591 549
266 iso_pu_bacteria 2721755556 2723027916 549
267 iso_pu_bacteria 2721755684 2723561546 549
268 iso_pu_bacteria 2721755685 2723568175 549
269 iso_pu_bacteria 2721755809 2724039404 549
270 iso_pu_bacteria 2721755819 2724090934 549
271 iso_pu_bacteria 2721755822 2724105440 549
272 iso_pu_bacteria 2721755823 2724111265 549
273 iso_pu_bacteria 2724679232 2725949241 549
274 iso_pu_bacteria 2728369352 2730108852 549
275 iso_pu_bacteria 2738541333 2739033266 549
276 iso_pu_bacteria 2765235942 2766066315 549
277 iso_pu_bacteria 2791355256 2793293985 549
278 iso_pu_bacteria 2791355259 2793314339 549
279 iso_pu_bacteria 2791355260 2793323828 549
280 iso_pu_bacteria 2791355262 2793335080 549
281 iso_pu_bacteria 2791355263 2793342332 549
282 iso_pu_bacteria 2791355265 2793355351 549
283 iso_pu_bacteria 2791355266 2793363041 549
284 iso_pu_bacteria 2791355267 2793369910 549
285 iso_pu_bacteria 2802428860 2802730416 549
286 iso_pu_bacteria 2802428861 2802737612 549
287 iso_pu_bacteria 2802429605 2805929567 549
288 iso_pu_bacteria 2802429606 2805936872 549
289 iso_pu_bacteria 2802429633 2806047492 549
290 iso_pu_bacteria 2802429634 2806055158 549
291 iso_pu_bacteria 2802429635 2806063032 549
292 iso_pu_bacteria 2802429636 2806069767 549
293 iso_pu_bacteria 2802429637 2806075696 549
294 iso_pu_bacteria 2818991448 2819609902 549
295 iso_pu_bacteria 2818991460 2819682336 549
296 iso_pu_bacteria 2857516855 2857516975 549
297 iso_pu_bacteria 2915980308 2915981178 549
298 iso_pu_bacteria 2916061851 2916062041 549
299 iso_pu_bacteria 2933570622 2933571275 549
300 iso_pu_bacteria 2933586486 2933591958 549
301 iso_pu_bacteria 2933599457 2933600504 549
302 iso_pu_bacteria 2935894831 2935896556 549
303 iso_pu_bacteria 2935901341 2935901450 549
304 iso_pu_bacteria 2936367885 2936371595 549
305 iso_pu_bacteria 2936375103 2936376968 549
306 iso_pu_bacteria 2936381700 2936383444 549
307 iso_pu_bacteria 2957375807 2957380655 549
308 iso_pu_bacteria 2960631154 2960634045 549
309 iso_pu_bacteria 2960680706 2960680771 549
310 iso_pu_bacteria 2967686174 2967691041 549
311 iso_pu_bacteria 2977544691 2977549637 549
312 iso_pu_bacteria 2996893221 2996898083 549
313 iso_pu_bacteria 3005445848 3005448863 549
314 iso_pu_bacteria 639633055 639649606 549
315 iso_pu_bacteria 8005275841 8005281679 549
316 iso_pu_bacteria 8005282627 8005284361 549
317 iso_pu_bacteria 8005289223 8005289613 549
318 iso_pu_bacteria 8005301065 8005303590 549
319 iso_pu_bacteria 8005307578 8005314103 549
320 iso_pu_bacteria 8005376324 8005382654 549
321 iso_pu_bacteria 8005382845 8005384617 549
322 iso_pu_bacteria 8005395548 8005395646 549
323 iso_pu_bacteria 8005430974 8005433883 549
324 iso_pu_bacteria 8005460587 8005464248 549
325 iso_pu_bacteria 8005497431 8005501352 549
326 iso_pu_bacteria 8005556819 8005561661 549
327 iso_pu_bacteria 8005563573 8005568439 549
328 iso_pu_bacteria 8005570704 8005573023 549
329 iso_pu_bacteria 8005619151 8005622714 549
330 iso_pu_bacteria 8005626139 8005630229 549
331 iso_pu_bacteria 8005645114 8005645822 549
332 iso_pu_bacteria 8005668836 8005672771 549
333 iso_pu_bacteria 8005688590 8005691630 549
334 iso_pu_bacteria 8005695170 8005696765 549
335 iso_pu_bacteria 8018127388 8018127600 549
336 iso_pu_bacteria 8018163183 8018163318 549
337 iso_pu_bacteria 8023680758 8023682725 549
338 iso_pu_bacteria 8024479707 8024486083 549
339 iso_pu_bacteria 8024501048 8024501159 549
340 iso_pu_bacteria 8056375014 8056377044 549
341 iso_pu_bacteria 8056382006 8056387368 549
342 iso_pu_bacteria 8057874678 8057881894 549
343 3300005331 Ga0070670_100000044 Ga0070670_10000004485 550
344 3300005347 Ga0070668_100010408 Ga0070668_1000104086 550
345 3300005367 Ga0070667_100000442 Ga0070667_1000004427 550
346 3300005548 Ga0070665_100000901 Ga0070665_10000090124 550
347 3300005563 Ga0068855_100000272 Ga0068855_1000002722 550
348 3300005618 Ga0068864_100000061 Ga0068864_10000006136 550
349 3300005841 Ga0068863_100008487 Ga0068863_1000084873 550
350 3300005843 Ga0068860_100000122 Ga0068860_10000012237 550
351 3300005844 Ga0068862_100000175 Ga0068862_10000017536 550
352 3300009177 Ga0105248_10158469 Ga0105248_101584692 550
353 3300009553 Ga0105249_10010504 Ga0105249_100105043 550
354 3300025256 Ga0209759_1010318 Ga0209759_10103182 550
355 3300025315 Ga0207697_10004142 Ga0207697_100041428 550
356 3300025925 Ga0207650_10000065 Ga0207650_1000006585 550
357 3300025941 Ga0207711_10111920 Ga0207711_101119202 550
358 3300025949 Ga0207667_10000376 Ga0207667_100003767 550
359 3300025961 Ga0207712_10001384 Ga0207712_1000138415 550
