F483313
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 847 | 388 | 796 | 631 |
Family's Representative Sequence
| Representative Sequence | 3300001904|JGI24736J21556_1001682|JGI24736J21556_10016822 |
| Length | 683 |
| Sequence | MTGIPGPVTSGIGRPRTVTFSIGGLRGPQGTARIHSQAGRPGDPHAPRENLLKSTLLASALXXALAGIGATAAFAADDVPAIKDGPFNGTVKVVVDATDTDHRIFRVKETVPAQPGKLTLLFPEWIPGHHSPTGPIDQFAGLIVKANGQRLEWTRDEYNVYAFHVDVPAGASSVDLEFQTLTPQDTRQGRIVMTPDIVNVQWNQVALYPAGYRADQVQFEPSVKLPAGFQFGTALEQASKDGDTVTFKNINFDDLVDSPIFAGRYFKRVDLDPNGRSPVHLNIVADSAKSLEIKPEALEIHRNLVKQMDKLYGARHYNHYDFLLALTDKLGGIGLEHHRSSENSASPNYFTEWDKSWLGRDLLAHEYNHSWDGKYRRGADLSTPSFNVPMGDSLLWVYEGQTQFWGNVVAARSGLVSQDQARDLLALVAATYDKGRPGLSWRNIQDTTNDPTIAQRRPLSYRNYQMSEDYYSGGQMIWLDVDTKLRELTKNKRSLDDFAKAFFGMKDGDWKVNPYTFDEVASTLNGIAPYDWAKYLRDRVDGHKGDIEGIERGGWKLVYNDKPSDAVKAFEARRHYTDLTYSAGFGVSSKGDISDVRWDSPAFNAGLSPGMHIVAVNGKEFDGDALKDAVTAAKGTSAPIELLVKNFDTYKTIKIEYHDGLMYPHLERDSSKPDWLSQLYKAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 3 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 4 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 5 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 6 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 7 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 8 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 9 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 10 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 11 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 12 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 13 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 14 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 15 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 16 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 17 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 18 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 19 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 20 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 21 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 22 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 23 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 24 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 25 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 26 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 27 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 28 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 29 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 30 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 31 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 32 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 33 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 34 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 35 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 36 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 37 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 38 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 39 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 40 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 41 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 42 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 43 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 44 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 45 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 46 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 47 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 48 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 49 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 50 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 51 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 52 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 53 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 54 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 55 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 56 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 57 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 58 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 59 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 60 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 61 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 62 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 63 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 64 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 65 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 66 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 67 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 68 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 69 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 70 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 71 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 72 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 73 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 74 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 75 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 76 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 77 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 78 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 79 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 80 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 81 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 82 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 83 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 84 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 85 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 86 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 88 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 93 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 109 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 110 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 113 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 114 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 116 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 120 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 122 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 123 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 124 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 125 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 126 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 127 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 128 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 129 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 130 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 131 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 132 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 134 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 135 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 136 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 137 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 138 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 153 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 164 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 167 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 168 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 169 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 170 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 171 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 174 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 175 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 176 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 187 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 188 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 191 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 196 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 203 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 247 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 251 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 252 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 253 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 254 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 255 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 256 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 257 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 259 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 262 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 263 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 264 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 265 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 266 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 267 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 268 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 269 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 270 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 271 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 272 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 273 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 276 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 277 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 278 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 279 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 280 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 281 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 282 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 283 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 284 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 285 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 286 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 287 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 288 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 289 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 336 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 337 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 338 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 339 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 340 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 341 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 342 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 343 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 344 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 345 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 346 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 347 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 348 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 349 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 350 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 351 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 352 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 353 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 354 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 355 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 377 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 378 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 379 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 380 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 381 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 382 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 383 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 384 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 385 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 386 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 387 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 388 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.62 |
| Metatranscriptomes | 0.35 |
| Isolates | 6.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 15.82 |
| Nodule | 0 |
| Rhizoplane | 1.77 |
| Rhizosphere | 65.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3055844 | 2162886007 | Bacteria | 22848 |
| 2 | JGI24736J21556_1001682 | 3300001904 | Bacteria | 4007 |
| 3 | JGI24740J21852_10011041 | 3300001979 | Bacteria | 3453 |
| 4 | JGI24739J22299_10001118 | 3300001989 | Bacteria | 10000 |
| 5 | JGI24737J22298_10000507 | 3300001990 | Bacteria | 13598 |
| 6 | JGI24735J21928_10009465 | 3300002067 | Bacteria | 3127 |
| 7 | JGI24738J21930_10000386 | 3300002075 | Bacteria | 12279 |
| 8 | JGI25156J39149_1005622 | 3300002705 | Bacteria | 3571 |
| 9 | JGI25162J39368_1000156 | 3300002737 | Bacteria | 75086 |
| 10 | JGI25162J39368_1000255 | 3300002737 | Bacteria | 50867 |
| 11 | JGI25162J39368_1000580 | 3300002737 | Bacteria | 26829 |
| 12 | JGI25162J39368_1000588 | 3300002737 | Bacteria | 26533 |
| 13 | JGI25162J39368_1000830 | 3300002737 | Bacteria | 20342 |
| 14 | JGI25162J39368_1002555 | 3300002737 | Bacteria | 6922 |
| 15 | JGI25154J39366_1002703 | 3300002738 | Bacteria | 4322 |
| 16 | JGI25157J39369_1000165 | 3300002741 | Bacteria | 55870 |
| 17 | JGI25157J39369_1000659 | 3300002741 | Bacteria | 19127 |
| 18 | JGI25157J39369_1000719 | 3300002741 | Bacteria | 17685 |
| 19 | JGI25163J39215_1000430 | 3300002771 | Bacteria | 12989 |
| 20 | JGI25164J39214_1000086 | 3300002772 | Bacteria | 91769 |
| 21 | JGI25164J39214_1000136 | 3300002772 | Bacteria | 71176 |
| 22 | JGI25164J39214_1000354 | 3300002772 | Bacteria | 28569 |
| 23 | JGI25164J39214_1002298 | 3300002772 | Bacteria | 3064 |
| 24 | JGI25152J39213_1000231 | 3300002773 | Bacteria | 37495 |
| 25 | JGI25150J39212_1000095 | 3300002774 | Bacteria | 50881 |
| 26 | JGI25151J46595_10000477 | 3300003187 | Bacteria | 37879 |
| 27 | JGI25165J46597_1000144 | 3300003214 | Bacteria | 117624 |
| 28 | JGI25165J46597_1000256 | 3300003214 | Bacteria | 71176 |
| 29 | JGI25153J46596_10000291 | 3300003215 | Bacteria | 37879 |
| 30 | rootH2_10016193 | 3300003320 | Bacteria | 38745 |
| 31 | Ga0006562J51391_1023108 | 3300003578 | Bacteria | 8247 |
| 32 | Ga0006562J51391_1023112 | 3300003578 | Bacteria | 3210 |
| 33 | Ga0055538_1000254 | 3300003751 | Bacteria | 28466 |
| 34 | Ga0055533_1001435 | 3300003756 | Bacteria | 6303 |
| 35 | Ga0055525_1000043 | 3300003759 | Bacteria | 268656 |
| 36 | Ga0055527_1000028 | 3300003760 | Bacteria | 172877 |
| 37 | Ga0055527_1000147 | 3300003760 | Bacteria | 50195 |
| 38 | Ga0055535_1000061 | 3300003761 | Bacteria | 117624 |
| 39 | Ga0055535_1000303 | 3300003761 | Bacteria | 50195 |
| 40 | Ga0055535_1000436 | 3300003761 | Bacteria | 38597 |
| 41 | Ga0055535_1000497 | 3300003761 | Bacteria | 35185 |
| 42 | Ga0055535_1000741 | 3300003761 | Bacteria | 24447 |