360 3300025972 Ga0207668_10000032 Ga0207668_10000032107 550
361 3300025986 Ga0207658_10000727 Ga0207658_1000072710 550
362 3300026035 Ga0207703_10004487 Ga0207703_100044879 550
363 3300026088 Ga0207641_10000665 Ga0207641_1000066524 550
364 3300026095 Ga0207676_10000062 Ga0207676_1000006256 550
365 3300028381 Ga0268264_10000172 Ga0268264_1000017252 550
366 3300031711 Ga0265314_10015847 Ga0265314_100158476 550
367 3300031730 Ga0307516_10000445 Ga0307516_1000044552 550
368 3300031852 Ga0307410_10016013 Ga0307410_100160134 550
369 3300032126 Ga0307415_100004143 Ga0307415_1000041434 550
370 3300037418 Ga0395900_0079269 Ga0395900_0079269_1411_3111 550
371 3300037471 Ga0395905_0000455 Ga0395905_0000455_43882_45582 550
372 3300041404 Ga0439436_0017761 Ga0439436_0017761_51_1796 550
373 3300042014 Ga0439457_002233 Ga0439457_002233_1894_3639 550
374 3300042015 Ga0439462_0010702 Ga0439462_0010702_56_1801 550
375 3300044656 Ga0466969_0007912 Ga0466969_0007912_2068_3768 550
376 3300044706 Ga0466964_0007314 Ga0466964_0007314_880_2580 550
377 3300045049 Ga0466959_0002098 Ga0466959_0002098_8180_9880 550
378 3300046471 Ga0495650_0000278 Ga0495650_0000278_56155_57855 550
379 3300046471 Ga0495650_0000845 Ga0495650_0000845_21939_23639 550
380 3300046471 Ga0495650_0005257 Ga0495650_0005257_4964_6664 550
381 3300046472 Ga0495580_0006570 Ga0495580_0006570_4466_6211 550
382 3300046507 Ga0495606_0000015 Ga0495606_0000015_149551_151251 550
383 3300046512 Ga0495610_0000008 Ga0495610_0000008_148149_149849 550
384 3300046524 Ga0495648_0017900 Ga0495648_0017900_582_2282 550
385 3300046692 Ga0495671_0000002 Ga0495671_0000002_752544_754244 550
386 3300047469 Ga0495673_0000064 Ga0495673_0000064_138886_140586 550
387 3300047472 Ga0495686_0001427 Ga0495686_0001427_4618_6318 550
388 3300048910 Ga0496107_0105785 Ga0496107_0105785_179_1918 550
389 3300048915 Ga0496112_0114592 Ga0496112_0114592_348_2093 550
390 3300049459 Ga0495678_003089 Ga0495678_003089_4272_5972 550
391 3300049742 Ga0501080_0019428 Ga0501080_0019428_2616_4358 550
392 3300002070 JGI24750J21931_1000712 JGI24750J21931_10007125 551
393 3300002074 JGI24748J21848_1000111 JGI24748J21848_10001118 551
394 3300002076 JGI24749J21850_1000026 JGI24749J21850_100002613 551
395 3300002239 JGI24034J26672_10000089 JGI24034J26672_1000008911 551
396 3300002459 JGI24751J29686_10000128 JGI24751J29686_1000012817 551
397 3300003187 JGI25151J46595_10009751 JGI25151J46595_100097514 551
398 3300003187 JGI25151J46595_10009754 JGI25151J46595_100097544 551
399 3300003214 JGI25165J46597_1000038 JGI25165J46597_1000038198 551
400 3300003578 Ga0006562J51391_1018249 Ga0006562J51391_10182494 551
401 3300003763 Ga0055529_1000015 Ga0055529_1000015321 551
402 3300003790 Ga0055528_1007169 Ga0055528_10071695 551
403 3300003791 Ga0055530_10000091 Ga0055530_1000009110 551
404 3300005289 Ga0065704_10072996 Ga0065704_100729963 551
405 3300005295 Ga0065707_10097340 Ga0065707_100973401 551
406 3300005327 Ga0070658_10085823 Ga0070658_100858232 551
407 3300005331 Ga0070670_100000282 Ga0070670_10000028227 551
408 3300005331 Ga0070670_100085668 Ga0070670_1000856683 551
409 3300005335 Ga0070666_10001085 Ga0070666_100010857 551
410 3300005347 Ga0070668_100000300 Ga0070668_10000030027 551
411 3300005355 Ga0070671_100000604 Ga0070671_1000006041 551
412 3300005355 Ga0070671_100001700 Ga0070671_1000017007 551
413 3300005367 Ga0070667_100000019 Ga0070667_100000019129 551
414 3300005367 Ga0070667_100002314 Ga0070667_1000023147 551
415 3300005471 Ga0070698_100008743 Ga0070698_10000874310 551
416 3300005536 Ga0070697_100004306 Ga0070697_10000430611 551
417 3300005536 Ga0070697_100036682 Ga0070697_1000366823 551
418 3300005539 Ga0068853_100005761 Ga0068853_10000576110 551
419 3300005544 Ga0070686_100000951 Ga0070686_1000009517 551
420 3300005549 Ga0070704_100005789 Ga0070704_1000057897 551
421 3300005618 Ga0068864_100000289 Ga0068864_10000028927 551
422 3300005618 Ga0068864_100002032 Ga0068864_1000020327 551
423 3300005618 Ga0068864_100006029 Ga0068864_1000060296 551
424 3300005719 Ga0068861_100004465 Ga0068861_1000044654 551
425 3300005719 Ga0068861_100007893 Ga0068861_1000078935 551
426 3300005841 Ga0068863_100005272 Ga0068863_10000527210 551
427 3300005843 Ga0068860_100000042 Ga0068860_10000004252 551
428 3300005843 Ga0068860_100003263 Ga0068860_1000032637 551
429 3300005844 Ga0068862_100000073 Ga0068862_10000007315 551
430 3300005844 Ga0068862_100000699 Ga0068862_1000006998 551
431 3300005844 Ga0068862_100002484 Ga0068862_1000024847 551
432 3300005983 Ga0081540_1000162 Ga0081540_100016254 551