| 43 | Ga0055542_1000053 | 3300003762 | Bacteria | 172877 |
| 44 | Ga0055542_1000099 | 3300003762 | Bacteria | 117624 |
| 45 | Ga0055542_1000107 | 3300003762 | Bacteria | 111897 |
| 46 | Ga0055542_1000333 | 3300003762 | Bacteria | 50195 |
| 47 | Ga0055542_1000513 | 3300003762 | Bacteria | 35185 |
| 48 | Ga0055542_1000640 | 3300003762 | Bacteria | 29300 |
| 49 | Ga0055529_1000067 | 3300003763 | Bacteria | 165941 |
| 50 | Ga0055529_1000117 | 3300003763 | Bacteria | 117613 |
| 51 | Ga0055529_1000356 | 3300003763 | Bacteria | 50195 |
| 52 | Ga0055529_1000360 | 3300003763 | Bacteria | 49654 |
| 53 | Ga0055526_1000464 | 3300003771 | Bacteria | 32229 |
| 54 | Ga0055537_1000169 | 3300003773 | Bacteria | 48599 |
| 55 | Ga0055536_1003537 | 3300003781 | Bacteria | 8365 |
| 56 | Ga0055534_1000404 | 3300003784 | Bacteria | 26598 |
| 57 | Ga0055528_1000587 | 3300003790 | Bacteria | 27449 |
| 58 | Ga0055530_10001287 | 3300003791 | Bacteria | 18959 |
| 59 | Ga0055530_10005941 | 3300003791 | Bacteria | 5623 |
| 60 | Ga0055530_10005949 | 3300003791 | Bacteria | 5616 |
| 61 | Ga0055531_10013620 | 3300003794 | Bacteria | 3733 |
| 62 | Ga0058692_1000017 | 3300003856 | Bacteria | 274459 |
| 63 | Ga0065165_1000199 | 3300005262 | Bacteria | 104204 |
| 64 | Ga0065165_1000532 | 3300005262 | Bacteria | 58082 |
| 65 | Ga0065165_1006565 | 3300005262 | Bacteria | 6056 |
| 66 | Ga0065704_10000275 | 3300005289 | Bacteria | 50973 |
| 67 | Ga0065707_10084906 | 3300005295 | Bacteria | 6649 |
| 68 | Ga0070658_10000632 | 3300005327 | Bacteria | 30414 |
| 69 | Ga0070658_10003827 | 3300005327 | Bacteria | 12334 |
| 70 | Ga0070658_10005565 | 3300005327 | Bacteria | 10218 |
| 71 | Ga0070690_100001336 | 3300005330 | Bacteria | 12818 |
| 72 | Ga0070690_100028447 | 3300005330 | Bacteria | 3462 |
| 73 | Ga0070670_100005186 | 3300005331 | Bacteria | 10969 |
| 74 | Ga0070670_100008001 | 3300005331 | Bacteria | 8990 |
| 75 | Ga0070666_10000008 | 3300005335 | Bacteria | 293415 |
| 76 | Ga0070666_10000020 | 3300005335 | Bacteria | 177564 |
| 77 | Ga0070680_100000757 | 3300005336 | Bacteria | 22564 |
| 78 | Ga0070680_100001023 | 3300005336 | Bacteria | 19993 |
| 79 | Ga0070680_100003859 | 3300005336 | Bacteria | 11202 |
| 80 | Ga0070680_100081681 | 3300005336 | Bacteria | 2666 |
| 81 | Ga0070682_100018605 | 3300005337 | Bacteria | 4065 |
| 82 | Ga0070682_100057224 | 3300005337 | Bacteria | 2455 |
| 83 | Ga0070689_100013250 | 3300005340 | Bacteria | 5961 |
| 84 | Ga0070689_100016611 | 3300005340 | Bacteria | 5388 |
| 85 | Ga0070691_10000173 | 3300005341 | Bacteria | 21089 |
| 86 | Ga0070691_10008356 | 3300005341 | Bacteria | 4741 |
| 87 | Ga0070661_100000592 | 3300005344 | Bacteria | 27294 |
| 88 | Ga0070661_100020478 | 3300005344 | Bacteria | 4718 |
| 89 | Ga0070661_100046241 | 3300005344 | Bacteria | 3184 |
| 90 | Ga0070668_100047749 | 3300005347 | Bacteria | 3292 |
| 91 | Ga0070669_100000003 | 3300005353 | Bacteria | 338807 |
| 92 | Ga0070675_100000102 | 3300005354 | Bacteria | 50103 |
| 93 | Ga0070675_100039998 | 3300005354 | Bacteria | 3827 |
| 94 | Ga0070671_100004985 | 3300005355 | Bacteria | 10576 |
| 95 | Ga0070671_100010066 | 3300005355 | Bacteria | 7594 |
| 96 | Ga0070673_100003087 | 3300005364 | Bacteria | 10309 |
| 97 | Ga0070659_100000645 | 3300005366 | Bacteria | 25489 |
| 98 | Ga0070659_100001854 | 3300005366 | Bacteria | 15197 |
| 99 | Ga0070659_100021687 | 3300005366 | Bacteria | 4897 |
| 100 | Ga0070667_100000012 | 3300005367 | Bacteria | 258575 |
| 101 | Ga0070667_100000238 | 3300005367 | Bacteria | 62518 |
| 102 | Ga0070667_100005776 | 3300005367 | Bacteria | 10326 |
| 103 | Ga0070667_100007898 | 3300005367 | Bacteria | 8826 |
| 104 | Ga0070667_100015414 | 3300005367 | Bacteria | 6319 |
| 105 | Ga0070714_100000285 | 3300005435 | Bacteria | 38892 |
| 106 | Ga0070714_100011841 | 3300005435 | Bacteria | 6932 |
| 107 | Ga0070714_100042692 | 3300005435 | Bacteria | 3832 |
| 108 | Ga0070713_100002100 | 3300005436 | Bacteria | 12880 |
| 109 | Ga0070711_100015889 | 3300005439 | Bacteria | 4769 |
| 110 | Ga0070711_100028503 | 3300005439 | Bacteria | 3675 |
| 111 | Ga0070708_100011892 | 3300005445 | Bacteria | 7087 |
| 112 | Ga0070663_100000126 | 3300005455 | Bacteria | 36101 |
| 113 | Ga0070663_100010476 | 3300005455 | Bacteria | 5777 |
| 114 | Ga0070663_100018862 | 3300005455 | Bacteria | 4534 |
| 115 | Ga0070663_100043261 | 3300005455 | Bacteria | 3169 |
| 116 | Ga0070663_100081340 | 3300005455 | Bacteria | 2381 |
| 117 | Ga0070662_100007301 | 3300005457 | Bacteria | 7159 |
| 118 | Ga0070681_10001214 | 3300005458 | Bacteria | 22414 |
| 119 | Ga0070681_10001772 | 3300005458 | Bacteria | 19367 |
| 120 | Ga0070681_10002905 | 3300005458 | Bacteria | 15852 |
| 121 | Ga0070681_10005388 | 3300005458 | Bacteria | 12349 |
| 122 | Ga0070681_10006795 | 3300005458 | Bacteria | 11135 |
| 123 | Ga0070685_10001037 | 3300005466 | Bacteria | 14899 |
| 124 | Ga0070685_10001192 | 3300005466 | Bacteria | 13890 |
| 125 | Ga0070685_10002768 | 3300005466 | Bacteria | 8965 |
| 126 | Ga0070698_100018240 | 3300005471 | Bacteria | 7390 |
| 127 | Ga0070699_100120221 | 3300005518 | Bacteria | 2309 |
| 128 | Ga0070679_100000992 | 3300005530 | Bacteria | 24720 |
| 129 | Ga0070679_100001076 | 3300005530 | Bacteria | 23858 |
| 130 | Ga0070679_100001316 | 3300005530 | Bacteria | 21885 |
| 131 | Ga0070684_100022717 | 3300005535 | Bacteria | 5236 |
| 132 | Ga0070697_100012911 | 3300005536 | Bacteria | 6545 |
| 133 | Ga0068853_100000191 | 3300005539 | Bacteria | 43207 |
| 134 | Ga0068853_100001170 | 3300005539 | Bacteria | 18664 |
| 135 | Ga0070672_100005812 | 3300005543 | Bacteria | 8228 |
| 136 | Ga0070672_100015022 | 3300005543 | Bacteria | 5502 |
| 137 | Ga0070696_100000382 | 3300005546 | Bacteria | 27135 |
| 138 | Ga0070696_100013399 | 3300005546 | Bacteria | 5501 |
| 139 | Ga0070696_100014957 | 3300005546 | Bacteria | 5210 |
| 140 | Ga0070665_100000132 | 3300005548 | Bacteria | 140229 |
| 141 | Ga0070665_100001521 | 3300005548 | Bacteria | 26874 |
| 142 | Ga0070665_100003317 | 3300005548 | Bacteria | 17245 |
| 143 | Ga0070665_100070395 | 3300005548 | Bacteria | 3505 |
| 144 | Ga0068855_100000601 | 3300005563 | Bacteria | 44104 |
| 145 | Ga0068855_100017609 | 3300005563 | Bacteria | 8591 |
| 146 | Ga0068855_100087040 | 3300005563 | Bacteria | 3612 |
| 147 | Ga0070664_100001090 | 3300005564 | Bacteria | 21405 |
| 148 | Ga0070664_100001813 | 3300005564 | Bacteria | 17124 |
| 149 | Ga0068857_100023963 | 3300005577 | Bacteria | 5372 |
| 150 | Ga0068857_100074675 | 3300005577 | Bacteria | 3022 |
| 151 | Ga0068857_100119646 | 3300005577 | Bacteria | 2371 |
| 152 | Ga0068854_100000002 | 3300005578 | Bacteria | 362695 |
| 153 | Ga0068854_100000481 | 3300005578 | Bacteria | 24413 |
| 154 | Ga0068854_100003804 | 3300005578 | Bacteria | 9439 |
| 155 | Ga0068854_100060028 | 3300005578 | Bacteria | 2749 |
| 156 | Ga0068854_100066898 | 3300005578 | Bacteria | 2616 |
| 157 | Ga0068856_100013197 | 3300005614 | Bacteria | 8002 |
| 158 | Ga0068856_100024504 | 3300005614 | Bacteria | 5876 |
| 159 | Ga0068852_100085078 | 3300005616 | Bacteria | 2816 |
| 160 | Ga0068859_100001584 | 3300005617 | Bacteria | 23196 |
| 161 | Ga0068859_100001612 | 3300005617 | Bacteria | 23064 |
| 162 | Ga0068859_100182488 | 3300005617 | Bacteria | 2182 |
| 163 | Ga0068864_100039204 | 3300005618 | Bacteria | 4048 |
| 164 | Ga0068864_100055268 | 3300005618 | Bacteria | 3427 |
| 165 | Ga0068851_10005497 | 3300005834 | Bacteria | 5742 |
| 166 | Ga0068863_100002479 | 3300005841 | Bacteria | 18349 |
| 167 | Ga0068863_100041259 | 3300005841 | Bacteria | 4387 |
| 168 | Ga0068863_100105737 | 3300005841 | Unclassified | 2677 |
| 169 | Ga0068858_100000132 | 3300005842 | Bacteria | 77767 |
| 170 | Ga0068858_100006090 | 3300005842 | Bacteria | 11767 |
| 171 | Ga0068858_100018210 | 3300005842 | Bacteria | 6577 |
| 172 | Ga0068860_100000771 | 3300005843 | Bacteria | 36058 |
| 173 | Ga0068860_100003593 | 3300005843 | Bacteria | 15941 |
| 174 | Ga0068860_100008839 | 3300005843 | Bacteria | 10033 |
| 175 | Ga0068860_100036499 | 3300005843 | Bacteria | 4709 |
| 176 | Ga0068862_100052969 | 3300005844 | Bacteria | 3473 |
| 177 | Ga0068862_100091506 | 3300005844 | Bacteria | 2650 |
| 178 | Ga0097621_100037884 | 3300006237 | Bacteria | 3868 |
| 179 | Ga0097621_100051245 | 3300006237 | Bacteria | 3359 |
| 180 | Ga0068871_100068095 | 3300006358 | Bacteria | 2922 |
| 181 | Ga0068871_100089700 | 3300006358 | Bacteria | 2560 |
| 182 | Ga0075430_100076585 | 3300006846 | Bacteria | 2804 |
| 183 | Ga0075434_100044197 | 3300006871 | Bacteria | 4420 |
| 184 | Ga0068865_100008576 | 3300006881 | Bacteria | 6319 |
| 185 | Ga0068865_100035847 | 3300006881 | Bacteria | 3340 |
| 186 | Ga0075436_100017086 | 3300006914 | Bacteria | 4966 |
| 187 | Ga0097620_100001584 | 3300006931 | Bacteria | 23196 |
| 188 | Ga0097620_100001612 | 3300006931 | Bacteria | 23064 |
| 189 | Ga0097620_100182478 | 3300006931 | Bacteria | 2182 |
| 190 | Ga0105251_10001750 | 3300009011 | Bacteria | 18123 |
| 191 | Ga0105240_10000049 | 3300009093 | Bacteria | 236718 |
| 192 | Ga0105240_10000368 | 3300009093 | Bacteria | 84618 |
| 193 | Ga0105240_10000624 | 3300009093 | Bacteria | 65382 |
| 194 | Ga0105240_10002793 | 3300009093 | Bacteria | 27614 |
| 195 | Ga0105240_10003217 | 3300009093 | Bacteria | 25589 |
| 196 | Ga0105240_10039957 | 3300009093 | Bacteria | 6005 |
| 197 | Ga0105240_10040933 | 3300009093 | Bacteria | 5920 |
| 198 | Ga0105240_10057086 | 3300009093 | Bacteria | 4881 |
| 199 | Ga0105240_10068042 | 3300009093 | Bacteria | 4412 |
| 200 | Ga0105240_10089489 | 3300009093 | Bacteria | 3765 |
| 201 | Ga0111539_10007836 | 3300009094 | Bacteria | 13640 |
| 202 | Ga0105245_10008344 | 3300009098 | Bacteria | 9053 |
| 203 | Ga0105247_10012918 | 3300009101 | Bacteria | 5008 |
| 204 | Ga0114129_10002885 | 3300009147 | Bacteria | 24057 |
| 205 | Ga0105243_10003262 | 3300009148 | Bacteria | 13207 |
| 206 | Ga0105241_10027712 | 3300009174 | Bacteria | 4219 |
| 207 | Ga0105248_10000179 | 3300009177 | Bacteria | 73845 |
| 208 | Ga0105248_10000244 | 3300009177 | Bacteria | 62961 |
| 209 | Ga0105248_10002189 | 3300009177 | Bacteria | 21624 |
| 210 | Ga0105248_10045312 | 3300009177 | Bacteria | 4932 |
| 211 | Ga0105237_10000097 | 3300009545 | Bacteria | 121349 |
| 212 | Ga0105237_10001219 | 3300009545 | Bacteria | 34275 |
| 213 | Ga0105237_10128855 | 3300009545 | Bacteria | 2525 |
| 214 | Ga0105237_10151898 | 3300009545 | Bacteria | 2312 |
| 215 | Ga0105237_10167622 | 3300009545 | Bacteria | 2196 |
| 216 | Ga0105238_10000145 | 3300009551 | Bacteria | 77797 |
| 217 | Ga0105238_10000335 | 3300009551 | Bacteria | 51399 |
| 218 | Ga0105238_10003689 | 3300009551 | Bacteria | 15246 |
| 219 | Ga0105238_10020116 | 3300009551 | Bacteria | 6795 |
| 220 | Ga0105238_10033452 | 3300009551 | Bacteria | 5233 |
| 221 | Ga0105249_10000262 | 3300009553 | Bacteria | 56551 |
| 222 | Ga0105239_10000070 | 3300010375 | Bacteria | 144044 |
| 223 | Ga0105239_10000967 | 3300010375 | Bacteria | 40367 |
| 224 | Ga0105239_10032770 | 3300010375 | Bacteria | 5709 |
| 225 | Ga0105239_10058346 | 3300010375 | Bacteria | 4235 |
| 226 | Ga0157314_1000001 | 3300012500 | Bacteria | 57291 |
| 227 | Ga0157373_10011039 | 3300013100 | Bacteria | 6653 |
| 228 | Ga0157373_10038130 | 3300013100 | Bacteria | 3444 |
| 229 | Ga0157371_10001503 | 3300013102 | Bacteria | 24118 |
| 230 | Ga0157371_10003102 | 3300013102 | Bacteria | 15388 |
| 231 | Ga0157370_10000224 | 3300013104 | Bacteria | 71976 |
| 232 | Ga0157370_10000342 | 3300013104 | Bacteria | 58828 |
| 233 | Ga0157370_10001344 | 3300013104 | Bacteria | 30527 |
| 234 | Ga0157370_10039001 | 3300013104 | Bacteria | 4593 |
| 235 | Ga0157369_10003305 | 3300013105 | Bacteria | 19174 |
| 236 | Ga0157369_10004308 | 3300013105 | Bacteria | 16807 |
| 237 | Ga0157369_10031478 | 3300013105 | Bacteria | 5840 |
| 238 | Ga0157369_10041194 | 3300013105 | Bacteria | 5041 |
| 239 | Ga0157369_10086800 | 3300013105 | Bacteria | 3341 |
| 240 | Ga0157369_10107685 | 3300013105 | Bacteria | 2965 |
| 241 | Ga0157378_10118007 | 3300013297 | Bacteria | 2442 |
| 242 | Ga0163162_10001968 | 3300013306 | Bacteria | 19312 |
| 243 | Ga0163162_10006577 | 3300013306 | Bacteria | 11263 |
| 244 | Ga0163162_10013318 | 3300013306 | Bacteria | 8033 |
| 245 | Ga0157372_10021320 | 3300013307 | Bacteria | 7000 |
| 246 | Ga0157372_10030736 | 3300013307 | Bacteria | 5876 |
| 247 | Ga0157375_10000216 | 3300013308 | Bacteria | 53883 |
| 248 | Ga0157375_10013933 | 3300013308 | Bacteria | 7169 |
| 249 | Ga0157375_10015954 | 3300013308 | Bacteria | 6738 |
| 250 | Ga0163163_10074753 | 3300014325 | Bacteria | 3381 |
| 251 | Ga0163163_10087332 | 3300014325 | Bacteria | 3129 |
| 252 | Ga0157380_10026626 | 3300014326 | Bacteria | 4392 |
| 253 | Ga0157380_10104227 | 3300014326 | Bacteria | 2368 |
| 254 | Ga0182008_10000745 | 3300014497 | Bacteria | 22965 |
| 255 | Ga0182008_10002859 | 3300014497 | Bacteria | 10697 |
| 256 | Ga0182008_10015138 | 3300014497 | Bacteria | 4030 |
| 257 | Ga0182008_10022630 | 3300014497 | Bacteria | 3218 |
| 258 | Ga0157379_10000091 | 3300014968 | Bacteria | 61113 |
| 259 | Ga0157376_10027808 | 3300014969 | Bacteria | 4487 |
| 260 | Ga0182006_1000058 | 3300015261 | Bacteria | 167164 |
| 261 | Ga0182006_1000098 | 3300015261 | Bacteria | 101707 |
| 262 | Ga0182006_1029320 | 3300015261 | Bacteria | 2230 |
| 263 | Ga0182007_10000311 | 3300015262 | Bacteria | 31137 |
| 264 | Ga0182005_1000015 | 3300015265 | Bacteria | 387565 |
| 265 | Ga0183369_1019 | 3300015685 | Bacteria | 115894 |
| 266 | Ga0183368_1007 | 3300015687 | Bacteria | 405609 |
| 267 | Ga0163161_10001852 | 3300017792 | Bacteria | 15455 |
| 268 | Ga0163161_10003406 | 3300017792 | Bacteria | 11158 |
| 269 | Ga0163161_10033273 | 3300017792 | Bacteria | 3684 |
| 270 | Ga0206356_10268222 | 3300020070 | Bacteria | 11936 |
| 271 | Ga0213872_10000601 | 3300021361 | Bacteria | 27442 |
| 272 | Ga0213872_10002289 | 3300021361 | Bacteria | 11410 |
| 273 | Ga0213872_10003100 | 3300021361 | Bacteria | 9362 |
| 274 | Ga0213872_10004729 | 3300021361 | Bacteria | 7141 |
| 275 | Ga0213872_10008108 | 3300021361 | Bacteria | 5099 |
| 276 | Ga0213872_10009756 | 3300021361 | Bacteria | 4590 |
| 277 | Ga0213872_10029877 | 3300021361 | Bacteria | 2499 |
| 278 | Ga0213876_10000303 | 3300021384 | Bacteria | 44145 |
| 279 | Ga0213875_10010605 | 3300021388 | Bacteria | 4611 |
| 280 | Ga0209760_100243 | 3300025207 | Bacteria | 22600 |
| 281 | Ga0209784_100043 | 3300025224 | Bacteria | 217823 |
| 282 | Ga0209566_102982 | 3300025225 | Bacteria | 2807 |
| 283 | Ga0209674_100037 | 3300025226 | Bacteria | 404339 |
| 284 | Ga0209674_100059 | 3300025226 | Bacteria | 282517 |
| 285 | Ga0209674_101158 | 3300025226 | Bacteria | 7626 |
| 286 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 287 | Ga0209672_100008 | 3300025228 | Bacteria | 946876 |
| 288 | Ga0209672_100274 | 3300025228 | Bacteria | 37549 |
| 289 | Ga0209672_100473 | 3300025228 | Bacteria | 22550 |
| 290 | Ga0209563_100036 | 3300025230 | Bacteria | 448275 |
| 291 | Ga0207427_100044 | 3300025231 | Bacteria | 242623 |
| 292 | Ga0207427_100087 | 3300025231 | Bacteria | 140098 |
| 293 | Ga0207427_100088 | 3300025231 | Bacteria | 137220 |
| 294 | Ga0207427_100145 | 3300025231 | Bacteria | 82641 |
| 295 | Ga0207427_100191 | 3300025231 | Bacteria | 60860 |
| 296 | Ga0207427_101926 | 3300025231 | Bacteria | 6419 |
| 297 | Ga0209437_100005 | 3300025233 | Bacteria | 1071596 |
| 298 | Ga0209437_100167 | 3300025233 | Bacteria | 144661 |
| 299 | Ga0209437_100173 | 3300025233 | Bacteria | 140098 |
| 300 | Ga0209437_100266 | 3300025233 | Bacteria | 79564 |
| 301 | Ga0209437_100431 | 3300025233 | Bacteria | 36840 |
| 302 | Ga0209437_101228 | 3300025233 | Bacteria | 7282 |
| 303 | Ga0209437_101348 | 3300025233 | Bacteria | 6394 |
| 304 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 305 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 306 | Ga0209258_100008 | 3300025242 | Bacteria | 1009355 |
| 307 | Ga0209258_100092 | 3300025242 | Bacteria | 226544 |
| 308 | Ga0209258_100265 | 3300025242 | Bacteria | 90172 |
| 309 | Ga0209258_100372 | 3300025242 | Bacteria | 58847 |
| 310 | Ga0209258_100798 | 3300025242 | Bacteria | 18582 |
| 311 | Ga0207425_1000028 | 3300025245 | Bacteria | 286333 |
| 312 | Ga0209646_1000576 | 3300025246 | Bacteria | 15271 |
| 313 | Ga0209646_1001067 | 3300025246 | Bacteria | 8227 |
| 314 | Ga0209026_1000010 | 3300025250 | Bacteria | 511986 |
| 315 | Ga0209026_1000081 | 3300025250 | Bacteria | 196861 |
| 316 | Ga0209026_1000112 | 3300025250 | Bacteria | 140098 |
| 317 | Ga0209026_1001377 | 3300025250 | Bacteria | 10854 |
| 318 | Ga0209026_1003633 | 3300025250 | Bacteria | 4952 |
| 319 | Ga0209026_1004232 | 3300025250 | Bacteria | 4363 |
| 320 | Ga0209677_100814 | 3300025253 | Bacteria | 15605 |
| 321 | Ga0209148_1000016 | 3300025254 | Bacteria | 804369 |
| 322 | Ga0209148_1000042 | 3300025254 | Bacteria | 464111 |
| 323 | Ga0209148_1000047 | 3300025254 | Bacteria | 434369 |
| 324 | Ga0209148_1000055 | 3300025254 | Bacteria | 367500 |
| 325 | Ga0209148_1000065 | 3300025254 | Bacteria | 344489 |
| 326 | Ga0209148_1000222 | 3300025254 | Bacteria | 93775 |
| 327 | Ga0209759_1000468 | 3300025256 | Bacteria | 45634 |
| 328 | Ga0209759_1000934 | 3300025256 | Bacteria | 21037 |
| 329 | Ga0209759_1001497 | 3300025256 | Bacteria | 12906 |
| 330 | Ga0209129_1000065 | 3300025258 | Bacteria | 232568 |
| 331 | Ga0209129_1000907 | 3300025258 | Bacteria | 18130 |
| 332 | Ga0209233_1000011 | 3300025261 | Bacteria | 1071611 |
| 333 | Ga0209233_1000046 | 3300025261 | Bacteria | 470971 |
| 334 | Ga0209233_1000179 | 3300025261 | Bacteria | 140518 |
| 335 | Ga0209233_1000254 | 3300025261 | Bacteria | 82641 |
| 336 | Ga0209565_1000031 | 3300025263 | Bacteria | 320341 |
| 337 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 338 | Ga0209455_1000007 | 3300025272 | Bacteria | 1157983 |
| 339 | Ga0209455_1000016 | 3300025272 | Bacteria | 753097 |
| 340 | Ga0209455_1000056 | 3300025272 | Bacteria | 349821 |
| 341 | Ga0209455_1000103 | 3300025272 | Bacteria | 201664 |
| 342 | Ga0209455_1000295 | 3300025272 | Bacteria | 52412 |
| 343 | Ga0209455_1004681 | 3300025272 | Bacteria | 4406 |
| 344 | Ga0209673_1000484 | 3300025273 | Bacteria | 66361 |
| 345 | Ga0209675_1000015 | 3300025291 | Bacteria | 403517 |
| 346 | Ga0209676_1000182 | 3300025292 | Bacteria | 146373 |
| 347 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 348 | Ga0209564_1000480 | 3300025295 | Bacteria | 66421 |
| 349 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 350 | Ga0209758_1000696 | 3300025297 | Bacteria | 49847 |
| 351 | Ga0209758_1001407 | 3300025297 | Bacteria | 28504 |
| 352 | Ga0209050_1000141 | 3300025298 | Bacteria | 173116 |
| 353 | Ga0209050_1000201 | 3300025298 | Bacteria | 134028 |
| 354 | Ga0209050_1001448 | 3300025298 | Bacteria | 25493 |
| 355 | Ga0209256_1010915 | 3300025299 | Bacteria | 3724 |
| 356 | Ga0209051_1001660 | 3300025303 | Bacteria | 17957 |
| 357 | Ga0209051_1002093 | 3300025303 | Bacteria | 15039 |
| 358 | Ga0209257_1000180 | 3300025304 | Bacteria | 158090 |
| 359 | Ga0209257_1000208 | 3300025304 | Bacteria | 141393 |
| 360 | Ga0209257_1000484 | 3300025304 | Bacteria | 72044 |
| 361 | Ga0209257_1000636 | 3300025304 | Bacteria | 56284 |
| 362 | Ga0209257_1002229 | 3300025304 | Bacteria | 19909 |
| 363 | Ga0209257_1016563 | 3300025304 | Bacteria | 2971 |
| 364 | Ga0207656_10001699 | 3300025321 | Bacteria | 7309 |
| 365 | Ga0207713_1000393 | 3300025735 | Bacteria | 47322 |
| 366 | Ga0207680_10000001 | 3300025903 | Bacteria | 1091453 |
| 367 | Ga0207680_10000005 | 3300025903 | Bacteria | 660983 |
| 368 | Ga0207680_10048918 | 3300025903 | Bacteria | 2514 |
| 369 | Ga0207647_10000019 | 3300025904 | Bacteria | 123924 |
| 370 | Ga0207647_10000031 | 3300025904 | Bacteria | 104231 |
| 371 | Ga0207647_10004652 | 3300025904 | Bacteria | 10167 |
| 372 | Ga0207647_10008443 | 3300025904 | Bacteria | 7386 |
| 373 | Ga0207647_10014983 | 3300025904 | Bacteria | 5328 |
| 374 | Ga0207647_10020725 | 3300025904 | Bacteria | 4404 |
| 375 | Ga0207705_10000641 | 3300025909 | Bacteria | 29186 |
| 376 | Ga0207705_10001258 | 3300025909 | Bacteria | 20379 |
| 377 | Ga0207705_10011802 | 3300025909 | Bacteria | 6314 |
| 378 | Ga0207684_10009533 | 3300025910 | Bacteria | 8566 |
| 379 | Ga0207654_10026208 | 3300025911 | Bacteria | 3154 |
| 380 | Ga0207707_10000248 | 3300025912 | Bacteria | 59206 |
| 381 | Ga0207707_10000267 | 3300025912 | Bacteria | 56162 |
| 382 | Ga0207707_10001078 | 3300025912 | Bacteria | 26123 |
| 383 | Ga0207707_10005096 | 3300025912 | Bacteria | 11523 |
| 384 | Ga0207707_10008813 | 3300025912 | Bacteria | 8758 |
| 385 | Ga0207707_10019320 | 3300025912 | Bacteria | 5947 |
| 386 | Ga0207707_10030671 | 3300025912 | Bacteria | 4703 |
| 387 | Ga0207707_10032484 | 3300025912 | Bacteria | 4568 |
| 388 | Ga0207695_10000014 | 3300025913 | Bacteria | 812599 |
| 389 | Ga0207695_10000100 | 3300025913 | Bacteria | 258626 |
| 390 | Ga0207695_10000114 | 3300025913 | Bacteria | 242465 |
| 391 | Ga0207695_10000704 | 3300025913 | Bacteria | 65282 |
| 392 | Ga0207695_10001693 | 3300025913 | Bacteria | 35385 |
| 393 | Ga0207695_10002625 | 3300025913 | Bacteria | 26298 |
| 394 | Ga0207695_10007072 | 3300025913 | Bacteria | 14389 |
| 395 | Ga0207695_10012442 | 3300025913 | Bacteria | 10216 |
| 396 | Ga0207695_10017563 | 3300025913 | Bacteria | 8318 |
| 397 | Ga0207695_10030334 | 3300025913 | Bacteria | 5954 |
| 398 | Ga0207671_10000119 | 3300025914 | Bacteria | 121359 |
| 399 | Ga0207671_10000409 | 3300025914 | Bacteria | 60086 |
| 400 | Ga0207671_10024108 | 3300025914 | Bacteria | 4579 |
| 401 | Ga0207660_10006597 | 3300025917 | Bacteria | 7534 |
| 402 | Ga0207660_10056984 | 3300025917 | Bacteria | 2798 |
| 403 | Ga0207657_10080404 | 3300025919 | Bacteria | 2740 |
| 404 | Ga0207649_10001813 | 3300025920 | Bacteria | 12193 |
| 405 | Ga0207649_10001942 | 3300025920 | Bacteria | 11779 |
| 406 | Ga0207649_10011905 | 3300025920 | Bacteria | 4813 |
| 407 | Ga0207649_10017407 | 3300025920 | Bacteria | 4072 |
| 408 | Ga0207652_10000025 | 3300025921 | Bacteria | 157704 |
| 409 | Ga0207652_10001915 | 3300025921 | Bacteria | 18022 |
| 410 | Ga0207652_10002103 | 3300025921 | Bacteria | 17102 |
| 411 | Ga0207681_10000007 | 3300025923 | Bacteria | 483669 |
| 412 | Ga0207694_10001078 | 3300025924 | Bacteria | 23707 |
| 413 | Ga0207694_10001535 | 3300025924 | Bacteria | 19628 |
| 414 | Ga0207694_10006773 | 3300025924 | Bacteria | 8701 |
| 415 | Ga0207694_10016576 | 3300025924 | Bacteria | 5564 |
| 416 | Ga0207694_10037547 | 3300025924 | Bacteria | 3721 |
| 417 | Ga0207650_10001635 | 3300025925 | Bacteria | 15954 |
| 418 | Ga0207659_10000802 | 3300025926 | Bacteria | 18581 |
| 419 | Ga0207659_10004529 | 3300025926 | Bacteria | 8407 |
| 420 | Ga0207659_10008284 | 3300025926 | Bacteria | 6445 |
| 421 | Ga0207687_10011627 | 3300025927 | Bacteria | 5753 |
| 422 | Ga0207700_10019467 | 3300025928 | Bacteria | 4586 |
| 423 | Ga0207664_10000092 | 3300025929 | Bacteria | 83276 |
| 424 | Ga0207664_10001368 | 3300025929 | Bacteria | 16021 |
| 425 | Ga0207644_10008561 | 3300025931 | Bacteria | 6693 |
| 426 | Ga0207690_10000768 | 3300025932 | Bacteria | 20778 |
| 427 | Ga0207690_10012171 | 3300025932 | Bacteria | 5148 |
| 428 | Ga0207690_10032344 | 3300025932 | Bacteria | 3356 |
| 429 | Ga0207690_10041998 | 3300025932 | Bacteria | 3000 |
| 430 | Ga0207690_10044971 | 3300025932 | Bacteria | 2914 |
| 431 | Ga0207706_10000898 | 3300025933 | Bacteria | 30553 |
| 432 | Ga0207706_10003006 | 3300025933 | Bacteria | 16254 |
| 433 | Ga0207706_10039207 | 3300025933 | Bacteria | 4200 |
| 434 | Ga0207706_10039256 | 3300025933 | Bacteria | 4197 |
| 435 | Ga0207706_10062435 | 3300025933 | Bacteria | 3281 |
| 436 | Ga0207670_10016152 | 3300025936 | Unclassified | 4479 |
| 437 | Ga0207691_10011979 | 3300025940 | Bacteria | 8318 |
| 438 | Ga0207711_10000406 | 3300025941 | Bacteria | 45644 |
| 439 | Ga0207711_10004808 | 3300025941 | Bacteria | 11469 |
| 440 | Ga0207711_10040247 | 3300025941 | Bacteria | 3976 |
| 441 | Ga0207679_10001906 | 3300025945 | Bacteria | 12951 |
| 442 | Ga0207667_10000134 | 3300025949 | Bacteria | 112086 |
| 443 | Ga0207667_10000195 | 3300025949 | Bacteria | 88237 |
| 444 | Ga0207667_10008255 | 3300025949 | Bacteria | 12394 |
| 445 | Ga0207667_10010193 | 3300025949 | Bacteria | 11007 |
| 446 | Ga0207667_10012338 | 3300025949 | Bacteria | 9856 |
| 447 | Ga0207667_10033996 | 3300025949 | Bacteria | 5476 |
| 448 | Ga0207667_10064449 | 3300025949 | Bacteria | 3826 |
| 449 | Ga0207667_10080129 | 3300025949 | Bacteria | 3383 |
| 450 | Ga0207667_10097354 | 3300025949 | Bacteria | 3037 |
| 451 | Ga0207712_10000215 | 3300025961 | Bacteria | 57704 |
| 452 | Ga0207640_10000003 | 3300025981 | Bacteria | 505282 |
| 453 | Ga0207640_10000025 | 3300025981 | Bacteria | 143903 |
| 454 | Ga0207640_10001460 | 3300025981 | Bacteria | 12780 |
| 455 | Ga0207640_10006300 | 3300025981 | Bacteria | 6506 |
| 456 | Ga0207640_10011194 | 3300025981 | Bacteria | 5073 |
| 457 | Ga0207640_10021651 | 3300025981 | Bacteria | 3835 |
| 458 | Ga0207658_10000027 | 3300025986 | Bacteria | 174626 |
| 459 | Ga0207658_10009737 | 3300025986 | Bacteria | 6525 |
| 460 | Ga0207658_10014695 | 3300025986 | Bacteria | 5365 |
| 461 | Ga0207658_10027601 | 3300025986 | Bacteria | 3990 |
| 462 | Ga0207703_10000590 | 3300026035 | Bacteria | 36957 |
| 463 | Ga0207703_10000753 | 3300026035 | Bacteria | 31952 |
| 464 | Ga0207703_10006133 | 3300026035 | Bacteria | 9621 |
| 465 | Ga0207639_10000117 | 3300026041 | Bacteria | 61185 |
| 466 | Ga0207639_10026564 | 3300026041 | Bacteria | 4207 |
| 467 | Ga0207678_10004533 | 3300026067 | Bacteria | 12490 |
| 468 | Ga0207678_10020176 | 3300026067 | Bacteria | 5852 |
| 469 | Ga0207678_10022401 | 3300026067 | Bacteria | 5532 |
| 470 | Ga0207678_10033569 | 3300026067 | Bacteria | 4470 |
| 471 | Ga0207678_10040625 | 3300026067 | Bacteria | 4034 |
| 472 | Ga0207678_10061222 | 3300026067 | Bacteria | 3237 |
| 473 | Ga0207678_10096985 | 3300026067 | Bacteria | 2520 |
| 474 | Ga0207702_10000037 | 3300026078 | Bacteria | 153366 |
| 475 | Ga0207702_10000374 | 3300026078 | Bacteria | 51061 |
| 476 | Ga0207702_10036900 | 3300026078 | Bacteria | 4088 |
| 477 | Ga0207641_10000491 | 3300026088 | Bacteria | 44561 |
| 478 | Ga0207641_10001423 | 3300026088 | Bacteria | 23551 |
| 479 | Ga0207641_10006026 | 3300026088 | Bacteria | 10273 |
| 480 | Ga0207676_10001405 | 3300026095 | Bacteria | 17908 |
| 481 | Ga0207676_10068299 | 3300026095 | Bacteria | 2842 |
| 482 | Ga0207674_10001703 | 3300026116 | Bacteria | 28127 |
| 483 | Ga0207674_10002408 | 3300026116 | Bacteria | 23603 |
| 484 | Ga0207674_10042961 | 3300026116 | Bacteria | 4663 |
| 485 | Ga0207674_10074079 | 3300026116 | Bacteria | 3417 |
| 486 | Ga0207674_10105795 | 3300026116 | Bacteria | 2791 |
| 487 | Ga0207698_10001294 | 3300026142 | Bacteria | 14583 |
| 488 | Ga0207698_10005275 | 3300026142 | Bacteria | 7953 |
| 489 | Ga0209371_1000044 | 3300027312 | Bacteria | 327086 |
| 490 | Ga0207428_10005919 | 3300027907 | Bacteria | 11322 |
| 491 | Ga0268266_10000007 | 3300028379 | Bacteria | 1372921 |
| 492 | Ga0268266_10000051 | 3300028379 | Bacteria | 296231 |
| 493 | Ga0268266_10000067 | 3300028379 | Bacteria | 241577 |
| 494 | Ga0268266_10002151 | 3300028379 | Bacteria | 21661 |
| 495 | Ga0268265_10061495 | 3300028380 | Bacteria | 2882 |
| 496 | Ga0268264_10000102 | 3300028381 | Bacteria | 222526 |
| 497 | Ga0268264_10003055 | 3300028381 | Bacteria | 14503 |
| 498 | Ga0265319_1005768 | 3300028563 | Bacteria | 5858 |
| 499 | Ga0268256_1000046 | 3300030500 | Bacteria | 327003 |
| 500 | Ga0307511_10009921 | 3300030521 | Bacteria | 9477 |
| 501 | Ga0307413_10001009 | 3300031824 | Bacteria | 10163 |
| 502 | Ga0307406_10012231 | 3300031901 | Bacteria | 4891 |
| 503 | Ga0307412_10002015 | 3300031911 | Bacteria | 11275 |
| 504 | Ga0307412_10002443 | 3300031911 | Bacteria | 10338 |
| 505 | Ga0307510_10000707 | 3300033180 | Bacteria | 34254 |
| 506 | Ga0307510_10002809 | 3300033180 | Bacteria | 19958 |
| 507 | Ga0373961_0000030 | 3300035241 | Bacteria | 90416 |
| 508 | Ga0373927_0000200 | 3300035695 | Bacteria | 48402 |
| 509 | Ga0373927_0003547 | 3300035695 | Bacteria | 11154 |
| 510 | Ga0373937_0019790 | 3300036401 | Bacteria | 6029 |
| 511 | Ga0373937_0021549 | 3300036401 | Bacteria | 5783 |
| 512 | Ga0373925_0000032 | 3300037068 | Bacteria | 145357 |
| 513 | Ga0395899_0000047 | 3300037312 | Bacteria | 233482 |
| 514 | Ga0395899_0002204 | 3300037312 | Bacteria | 15967 |
| 515 | Ga0395899_0004280 | 3300037312 | Bacteria | 11160 |
| 516 | Ga0395899_0017397 | 3300037312 | Bacteria | 5476 |
| 517 | Ga0395899_0035158 | 3300037312 | Bacteria | 3761 |
| 518 | Ga0395899_0036795 | 3300037312 | Bacteria | 3670 |
| 519 | Ga0395899_0092174 | 3300037312 | Bacteria | 2194 |
| 520 | Ga0395900_0000011 | 3300037418 | Bacteria | 421926 |
| 521 | Ga0395900_0000648 | 3300037418 | Bacteria | 46594 |
| 522 | Ga0395900_0001660 | 3300037418 | Bacteria | 26042 |
| 523 | Ga0395900_0047107 | 3300037418 | Bacteria | 4438 |
| 524 | Ga0395898_0000013 | 3300037466 | Bacteria | 458788 |
| 525 | Ga0395898_0000058 | 3300037466 | Bacteria | 277701 |
| 526 | Ga0395898_0008566 | 3300037466 | Bacteria | 10797 |
| 527 | Ga0395898_0021551 | 3300037466 | Bacteria | 6533 |
| 528 | Ga0395898_0063376 | 3300037466 | Bacteria | 3587 |
| 529 | Ga0395898_0110031 | 3300037466 | Bacteria | 2641 |