433 3300005983 Ga0081540_1000379 Ga0081540_10003797 551
434 3300006042 Ga0075368_10000094 Ga0075368_1000009410 551
435 3300006177 Ga0075362_10005230 Ga0075362_100052303 551
436 3300006178 Ga0075367_10004415 Ga0075367_100044156 551
437 3300006195 Ga0075366_10031399 Ga0075366_100313994 551
438 3300006946 Ga0079104_1004975 Ga0079104_10049752 551
439 3300009101 Ga0105247_10060273 Ga0105247_100602731 551
440 3300009177 Ga0105248_10000493 Ga0105248_1000049315 551
441 3300009553 Ga0105249_10002201 Ga0105249_100022017 551
442 3300013296 Ga0157374_10025151 Ga0157374_100251516 551
443 3300014325 Ga0163163_10012210 Ga0163163_100122105 551
444 3300017792 Ga0163161_10001564 Ga0163161_100015647 551
445 3300025229 Ga0209147_100209 Ga0209147_10020916 551
446 3300025245 Ga0207425_1005468 Ga0207425_10054684 551
447 3300025250 Ga0209026_1001707 Ga0209026_10017074 551
448 3300025258 Ga0209129_1000068 Ga0209129_100006856 551
449 3300025261 Ga0209233_1000042 Ga0209233_1000042318 551
450 3300025273 Ga0209673_1016135 Ga0209673_10161352 551
451 3300025284 Ga0209130_1000709 Ga0209130_100070912 551
452 3300025294 Ga0209025_1000045 Ga0209025_1000045268 551
453 3300025294 Ga0209025_1002361 Ga0209025_100236119 551
454 3300025294 Ga0209025_1002941 Ga0209025_100294117 551
455 3300025297 Ga0209758_1002042 Ga0209758_100204211 551
456 3300025298 Ga0209050_1000029 Ga0209050_100002911 551
457 3300025302 Ga0207426_1000198 Ga0207426_100019858 551
458 3300025304 Ga0209257_1000271 Ga0209257_1000271111 551
459 3300025903 Ga0207680_10000608 Ga0207680_100006087 551
460 3300025917 Ga0207660_10021118 Ga0207660_100211184 551
461 3300025924 Ga0207694_10001688 Ga0207694_100016883 551
462 3300025925 Ga0207650_10000029 Ga0207650_10000029168 551
463 3300025925 Ga0207650_10014576 Ga0207650_100145763 551
464 3300025931 Ga0207644_10001158 Ga0207644_100011587 551
465 3300025931 Ga0207644_10016311 Ga0207644_100163112 551
466 3300025941 Ga0207711_10000541 Ga0207711_1000054123 551
467 3300025961 Ga0207712_10001334 Ga0207712_100013347 551
468 3300025972 Ga0207668_10000270 Ga0207668_1000027022 551
469 3300025986 Ga0207658_10000002 Ga0207658_10000002157 551
470 3300025986 Ga0207658_10000550 Ga0207658_1000055031 551
471 3300025986 Ga0207658_10003762 Ga0207658_100037629 551
472 3300026078 Ga0207702_10107610 Ga0207702_101076104 551
473 3300026088 Ga0207641_10000207 Ga0207641_1000020745 551
474 3300026088 Ga0207641_10000820 Ga0207641_1000082010 551
475 3300026088 Ga0207641_10003626 Ga0207641_1000362614 551
476 3300026095 Ga0207676_10000059 Ga0207676_1000005989 551
477 3300026095 Ga0207676_10000112 Ga0207676_1000011260 551
478 3300026095 Ga0207676_10037411 Ga0207676_100374114 551
479 3300026118 Ga0207675_100004219 Ga0207675_10000421911 551
480 3300027111 Ga0209281_1011381 Ga0209281_10113812 551
481 3300027866 Ga0209813_10000202 Ga0209813_1000020214 551
482 3300028379 Ga0268266_10000310 Ga0268266_1000031054 551
483 3300028380 Ga0268265_10000018 Ga0268265_1000001817 551
484 3300028380 Ga0268265_10000510 Ga0268265_1000051027 551
485 3300028380 Ga0268265_10000658 Ga0268265_100006588 551
486 3300028381 Ga0268264_10000001 Ga0268264_10000001482 551
487 3300028381 Ga0268264_10002306 Ga0268264_100023067 551
488 3300028563 Ga0265319_1004164 Ga0265319_10041646 551
489 3300031250 Ga0265331_10020698 Ga0265331_100206982 551
490 3300031548 Ga0307408_100000062 Ga0307408_10000006228 551
491 3300031727 Ga0316576_10000782 Ga0316576_1000078211 551
492 3300031731 Ga0307405_10004857 Ga0307405_100048572 551
493 3300031731 Ga0307405_10021709 Ga0307405_100217092 551
494 3300031911 Ga0307412_10015598 Ga0307412_100155983 551
495 3300033180 Ga0307510_10040256 Ga0307510_100402562 551
496 3300037418 Ga0395900_0029284 Ga0395900_0029284_1291_3021 551
497 3300038443 Ga0395901_0027577 Ga0395901_0027577_3500_5230 551
498 3300038443 Ga0395901_0142178 Ga0395901_0142178_750_2453 551
499 3300039437 Ga0436365_1090173 Ga0436365_1090173_715_2448 551
500 3300042007 Ga0439449_0002099 Ga0439449_0002099_2204_3961 551
501 3300044712 Ga0453684_0000019 Ga0453684_0000019_766237_768006 551
502 3300044712 Ga0453684_0039740 Ga0453684_0039740_538_2307 551
503 3300046530 Ga0495654_0005977 Ga0495654_0005977_1370_3079 551
504 3300047472 Ga0495686_0000772 Ga0495686_0000772_35028_36743 551
505 3300048903 Ga0496100_0038917 Ga0496100_0038917_52_1770 551
506 3300048904 Ga0496101_0015408 Ga0496101_0015408_812_2530 551
507 3300048905 Ga0496102_0028193 Ga0496102_0028193_2545_4263 551
508 3300048908 Ga0496105_0001832 Ga0496105_0001832_10652_12370 551
509 3300048909 Ga0496106_0000693 Ga0496106_0000693_3716_5434 551