| 530 | Ga0395905_0053804 | 3300037471 | Bacteria | 3767 |
| 531 | Ga0436364_0644604 | 3300037853 | Bacteria | 15914 |
| 532 | Ga0395901_0000435 | 3300038443 | Bacteria | 48931 |
| 533 | Ga0395901_0007887 | 3300038443 | Bacteria | 10741 |
| 534 | Ga0395901_0015375 | 3300038443 | Bacteria | 7790 |
| 535 | Ga0395901_0019340 | 3300038443 | Bacteria | 6961 |
| 536 | Ga0395901_0047331 | 3300038443 | Bacteria | 4465 |
| 537 | Ga0395901_0074576 | 3300038443 | Bacteria | 3540 |
| 538 | Ga0395901_0076054 | 3300038443 | Bacteria | 3503 |
| 539 | Ga0395901_0221620 | 3300038443 | Bacteria | 1977 |
| 540 | Ga0237819_00006 | 3300038705 | Bacteria | 78253 |
| 541 | Ga0237816_00140 | 3300039145 | Bacteria | 5646 |
| 542 | Ga0436365_0854233 | 3300039437 | Bacteria | 41356 |
| 543 | Ga0436361_0110651 | 3300039447 | Bacteria | 3925 |
| 544 | Ga0436361_0169760 | 3300039447 | Bacteria | 8191 |
| 545 | Ga0436361_0201010 | 3300039447 | Bacteria | 3615 |
| 546 | Ga0436361_0252460 | 3300039447 | Bacteria | 41857 |
| 547 | Ga0436361_0519031 | 3300039447 | Bacteria | 16348 |
| 548 | Ga0436361_0713206 | 3300039447 | Bacteria | 50586 |
| 549 | Ga0436361_0714695 | 3300039447 | Bacteria | 5139 |
| 550 | Ga0436361_0965373 | 3300039447 | Bacteria | 5678 |
| 551 | Ga0439436_0000003 | 3300041404 | Bacteria | 186684 |
| 552 | Ga0439465_0000406 | 3300041413 | Bacteria | 12511 |
| 553 | Ga0451806_541229 | 3300041462 | Bacteria | 7600 |
| 554 | Ga0451804_0812598 | 3300041463 | Bacteria | 3111 |
| 555 | Ga0451807_2369243 | 3300041486 | Bacteria | 4021 |
| 556 | Ga0450908_000296 | 3300042184 | Bacteria | 9873 |
| 557 | Ga0466969_0004902 | 3300044656 | Bacteria | 7129 |
| 558 | Ga0466969_0014377 | 3300044656 | Bacteria | 4160 |
| 559 | Ga0466982_0000022 | 3300044672 | Bacteria | 95114 |
| 560 | Ga0466982_0000041 | 3300044672 | Bacteria | 40889 |
| 561 | Ga0466965_0001607 | 3300044683 | Bacteria | 9223 |
| 562 | Ga0466966_0003909 | 3300044684 | Bacteria | 9836 |
| 563 | Ga0466966_0010372 | 3300044684 | Bacteria | 6185 |
| 564 | Ga0466966_0021019 | 3300044684 | Bacteria | 4288 |
| 565 | Ga0466961_0002235 | 3300044693 | Bacteria | 12057 |
| 566 | Ga0466961_0008197 | 3300044693 | Bacteria | 6656 |
| 567 | Ga0466971_0012675 | 3300044719 | Bacteria | 3697 |
| 568 | Ga0466968_0002639 | 3300044735 | Bacteria | 6598 |
| 569 | Ga0466970_0011483 | 3300044765 | Bacteria | 4515 |
| 570 | Ga0466957_0004765 | 3300044842 | Bacteria | 7592 |
| 571 | Ga0466957_0014329 | 3300044842 | Bacteria | 4615 |
| 572 | Ga0466960_0004781 | 3300044901 | Bacteria | 5320 |
| 573 | Ga0466959_0002514 | 3300045049 | Bacteria | 11755 |
| 574 | Ga0466959_0041762 | 3300045049 | Bacteria | 3385 |
| 575 | Ga0466958_0001258 | 3300045836 | Bacteria | 11879 |
| 576 | Ga0466958_0013819 | 3300045836 | Bacteria | 4603 |
| 577 | Ga0466958_0026423 | 3300045836 | Bacteria | 3431 |
| 578 | Ga0495617_000031 | 3300046452 | Bacteria | 151115 |
| 579 | Ga0495592_0007607 | 3300046454 | Bacteria | 8115 |
| 580 | Ga0495638_0000081 | 3300046460 | Bacteria | 155203 |
| 581 | Ga0495638_0000089 | 3300046460 | Bacteria | 151067 |
| 582 | Ga0495638_0000211 | 3300046460 | Bacteria | 82400 |
| 583 | Ga0495638_0000242 | 3300046460 | Bacteria | 74758 |
| 584 | Ga0495638_0002424 | 3300046460 | Bacteria | 15245 |
| 585 | Ga0495638_0023833 | 3300046460 | Bacteria | 3998 |
| 586 | Ga0495650_0000027 | 3300046471 | Bacteria | 475071 |
| 587 | Ga0495650_0000465 | 3300046471 | Bacteria | 62638 |
| 588 | Ga0495650_0001170 | 3300046471 | Bacteria | 28030 |
| 589 | Ga0495650_0001248 | 3300046471 | Bacteria | 26317 |
| 590 | Ga0495584_0003103 | 3300046491 | Bacteria | 9234 |
| 591 | Ga0495585_0000035 | 3300046492 | Bacteria | 136801 |
| 592 | Ga0495596_0000154 | 3300046500 | Bacteria | 47820 |
| 593 | Ga0495607_0000008 | 3300046501 | Bacteria | 265274 |
| 594 | Ga0495607_0000020 | 3300046501 | Bacteria | 164851 |
| 595 | Ga0495607_0000553 | 3300046501 | Bacteria | 36595 |
| 596 | Ga0495583_0007433 | 3300046506 | Bacteria | 6882 |
| 597 | Ga0495606_0000174 | 3300046507 | Bacteria | 113955 |
| 598 | Ga0495606_0001389 | 3300046507 | Bacteria | 32713 |
| 599 | Ga0495606_0001420 | 3300046507 | Bacteria | 32141 |
| 600 | Ga0495608_0062059 | 3300046511 | Bacteria | 2456 |
| 601 | Ga0495610_0001741 | 3300046512 | Bacteria | 19066 |
| 602 | Ga0495610_0002267 | 3300046512 | Bacteria | 16255 |
| 603 | Ga0495610_0037869 | 3300046512 | Bacteria | 2451 |
| 604 | Ga0495616_0000028 | 3300046513 | Bacteria | 133873 |
| 605 | Ga0495618_0026351 | 3300046514 | Bacteria | 3614 |
| 606 | Ga0495620_0000088 | 3300046515 | Bacteria | 74950 |
| 607 | Ga0495620_0002919 | 3300046515 | Bacteria | 9819 |
| 608 | Ga0495631_0000212 | 3300046518 | Bacteria | 39918 |
| 609 | Ga0495631_0000425 | 3300046518 | Bacteria | 29180 |
| 610 | Ga0495631_0001762 | 3300046518 | Bacteria | 12834 |
| 611 | Ga0495632_0000005 | 3300046519 | Bacteria | 362872 |
| 612 | Ga0495643_0001267 | 3300046522 | Bacteria | 24200 |
| 613 | Ga0495643_0023874 | 3300046522 | Bacteria | 3472 |
| 614 | Ga0495648_0000360 | 3300046524 | Bacteria | 50159 |
| 615 | Ga0495663_0002348 | 3300046525 | Bacteria | 5719 |
| 616 | Ga0495609_0007391 | 3300046538 | Bacteria | 5491 |
| 617 | Ga0495621_0002958 | 3300046539 | Bacteria | 4629 |
| 618 | Ga0495597_0032817 | 3300046542 | Bacteria | 2355 |
| 619 | Ga0495622_0034512 | 3300046557 | Bacteria | 2359 |
| 620 | Ga0495633_0004675 | 3300046558 | Bacteria | 8614 |
| 621 | Ga0495633_0008488 | 3300046558 | Bacteria | 5778 |
| 622 | Ga0495633_0035610 | 3300046558 | Bacteria | 2389 |
| 623 | Ga0495667_0000845 | 3300046559 | Bacteria | 19806 |
| 624 | Ga0495656_0000648 | 3300046615 | Bacteria | 11157 |
| 625 | Ga0495611_0000005 | 3300046648 | Bacteria | 284271 |
| 626 | Ga0495611_0000049 | 3300046648 | Bacteria | 85148 |
| 627 | Ga0495625_0000285 | 3300046660 | Bacteria | 78065 |
| 628 | Ga0495625_0003741 | 3300046660 | Bacteria | 14802 |
| 629 | Ga0495625_0023682 | 3300046660 | Bacteria | 4686 |
| 630 | Ga0495661_0000566 | 3300046665 | Bacteria | 38323 |
| 631 | Ga0495657_0000586 | 3300046675 | Bacteria | 33357 |
| 632 | Ga0495599_0058830 | 3300046678 | Bacteria | 2404 |
| 633 | Ga0495613_0028717 | 3300046689 | Bacteria | 4138 |
| 634 | Ga0495670_0000268 | 3300046691 | Bacteria | 24390 |
| 635 | Ga0495670_0001095 | 3300046691 | Bacteria | 13137 |
| 636 | Ga0495671_0001264 | 3300046692 | Bacteria | 17243 |
| 637 | Ga0495649_0000929 | 3300046694 | Bacteria | 23212 |
| 638 | Ga0495589_0000056 | 3300046794 | Bacteria | 109990 |
| 639 | Ga0495660_0000108 | 3300046810 | Bacteria | 88833 |
| 640 | Ga0495660_0000217 | 3300046810 | Bacteria | 57840 |
| 641 | Ga0495636_0023614 | 3300047318 | Bacteria | 2490 |
| 642 | Ga0495674_0077234 | 3300047319 | Bacteria | 2863 |
| 643 | Ga0495672_0001346 | 3300047320 | Bacteria | 24356 |
| 644 | Ga0495683_0003298 | 3300047323 | Bacteria | 9432 |
| 645 | Ga0495679_000010 | 3300047446 | Bacteria | 337760 |
| 646 | Ga0495673_0000038 | 3300047469 | Bacteria | 303785 |
| 647 | Ga0495673_0000045 | 3300047469 | Bacteria | 280765 |
| 648 | Ga0495673_0001199 | 3300047469 | Bacteria | 21627 |
| 649 | Ga0495686_0000007 | 3300047472 | Bacteria | 732622 |
| 650 | Ga0495686_0000227 | 3300047472 | Bacteria | 103680 |
| 651 | Ga0495686_0000311 | 3300047472 | Bacteria | 82066 |
| 652 | Ga0495686_0005468 | 3300047472 | Bacteria | 10011 |
| 653 | Ga0495686_0010095 | 3300047472 | Bacteria | 6742 |
| 654 | Ga0495686_0010337 | 3300047472 | Bacteria | 6643 |
| 655 | Ga0495686_0012040 | 3300047472 | Bacteria | 6078 |
| 656 | Ga0495686_0013009 | 3300047472 | Bacteria | 5796 |
| 657 | Ga0495686_0053931 | 3300047472 | Bacteria | 2518 |
| 658 | Ga0496101_0056308 | 3300048904 | Bacteria | 2842 |
| 659 | Ga0496104_0053871 | 3300048907 | Bacteria | 3802 |
| 660 | Ga0496105_0008153 | 3300048908 | Bacteria | 8143 |
| 661 | Ga0496106_0002598 | 3300048909 | Bacteria | 13443 |
| 662 | Ga0496107_0092688 | 3300048910 | Bacteria | 2209 |
| 663 | Ga0496110_0041447 | 3300048913 | Bacteria | 4018 |
| 664 | Ga0496112_0004629 | 3300048915 | Bacteria | 11704 |
| 665 | Ga0496113_0022710 | 3300048916 | Bacteria | 4442 |
| 666 | Ga0496114_0123111 | 3300048917 | Bacteria | 2232 |
| 667 | Ga0496115_0000738 | 3300048918 | Bacteria | 24162 |
| 668 | Ga0496115_0001079 | 3300048918 | Bacteria | 19755 |
| 669 | Ga0496115_0024016 | 3300048918 | Bacteria | 4736 |
| 670 | Ga0496116_0000045 | 3300048919 | Bacteria | 324307 |
| 671 | Ga0496116_0002334 | 3300048919 | Bacteria | 20087 |
| 672 | Ga0496117_0001068 | 3300048920 | Bacteria | 41562 |
| 673 | Ga0496117_0001420 | 3300048920 | Bacteria | 34726 |
| 674 | Ga0496117_0001484 | 3300048920 | Bacteria | 33643 |
| 675 | Ga0496117_0003379 | 3300048920 | Bacteria | 18595 |
| 676 | Ga0496117_0003579 | 3300048920 | Bacteria | 17931 |
| 677 | Ga0496118_0000719 | 3300048921 | Bacteria | 53455 |
| 678 | Ga0496118_0001160 | 3300048921 | Bacteria | 40619 |
| 679 | Ga0496118_0001249 | 3300048921 | Bacteria | 39060 |
| 680 | Ga0496118_0001496 | 3300048921 | Bacteria | 34894 |
| 681 | Ga0496118_0002452 | 3300048921 | Bacteria | 24974 |
| 682 | Ga0496118_0002549 | 3300048921 | Bacteria | 24408 |
| 683 | Ga0496118_0003641 | 3300048921 | Bacteria | 19134 |
| 684 | Ga0496118_0003682 | 3300048921 | Bacteria | 19006 |
| 685 | Ga0496118_0006497 | 3300048921 | Bacteria | 12817 |
| 686 | Ga0496118_0006654 | 3300048921 | Bacteria | 12613 |
| 687 | Ga0496118_0018257 | 3300048921 | Bacteria | 6336 |
| 688 | Ga0496119_0000094 | 3300048922 | Bacteria | 130089 |
| 689 | Ga0496119_0000929 | 3300048922 | Bacteria | 37913 |
| 690 | Ga0496119_0001859 | 3300048922 | Bacteria | 24380 |
| 691 | Ga0496119_0002453 | 3300048922 | Bacteria | 20369 |
| 692 | Ga0496120_0000013 | 3300048923 | Bacteria | 331109 |
| 693 | Ga0496120_0000183 | 3300048923 | Bacteria | 106937 |
| 694 | Ga0496120_0000839 | 3300048923 | Bacteria | 43743 |
| 695 | Ga0496120_0000943 | 3300048923 | Bacteria | 39981 |
| 696 | Ga0496120_0002147 | 3300048923 | Bacteria | 21033 |
| 697 | Ga0496121_0000162 | 3300048924 | Bacteria | 145682 |
| 698 | Ga0496121_0000403 | 3300048924 | Bacteria | 86293 |
| 699 | Ga0496121_0000464 | 3300048924 | Bacteria | 79337 |
| 700 | Ga0496121_0001456 | 3300048924 | Bacteria | 39986 |
| 701 | Ga0496121_0001922 | 3300048924 | Bacteria | 33169 |
| 702 | Ga0496121_0003492 | 3300048924 | Bacteria | 22370 |
| 703 | Ga0496121_0006431 | 3300048924 | Bacteria | 14587 |
| 704 | Ga0496121_0007118 | 3300048924 | Bacteria | 13577 |
| 705 | Ga0496121_0031306 | 3300048924 | Bacteria | 4862 |
| 706 | Ga0496122_0001331 | 3300048925 | Bacteria | 40422 |
| 707 | Ga0496122_0001959 | 3300048925 | Bacteria | 30816 |
| 708 | Ga0496122_0002854 | 3300048925 | Bacteria | 23661 |
| 709 | Ga0496122_0003345 | 3300048925 | Bacteria | 21155 |
| 710 | Ga0496122_0009868 | 3300048925 | Bacteria | 9953 |
| 711 | Ga0496122_0020910 | 3300048925 | Bacteria | 5883 |
| 712 | Ga0496122_0041374 | 3300048925 | Bacteria | 3644 |
| 713 | Ga0496123_0000107 | 3300048926 | Bacteria | 166923 |
| 714 | Ga0496123_0001677 | 3300048926 | Bacteria | 29647 |
| 715 | Ga0496123_0002372 | 3300048926 | Bacteria | 23618 |
| 716 | Ga0496123_0002721 | 3300048926 | Bacteria | 21201 |
| 717 | Ga0496123_0003093 | 3300048926 | Bacteria | 19114 |
| 718 | Ga0496123_0007280 | 3300048926 | Bacteria | 10504 |
| 719 | Ga0496123_0018592 | 3300048926 | Bacteria | 5518 |
| 720 | Ga0496123_0044558 | 3300048926 | Bacteria | 3032 |
| 721 | Ga0496124_0000032 | 3300048927 | Bacteria | 332524 |
| 722 | Ga0496124_0000844 | 3300048927 | Bacteria | 50021 |
| 723 | Ga0496124_0001447 | 3300048927 | Bacteria | 35077 |
| 724 | Ga0496124_0001753 | 3300048927 | Bacteria | 30327 |
| 725 | Ga0496124_0001946 | 3300048927 | Bacteria | 28229 |
| 726 | Ga0496124_0002067 | 3300048927 | Bacteria | 27205 |
| 727 | Ga0496124_0003171 | 3300048927 | Bacteria | 20326 |
| 728 | Ga0496124_0003791 | 3300048927 | Bacteria | 18160 |
| 729 | Ga0496124_0003995 | 3300048927 | Bacteria | 17569 |
| 730 | Ga0496124_0004289 | 3300048927 | Bacteria | 16749 |
| 731 | Ga0496124_0004843 | 3300048927 | Bacteria | 15479 |
| 732 | Ga0496125_0000435 | 3300048928 | Bacteria | 76312 |
| 733 | Ga0496125_0003037 | 3300048928 | Bacteria | 20991 |
| 734 | Ga0496125_0003210 | 3300048928 | Bacteria | 20186 |
| 735 | Ga0496125_0004340 | 3300048928 | Bacteria | 16456 |
| 736 | Ga0496125_0005558 | 3300048928 | Bacteria | 13942 |
| 737 | Ga0496125_0008045 | 3300048928 | Bacteria | 11130 |
| 738 | Ga0496125_0033060 | 3300048928 | Bacteria | 4584 |
| 739 | Ga0496125_0077875 | 3300048928 | Bacteria | 2552 |
| 740 | Ga0496126_0000301 | 3300048929 | Bacteria | 104981 |
| 741 | Ga0496126_0000568 | 3300048929 | Bacteria | 70707 |
| 742 | Ga0496126_0004357 | 3300048929 | Bacteria | 16974 |
| 743 | Ga0496126_0026807 | 3300048929 | Bacteria | 5518 |
| 744 | Ga0496126_0095419 | 3300048929 | Bacteria | 2609 |
| 745 | Ga0496126_0103110 | 3300048929 | Bacteria | 2493 |
| 746 | Ga0496126_0122343 | 3300048929 | Bacteria | 2255 |
| 747 | Ga0495678_000321 | 3300049459 | Bacteria | 51252 |
| 748 | Ga0501032_0021495 | 3300049569 | Bacteria | 4484 |
| 749 | Ga0501032_0048657 | 3300049569 | Bacteria | 2862 |
| 750 | Ga0501033_0002743 | 3300049570 | Bacteria | 14769 |
| 751 | Ga0501037_0076632 | 3300049573 | Bacteria | 2427 |
| 752 | Ga0501038_0046681 | 3300049574 | Bacteria | 3754 |
| 753 | Ga0501039_0080576 | 3300049575 | Bacteria | 2533 |
| 754 | Ga0501043_0041143 | 3300049579 | Bacteria | 3631 |
| 755 | Ga0501048_0019221 | 3300049582 | Bacteria | 5016 |
| 756 | Ga0501048_0024202 | 3300049582 | Bacteria | 4432 |
| 757 | Ga0501067_0000058 | 3300049583 | Bacteria | 64397 |
| 758 | Ga0501070_0004463 | 3300049586 | Bacteria | 12018 |
| 759 | Ga0501070_0008874 | 3300049586 | Bacteria | 8497 |
| 760 | Ga0501070_0011226 | 3300049586 | Bacteria | 7563 |
| 761 | Ga0501070_0018570 | 3300049586 | Bacteria | 5832 |
| 762 | Ga0501070_0064971 | 3300049586 | Bacteria | 3021 |
| 763 | Ga0501071_0010063 | 3300049587 | Bacteria | 6321 |
| 764 | Ga0501073_0000154 | 3300049589 | Bacteria | 45306 |
| 765 | Ga0501074_0038428 | 3300049590 | Bacteria | 3468 |
| 766 | Ga0501077_0000148 | 3300049593 | Bacteria | 38929 |
| 767 | Ga0501077_0033537 | 3300049593 | Bacteria | 3268 |
| 768 | Ga0501080_0009035 | 3300049742 | Bacteria | 9070 |
| 769 | Ga0501080_0013459 | 3300049742 | Bacteria | 7526 |
| 770 | Ga0501083_0000925 | 3300049744 | Bacteria | 19477 |
| 771 | Ga0501035_0010503 | 3300049822 | Bacteria | 8579 |
| 772 | Ga0501035_0069062 | 3300049822 | Bacteria | 3132 |
| 773 | Ga0501044_0035501 | 3300049823 | Bacteria | 5220 |
| 774 | Ga0501044_0074928 | 3300049823 | Bacteria | 3437 |
| 775 | Ga0501044_0110617 | 3300049823 | Bacteria | 2756 |
| 776 | Ga0501044_0117568 | 3300049823 | Bacteria | 2662 |
| 777 | nmdc:mga05p37_21979_c1 | 3300050507 | Bacteria | 7728 |
| 778 | nmdc:mga08y16_12695_c1 | 3300050511 | Bacteria | 8863 |
| 779 | nmdc:mga08y16_7120_c1 | 3300050511 | Bacteria | 11738 |
| 780 | nmdc:mga08y16_81919_c1 | 3300050511 | Bacteria | 3364 |
| 781 | nmdc:mga08y16_96115_c1 | 3300050511 | Bacteria | 3085 |
| 782 | nmdc:mga08x19_13309_c1 | 3300050514 | Bacteria | 4970 |
| 783 | Ga0500643_000051 | 3300053087 | Bacteria | 145619 |
| 784 | Ga0500643_000897 | 3300053087 | Bacteria | 18863 |
| 785 | Ga0500651_0005237 | 3300053093 | Bacteria | 7388 |
| 786 | Ga0500555_000953 | 3300053103 | Bacteria | 10062 |
| 787 | Ga0500595_001986 | 3300053119 | Bacteria | 10496 |
| 788 | Ga0500595_006184 | 3300053119 | Bacteria | 5120 |
| 789 | Ga0500597_000488 | 3300053120 | Bacteria | 8453 |
| 790 | Ga0500559_0017948 | 3300053136 | Bacteria | 2991 |
| 791 | Ga0500634_0000094 | 3300053161 | Bacteria | 34789 |
| 792 | Ga0500637_0036552 | 3300053178 | Unclassified | 2758 |
| 793 | Ga0500645_002198 | 3300053730 | Bacteria | 8922 |
| 794 | Ga0500645_004384 | 3300053730 | Bacteria | 5426 |
| 795 | Ga0466962_0001688 | 3300061719 | Bacteria | 10360 |
| 796 | Ga0466962_0004875 | 3300061719 | Bacteria | 6454 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002067 | JGI24735J21928_10009465 | JGI24735J21928_100094653 | 552 |
| 2 | 3300025912 | Ga0207707_10019320 | Ga0207707_100193202 | 558 |
| 3 | 3300025926 | Ga0207659_10008284 | Ga0207659_100082843 | 565 |
| 4 | 3300038443 | Ga0395901_0221620 | Ga0395901_0221620_231_1934 | 565 |
| 5 | 3300009098 | Ga0105245_10008344 | Ga0105245_100083443 | 572 |
| 6 | 3300013297 | Ga0157378_10118007 | Ga0157378_101180072 | 572 |
| 7 | 3300025927 | Ga0207687_10011627 | Ga0207687_100116273 | 572 |
| 8 | 3300053136 | Ga0500559_0017948 | Ga0500559_0017948_1044_2963 | 582 |
| 9 | 3300005842 | Ga0068858_100000132 | Ga0068858_10000013275 | 584 |
| 10 | 3300026035 | Ga0207703_10000753 | Ga0207703_100007538 | 584 |
| 11 | 3300048924 | Ga0496121_0001456 | Ga0496121_0001456_26885_28735 | 584 |
| 12 | 3300021388 | Ga0213875_10010605 | Ga0213875_100106053 | 586 |
| 13 | 3300037853 | Ga0436364_0644604 | Ga0436364_0644604_620_2533 | 586 |
| 14 | 3300048915 | Ga0496112_0004629 | Ga0496112_0004629_8671_10479 | 586 |
| 15 | 3300005844 | Ga0068862_100091506 | Ga0068862_1000915062 | 588 |
| 16 | 3300005327 | Ga0070658_10003827 | Ga0070658_100038277 | 589 |
| 17 | 3300039447 | Ga0436361_0714695 | Ga0436361_0714695_958_2760 | 589 |
| 18 | 3300005455 | Ga0070663_100043261 | Ga0070663_1000432612 | 590 |
| 19 | 3300009177 | Ga0105248_10000244 | Ga0105248_1000024457 | 592 |
| 20 | 3300013306 | Ga0163162_10001968 | Ga0163162_1000196810 | 592 |
| 21 | 3300013308 | Ga0157375_10000216 | Ga0157375_100002167 | 592 |
| 22 | 3300014326 | Ga0157380_10104227 | Ga0157380_101042271 | 592 |
| 23 | 3300014968 | Ga0157379_10000091 | Ga0157379_1000009111 | 592 |
| 24 | 3300014969 | Ga0157376_10027808 | Ga0157376_100278083 | 592 |
| 25 | 3300046689 | Ga0495613_0028717 | Ga0495613_0028717_1545_3332 | 592 |
| 26 | 3300048913 | Ga0496110_0041447 | Ga0496110_0041447_1822_3609 | 592 |
| 27 | 3300050511 | nmdc:mga08y16_12695_c1 | nmdc:mga08y16_12695_c1_6027_7814 | 592 |
| 28 | 3300005563 | Ga0068855_100000601 | Ga0068855_10000060144 | 593 |
| 29 | 3300009545 | Ga0105237_10167622 | Ga0105237_101676221 | 593 |
| 30 | 3300025949 | Ga0207667_10000134 | Ga0207667_10000134114 | 593 |
| 31 | 3300005455 | Ga0070663_100010476 | Ga0070663_1000104763 | 595 |
| 32 | 3300025949 | Ga0207667_10033996 | Ga0207667_100339965 | 595 |
| 33 | 3300026067 | Ga0207678_10022401 | Ga0207678_100224015 | 595 |
| 34 | 3300035695 | Ga0373927_0000200 | Ga0373927_0000200_32994_34913 | 598 |
| 35 | 3300037068 | Ga0373925_0000032 | Ga0373925_0000032_43460_45379 | 598 |
| 36 | 3300005347 | Ga0070668_100047749 | Ga0070668_1000477492 | 600 |
| 37 | 3300009093 | Ga0105240_10040933 | Ga0105240_100409337 | 600 |
| 38 | 3300025913 | Ga0207695_10030334 | Ga0207695_100303347 | 600 |
| 39 | 3300005578 | Ga0068854_100000002 | Ga0068854_100000002346 | 601 |
| 40 | 3300020070 | Ga0206356_10268222 | Ga0206356_1026822211 | 601 |
| 41 | 3300025981 | Ga0207640_10000003 | Ga0207640_10000003454 | 601 |
| 42 | 3300035695 | Ga0373927_0003547 | Ga0373927_0003547_6232_8085 | 601 |
| 43 | 3300044842 | Ga0466957_0014329 | Ga0466957_0014329_218_2137 | 601 |
| 44 | 3300045049 | Ga0466959_0041762 | Ga0466959_0041762_135_2162 | 601 |
| 45 | 3300045836 | Ga0466958_0013819 | Ga0466958_0013819_2357_4384 | 601 |
| 46 | 3300061719 | Ga0466962_0001688 | Ga0466962_0001688_583_2610 | 601 |
| 47 | 3300005458 | Ga0070681_10006795 | Ga0070681_100067952 | 602 |
| 48 | 3300006358 | Ga0068871_100089700 | Ga0068871_1000897002 | 602 |
| 49 | 3300044683 | Ga0466965_0001607 | Ga0466965_0001607_252_2231 | 602 |
| 50 | 3300005335 | Ga0070666_10000008 | Ga0070666_10000008172 | 603 |
| 51 | 3300005843 | Ga0068860_100036499 | Ga0068860_1000364995 | 603 |
| 52 | 3300009094 | Ga0111539_10007836 | Ga0111539_100078366 | 603 |
| 53 | 3300009551 | Ga0105238_10000335 | Ga0105238_1000033539 | 603 |
| 54 | 3300013306 | Ga0163162_10013318 | Ga0163162_100133187 | 603 |
| 55 | 3300013308 | Ga0157375_10015954 | Ga0157375_100159546 | 603 |
| 56 | 3300014326 | Ga0157380_10026626 | Ga0157380_100266263 | 603 |
| 57 | 3300025903 | Ga0207680_10000005 | Ga0207680_1000000568 | 603 |
| 58 | 3300025912 | Ga0207707_10032484 | Ga0207707_100324844 | 603 |
| 59 | 3300025924 | Ga0207694_10006773 | Ga0207694_100067734 | 603 |
| 60 | 3300026116 | Ga0207674_10105795 | Ga0207674_101057951 | 603 |
| 61 | 3300028379 | Ga0268266_10000051 | Ga0268266_1000005165 | 603 |
| 62 | 3300050511 | nmdc:mga08y16_81919_c1 | nmdc:mga08y16_81919_c1_72_1907 | 603 |
| 63 | 3300047472 | Ga0495686_0000007 | Ga0495686_0000007_23910_25847 | 604 |
| 64 | 3300047472 | Ga0495686_0012040 | Ga0495686_0012040_3698_5635 | 604 |
| 65 | 3300048919 | Ga0496116_0000045 | Ga0496116_0000045_140385_142328 | 604 |
| 66 | 3300048921 | Ga0496118_0018257 | Ga0496118_0018257_866_2809 | 604 |
| 67 | 3300048925 | Ga0496122_0009868 | Ga0496122_0009868_7358_9301 | 604 |
| 68 | 3300048926 | Ga0496123_0003093 | Ga0496123_0003093_14996_16939 | 604 |
| 69 | 3300048927 | Ga0496124_0003171 | Ga0496124_0003171_7412_9355 | 604 |
| 70 | 3300048928 | Ga0496125_0003210 | Ga0496125_0003210_11548_13491 | 604 |
| 71 | 3300048929 | Ga0496126_0000568 | Ga0496126_0000568_5031_6974 | 604 |
| 72 | 3300006881 | Ga0068865_100008576 | Ga0068865_1000085764 | 605 |
| 73 | 3300010375 | Ga0105239_10032770 | Ga0105239_100327702 | 605 |
| 74 | 3300025912 | Ga0207707_10005096 | Ga0207707_100050965 | 605 |
| 75 | 3300031824 | Ga0307413_10001009 | Ga0307413_100010095 | 605 |
| 76 | 3300037312 | Ga0395899_0036795 | Ga0395899_0036795_1544_3442 | 605 |
| 77 | 3300048921 | Ga0496118_0000719 | Ga0496118_0000719_19581_21452 | 606 |
| 78 | 3300048927 | Ga0496124_0000844 | Ga0496124_0000844_10227_12170 | 606 |
| 79 | 3300048929 | Ga0496126_0000301 | Ga0496126_0000301_71107_72978 | 606 |
| 80 | 3300005439 | Ga0070711_100028503 | Ga0070711_1000285032 | 607 |
| 81 | 3300049823 | Ga0501044_0074928 | Ga0501044_0074928_38_1897 | 607 |
| 82 | 3300053730 | Ga0500645_002198 | Ga0500645_002198_4421_6346 | 607 |
| 83 | 3300003791 | Ga0055530_10001287 | Ga0055530_100012872 | 608 |
| 84 | 3300005353 | Ga0070669_100000003 | Ga0070669_100000003137 | 608 |
| 85 | 3300025923 | Ga0207681_10000007 | Ga0207681_1000000785 | 608 |
| 86 | 3300046501 | Ga0495607_0000008 | Ga0495607_0000008_129145_131028 | 608 |
| 87 | 3300049744 | Ga0501083_0000925 | Ga0501083_0000925_14142_16034 | 608 |
| 88 | 3300005366 | Ga0070659_100000645 | Ga0070659_10000064511 | 609 |
| 89 | 3300005445 | Ga0070708_100011892 | Ga0070708_1000118922 | 609 |
| 90 | 3300005536 | Ga0070697_100012911 | Ga0070697_1000129111 | 609 |
| 91 | 3300005617 | Ga0068859_100182488 | Ga0068859_1001824881 | 609 |
| 92 | 3300006931 | Ga0097620_100182478 | Ga0097620_1001824782 | 609 |
| 93 | 3300013105 | Ga0157369_10107685 | Ga0157369_101076852 | 609 |
| 94 | 3300021384 | Ga0213876_10000303 | Ga0213876_100003037 | 609 |
| 95 | 3300025932 | Ga0207690_10041998 | Ga0207690_100419981 | 609 |
| 96 | 3300031901 | Ga0307406_10012231 | Ga0307406_100122314 | 609 |
| 97 | 3300036401 | Ga0373937_0019790 | Ga0373937_0019790_1654_3564 | 609 |
| 98 | 3300037471 | Ga0395905_0053804 | Ga0395905_0053804_1386_3311 | 609 |
| 99 | 3300039437 | Ga0436365_0854233 | Ga0436365_0854233_19360_21261 | 609 |
| 100 | 3300039447 | Ga0436361_0965373 | Ga0436361_0965373_2816_4735 | 609 |
| 101 | 3300048918 | Ga0496115_0024016 | Ga0496115_0024016_1194_3149 | 609 |
| 102 | 3300005458 | Ga0070681_10001772 | Ga0070681_100017725 | 610 |
| 103 | 3300009093 | Ga0105240_10039957 | Ga0105240_100399573 | 610 |
| 104 | 3300009551 | Ga0105238_10033452 | Ga0105238_100334522 | 610 |
| 105 | 3300021361 | Ga0213872_10009756 | Ga0213872_100097561 | 610 |
| 106 | 3300025913 | Ga0207695_10017563 | Ga0207695_100175637 | 610 |
| 107 | 3300037312 | Ga0395899_0092174 | Ga0395899_0092174_17_1915 | 610 |
| 108 | 3300037418 | Ga0395900_0047107 | Ga0395900_0047107_2524_4422 | 610 |
| 109 | 3300037466 | Ga0395898_0063376 | Ga0395898_0063376_1372_3270 | 610 |
| 110 | 3300038443 | Ga0395901_0019340 | Ga0395901_0019340_17_1915 | 610 |
| 111 | 3300046471 | Ga0495650_0000027 | Ga0495650_0000027_356785_358683 | 610 |
| 112 | 3300005340 | Ga0070689_100016611 | Ga0070689_1000166113 | 611 |
| 113 | 3300005471 | Ga0070698_100018240 | Ga0070698_1000182402 | 611 |
| 114 | 3300005518 | Ga0070699_100120221 | Ga0070699_1001202211 | 611 |
| 115 | 3300006871 | Ga0075434_100044197 | Ga0075434_1000441972 | 611 |
| 116 | 3300006914 | Ga0075436_100017086 | Ga0075436_1000170863 | 611 |
| 117 | 3300009147 | Ga0114129_10002885 | Ga0114129_1000288513 | 611 |
| 118 | 3300025910 | Ga0207684_10009533 | Ga0207684_100095335 | 611 |
| 119 | 3300041462 | Ga0451806_541229 | Ga0451806_541229_5670_7514 | 611 |
| 120 | 3300041463 | Ga0451804_0812598 | Ga0451804_0812598_24_1868 | 611 |
| 121 | 3300041486 | Ga0451807_2369243 | Ga0451807_2369243_2090_3934 | 611 |
| 122 | 3300050507 | nmdc:mga05p37_21979_c1 | nmdc:mga05p37_21979_c1_5025_6941 | 611 |
| 123 | 3300050514 | nmdc:mga08x19_13309_c1 | nmdc:mga08x19_13309_c1_1581_3497 | 611 |
| 124 | 3300005548 | Ga0070665_100000132 | Ga0070665_10000013298 | 612 |
| 125 | 3300021361 | Ga0213872_10000601 | Ga0213872_1000060123 | 612 |
| 126 | 3300028379 | Ga0268266_10002151 | Ga0268266_1000215110 | 612 |
| 127 | 3300039447 | Ga0436361_0713206 | Ga0436361_0713206_17763_19694 | 612 |
| 128 | 3300048925 | Ga0496122_0002854 | Ga0496122_0002854_21102_23021 | 612 |
| 129 | 3300048926 | Ga0496123_0044558 | Ga0496123_0044558_703_2622 | 612 |
| 130 | 3300050511 | nmdc:mga08y16_96115_c1 | nmdc:mga08y16_96115_c1_135_2060 | 612 |
| 131 | 3300005262 | Ga0065165_1006565 | Ga0065165_10065653 | 613 |
| 132 | 3300005330 | Ga0070690_100028447 | Ga0070690_1000284472 | 613 |
| 133 | 3300005337 | Ga0070682_100057224 | Ga0070682_1000572242 | 613 |
| 134 | 3300025225 | Ga0209566_102982 | Ga0209566_1029821 | 613 |
| 135 | 3300025233 | Ga0209437_101348 | Ga0209437_1013483 | 613 |
| 136 | 3300025912 | Ga0207707_10030671 | Ga0207707_100306713 | 613 |
| 137 | 3300035241 | Ga0373961_0000030 | Ga0373961_0000030_16211_18115 | 613 |
| 138 | 3300037312 | Ga0395899_0017397 | Ga0395899_0017397_1267_3228 | 613 |
| 139 | 3300037466 | Ga0395898_0110031 | Ga0395898_0110031_184_2145 | 613 |
| 140 | 3300038443 | Ga0395901_0047331 | Ga0395901_0047331_2288_4249 | 613 |
| 141 | 3300048929 | Ga0496126_0095419 | Ga0496126_0095419_14_1891 | 613 |
| 142 | 3300002737 | JGI25162J39368_1000580 | JGI25162J39368_100058012 | 614 |
| 143 | 3300002737 | JGI25162J39368_1000830 | JGI25162J39368_100083012 | 614 |
| 144 | 3300002772 | JGI25164J39214_1000354 | JGI25164J39214_100035412 | 614 |
| 145 | 3300002772 | JGI25164J39214_1002298 | JGI25164J39214_10022982 | 614 |
| 146 | 3300005336 | Ga0070680_100001023 | Ga0070680_1000010238 | 614 |
| 147 | 3300005354 | Ga0070675_100000102 | Ga0070675_10000010233 | 614 |
| 148 | 3300005355 | Ga0070671_100004985 | Ga0070671_1000049855 | 614 |
| 149 | 3300005364 | Ga0070673_100003087 | Ga0070673_1000030875 | 614 |
| 150 | 3300005367 | Ga0070667_100007898 | Ga0070667_1000078985 | 614 |
| 151 | 3300005435 | Ga0070714_100000285 | Ga0070714_10000028514 | 614 |
| 152 | 3300005435 | Ga0070714_100011841 | Ga0070714_1000118415 | 614 |
| 153 | 3300005435 | Ga0070714_100042692 | Ga0070714_1000426922 | 614 |
| 154 | 3300005436 | Ga0070713_100002100 | Ga0070713_1000021008 | 614 |
| 155 | 3300005458 | Ga0070681_10002905 | Ga0070681_100029058 | 614 |
| 156 | 3300005466 | Ga0070685_10001037 | Ga0070685_100010378 | 614 |
| 157 | 3300005530 | Ga0070679_100001316 | Ga0070679_10000131611 | 614 |
| 158 | 3300005543 | Ga0070672_100015022 | Ga0070672_1000150223 | 614 |
| 159 | 3300005617 | Ga0068859_100001612 | Ga0068859_1000016123 | 614 |
| 160 | 3300005618 | Ga0068864_100055268 | Ga0068864_1000552682 | 614 |
| 161 | 3300005841 | Ga0068863_100002479 | Ga0068863_10000247911 | 614 |
| 162 | 3300005843 | Ga0068860_100003593 | Ga0068860_1000035934 | 614 |
| 163 | 3300006358 | Ga0068871_100068095 | Ga0068871_1000680952 | 614 |
| 164 | 3300006931 | Ga0097620_100001612 | Ga0097620_1000016123 | 614 |
| 165 | 3300009093 | Ga0105240_10002793 | Ga0105240_1000279318 | 614 |
| 166 | 3300009545 | Ga0105237_10151898 | Ga0105237_101518981 | 614 |
| 167 | 3300009551 | Ga0105238_10003689 | Ga0105238_1000368913 | 614 |
| 168 | 3300013104 | Ga0157370_10001344 | Ga0157370_1000134413 | 614 |
| 169 | 3300013105 | Ga0157369_10041194 | Ga0157369_100411943 | 614 |
| 170 | 3300013307 | Ga0157372_10030736 | Ga0157372_100307365 | 614 |
| 171 | 3300021361 | Ga0213872_10002289 | Ga0213872_100022896 | 614 |
| 172 | 3300025231 | Ga0207427_100044 | Ga0207427_10004460 | 614 |
| 173 | 3300025231 | Ga0207427_100088 | Ga0207427_10008859 | 614 |
| 174 | 3300025231 | Ga0207427_100191 | Ga0207427_10019112 | 614 |
| 175 | 3300025233 | Ga0209437_100005 | Ga0209437_100005316 | 614 |
| 176 | 3300025233 | Ga0209437_100167 | Ga0209437_10016761 | 614 |
| 177 | 3300025261 | Ga0209233_1000011 | Ga0209233_1000011625 | 614 |
| 178 | 3300025261 | Ga0209233_1000046 | Ga0209233_100004661 | 614 |
| 179 | 3300025903 | Ga0207680_10048918 | Ga0207680_100489182 | 614 |
| 180 | 3300025904 | Ga0207647_10008443 | Ga0207647_100084436 | 614 |
| 181 | 3300025909 | Ga0207705_10011802 | Ga0207705_100118023 | 614 |
| 182 | 3300025912 | Ga0207707_10000267 | Ga0207707_1000026711 | 614 |
| 183 | 3300025913 | Ga0207695_10012442 | Ga0207695_100124427 | 614 |
| 184 | 3300025919 | Ga0207657_10080404 | Ga0207657_100804041 | 614 |
| 185 | 3300025926 | Ga0207659_10000802 | Ga0207659_100008023 | 614 |