510 3300048910 Ga0496107_0000187 Ga0496107_0000187_14398_16116 551
511 3300048911 Ga0496108_0129066 Ga0496108_0129066_82_1800 551
512 3300048912 Ga0496109_0004265 Ga0496109_0004265_6491_8209 551
513 3300048914 Ga0496111_0007280 Ga0496111_0007280_2906_4624 551
514 3300048915 Ga0496112_0011757 Ga0496112_0011757_3899_5617 551
515 3300048916 Ga0496113_0005238 Ga0496113_0005238_3541_5259 551
516 3300048919 Ga0496116_0012796 Ga0496116_0012796_1859_3577 551
517 3300048922 Ga0496119_0027011 Ga0496119_0027011_819_2537 551
518 3300048923 Ga0496120_0040413 Ga0496120_0040413_936_2729 551
519 3300048925 Ga0496122_0026471 Ga0496122_0026471_666_2384 551
520 3300048927 Ga0496124_0126391 Ga0496124_0126391_40_1758 551
521 3300048928 Ga0496125_0016404 Ga0496125_0016404_3691_5409 551
522 3300048929 Ga0496126_0015868 Ga0496126_0015868_2677_4395 551
523 3300049523 Ga0501300_005079 Ga0501300_005079_198_1907 551
524 3300049568 Ga0501031_0086026 Ga0501031_0086026_262_1971 551
525 3300049569 Ga0501032_0000292 Ga0501032_0000292_5359_7125 551
526 3300049572 Ga0501036_0025161 Ga0501036_0025161_1377_3143 551
527 3300049580 Ga0501046_0019090 Ga0501046_0019090_50_1816 551
528 3300049581 Ga0501047_0056812 Ga0501047_0056812_174_1940 551
529 3300049686 Ga0501257_000123 Ga0501257_000123_8011_9720 551
530 3300049822 Ga0501035_0000168 Ga0501035_0000168_28765_30531 551
531 3300049823 Ga0501044_0000025 Ga0501044_0000025_131143_132909 551
532 3300050489 nmdc:mga03683_159_c1 nmdc:mga03683_159_c1_7315_9024 551
533 3300050491 nmdc:mga00v17_25919_c1 nmdc:mga00v17_25919_c1_128_1837 551
534 3300050492 nmdc:mga0yw44_26504_c1 nmdc:mga0yw44_26504_c1_688_2397 551
535 3300050494 nmdc:mga06z11_266_c1 nmdc:mga06z11_266_c1_1472_3181 551
536 3300050495 nmdc:mga04h51_4635_c1 nmdc:mga04h51_4635_c1_657_2366 551
537 3300050496 nmdc:mga07m45_7_c1 nmdc:mga07m45_7_c1_134690_136399 551
538 3300050512 nmdc:mga0n895_42062_c1 nmdc:mga0n895_42062_c1_450_2156 551
539 3300050513 nmdc:mga0rr50_10537_c1 nmdc:mga0rr50_10537_c1_135_1841 551
540 3300050515 nmdc:mga0a205_111268_c1 nmdc:mga0a205_111268_c1_176_1882 551
541 3300050516 nmdc:mga0sz30_607_c1 nmdc:mga0sz30_607_c1_1737_3446 551
542 3300053121 Ga0500607_000831 Ga0500607_000831_1358_3067 551
543 3300053133 Ga0500655_002702 Ga0500655_002702_95_1804 551
544 3300053148 Ga0500590_000393 Ga0500590_000393_9372_11081 551
545 3300053156 Ga0500622_0007819 Ga0500622_0007819_2176_3885 551
546 3300001979 JGI24740J21852_10008372 JGI24740J21852_100083724 552
547 3300002741 JGI25157J39369_1000568 JGI25157J39369_10005688 552
548 3300003761 Ga0055535_1000087 Ga0055535_100008749 552
549 3300003761 Ga0055535_1000221 Ga0055535_100022113 552
550 3300003762 Ga0055542_1000129 Ga0055542_100012945 552
551 3300003763 Ga0055529_1000139 Ga0055529_100013956 552
552 3300003775 Ga0055524_1007009 Ga0055524_10070094 552
553 3300003781 Ga0055536_1005987 Ga0055536_10059875 552
554 3300003791 Ga0055530_10000809 Ga0055530_1000080917 552
555 3300003792 Ga0055540_1009468 Ga0055540_10094682 552
556 3300003794 Ga0055531_10000543 Ga0055531_100005434 552
557 3300003794 Ga0055531_10006609 Ga0055531_100066095 552
558 3300003794 Ga0055531_10010980 Ga0055531_100109804 552
559 3300005288 Ga0065714_10007852 Ga0065714_100078522 552
560 3300005366 Ga0070659_100017343 Ga0070659_1000173437 552
561 3300005539 Ga0068853_100003649 Ga0068853_1000036497 552
562 3300005548 Ga0070665_100000144 Ga0070665_10000014446 552
563 3300005834 Ga0068851_10016489 Ga0068851_100164894 552
564 3300006028 Ga0070717_10014585 Ga0070717_100145852 552
565 3300006353 Ga0075370_10010973 Ga0075370_100109736 552
566 3300009036 Ga0105244_10008055 Ga0105244_100080553 552
567 3300009093 Ga0105240_10000026 Ga0105240_10000026216 552
568 3300009148 Ga0105243_10009514 Ga0105243_100095149 552
569 3300009148 Ga0105243_10013142 Ga0105243_100131422 552
570 3300009177 Ga0105248_10049694 Ga0105248_100496944 552
571 3300013104 Ga0157370_10004419 Ga0157370_1000441915 552
572 3300013104 Ga0157370_10014496 Ga0157370_100144965 552
573 3300013307 Ga0157372_10023267 Ga0157372_100232673 552
574 3300014497 Ga0182008_10006332 Ga0182008_100063324 552
575 3300015262 Ga0182007_10005272 Ga0182007_100052724 552
576 3300015683 Ga0183362_10005 Ga0183362_10005354 552
577 3300017792 Ga0163161_10000099 Ga0163161_1000009953 552
578 3300017792 Ga0163161_10046984 Ga0163161_100469844 552
579 3300025228 Ga0209672_101776 Ga0209672_1017767 552
580 3300025229 Ga0209147_100111 Ga0209147_10011192 552
581 3300025242 Ga0209258_100044 Ga0209258_10004456 552
582 3300025242 Ga0209258_100240 Ga0209258_10024046 552
583 3300025250 Ga0209026_1000151 Ga0209026_100015121 552
584 3300025254 Ga0209148_1000033 Ga0209148_100003346 552
585 3300025256 Ga0209759_1000350 Ga0209759_100035027 552
586 3300025256 Ga0209759_1001278 Ga0209759_10012785 552
587 3300025258 Ga0209129_1001676 Ga0209129_100167610 552
588 3300025272 Ga0209455_1000048 Ga0209455_100004856 552
589 3300025284 Ga0209130_1001033 Ga0209130_10010334 552
590 3300025284 Ga0209130_1002096 Ga0209130_100209610 552
591 3300025291 Ga0209675_1001420 Ga0209675_10014202 552
592 3300025291 Ga0209675_1002065 Ga0209675_100206510 552
593 3300025291 Ga0209675_1008939 Ga0209675_10089395 552
594 3300025292 Ga0209676_1000048 Ga0209676_1000048327 552
595 3300025292 Ga0209676_1002368 Ga0209676_100236810 552
596 3300025294 Ga0209025_1000348 Ga0209025_100034881 552
597 3300025294 Ga0209025_1000906 Ga0209025_100090610 552
598 3300025294 Ga0209025_1022147 Ga0209025_10221473 552
599 3300025295 Ga0209564_1002025 Ga0209564_100202517 552
600 3300025295 Ga0209564_1002686 Ga0209564_100268610 552
601 3300025297 Ga0209758_1000034 Ga0209758_1000034441 552
602 3300025298 Ga0209050_1000012 Ga0209050_1000012327 552
603 3300025298 Ga0209050_1001075 Ga0209050_100107510 552
604 3300025299 Ga0209256_1002499 Ga0209256_100249917 552
605 3300025299 Ga0209256_1002780 Ga0209256_100278010 552
606 3300025302 Ga0207426_1000058 Ga0207426_1000058125 552
607 3300025302 Ga0207426_1000067 Ga0207426_1000067330 552
608 3300025303 Ga0209051_1000019 Ga0209051_1000019246 552
609 3300025303 Ga0209051_1000099 Ga0209051_100009929 552
610 3300025303 Ga0209051_1000221 Ga0209051_100022130 552
611 3300025304 Ga0209257_1000024 Ga0209257_1000024273 552
612 3300025304 Ga0209257_1000057 Ga0209257_1000057194 552
613 3300025304 Ga0209257_1000451 Ga0209257_100045167 552
614 3300025315 Ga0207697_10001103 Ga0207697_100011038 552
615 3300025728 Ga0207655_1002336 Ga0207655_100233616 552
616 3300025913 Ga0207695_10000046 Ga0207695_10000046261 552
617 3300025913 Ga0207695_10025575 Ga0207695_100255752 552
618 3300025935 Ga0207709_10001218 Ga0207709_1000121810 552
619 3300028379 Ga0268266_10000003 Ga0268266_10000003338 552
620 3300028666 Ga0265336_10000053 Ga0265336_1000005386 552
621 3300028794 Ga0307515_10000040 Ga0307515_10000040223 552
622 3300029957 Ga0265324_10000132 Ga0265324_1000013235 552
623 3300031548 Ga0307408_100001177 Ga0307408_1000011774 552
624 3300031901 Ga0307406_10000741 Ga0307406_1000074115 552
625 3300032002 Ga0307416_100015543 Ga0307416_1000155434 552
626 3300032002 Ga0307416_100072967 Ga0307416_1000729673 552
627 3300032002 Ga0307416_100136192 Ga0307416_1001361922 552
628 3300041404 Ga0439436_0003741 Ga0439436_0003741_1646_3364 552
629 3300041411 Ga0439466_0004200 Ga0439466_0004200_1182_2900 552
630 3300041413 Ga0439465_0007082 Ga0439465_0007082_1113_2831 552
631 3300041999 Ga0439433_0001384 Ga0439433_0001384_2141_3859 552
632 3300042006 Ga0439432_001342 Ga0439432_001342_2135_3853 552
633 3300042006 Ga0439432_001947 Ga0439432_001947_1675_3393 552
634 3300046515 Ga0495620_0029620 Ga0495620_0029620_217_1935 552
635 3300046518 Ga0495631_0000073 Ga0495631_0000073_1701_3419 552
636 3300046660 Ga0495625_0043440 Ga0495625_0043440_1181_2908 552
637 3300046674 Ga0495588_0012491 Ga0495588_0012491_1017_2735 552
638 3300046810 Ga0495660_0029454 Ga0495660_0029454_1145_2857 552
639 3300048918 Ga0496115_0003355 Ga0496115_0003355_5540_7249 552
640 3300048920 Ga0496117_0021324 Ga0496117_0021324_813_2531 552
641 3300048928 Ga0496125_0026960 Ga0496125_0026960_154_1872 552
642 3300049570 Ga0501033_0001436 Ga0501033_0001436_14888_16594 552
643 3300049572 Ga0501036_0001559 Ga0501036_0001559_15318_17024 552
644 3300049572 Ga0501036_0067583 Ga0501036_0067583_308_2014 552
645 3300049573 Ga0501037_0023747 Ga0501037_0023747_2104_3810 552
646 3300049575 Ga0501039_0068991 Ga0501039_0068991_640_2346 552
647 3300049579 Ga0501043_0005982 Ga0501043_0005982_7723_9429 552
648 3300049580 Ga0501046_0000123 Ga0501046_0000123_68427_70169 552
649 3300049823 Ga0501044_0001132 Ga0501044_0001132_3883_5589 552
650 3300049823 Ga0501044_0132311 Ga0501044_0132311_649_2355 552
651 3300053079 Ga0500610_0000329 Ga0500610_0000329_5867_7585 552
652 3300053093 Ga0500651_0000223 Ga0500651_0000223_11898_13616 552
653 3300053111 Ga0500572_002946 Ga0500572_002946_1853_3562 552
654 3300053122 Ga0500608_027482 Ga0500608_027482_903_2621 552
655 3300053134 Ga0500658_0001544 Ga0500658_0001544_2661_4379 552
656 3300053134 Ga0500658_0004395 Ga0500658_0004395_1593_3311 552
657 3300053136 Ga0500559_0005939 Ga0500559_0005939_169_1896 552