| 186 | 3300025928 | Ga0207700_10019467 | Ga0207700_100194673 | 614 |
| 187 | 3300025929 | Ga0207664_10000092 | Ga0207664_1000009217 | 614 |
| 188 | 3300025929 | Ga0207664_10001368 | Ga0207664_100013685 | 614 |
| 189 | 3300025931 | Ga0207644_10008561 | Ga0207644_100085613 | 614 |
| 190 | 3300025932 | Ga0207690_10012171 | Ga0207690_100121713 | 614 |
| 191 | 3300025932 | Ga0207690_10032344 | Ga0207690_100323441 | 614 |
| 192 | 3300025933 | Ga0207706_10039256 | Ga0207706_100392563 | 614 |
| 193 | 3300025941 | Ga0207711_10004808 | Ga0207711_100048088 | 614 |
| 194 | 3300025949 | Ga0207667_10010193 | Ga0207667_100101937 | 614 |
| 195 | 3300025949 | Ga0207667_10097354 | Ga0207667_100973543 | 614 |
| 196 | 3300025986 | Ga0207658_10014695 | Ga0207658_100146953 | 614 |
| 197 | 3300026088 | Ga0207641_10001423 | Ga0207641_100014234 | 614 |
| 198 | 3300026095 | Ga0207676_10068299 | Ga0207676_100682992 | 614 |
| 199 | 3300028381 | Ga0268264_10003055 | Ga0268264_100030555 | 614 |
| 200 | 3300031911 | Ga0307412_10002015 | Ga0307412_100020155 | 614 |
| 201 | 3300038443 | Ga0395901_0000435 | Ga0395901_0000435_14899_16797 | 614 |
| 202 | 3300039447 | Ga0436361_0519031 | Ga0436361_0519031_2371_4290 | 614 |
| 203 | 3300045836 | Ga0466958_0001258 | Ga0466958_0001258_6393_8315 | 614 |
| 204 | 3300002741 | JGI25157J39369_1000659 | JGI25157J39369_10006593 | 615 |
| 205 | 3300005546 | Ga0070696_100013399 | Ga0070696_1000133992 | 615 |
| 206 | 3300025250 | Ga0209026_1000010 | Ga0209026_1000010279 | 615 |
| 207 | 3300025297 | Ga0209758_1000696 | Ga0209758_100069630 | 615 |
| 208 | 3300025298 | Ga0209050_1000141 | Ga0209050_100014122 | 615 |
| 209 | 3300025304 | Ga0209257_1000636 | Ga0209257_100063639 | 615 |
| 210 | 3300033180 | Ga0307510_10002809 | Ga0307510_1000280915 | 615 |
| 211 | 3300005455 | Ga0070663_100018862 | Ga0070663_1000188625 | 616 |
| 212 | 3300005457 | Ga0070662_100007301 | Ga0070662_1000073014 | 616 |
| 213 | 3300005466 | Ga0070685_10001192 | Ga0070685_1000119213 | 616 |
| 214 | 3300005548 | Ga0070665_100001521 | Ga0070665_1000015219 | 616 |
| 215 | 3300005578 | Ga0068854_100060028 | Ga0068854_1000600281 | 616 |
| 216 | 3300005616 | Ga0068852_100085078 | Ga0068852_1000850783 | 616 |
| 217 | 3300005841 | Ga0068863_100105737 | Ga0068863_1001057372 | 616 |
| 218 | 3300005842 | Ga0068858_100006090 | Ga0068858_1000060908 | 616 |
| 219 | 3300005842 | Ga0068858_100018210 | Ga0068858_1000182104 | 616 |
| 220 | 3300005843 | Ga0068860_100000771 | Ga0068860_1000007716 | 616 |
| 221 | 3300006881 | Ga0068865_100035847 | Ga0068865_1000358473 | 616 |
| 222 | 3300009093 | Ga0105240_10003217 | Ga0105240_100032177 | 616 |
| 223 | 3300009101 | Ga0105247_10012918 | Ga0105247_100129183 | 616 |
| 224 | 3300009545 | Ga0105237_10128855 | Ga0105237_101288552 | 616 |
| 225 | 3300025904 | Ga0207647_10000019 | Ga0207647_1000001949 | 616 |
| 226 | 3300025913 | Ga0207695_10000014 | Ga0207695_10000014244 | 616 |
| 227 | 3300025914 | Ga0207671_10024108 | Ga0207671_100241083 | 616 |
| 228 | 3300025924 | Ga0207694_10001535 | Ga0207694_1000153516 | 616 |
| 229 | 3300025924 | Ga0207694_10016576 | Ga0207694_100165764 | 616 |
| 230 | 3300025933 | Ga0207706_10003006 | Ga0207706_1000300617 | 616 |
| 231 | 3300025981 | Ga0207640_10006300 | Ga0207640_100063003 | 616 |
| 232 | 3300026035 | Ga0207703_10000590 | Ga0207703_100005903 | 616 |
| 233 | 3300026035 | Ga0207703_10006133 | Ga0207703_100061334 | 616 |
| 234 | 3300026041 | Ga0207639_10000117 | Ga0207639_1000011744 | 616 |
| 235 | 3300026067 | Ga0207678_10020176 | Ga0207678_1002017610 | 616 |
| 236 | 3300026078 | Ga0207702_10036900 | Ga0207702_100369002 | 616 |
| 237 | 3300026116 | Ga0207674_10074079 | Ga0207674_100740792 | 616 |
| 238 | 3300028379 | Ga0268266_10000007 | Ga0268266_10000007518 | 616 |
| 239 | 3300028381 | Ga0268264_10000102 | Ga0268264_10000102141 | 616 |
| 240 | 3300028563 | Ga0265319_1005768 | Ga0265319_10057683 | 616 |
| 241 | 3300048921 | Ga0496118_0006654 | Ga0496118_0006654_7431_9314 | 616 |
| 242 | 3300048928 | Ga0496125_0004340 | Ga0496125_0004340_11428_13473 | 616 |
| 243 | 3300053178 | Ga0500637_0036552 | Ga0500637_0036552_21_1943 | 616 |
| 244 | iso_pu_bacteria | 2818991438 | 2819551254 | 616 |
| 245 | 3300005262 | Ga0065165_1000532 | Ga0065165_100053231 | 617 |
| 246 | 3300005336 | Ga0070680_100081681 | Ga0070680_1000816812 | 617 |
| 247 | 3300005577 | Ga0068857_100074675 | Ga0068857_1000746752 | 617 |
| 248 | 3300009093 | Ga0105240_10000049 | Ga0105240_1000004926 | 617 |
| 249 | 3300009093 | Ga0105240_10000368 | Ga0105240_1000036847 | 617 |
| 250 | 3300009093 | Ga0105240_10000624 | Ga0105240_1000062431 | 617 |
| 251 | 3300009093 | Ga0105240_10068042 | Ga0105240_100680421 | 617 |
| 252 | 3300009177 | Ga0105248_10045312 | Ga0105248_100453122 | 617 |
| 253 | 3300010375 | Ga0105239_10000070 | Ga0105239_1000007097 | 617 |
| 254 | 3300010375 | Ga0105239_10000967 | Ga0105239_1000096716 | 617 |
| 255 | 3300025207 | Ga0209760_100243 | Ga0209760_10024313 | 617 |
| 256 | 3300025224 | Ga0209784_100043 | Ga0209784_10004374 | 617 |
| 257 | 3300025231 | Ga0207427_100087 | Ga0207427_10008774 | 617 |
| 258 | 3300025233 | Ga0209437_100173 | Ga0209437_10017374 | 617 |
| 259 | 3300025242 | Ga0209258_100092 | Ga0209258_100092145 | 617 |
| 260 | 3300025250 | Ga0209026_1000112 | Ga0209026_100011274 | 617 |
| 261 | 3300025254 | Ga0209148_1000047 | Ga0209148_1000047342 | 617 |
| 262 | 3300025261 | Ga0209233_1000179 | Ga0209233_100017975 | 617 |
| 263 | 3300025272 | Ga0209455_1000056 | Ga0209455_1000056266 | 617 |
| 264 | 3300025912 | Ga0207707_10008813 | Ga0207707_100088133 | 617 |
| 265 | 3300025913 | Ga0207695_10000100 | Ga0207695_10000100141 | 617 |
| 266 | 3300025913 | Ga0207695_10000704 | Ga0207695_1000070429 | 617 |
| 267 | 3300044656 | Ga0466969_0004902 | Ga0466969_0004902_2915_4873 | 617 |
| 268 | 3300044684 | Ga0466966_0021019 | Ga0466966_0021019_1631_3589 | 617 |
| 269 | 3300044719 | Ga0466971_0012675 | Ga0466971_0012675_214_2172 | 617 |
| 270 | 3300044765 | Ga0466970_0011483 | Ga0466970_0011483_1861_3819 | 617 |
| 271 | 3300045836 | Ga0466958_0026423 | Ga0466958_0026423_904_2862 | 617 |
| 272 | 3300048907 | Ga0496104_0053871 | Ga0496104_0053871_802_2673 | 617 |
| 273 | 3300048908 | Ga0496105_0008153 | Ga0496105_0008153_1391_3262 | 617 |
| 274 | 3300048920 | Ga0496117_0003579 | Ga0496117_0003579_1574_3445 | 617 |
| 275 | 3300048921 | Ga0496118_0002549 | Ga0496118_0002549_11916_13787 | 617 |
| 276 | 3300048922 | Ga0496119_0000094 | Ga0496119_0000094_103783_105654 | 617 |
| 277 | 3300048922 | Ga0496119_0001859 | Ga0496119_0001859_13378_15249 | 617 |
| 278 | 3300048923 | Ga0496120_0000013 | Ga0496120_0000013_225412_227283 | 617 |
| 279 | 3300048923 | Ga0496120_0000183 | Ga0496120_0000183_69276_71147 | 617 |
| 280 | 3300048924 | Ga0496121_0000162 | Ga0496121_0000162_121892_123763 | 617 |
| 281 | 3300049823 | Ga0501044_0110617 | Ga0501044_0110617_777_2669 | 617 |
| 282 | 3300053119 | Ga0500595_006184 | Ga0500595_006184_88_2067 | 617 |
| 283 | 3300003781 | Ga0055536_1003537 | Ga0055536_10035373 | 618 |
| 284 | 3300005337 | Ga0070682_100018605 | Ga0070682_1000186052 | 618 |
| 285 | 3300005366 | Ga0070659_100021687 | Ga0070659_1000216871 | 618 |
| 286 | 3300005563 | Ga0068855_100017609 | Ga0068855_1000176094 | 618 |
| 287 | 3300005578 | Ga0068854_100003804 | Ga0068854_1000038045 | 618 |
| 288 | 3300013100 | Ga0157373_10011039 | Ga0157373_100110393 | 618 |
| 289 | 3300013104 | Ga0157370_10039001 | Ga0157370_100390012 | 618 |
| 290 | 3300025292 | Ga0209676_1000182 | Ga0209676_10001824 | 618 |
| 291 | 3300025304 | Ga0209257_1000484 | Ga0209257_10004845 | 618 |
| 292 | 3300025932 | Ga0207690_10044971 | Ga0207690_100449711 | 618 |
| 293 | 3300025949 | Ga0207667_10080129 | Ga0207667_100801292 | 618 |
| 294 | 3300037312 | Ga0395899_0004280 | Ga0395899_0004280_996_2894 | 618 |
| 295 | 3300037418 | Ga0395900_0001660 | Ga0395900_0001660_6511_8409 | 618 |
| 296 | 3300037466 | Ga0395898_0008566 | Ga0395898_0008566_3242_5218 | 618 |
| 297 | 3300038443 | Ga0395901_0007887 | Ga0395901_0007887_8762_10660 | 618 |
| 298 | 3300038443 | Ga0395901_0015375 | Ga0395901_0015375_173_2149 | 618 |
| 299 | 3300039447 | Ga0436361_0169760 | Ga0436361_0169760_4106_6016 | 618 |
| 300 | 3300005295 | Ga0065707_10084906 | Ga0065707_100849062 | 619 |
| 301 | 3300005327 | Ga0070658_10005565 | Ga0070658_100055653 | 619 |
| 302 | 3300005336 | Ga0070680_100003859 | Ga0070680_1000038597 | 619 |
| 303 | 3300005340 | Ga0070689_100013250 | Ga0070689_1000132506 | 619 |
| 304 | 3300005344 | Ga0070661_100000592 | Ga0070661_1000005922 | 619 |
| 305 | 3300005366 | Ga0070659_100001854 | Ga0070659_1000018546 | 619 |
| 306 | 3300005367 | Ga0070667_100000238 | Ga0070667_10000023810 | 619 |
| 307 | 3300005530 | Ga0070679_100000992 | Ga0070679_1000009924 | 619 |
| 308 | 3300005535 | Ga0070684_100022717 | Ga0070684_1000227174 | 619 |
| 309 | 3300005539 | Ga0068853_100000191 | Ga0068853_1000001912 | 619 |
| 310 | 3300005564 | Ga0070664_100001090 | Ga0070664_1000010904 | 619 |
| 311 | 3300005577 | Ga0068857_100023963 | Ga0068857_1000239633 | 619 |
| 312 | 3300005614 | Ga0068856_100024504 | Ga0068856_1000245045 | 619 |
| 313 | 3300005617 | Ga0068859_100001584 | Ga0068859_10000158417 | 619 |
| 314 | 3300005843 | Ga0068860_100008839 | Ga0068860_10000883910 | 619 |
| 315 | 3300006931 | Ga0097620_100001584 | Ga0097620_10000158417 | 619 |
| 316 | 3300013100 | Ga0157373_10038130 | Ga0157373_100381303 | 619 |
| 317 | 3300013102 | Ga0157371_10003102 | Ga0157371_1000310210 | 619 |
| 318 | 3300013105 | Ga0157369_10031478 | Ga0157369_100314783 | 619 |
| 319 | 3300025917 | Ga0207660_10006597 | Ga0207660_100065974 | 619 |
| 320 | 3300025920 | Ga0207649_10001942 | Ga0207649_100019426 | 619 |
| 321 | 3300025926 | Ga0207659_10004529 | Ga0207659_100045297 | 619 |
| 322 | 3300025932 | Ga0207690_10000768 | Ga0207690_1000076822 | 619 |
| 323 | 3300025933 | Ga0207706_10000898 | Ga0207706_100008987 | 619 |
| 324 | 3300025936 | Ga0207670_10016152 | Ga0207670_100161522 | 619 |
| 325 | 3300025949 | Ga0207667_10064449 | Ga0207667_100644493 | 619 |
| 326 | 3300025981 | Ga0207640_10011194 | Ga0207640_100111942 | 619 |
| 327 | 3300026088 | Ga0207641_10006026 | Ga0207641_100060263 | 619 |
| 328 | 3300030521 | Ga0307511_10009921 | Ga0307511_100099213 | 619 |
| 329 | 3300036401 | Ga0373937_0021549 | Ga0373937_0021549_1495_3435 | 619 |
| 330 | 3300046500 | Ga0495596_0000154 | Ga0495596_0000154_9310_11253 | 619 |
| 331 | 3300046512 | Ga0495610_0001741 | Ga0495610_0001741_1855_3798 | 619 |
| 332 | 3300048926 | Ga0496123_0007280 | Ga0496123_0007280_4402_6396 | 619 |
| 333 | 3300048928 | Ga0496125_0008045 | Ga0496125_0008045_4272_6215 | 619 |
| 334 | 3300048910 | Ga0496107_0092688 | Ga0496107_0092688_265_2193 | 620 |
| 335 | 3300048923 | Ga0496120_0000839 | Ga0496120_0000839_21903_23945 | 620 |
| 336 | iso_pu_bacteria | 2916178963 | 2916182433 | 620 |
| 337 | 3300005548 | Ga0070665_100070395 | Ga0070665_1000703951 | 621 |
| 338 | 3300006237 | Ga0097621_100037884 | Ga0097621_1000378843 | 621 |
| 339 | 3300006846 | Ga0075430_100076585 | Ga0075430_1000765851 | 621 |
| 340 | 3300021361 | Ga0213872_10003100 | Ga0213872_100031005 | 621 |
| 341 | 3300021361 | Ga0213872_10004729 | Ga0213872_100047295 | 621 |
| 342 | 3300021361 | Ga0213872_10008108 | Ga0213872_100081085 | 621 |
| 343 | 3300021361 | Ga0213872_10029877 | Ga0213872_100298772 | 621 |
| 344 | 3300026088 | Ga0207641_10000491 | Ga0207641_1000049117 | 621 |
| 345 | 3300033180 | Ga0307510_10000707 | Ga0307510_100007079 | 621 |
| 346 | 3300039447 | Ga0436361_0110651 | Ga0436361_0110651_1974_3893 | 621 |
| 347 | 3300039447 | Ga0436361_0201010 | Ga0436361_0201010_823_2751 | 621 |
| 348 | 3300039447 | Ga0436361_0252460 | Ga0436361_0252460_4232_6151 | 621 |
| 349 | 3300046471 | Ga0495650_0000465 | Ga0495650_0000465_4320_6203 | 621 |
| 350 | 3300046539 | Ga0495621_0002958 | Ga0495621_0002958_2179_4104 | 621 |
| 351 | 3300046660 | Ga0495625_0023682 | Ga0495625_0023682_314_2197 | 621 |
| 352 | 3300047318 | Ga0495636_0023614 | Ga0495636_0023614_436_2361 | 621 |
| 353 | 3300050511 | nmdc:mga08y16_7120_c1 | nmdc:mga08y16_7120_c1_7788_9710 | 621 |
| 354 | iso_pu_bacteria | 2857442823 | 2857442992 | 621 |
| 355 | iso_pu_bacteria | 2941485952 | 2941486913 | 621 |
| 356 | 3300005327 | Ga0070658_10000632 | Ga0070658_1000063216 | 622 |
| 357 | 3300005335 | Ga0070666_10000020 | Ga0070666_10000020160 | 622 |
| 358 | 3300005344 | Ga0070661_100046241 | Ga0070661_1000462412 | 622 |
| 359 | 3300005367 | Ga0070667_100015414 | Ga0070667_1000154147 | 622 |
| 360 | 3300005466 | Ga0070685_10002768 | Ga0070685_100027688 | 622 |
| 361 | 3300005548 | Ga0070665_100003317 | Ga0070665_10000331712 | 622 |
| 362 | 3300009551 | Ga0105238_10000145 | Ga0105238_1000014553 | 622 |
| 363 | 3300013306 | Ga0163162_10006577 | Ga0163162_100065773 | 622 |
| 364 | 3300025903 | Ga0207680_10000001 | Ga0207680_10000001962 | 622 |
| 365 | 3300025909 | Ga0207705_10000641 | Ga0207705_1000064114 | 622 |
| 366 | 3300025920 | Ga0207649_10017407 | Ga0207649_100174074 | 622 |
| 367 | 3300025924 | Ga0207694_10001078 | Ga0207694_1000107820 | 622 |
| 368 | 3300025986 | Ga0207658_10009737 | Ga0207658_100097373 | 622 |
| 369 | 3300028379 | Ga0268266_10000067 | Ga0268266_1000006768 | 622 |
| 370 | 3300048924 | Ga0496121_0031306 | Ga0496121_0031306_2810_4696 | 622 |
| 371 | 3300048929 | Ga0496126_0103110 | Ga0496126_0103110_383_2269 | 622 |
| 372 | iso_pu_bacteria | 2537561836 | 2538832072 | 622 |
| 373 | iso_pu_bacteria | 2643221562 | 2643828837 | 622 |
| 374 | iso_pu_bacteria | 2643221577 | 2643896652 | 622 |
| 375 | iso_pu_bacteria | 2643221685 | 2644478598 | 622 |
| 376 | iso_pu_bacteria | 2739367700 | 2739732828 | 622 |
| 377 | iso_pu_bacteria | 2747842501 | 2748017181 | 622 |
| 378 | iso_pu_bacteria | 2848694841 | 2848700144 | 622 |
| 379 | iso_pu_bacteria | 2852649853 | 2852651519 | 622 |
| 380 | iso_pu_bacteria | 2884411467 | 2884414214 | 622 |
| 381 | iso_pu_bacteria | 2895395659 | 2895395894 | 622 |
| 382 | iso_pu_bacteria | 2928963466 | 2928966454 | 622 |
| 383 | iso_pu_bacteria | 2939611941 | 2939613411 | 622 |
| 384 | iso_pu_bacteria | 2941475908 | 2941476947 | 622 |
| 385 | 3300003794 | Ga0055531_10013620 | Ga0055531_100136204 | 623 |
| 386 | 3300005439 | Ga0070711_100015889 | Ga0070711_1000158893 | 623 |
| 387 | 3300014497 | Ga0182008_10002859 | Ga0182008_100028595 | 623 |
| 388 | 3300015261 | Ga0182006_1000098 | Ga0182006_100009810 | 623 |
| 389 | 3300025304 | Ga0209257_1000180 | Ga0209257_100018069 | 623 |
| 390 | 3300031911 | Ga0307412_10002443 | Ga0307412_100024435 | 623 |
| 391 | 3300041404 | Ga0439436_0000003 | Ga0439436_0000003_83842_85725 | 623 |
| 392 | 3300042184 | Ga0450908_000296 | Ga0450908_000296_6702_8585 | 623 |