658 3300053177 Ga0500636_0000443 Ga0500636_0000443_10880_12589 552
659 3300001976 JGI24752J21851_1000393 JGI24752J21851_10003935 553
660 3300002737 JGI25162J39368_1000149 JGI25162J39368_100014913 553
661 3300002773 JGI25152J39213_1002125 JGI25152J39213_100212510 553
662 3300002773 JGI25152J39213_1002132 JGI25152J39213_10021322 553
663 3300003187 JGI25151J46595_10023784 JGI25151J46595_100237842 553
664 3300003214 JGI25165J46597_1001553 JGI25165J46597_100155313 553
665 3300003215 JGI25153J46596_10002731 JGI25153J46596_1000273112 553
666 3300003215 JGI25153J46596_10012555 JGI25153J46596_100125555 553
667 3300003354 JGI25160J50197_1000766 JGI25160J50197_100076612 553
668 3300003374 JGI25161J50226_1002967 JGI25161J50226_10029675 553
669 3300003396 JGI26137J50245_100046 JGI26137J50245_1000465 553
670 3300003504 JGI26138J51218_100133 JGI26138J51218_1001332 553
671 3300003790 Ga0055528_1016382 Ga0055528_10163822 553
672 3300003911 JGI25405J52794_10009060 JGI25405J52794_100090601 553
673 3300004625 Ga0055543_1000108 Ga0055543_100010830 553
674 3300005295 Ga0065707_10003225 Ga0065707_100032251 553
675 3300005328 Ga0070676_10007377 Ga0070676_100073775 553
676 3300005333 Ga0070677_10005311 Ga0070677_100053112 553
677 3300005336 Ga0070680_100025088 Ga0070680_1000250883 553
678 3300005336 Ga0070680_100110657 Ga0070680_1001106572 553
679 3300005343 Ga0070687_100008608 Ga0070687_1000086084 553
680 3300005344 Ga0070661_100015515 Ga0070661_1000155152 553
681 3300005354 Ga0070675_100125215 Ga0070675_1001252152 553
682 3300005364 Ga0070673_100021793 Ga0070673_1000217932 553
683 3300005438 Ga0070701_10005612 Ga0070701_100056123 553
684 3300005440 Ga0070705_100000010 Ga0070705_1000000109 553
685 3300005441 Ga0070700_100015893 Ga0070700_1000158934 553
686 3300005444 Ga0070694_100007490 Ga0070694_1000074908 553
687 3300005458 Ga0070681_10015235 Ga0070681_100152357 553
688 3300005459 Ga0068867_100022813 Ga0068867_1000228134 553
689 3300005468 Ga0070707_100003974 Ga0070707_1000039748 553
690 3300005518 Ga0070699_100001267 Ga0070699_10000126714 553
691 3300005536 Ga0070697_100011488 Ga0070697_1000114882 553
692 3300005545 Ga0070695_100020736 Ga0070695_1000207364 553
693 3300005546 Ga0070696_100000088 Ga0070696_10000008833 553
694 3300005546 Ga0070696_100045467 Ga0070696_1000454672 553
695 3300005547 Ga0070693_100027841 Ga0070693_1000278412 553
696 3300005549 Ga0070704_100007022 Ga0070704_1000070223 553
697 3300005564 Ga0070664_100016032 Ga0070664_1000160325 553
698 3300005840 Ga0068870_10000099 Ga0068870_1000009916 553
699 3300005840 Ga0068870_10002337 Ga0068870_100023372 553
700 3300005840 Ga0068870_10003189 Ga0068870_100031894 553
701 3300005840 Ga0068870_10006636 Ga0068870_100066362 553
702 3300005843 Ga0068860_100067955 Ga0068860_1000679553 553
703 3300005844 Ga0068862_100000484 Ga0068862_10000048430 553
704 3300005937 Ga0081455_10000194 Ga0081455_1000019451 553
705 3300005983 Ga0081540_1001802 Ga0081540_10018024 553
706 3300006038 Ga0075365_10002545 Ga0075365_100025457 553
707 3300006177 Ga0075362_10001438 Ga0075362_100014388 553
708 3300006195 Ga0075366_10002595 Ga0075366_100025954 553
709 3300006353 Ga0075370_10000296 Ga0075370_1000029612 553
710 3300006844 Ga0075428_100036383 Ga0075428_1000363833 553
711 3300006844 Ga0075428_100055641 Ga0075428_1000556415 553
712 3300006844 Ga0075428_100141534 Ga0075428_1001415342 553
713 3300006847 Ga0075431_100004278 Ga0075431_1000042782 553
714 3300006871 Ga0075434_100048056 Ga0075434_1000480563 553
715 3300007076 Ga0075435_100035528 Ga0075435_1000355285 553
716 3300009147 Ga0114129_10115745 Ga0114129_101157452 553
717 3300009176 Ga0105242_10032642 Ga0105242_100326424 553
718 3300009545 Ga0105237_10069600 Ga0105237_100696003 553
719 3300009553 Ga0105249_10012546 Ga0105249_100125467 553
720 3300009765 Ga0123341_1000018 Ga0123341_100001839 553
721 3300009766 Ga0123342_1021409 Ga0123342_10214092 553
722 3300011119 Ga0105246_10011861 Ga0105246_100118614 553
723 3300013100 Ga0157373_10042672 Ga0157373_100426723 553
724 3300013297 Ga0157378_10011041 Ga0157378_100110412 553
725 3300013307 Ga0157372_10123210 Ga0157372_101232104 553
726 3300025233 Ga0209437_100058 Ga0209437_100058128 553
727 3300025245 Ga0207425_1003377 Ga0207425_10033772 553
728 3300025258 Ga0209129_1000702 Ga0209129_10007027 553
729 3300025258 Ga0209129_1001400 Ga0209129_10014006 553
730 3300025261 Ga0209233_1000149 Ga0209233_100014956 553
731 3300025273 Ga0209673_1000256 Ga0209673_100025643 553
732 3300025273 Ga0209673_1001106 Ga0209673_10011066 553
733 3300025273 Ga0209673_1001124 Ga0209673_100112420 553
734 3300025294 Ga0209025_1000537 Ga0209025_100053735 553
735 3300025294 Ga0209025_1001251 Ga0209025_10012516 553
736 3300025295 Ga0209564_1000259 Ga0209564_100025950 553
737 3300025295 Ga0209564_1000778 Ga0209564_100077836 553
738 3300025297 Ga0209758_1001847 Ga0209758_100184713 553
739 3300025297 Ga0209758_1001921 Ga0209758_100192115 553
740 3300025299 Ga0209256_1000283 Ga0209256_100028348 553
741 3300025299 Ga0209256_1000669 Ga0209256_100066937 553
742 3300025303 Ga0209051_1002537 Ga0209051_100253712 553
743 3300025893 Ga0207682_10010055 Ga0207682_100100552 553
744 3300025907 Ga0207645_10008666 Ga0207645_100086665 553
745 3300025907 Ga0207645_10025356 Ga0207645_100253563 553
746 3300025908 Ga0207643_10000237 Ga0207643_1000023718 553
747 3300025908 Ga0207643_10005256 Ga0207643_100052565 553
748 3300025910 Ga0207684_10008538 Ga0207684_100085387 553
749 3300025910 Ga0207684_10017509 Ga0207684_100175095 553
750 3300025912 Ga0207707_10075607 Ga0207707_100756071 553
751 3300025917 Ga0207660_10007073 Ga0207660_100070734 553
752 3300025922 Ga0207646_10001678 Ga0207646_100016789 553
753 3300025923 Ga0207681_10002964 Ga0207681_100029649 553
754 3300025925 Ga0207650_10001249 Ga0207650_1000124912 553
755 3300025925 Ga0207650_10026882 Ga0207650_100268823 553
756 3300025938 Ga0207704_10022050 Ga0207704_100220502 553
757 3300025961 Ga0207712_10002216 Ga0207712_1000221611 553
758 3300025972 Ga0207668_10057755 Ga0207668_100577553 553
759 3300025981 Ga0207640_10050114 Ga0207640_100501141 553
760 3300026067 Ga0207678_10018939 Ga0207678_100189393 553
761 3300026075 Ga0207708_10031040 Ga0207708_100310404 553
762 3300026089 Ga0207648_10003447 Ga0207648_1000344712 553
763 3300026116 Ga0207674_10006059 Ga0207674_100060599 553
764 3300027360 Ga0209969_1000082 Ga0209969_100008210 553
765 3300027364 Ga0209967_1000794 Ga0209967_10007942 553
766 3300027395 Ga0209996_1000969 Ga0209996_10009693 553
767 3300027462 Ga0210000_1000841 Ga0210000_10008413 553
768 3300027471 Ga0209995_1000317 Ga0209995_10003174 553
769 3300027526 Ga0209968_1000295 Ga0209968_10002956 553
770 3300027552 Ga0209982_1000024 Ga0209982_10000244 553
771 3300027552 Ga0209982_1000199 Ga0209982_10001994 553
772 3300027614 Ga0209970_1001209 Ga0209970_10012093 553
773 3300027617 Ga0210002_1000307 Ga0210002_10003074 553
774 3300027665 Ga0209983_1001673 Ga0209983_10016734 553
775 3300027682 Ga0209971_1001320 Ga0209971_10013201 553
776 3300027682 Ga0209971_1002712 Ga0209971_10027123 553
777 3300027695 Ga0209966_1001021 Ga0209966_10010213 553
778 3300027717 Ga0209998_10001830 Ga0209998_100018304 553
779 3300027876 Ga0209974_10000060 Ga0209974_1000006027 553
780 3300027876 Ga0209974_10001948 Ga0209974_100019485 553
781 3300027907 Ga0207428_10002822 Ga0207428_100028224 553
782 3300028380 Ga0268265_10002000 Ga0268265_1000200011 553
783 3300028381 Ga0268264_10029848 Ga0268264_100298483 553
784 3300028794 Ga0307515_10016158 Ga0307515_100161587 553
785 3300031727 Ga0316576_10040284 Ga0316576_100402845 553
786 3300041494 Ga0451837_0336576 Ga0451837_0336576_241_1953 553
787 3300042016 Ga0439463_010268 Ga0439463_010268_189_1907 553
788 3300042156 Ga0439446_0005500 Ga0439446_0005500_1010_2728 553
789 3300042156 Ga0439446_0006774 Ga0439446_0006774_1001_2719 553
790 3300042437 Ga0439444_0000586 Ga0439444_0000586_2229_3947 553
791 3300042993 Ga0439440_0001141 Ga0439440_0001141_1575_3293 553
792 3300042993 Ga0439440_0002103 Ga0439440_0002103_1745_3463 553
793 3300044712 Ga0453684_0075444 Ga0453684_0075444_121_1842 553
794 3300045051 Ga0451576_0009293 Ga0451576_0009293_847_2571 553
795 3300048910 Ga0496107_0043350 Ga0496107_0043350_1034_2746 553
796 3300048913 Ga0496110_0027024 Ga0496110_0027024_1482_3194 553
797 3300049568 Ga0501031_0038163 Ga0501031_0038163_1176_2894 553
798 3300049571 Ga0501034_0002517 Ga0501034_0002517_12596_14308 553
799 3300049571 Ga0501034_0096718 Ga0501034_0096718_253_1965 553
800 3300049572 Ga0501036_0037725 Ga0501036_0037725_1654_3372 553
801 3300049572 Ga0501036_0060084 Ga0501036_0060084_564_2282 553
802 3300049573 Ga0501037_0030396 Ga0501037_0030396_1126_2844 553
803 3300049574 Ga0501038_0000047 Ga0501038_0000047_39131_40843 553
804 3300049574 Ga0501038_0104153 Ga0501038_0104153_614_2332 553
805 3300049575 Ga0501039_0000038 Ga0501039_0000038_29590_31302 553
806 3300049575 Ga0501039_0005233 Ga0501039_0005233_6792_8510 553
807 3300049575 Ga0501039_0078491 Ga0501039_0078491_257_1969 553
808 3300049575 Ga0501039_0096391 Ga0501039_0096391_221_1939 553