| 393 | 3300046691 | Ga0495670_0001095 | Ga0495670_0001095_1750_3633 | 623 |
| 394 | 3300048925 | Ga0496122_0001331 | Ga0496122_0001331_16337_18259 | 623 |
| 395 | 3300048926 | Ga0496123_0000107 | Ga0496123_0000107_129169_131091 | 623 |
| 396 | 3300053087 | Ga0500643_000897 | Ga0500643_000897_1504_3426 | 623 |
| 397 | 3300053120 | Ga0500597_000488 | Ga0500597_000488_3444_5366 | 623 |
| 398 | iso_pu_bacteria | 2576861471 | 2578459159 | 623 |
| 399 | iso_pu_bacteria | 2593339238 | 2595449254 | 623 |
| 400 | iso_pu_bacteria | 2593339239 | 2595450544 | 623 |
| 401 | iso_pu_bacteria | 2643221574 | 2643884801 | 623 |
| 402 | iso_pu_bacteria | 2643221663 | 2644353735 | 623 |
| 403 | iso_pu_bacteria | 2643221699 | 2644548500 | 623 |
| 404 | iso_pu_bacteria | 2643221699 | 2644550762 | 623 |
| 405 | iso_pu_bacteria | 2687453130 | 2687581440 | 623 |
| 406 | iso_pu_bacteria | 2718218334 | 2721029276 | 623 |
| 407 | iso_pu_bacteria | 2734482264 | 2735835126 | 623 |
| 408 | iso_pu_bacteria | 2738543009 | 2739228986 | 623 |
| 409 | iso_pu_bacteria | 2818991440 | 2819566399 | 623 |
| 410 | iso_pu_bacteria | 2842757796 | 2842759375 | 623 |
| 411 | iso_pu_bacteria | 2842780639 | 2842783590 | 623 |
| 412 | iso_pu_bacteria | 2842914999 | 2842916813 | 623 |
| 413 | iso_pu_bacteria | 2842918807 | 2842922560 | 623 |
| 414 | iso_pu_bacteria | 2884338543 | 2884342475 | 623 |
| 415 | iso_pu_bacteria | 2904463128 | 2904467028 | 623 |
| 416 | iso_pu_bacteria | 2919085039 | 2919088138 | 623 |
| 417 | iso_pu_bacteria | 2919130084 | 2919130405 | 623 |
| 418 | iso_pu_bacteria | 2919404418 | 2919407532 | 623 |
| 419 | iso_pu_bacteria | 2939589442 | 2939592224 | 623 |
| 420 | iso_pu_bacteria | 2939622612 | 2939625070 | 623 |
| 421 | iso_pu_bacteria | 2953994433 | 2953996731 | 623 |
| 422 | iso_pu_bacteria | 2974307012 | 2974309599 | 623 |
| 423 | iso_pu_bacteria | 2977247770 | 2977250346 | 623 |
| 424 | iso_pu_bacteria | 2984514374 | 2984515188 | 623 |
| 425 | 3300005330 | Ga0070690_100001336 | Ga0070690_1000013361 | 624 |
| 426 | 3300005331 | Ga0070670_100008001 | Ga0070670_1000080013 | 624 |
| 427 | 3300005344 | Ga0070661_100020478 | Ga0070661_1000204782 | 624 |
| 428 | 3300005355 | Ga0070671_100010066 | Ga0070671_1000100662 | 624 |
| 429 | 3300005367 | Ga0070667_100000012 | Ga0070667_100000012147 | 624 |
| 430 | 3300005367 | Ga0070667_100005776 | Ga0070667_1000057765 | 624 |
| 431 | 3300005455 | Ga0070663_100000126 | Ga0070663_10000012620 | 624 |
| 432 | 3300005539 | Ga0068853_100001170 | Ga0068853_1000011708 | 624 |
| 433 | 3300005543 | Ga0070672_100005812 | Ga0070672_1000058124 | 624 |
| 434 | 3300005564 | Ga0070664_100001813 | Ga0070664_10000181312 | 624 |
| 435 | 3300009177 | Ga0105248_10000179 | Ga0105248_1000017938 | 624 |
| 436 | 3300009177 | Ga0105248_10002189 | Ga0105248_1000218911 | 624 |
| 437 | 3300009553 | Ga0105249_10000262 | Ga0105249_1000026239 | 624 |
| 438 | 3300013308 | Ga0157375_10013933 | Ga0157375_100139335 | 624 |
| 439 | 3300014325 | Ga0163163_10074753 | Ga0163163_100747531 | 624 |
| 440 | 3300025913 | Ga0207695_10000114 | Ga0207695_10000114128 | 624 |
| 441 | 3300025920 | Ga0207649_10011905 | Ga0207649_100119052 | 624 |
| 442 | 3300025925 | Ga0207650_10001635 | Ga0207650_1000163513 | 624 |
| 443 | 3300025940 | Ga0207691_10011979 | Ga0207691_100119795 | 624 |
| 444 | 3300025941 | Ga0207711_10000406 | Ga0207711_100004062 | 624 |
| 445 | 3300025941 | Ga0207711_10040247 | Ga0207711_100402474 | 624 |
| 446 | 3300025945 | Ga0207679_10001906 | Ga0207679_100019062 | 624 |
| 447 | 3300025961 | Ga0207712_10000215 | Ga0207712_1000021511 | 624 |
| 448 | 3300025986 | Ga0207658_10000027 | Ga0207658_10000027104 | 624 |
| 449 | 3300025986 | Ga0207658_10027601 | Ga0207658_100276014 | 624 |
| 450 | 3300026067 | Ga0207678_10004533 | Ga0207678_100045332 | 624 |
| 451 | 3300026095 | Ga0207676_10001405 | Ga0207676_100014059 | 624 |
| 452 | 3300046514 | Ga0495618_0026351 | Ga0495618_0026351_174_2099 | 624 |
| 453 | 3300047319 | Ga0495674_0077234 | Ga0495674_0077234_553_2478 | 624 |
| 454 | 3300048921 | Ga0496118_0003641 | Ga0496118_0003641_14940_16892 | 624 |
| 455 | 3300048928 | Ga0496125_0005558 | Ga0496125_0005558_10952_12826 | 624 |
| 456 | iso_pu_bacteria | 2929195423 | 2929198587 | 624 |
| 457 | 3300002705 | JGI25156J39149_1005622 | JGI25156J39149_10056223 | 625 |
| 458 | 3300002741 | JGI25157J39369_1000719 | JGI25157J39369_10007197 | 625 |
| 459 | 3300005336 | Ga0070680_100000757 | Ga0070680_1000007572 | 625 |
| 460 | 3300005341 | Ga0070691_10000173 | Ga0070691_100001732 | 625 |
| 461 | 3300005341 | Ga0070691_10008356 | Ga0070691_100083562 | 625 |
| 462 | 3300005354 | Ga0070675_100039998 | Ga0070675_1000399983 | 625 |
| 463 | 3300005458 | Ga0070681_10001214 | Ga0070681_1000121415 | 625 |
| 464 | 3300005530 | Ga0070679_100001076 | Ga0070679_10000107617 | 625 |
| 465 | 3300005546 | Ga0070696_100014957 | Ga0070696_1000149572 | 625 |
| 466 | 3300005563 | Ga0068855_100087040 | Ga0068855_1000870402 | 625 |
| 467 | 3300005841 | Ga0068863_100041259 | Ga0068863_1000412593 | 625 |
| 468 | 3300006237 | Ga0097621_100051245 | Ga0097621_1000512452 | 625 |
| 469 | 3300009093 | Ga0105240_10057086 | Ga0105240_100570862 | 625 |
| 470 | 3300009174 | Ga0105241_10027712 | Ga0105241_100277122 | 625 |
| 471 | 3300009551 | Ga0105238_10020116 | Ga0105238_100201162 | 625 |
| 472 | 3300013307 | Ga0157372_10021320 | Ga0157372_100213202 | 625 |
| 473 | 3300014325 | Ga0163163_10087332 | Ga0163163_100873322 | 625 |
| 474 | 3300025250 | Ga0209026_1000081 | Ga0209026_100008153 | 625 |
| 475 | 3300025256 | Ga0209759_1000468 | Ga0209759_100046834 | 625 |
| 476 | 3300025904 | Ga0207647_10004652 | Ga0207647_100046523 | 625 |
| 477 | 3300025909 | Ga0207705_10001258 | Ga0207705_100012588 | 625 |
| 478 | 3300025911 | Ga0207654_10026208 | Ga0207654_100262082 | 625 |
| 479 | 3300025912 | Ga0207707_10000248 | Ga0207707_1000024823 | 625 |
| 480 | 3300025912 | Ga0207707_10001078 | Ga0207707_100010784 | 625 |
| 481 | 3300025913 | Ga0207695_10007072 | Ga0207695_100070728 | 625 |
| 482 | 3300025917 | Ga0207660_10056984 | Ga0207660_100569842 | 625 |
| 483 | 3300025920 | Ga0207649_10001813 | Ga0207649_100018132 | 625 |
| 484 | 3300025921 | Ga0207652_10000025 | Ga0207652_1000002567 | 625 |
| 485 | 3300025921 | Ga0207652_10001915 | Ga0207652_100019157 | 625 |
| 486 | 3300025921 | Ga0207652_10002103 | Ga0207652_100021032 | 625 |
| 487 | 3300025933 | Ga0207706_10062435 | Ga0207706_100624352 | 625 |
| 488 | 3300025949 | Ga0207667_10012338 | Ga0207667_100123382 | 625 |
| 489 | 3300025981 | Ga0207640_10021651 | Ga0207640_100216512 | 625 |
| 490 | 3300026041 | Ga0207639_10026564 | Ga0207639_100265642 | 625 |
| 491 | 3300026067 | Ga0207678_10061222 | Ga0207678_100612222 | 625 |
| 492 | 3300026116 | Ga0207674_10001703 | Ga0207674_100017037 | 625 |
| 493 | 3300026142 | Ga0207698_10001294 | Ga0207698_1000129411 | 625 |
| 494 | 3300026142 | Ga0207698_10005275 | Ga0207698_100052752 | 625 |
| 495 | 3300027907 | Ga0207428_10005919 | Ga0207428_1000591924 | 625 |
| 496 | 3300046511 | Ga0495608_0062059 | Ga0495608_0062059_177_2105 | 625 |
| 497 | 3300046512 | Ga0495610_0037869 | Ga0495610_0037869_132_2027 | 625 |
| 498 | 3300046559 | Ga0495667_0000845 | Ga0495667_0000845_9320_11248 | 625 |
| 499 | 3300046675 | Ga0495657_0000586 | Ga0495657_0000586_22106_24034 | 625 |
| 500 | 3300049569 | Ga0501032_0021495 | Ga0501032_0021495_1095_3023 | 625 |
| 501 | 3300049583 | Ga0501067_0000058 | Ga0501067_0000058_57282_59210 | 625 |
| 502 | 3300049586 | Ga0501070_0004463 | Ga0501070_0004463_1334_3229 | 625 |
| 503 | 3300049586 | Ga0501070_0008874 | Ga0501070_0008874_2897_4858 | 625 |
| 504 | 3300049586 | Ga0501070_0064971 | Ga0501070_0064971_220_2172 | 625 |
| 505 | 3300049589 | Ga0501073_0000154 | Ga0501073_0000154_18317_20245 | 625 |
| 506 | 3300049590 | Ga0501074_0038428 | Ga0501074_0038428_1300_3252 | 625 |
| 507 | 3300049593 | Ga0501077_0000148 | Ga0501077_0000148_27847_29775 | 625 |
| 508 | 3300049593 | Ga0501077_0033537 | Ga0501077_0033537_31_1992 | 625 |
| 509 | 3300049742 | Ga0501080_0009035 | Ga0501080_0009035_682_2610 | 625 |
| 510 | 3300049822 | Ga0501035_0069062 | Ga0501035_0069062_850_2802 | 625 |
| 511 | 3300049823 | Ga0501044_0035501 | Ga0501044_0035501_140_2092 | 625 |
| 512 | 3300053119 | Ga0500595_001986 | Ga0500595_001986_2973_4994 | 625 |
| 513 | iso_pu_bacteria | 2818991457 | 2819660323 | 625 |
| 514 | iso_pu_bacteria | 2852684882 | 2852689141 | 625 |
| 515 | iso_pu_bacteria | 8021622325 | 8021624866 | 625 |
| 516 | iso_pu_bacteria | 8021626552 | 8021627847 | 625 |
| 517 | iso_pu_bacteria | 8021648035 | 8021650779 | 625 |
| 518 | 3300001979 | JGI24740J21852_10011041 | JGI24740J21852_100110411 | 626 |
| 519 | 3300001989 | JGI24739J22299_10001118 | JGI24739J22299_100011183 | 626 |
| 520 | 3300001990 | JGI24737J22298_10000507 | JGI24737J22298_100005079 | 626 |
| 521 | 3300002737 | JGI25162J39368_1000156 | JGI25162J39368_100015646 | 626 |
| 522 | 3300002737 | JGI25162J39368_1000255 | JGI25162J39368_100025548 | 626 |
| 523 | 3300002738 | JGI25154J39366_1002703 | JGI25154J39366_10027035 | 626 |
| 524 | 3300002741 | JGI25157J39369_1000165 | JGI25157J39369_100016513 | 626 |
| 525 | 3300002771 | JGI25163J39215_1000430 | JGI25163J39215_10004306 | 626 |
| 526 | 3300002772 | JGI25164J39214_1000086 | JGI25164J39214_100008655 | 626 |
| 527 | 3300002773 | JGI25152J39213_1000231 | JGI25152J39213_100023117 | 626 |
| 528 | 3300002774 | JGI25150J39212_1000095 | JGI25150J39212_100009520 | 626 |
| 529 | 3300003187 | JGI25151J46595_10000477 | JGI25151J46595_1000047726 | 626 |
| 530 | 3300003214 | JGI25165J46597_1000144 | JGI25165J46597_100014448 | 626 |
| 531 | 3300003215 | JGI25153J46596_10000291 | JGI25153J46596_1000029126 | 626 |
| 532 | 3300003320 | rootH2_10016193 | rootH2_100161931 | 626 |
| 533 | 3300003578 | Ga0006562J51391_1023108 | Ga0006562J51391_10231088 | 626 |
| 534 | 3300003578 | Ga0006562J51391_1023112 | Ga0006562J51391_10231122 | 626 |
| 535 | 3300003751 | Ga0055538_1000254 | Ga0055538_10002544 | 626 |
| 536 | 3300003756 | Ga0055533_1001435 | Ga0055533_10014354 | 626 |
| 537 | 3300003759 | Ga0055525_1000043 | Ga0055525_1000043211 | 626 |
| 538 | 3300003760 | Ga0055527_1000028 | Ga0055527_100002827 | 626 |
| 539 | 3300003760 | Ga0055527_1000147 | Ga0055527_100014726 | 626 |
| 540 | 3300003761 | Ga0055535_1000061 | Ga0055535_100006155 | 626 |
| 541 | 3300003761 | Ga0055535_1000303 | Ga0055535_100030325 | 626 |
| 542 | 3300003761 | Ga0055535_1000436 | Ga0055535_100043615 | 626 |
| 543 | 3300003762 | Ga0055542_1000053 | Ga0055542_100005327 | 626 |
| 544 | 3300003762 | Ga0055542_1000099 | Ga0055542_100009948 | 626 |
| 545 | 3300003762 | Ga0055542_1000333 | Ga0055542_100033326 | 626 |
| 546 | 3300003763 | Ga0055529_1000117 | Ga0055529_100011748 | 626 |
| 547 | 3300003763 | Ga0055529_1000356 | Ga0055529_100035626 | 626 |
| 548 | 3300003763 | Ga0055529_1000360 | Ga0055529_100036027 | 626 |
| 549 | 3300005455 | Ga0070663_100081340 | Ga0070663_1000813401 | 626 |
| 550 | 3300005458 | Ga0070681_10005388 | Ga0070681_100053885 | 626 |
| 551 | 3300005546 | Ga0070696_100000382 | Ga0070696_1000003829 | 626 |
| 552 | 3300005577 | Ga0068857_100119646 | Ga0068857_1001196461 | 626 |
| 553 | 3300005578 | Ga0068854_100000481 | Ga0068854_1000004813 | 626 |
| 554 | 3300005614 | Ga0068856_100013197 | Ga0068856_1000131974 | 626 |
| 555 | 3300005834 | Ga0068851_10005497 | Ga0068851_100054972 | 626 |
| 556 | 3300009093 | Ga0105240_10089489 | Ga0105240_100894893 | 626 |
| 557 | 3300009545 | Ga0105237_10001219 | Ga0105237_100012196 | 626 |
| 558 | 3300013102 | Ga0157371_10001503 | Ga0157371_1000150320 | 626 |
| 559 | 3300013105 | Ga0157369_10004308 | Ga0157369_100043084 | 626 |
| 560 | 3300015262 | Ga0182007_10000311 | Ga0182007_1000031111 | 626 |
| 561 | 3300015687 | Ga0183368_1007 | Ga0183368_1007243 | 626 |
| 562 | 3300025226 | Ga0209674_100037 | Ga0209674_100037117 | 626 |
| 563 | 3300025226 | Ga0209674_100059 | Ga0209674_10005921 | 626 |
| 564 | 3300025226 | Ga0209674_101158 | Ga0209674_1011587 | 626 |
| 565 | 3300025228 | Ga0209672_100004 | Ga0209672_100004562 | 626 |
| 566 | 3300025228 | Ga0209672_100008 | Ga0209672_100008464 | 626 |
| 567 | 3300025230 | Ga0209563_100036 | Ga0209563_100036336 | 626 |
| 568 | 3300025242 | Ga0209258_100003 | Ga0209258_100003562 | 626 |
| 569 | 3300025242 | Ga0209258_100004 | Ga0209258_100004727 | 626 |
| 570 | 3300025242 | Ga0209258_100008 | Ga0209258_100008352 | 626 |
| 571 | 3300025242 | Ga0209258_100798 | Ga0209258_10079815 | 626 |
| 572 | 3300025245 | Ga0207425_1000028 | Ga0207425_1000028134 | 626 |
| 573 | 3300025246 | Ga0209646_1000576 | Ga0209646_100057612 | 626 |
| 574 | 3300025253 | Ga0209677_100814 | Ga0209677_1008148 | 626 |
| 575 | 3300025254 | Ga0209148_1000016 | Ga0209148_1000016562 | 626 |
| 576 | 3300025254 | Ga0209148_1000222 | Ga0209148_100022246 | 626 |
| 577 | 3300025256 | Ga0209759_1000934 | Ga0209759_100093413 | 626 |
| 578 | 3300025258 | Ga0209129_1000065 | Ga0209129_100006582 | 626 |
| 579 | 3300025272 | Ga0209455_1000004 | Ga0209455_1000004562 | 626 |
| 580 | 3300025272 | Ga0209455_1000007 | Ga0209455_1000007472 | 626 |
| 581 | 3300025272 | Ga0209455_1000103 | Ga0209455_100010351 | 626 |
| 582 | 3300025294 | Ga0209025_1000002 | Ga0209025_1000002138 | 626 |
| 583 | 3300025297 | Ga0209758_1000003 | Ga0209758_1000003145 | 626 |
| 584 | 3300025297 | Ga0209758_1001407 | Ga0209758_100140719 | 626 |
| 585 | 3300025321 | Ga0207656_10001699 | Ga0207656_100016992 | 626 |
| 586 | 3300025904 | Ga0207647_10014983 | Ga0207647_100149832 | 626 |
| 587 | 3300025913 | Ga0207695_10001693 | Ga0207695_1000169319 | 626 |
| 588 | 3300025914 | Ga0207671_10000119 | Ga0207671_100001198 | 626 |
| 589 | 3300025924 | Ga0207694_10037547 | Ga0207694_100375473 | 626 |
| 590 | 3300025933 | Ga0207706_10039207 | Ga0207706_100392074 | 626 |
| 591 | 3300025949 | Ga0207667_10000195 | Ga0207667_1000019538 | 626 |
| 592 | 3300025949 | Ga0207667_10008255 | Ga0207667_100082555 | 626 |
| 593 | 3300025981 | Ga0207640_10000025 | Ga0207640_1000002538 | 626 |
| 594 | 3300026067 | Ga0207678_10096985 | Ga0207678_100969851 | 626 |
| 595 | 3300026078 | Ga0207702_10000037 | Ga0207702_1000003785 | 626 |
| 596 | 3300026078 | Ga0207702_10000374 | Ga0207702_1000037414 | 626 |
| 597 | 3300026116 | Ga0207674_10002408 | Ga0207674_1000240812 | 626 |
| 598 | 3300026116 | Ga0207674_10042961 | Ga0207674_100429613 | 626 |
| 599 | 3300037312 | Ga0395899_0000047 | Ga0395899_0000047_84781_86685 | 626 |
| 600 | 3300037312 | Ga0395899_0035158 | Ga0395899_0035158_250_2148 | 626 |
| 601 | 3300037418 | Ga0395900_0000011 | Ga0395900_0000011_200169_202073 | 626 |
| 602 | 3300037418 | Ga0395900_0000648 | Ga0395900_0000648_25963_27861 | 626 |
| 603 | 3300037466 | Ga0395898_0000058 | Ga0395898_0000058_221695_223599 | 626 |