809 3300049576 Ga0501040_0000247 Ga0501040_0000247_19519_21237 553
810 3300049576 Ga0501040_0025687 Ga0501040_0025687_2217_3935 553
811 3300049576 Ga0501040_0033569 Ga0501040_0033569_930_2648 553
812 3300049577 Ga0501041_0006353 Ga0501041_0006353_2438_4156 553
813 3300049577 Ga0501041_0006447 Ga0501041_0006447_2256_3974 553
814 3300049578 Ga0501042_0000550 Ga0501042_0000550_517_2235 553
815 3300049578 Ga0501042_0021305 Ga0501042_0021305_79_1797 553
816 3300049579 Ga0501043_0000131 Ga0501043_0000131_44738_46450 553
817 3300049579 Ga0501043_0050614 Ga0501043_0050614_520_2238 553
818 3300049580 Ga0501046_0006134 Ga0501046_0006134_2846_4564 553
819 3300049580 Ga0501046_0017614 Ga0501046_0017614_3130_4848 553
820 3300049581 Ga0501047_0003356 Ga0501047_0003356_6971_8683 553
821 3300049582 Ga0501048_0007473 Ga0501048_0007473_615_2333 553
822 3300049582 Ga0501048_0009801 Ga0501048_0009801_4549_6267 553
823 3300049586 Ga0501070_0000158 Ga0501070_0000158_46393_48105 553
824 3300049586 Ga0501070_0010652 Ga0501070_0010652_2454_4166 553
825 3300049587 Ga0501071_0000120 Ga0501071_0000120_26012_27730 553
826 3300049587 Ga0501071_0002565 Ga0501071_0002565_4664_6382 553
827 3300049587 Ga0501071_0114297 Ga0501071_0114297_238_1956 553
828 3300049588 Ga0501072_0001202 Ga0501072_0001202_14876_16594 553
829 3300049588 Ga0501072_0022257 Ga0501072_0022257_2001_3719 553
830 3300049591 Ga0501075_0000234 Ga0501075_0000234_26588_28306 553
831 3300049591 Ga0501075_0043112 Ga0501075_0043112_985_2703 553
832 3300049591 Ga0501075_0058938 Ga0501075_0058938_695_2413 553
833 3300049592 Ga0501076_0000063 Ga0501076_0000063_44283_46001 553
834 3300049593 Ga0501077_0001160 Ga0501077_0001160_6439_8157 553
835 3300049741 Ga0501079_0006499 Ga0501079_0006499_6922_8634 553
836 3300049741 Ga0501079_0007106 Ga0501079_0007106_4904_6622 553
837 3300049742 Ga0501080_0023819 Ga0501080_0023819_2002_3720 553
838 3300049743 Ga0501081_0000569 Ga0501081_0000569_7781_9499 553
839 3300049743 Ga0501081_0017425 Ga0501081_0017425_2915_4633 553
840 3300049823 Ga0501044_0012550 Ga0501044_0012550_6069_7781 553
841 3300049824 Ga0501045_0002594 Ga0501045_0002594_10127_11845 553
842 3300050507 nmdc:mga05p37_150874_c1 nmdc:mga05p37_150874_c1_487_2205 553
843 3300050508 nmdc:mga09592_45846_c1 nmdc:mga09592_45846_c1_1723_3441 553
844 3300050509 nmdc:mga0qj67_10103_c1 nmdc:mga0qj67_10103_c1_621_2339 553
845 3300050511 nmdc:mga08y16_18684_c1 nmdc:mga08y16_18684_c1_4194_5912 553
846 3300053727 Ga0500611_000013 Ga0500611_000013_44513_46234 553
847 3300054114 Ga0501084_0003507 Ga0501084_0003507_5504_7216 553
848 3300054114 Ga0501084_0008330 Ga0501084_0008330_696_2414 553
849 3300060353 Ga0501082_0000455 Ga0501082_0000455_24386_26104 553
850 3300061734 Ga0530510_0016352 Ga0530510_0016352_2724_4442 553
851 3300061734 Ga0530510_0020016 Ga0530510_0020016_227_1945 553

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00449

Urease_alpha

Urease alpha-subunit, N-terminal domain

31

149

0.99

PF01979

Amidohydro_1

Amidohydrolase family

155

493

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a5m-assembly1.cif.gz_C k217a variant of klebsiella aerogenes urease 0.9474 4 553
1fwa-assembly1.cif.gz_C klebsiella aerogenes urease, c319a variant at ph 7.5 0.9473 4 553
1ejt-assembly1.cif.gz_C crystal structure of the h219q variant of klebsiella aerogenes urease 0.9472 4 553
1a5k-assembly1.cif.gz_C k217e variant of klebsiella aerogenes urease 0.9472 4 553
1krb-assembly1.cif.gz_C crystal structure of klebsiella aerogenes urease, its apoenzyme and two active site mutants 0.9472 4 553
ID Description Score Start End Superfamily
af_P9WFF1_136_577_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9353 115 553 3.20.20.140
af_Q2G2K5_2_132_2.30.40.10 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9315 2 116 2.30.40.10
af_P9WFF1_136_577_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.927 115 553 3.20.20.140
af_P9WFF1_1_135_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.922 1 115 3.40.50.1100
4g7eA04 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9176 115 541 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A529HGS4-F1-model_v4 deleted 0.985 367 439
AF-A0A6G3VPM3-F1-model_v4 deleted 0.9827 454 541
AF-A0A097J9U3-F1-model_v4 urease (EC 3.5.1.5) 0.9816 357 513 GO:0005737
GO:0009039
GO:0016151
GO:0043419
AF-A0A5C8S4I8-F1-model_v4 deleted 0.98 267 553
AF-A0A3A0V775-F1-model_v4 urease (EC 3.5.1.5) 0.9782 289 526 GO:0005737
GO:0009039
GO:0016151
GO:0043419

Feature Viewer

pLDDT pTM Quality
81.64 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map