| 604 | 3300037466 | Ga0395898_0021551 | Ga0395898_0021551_1624_3522 | 626 |
| 605 | 3300038443 | Ga0395901_0074576 | Ga0395901_0074576_250_2148 | 626 |
| 606 | 3300038705 | Ga0237819_00006 | Ga0237819_00006_66204_68096 | 626 |
| 607 | 3300044656 | Ga0466969_0014377 | Ga0466969_0014377_1686_3590 | 626 |
| 608 | 3300044684 | Ga0466966_0003909 | Ga0466966_0003909_7376_9280 | 626 |
| 609 | 3300044693 | Ga0466961_0002235 | Ga0466961_0002235_6087_7991 | 626 |
| 610 | 3300044842 | Ga0466957_0004765 | Ga0466957_0004765_93_1997 | 626 |
| 611 | 3300045049 | Ga0466959_0002514 | Ga0466959_0002514_3820_5724 | 626 |
| 612 | 3300046454 | Ga0495592_0007607 | Ga0495592_0007607_4825_6846 | 626 |
| 613 | 3300046460 | Ga0495638_0000211 | Ga0495638_0000211_79907_81805 | 626 |
| 614 | 3300046460 | Ga0495638_0000242 | Ga0495638_0000242_71976_73874 | 626 |
| 615 | 3300046471 | Ga0495650_0001170 | Ga0495650_0001170_4670_6568 | 626 |
| 616 | 3300046507 | Ga0495606_0001420 | Ga0495606_0001420_9354_11252 | 626 |
| 617 | 3300046542 | Ga0495597_0032817 | Ga0495597_0032817_76_1974 | 626 |
| 618 | 3300046557 | Ga0495622_0034512 | Ga0495622_0034512_375_2273 | 626 |
| 619 | 3300046558 | Ga0495633_0035610 | Ga0495633_0035610_264_2144 | 626 |
| 620 | 3300046678 | Ga0495599_0058830 | Ga0495599_0058830_11_2032 | 626 |
| 621 | 3300046694 | Ga0495649_0000929 | Ga0495649_0000929_363_2261 | 626 |
| 622 | 3300047472 | Ga0495686_0005468 | Ga0495686_0005468_7585_9471 | 626 |
| 623 | 3300048918 | Ga0496115_0000738 | Ga0496115_0000738_21896_23794 | 626 |
| 624 | 3300048919 | Ga0496116_0002334 | Ga0496116_0002334_16393_18273 | 626 |
| 625 | 3300048922 | Ga0496119_0000929 | Ga0496119_0000929_25872_27752 | 626 |
| 626 | 3300048923 | Ga0496120_0000943 | Ga0496120_0000943_12197_14077 | 626 |
| 627 | 3300048925 | Ga0496122_0020910 | Ga0496122_0020910_3311_5191 | 626 |
| 628 | 3300048927 | Ga0496124_0004843 | Ga0496124_0004843_977_2857 | 626 |
| 629 | 3300048928 | Ga0496125_0077875 | Ga0496125_0077875_36_1916 | 626 |
| 630 | 3300048929 | Ga0496126_0004357 | Ga0496126_0004357_2510_4390 | 626 |
| 631 | 3300049569 | Ga0501032_0048657 | Ga0501032_0048657_483_2384 | 626 |
| 632 | 3300049570 | Ga0501033_0002743 | Ga0501033_0002743_4126_6027 | 626 |
| 633 | 3300049573 | Ga0501037_0076632 | Ga0501037_0076632_47_1948 | 626 |
| 634 | 3300049574 | Ga0501038_0046681 | Ga0501038_0046681_302_2203 | 626 |
| 635 | 3300049575 | Ga0501039_0080576 | Ga0501039_0080576_89_1990 | 626 |
| 636 | 3300049579 | Ga0501043_0041143 | Ga0501043_0041143_1313_3211 | 626 |
| 637 | 3300049582 | Ga0501048_0024202 | Ga0501048_0024202_811_2712 | 626 |
| 638 | 3300049586 | Ga0501070_0011226 | Ga0501070_0011226_5015_6985 | 626 |
| 639 | 3300049586 | Ga0501070_0018570 | Ga0501070_0018570_789_2759 | 626 |
| 640 | 3300049587 | Ga0501071_0010063 | Ga0501071_0010063_675_2645 | 626 |
| 641 | 3300049742 | Ga0501080_0013459 | Ga0501080_0013459_221_2191 | 626 |
| 642 | 3300049822 | Ga0501035_0010503 | Ga0501035_0010503_4263_6161 | 626 |
| 643 | 3300049823 | Ga0501044_0117568 | Ga0501044_0117568_540_2438 | 626 |
| 644 | 3300002075 | JGI24738J21930_10000386 | JGI24738J21930_100003864 | 627 |
| 645 | 3300002737 | JGI25162J39368_1000588 | JGI25162J39368_100058810 | 627 |
| 646 | 3300002737 | JGI25162J39368_1002555 | JGI25162J39368_10025555 | 627 |
| 647 | 3300002772 | JGI25164J39214_1000136 | JGI25164J39214_100013656 | 627 |
| 648 | 3300003214 | JGI25165J46597_1000256 | JGI25165J46597_100025611 | 627 |
| 649 | 3300003761 | Ga0055535_1000497 | Ga0055535_100049718 | 627 |
| 650 | 3300003761 | Ga0055535_1000741 | Ga0055535_100074111 | 627 |
| 651 | 3300003762 | Ga0055542_1000107 | Ga0055542_10001071 | 627 |
| 652 | 3300003762 | Ga0055542_1000513 | Ga0055542_100051318 | 627 |
| 653 | 3300003762 | Ga0055542_1000640 | Ga0055542_100064011 | 627 |
| 654 | 3300003763 | Ga0055529_1000067 | Ga0055529_100006743 | 627 |
| 655 | 3300003771 | Ga0055526_1000464 | Ga0055526_100046421 | 627 |
| 656 | 3300003773 | Ga0055537_1000169 | Ga0055537_100016916 | 627 |
| 657 | 3300003784 | Ga0055534_1000404 | Ga0055534_10004048 | 627 |
| 658 | 3300003790 | Ga0055528_1000587 | Ga0055528_100058714 | 627 |
| 659 | 3300003791 | Ga0055530_10005941 | Ga0055530_100059412 | 627 |
| 660 | 3300003791 | Ga0055530_10005949 | Ga0055530_100059492 | 627 |
| 661 | 3300005262 | Ga0065165_1000199 | Ga0065165_100019992 | 627 |
| 662 | 3300005578 | Ga0068854_100066898 | Ga0068854_1000668982 | 627 |
| 663 | 3300005844 | Ga0068862_100052969 | Ga0068862_1000529693 | 627 |
| 664 | 3300009545 | Ga0105237_10000097 | Ga0105237_100000978 | 627 |
| 665 | 3300010375 | Ga0105239_10058346 | Ga0105239_100583462 | 627 |
| 666 | 3300012500 | Ga0157314_1000001 | Ga0157314_10000018 | 627 |
| 667 | 3300013104 | Ga0157370_10000224 | Ga0157370_1000022415 | 627 |
| 668 | 3300013104 | Ga0157370_10000342 | Ga0157370_1000034238 | 627 |
| 669 | 3300013105 | Ga0157369_10003305 | Ga0157369_100033052 | 627 |
| 670 | 3300013105 | Ga0157369_10086800 | Ga0157369_100868003 | 627 |
| 671 | 3300014497 | Ga0182008_10000745 | Ga0182008_1000074514 | 627 |
| 672 | 3300014497 | Ga0182008_10015138 | Ga0182008_100151382 | 627 |
| 673 | 3300014497 | Ga0182008_10022630 | Ga0182008_100226302 | 627 |
| 674 | 3300015261 | Ga0182006_1000058 | Ga0182006_1000058131 | 627 |
| 675 | 3300015265 | Ga0182005_1000015 | Ga0182005_1000015241 | 627 |
| 676 | 3300015685 | Ga0183369_1019 | Ga0183369_101979 | 627 |
| 677 | 3300017792 | Ga0163161_10001852 | Ga0163161_1000185210 | 627 |
| 678 | 3300017792 | Ga0163161_10003406 | Ga0163161_100034065 | 627 |
| 679 | 3300017792 | Ga0163161_10033273 | Ga0163161_100332732 | 627 |
| 680 | 3300025228 | Ga0209672_100274 | Ga0209672_10027433 | 627 |
| 681 | 3300025228 | Ga0209672_100473 | Ga0209672_1004731 | 627 |
| 682 | 3300025231 | Ga0207427_100145 | Ga0207427_10014558 | 627 |
| 683 | 3300025231 | Ga0207427_101926 | Ga0207427_1019261 | 627 |
| 684 | 3300025233 | Ga0209437_100266 | Ga0209437_10026620 | 627 |
| 685 | 3300025233 | Ga0209437_100431 | Ga0209437_10043130 | 627 |
| 686 | 3300025233 | Ga0209437_101228 | Ga0209437_1012281 | 627 |
| 687 | 3300025242 | Ga0209258_100265 | Ga0209258_10026552 | 627 |
| 688 | 3300025242 | Ga0209258_100372 | Ga0209258_10037241 | 627 |
| 689 | 3300025246 | Ga0209646_1001067 | Ga0209646_10010677 | 627 |
| 690 | 3300025250 | Ga0209026_1001377 | Ga0209026_10013774 | 627 |
| 691 | 3300025250 | Ga0209026_1003633 | Ga0209026_10036333 | 627 |
| 692 | 3300025250 | Ga0209026_1004232 | Ga0209026_10042323 | 627 |
| 693 | 3300025254 | Ga0209148_1000042 | Ga0209148_1000042101 | 627 |
| 694 | 3300025254 | Ga0209148_1000055 | Ga0209148_1000055105 | 627 |
| 695 | 3300025254 | Ga0209148_1000065 | Ga0209148_1000065259 | 627 |
| 696 | 3300025256 | Ga0209759_1001497 | Ga0209759_10014979 | 627 |
| 697 | 3300025258 | Ga0209129_1000907 | Ga0209129_10009078 | 627 |
| 698 | 3300025261 | Ga0209233_1000254 | Ga0209233_100025458 | 627 |
| 699 | 3300025263 | Ga0209565_1000031 | Ga0209565_1000031318 | 627 |
| 700 | 3300025272 | Ga0209455_1000016 | Ga0209455_1000016356 | 627 |
| 701 | 3300025272 | Ga0209455_1000295 | Ga0209455_10002953 | 627 |
| 702 | 3300025272 | Ga0209455_1004681 | Ga0209455_10046812 | 627 |
| 703 | 3300025273 | Ga0209673_1000484 | Ga0209673_100048447 | 627 |
| 704 | 3300025291 | Ga0209675_1000015 | Ga0209675_1000015417 | 627 |
| 705 | 3300025295 | Ga0209564_1000480 | Ga0209564_100048050 | 627 |
| 706 | 3300025298 | Ga0209050_1000201 | Ga0209050_1000201104 | 627 |
| 707 | 3300025298 | Ga0209050_1001448 | Ga0209050_10014486 | 627 |
| 708 | 3300025299 | Ga0209256_1010915 | Ga0209256_10109151 | 627 |
| 709 | 3300025303 | Ga0209051_1001660 | Ga0209051_10016604 | 627 |
| 710 | 3300025303 | Ga0209051_1002093 | Ga0209051_10020939 | 627 |
| 711 | 3300025304 | Ga0209257_1000208 | Ga0209257_1000208107 | 627 |
| 712 | 3300025304 | Ga0209257_1002229 | Ga0209257_100222917 | 627 |
| 713 | 3300025304 | Ga0209257_1016563 | Ga0209257_10165632 | 627 |
| 714 | 3300025904 | Ga0207647_10020725 | Ga0207647_100207251 | 627 |
| 715 | 3300025913 | Ga0207695_10002625 | Ga0207695_100026259 | 627 |
| 716 | 3300025914 | Ga0207671_10000409 | Ga0207671_1000040922 | 627 |
| 717 | 3300025981 | Ga0207640_10001460 | Ga0207640_100014602 | 627 |
| 718 | 3300026067 | Ga0207678_10033569 | Ga0207678_100335693 | 627 |
| 719 | 3300026067 | Ga0207678_10040625 | Ga0207678_100406253 | 627 |
| 720 | 3300028380 | Ga0268265_10061495 | Ga0268265_100614952 | 627 |
| 721 | 3300037312 | Ga0395899_0002204 | Ga0395899_0002204_3708_5615 | 627 |
| 722 | 3300037466 | Ga0395898_0000013 | Ga0395898_0000013_204174_206081 | 627 |
| 723 | 3300038443 | Ga0395901_0076054 | Ga0395901_0076054_977_2884 | 627 |
| 724 | 3300044672 | Ga0466982_0000022 | Ga0466982_0000022_5952_7868 | 627 |
| 725 | 3300044672 | Ga0466982_0000041 | Ga0466982_0000041_32640_34538 | 627 |
| 726 | 3300044684 | Ga0466966_0010372 | Ga0466966_0010372_1994_3910 | 627 |
| 727 | 3300044693 | Ga0466961_0008197 | Ga0466961_0008197_489_2396 | 627 |
| 728 | 3300044735 | Ga0466968_0002639 | Ga0466968_0002639_3889_5805 | 627 |
| 729 | 3300044901 | Ga0466960_0004781 | Ga0466960_0004781_906_2822 | 627 |
| 730 | 3300046452 | Ga0495617_000031 | Ga0495617_000031_91295_93190 | 627 |
| 731 | 3300046460 | Ga0495638_0000081 | Ga0495638_0000081_67376_69343 | 627 |
| 732 | 3300046460 | Ga0495638_0000089 | Ga0495638_0000089_115249_117144 | 627 |
| 733 | 3300046460 | Ga0495638_0002424 | Ga0495638_0002424_506_2389 | 627 |
| 734 | 3300046460 | Ga0495638_0023833 | Ga0495638_0023833_110_2047 | 627 |
| 735 | 3300046471 | Ga0495650_0001248 | Ga0495650_0001248_6211_8106 | 627 |
| 736 | 3300046491 | Ga0495584_0003103 | Ga0495584_0003103_3160_5055 | 627 |
| 737 | 3300046492 | Ga0495585_0000035 | Ga0495585_0000035_95087_96982 | 627 |
| 738 | 3300046501 | Ga0495607_0000020 | Ga0495607_0000020_129725_131620 | 627 |
| 739 | 3300046501 | Ga0495607_0000553 | Ga0495607_0000553_18031_19926 | 627 |
| 740 | 3300046506 | Ga0495583_0007433 | Ga0495583_0007433_1095_2990 | 627 |
| 741 | 3300046507 | Ga0495606_0000174 | Ga0495606_0000174_69665_71560 | 627 |
| 742 | 3300046507 | Ga0495606_0001389 | Ga0495606_0001389_13973_15868 | 627 |
| 743 | 3300046512 | Ga0495610_0002267 | Ga0495610_0002267_6147_8030 | 627 |
| 744 | 3300046513 | Ga0495616_0000028 | Ga0495616_0000028_65542_67437 | 627 |
| 745 | 3300046515 | Ga0495620_0000088 | Ga0495620_0000088_48376_50271 | 627 |
| 746 | 3300046515 | Ga0495620_0002919 | Ga0495620_0002919_4775_6670 | 627 |
| 747 | 3300046518 | Ga0495631_0000212 | Ga0495631_0000212_12483_14378 | 627 |
| 748 | 3300046518 | Ga0495631_0000425 | Ga0495631_0000425_15344_17239 | 627 |
| 749 | 3300046518 | Ga0495631_0001762 | Ga0495631_0001762_8492_10375 | 627 |
| 750 | 3300046519 | Ga0495632_0000005 | Ga0495632_0000005_84605_86500 | 627 |
| 751 | 3300046522 | Ga0495643_0023874 | Ga0495643_0023874_994_2889 | 627 |
| 752 | 3300046524 | Ga0495648_0000360 | Ga0495648_0000360_24094_25989 | 627 |
| 753 | 3300046525 | Ga0495663_0002348 | Ga0495663_0002348_3290_5173 | 627 |
| 754 | 3300046538 | Ga0495609_0007391 | Ga0495609_0007391_186_2081 | 627 |
| 755 | 3300046558 | Ga0495633_0004675 | Ga0495633_0004675_2579_4462 | 627 |
| 756 | 3300046558 | Ga0495633_0008488 | Ga0495633_0008488_1728_3617 | 627 |
| 757 | 3300046648 | Ga0495611_0000005 | Ga0495611_0000005_22235_24130 | 627 |
| 758 | 3300046648 | Ga0495611_0000049 | Ga0495611_0000049_40798_42693 | 627 |
| 759 | 3300046660 | Ga0495625_0000285 | Ga0495625_0000285_53512_55407 | 627 |
| 760 | 3300046660 | Ga0495625_0003741 | Ga0495625_0003741_12743_14638 | 627 |
| 761 | 3300046665 | Ga0495661_0000566 | Ga0495661_0000566_23953_25848 | 627 |
| 762 | 3300046691 | Ga0495670_0000268 | Ga0495670_0000268_20432_22327 | 627 |
| 763 | 3300046692 | Ga0495671_0001264 | Ga0495671_0001264_2962_4857 | 627 |
| 764 | 3300046794 | Ga0495589_0000056 | Ga0495589_0000056_5100_6995 | 627 |
| 765 | 3300046810 | Ga0495660_0000108 | Ga0495660_0000108_14707_16602 | 627 |
| 766 | 3300046810 | Ga0495660_0000217 | Ga0495660_0000217_16652_18547 | 627 |
| 767 | 3300047323 | Ga0495683_0003298 | Ga0495683_0003298_1259_3154 | 627 |
| 768 | 3300047446 | Ga0495679_000010 | Ga0495679_000010_232944_234839 | 627 |
| 769 | 3300047469 | Ga0495673_0000038 | Ga0495673_0000038_281543_283438 | 627 |
| 770 | 3300047469 | Ga0495673_0000045 | Ga0495673_0000045_236758_238653 | 627 |
| 771 | 3300047469 | Ga0495673_0001199 | Ga0495673_0001199_15301_17196 | 627 |
| 772 | 3300047472 | Ga0495686_0000227 | Ga0495686_0000227_82629_84524 | 627 |
| 773 | 3300047472 | Ga0495686_0000311 | Ga0495686_0000311_10810_12705 | 627 |
| 774 | 3300047472 | Ga0495686_0010095 | Ga0495686_0010095_2292_4187 | 627 |
| 775 | 3300047472 | Ga0495686_0010337 | Ga0495686_0010337_4500_6395 | 627 |
| 776 | 3300047472 | Ga0495686_0013009 | Ga0495686_0013009_2539_4434 | 627 |
| 777 | 3300048909 | Ga0496106_0002598 | Ga0496106_0002598_9757_11652 | 627 |
| 778 | 3300048916 | Ga0496113_0022710 | Ga0496113_0022710_2487_4370 | 627 |
| 779 | 3300048918 | Ga0496115_0001079 | Ga0496115_0001079_426_2369 | 627 |
| 780 | 3300048920 | Ga0496117_0001068 | Ga0496117_0001068_13825_15708 | 627 |
| 781 | 3300048920 | Ga0496117_0001484 | Ga0496117_0001484_4362_6245 | 627 |
| 782 | 3300048920 | Ga0496117_0003379 | Ga0496117_0003379_7708_9591 | 627 |
| 783 | 3300048921 | Ga0496118_0001160 | Ga0496118_0001160_27417_29300 | 627 |
| 784 | 3300048921 | Ga0496118_0001249 | Ga0496118_0001249_23951_25834 | 627 |
| 785 | 3300048921 | Ga0496118_0001496 | Ga0496118_0001496_16692_18590 | 627 |
| 786 | 3300048921 | Ga0496118_0002452 | Ga0496118_0002452_17518_19413 | 627 |
| 787 | 3300048921 | Ga0496118_0003682 | Ga0496118_0003682_592_2475 | 627 |
| 788 | 3300048921 | Ga0496118_0006497 | Ga0496118_0006497_677_2560 | 627 |
| 789 | 3300048924 | Ga0496121_0000403 | Ga0496121_0000403_21265_23160 | 627 |
| 790 | 3300048924 | Ga0496121_0000464 | Ga0496121_0000464_70024_71922 | 627 |
| 791 | 3300048924 | Ga0496121_0001922 | Ga0496121_0001922_11309_13192 | 627 |
| 792 | 3300048924 | Ga0496121_0003492 | Ga0496121_0003492_19468_21363 | 627 |
| 793 | 3300048924 | Ga0496121_0006431 | Ga0496121_0006431_9395_11320 | 627 |
| 794 | 3300048924 | Ga0496121_0007118 | Ga0496121_0007118_6503_8398 | 627 |
| 795 | 3300048925 | Ga0496122_0001959 | Ga0496122_0001959_19106_20989 | 627 |
| 796 | 3300048925 | Ga0496122_0041374 | Ga0496122_0041374_1729_3612 | 627 |
| 797 | 3300048926 | Ga0496123_0001677 | Ga0496123_0001677_8659_10542 | 627 |
| 798 | 3300048926 | Ga0496123_0002372 | Ga0496123_0002372_18851_20734 | 627 |
| 799 | 3300048926 | Ga0496123_0018592 | Ga0496123_0018592_1067_2965 | 627 |
| 800 | 3300048927 | Ga0496124_0000032 | Ga0496124_0000032_300720_302708 | 627 |
| 801 | 3300048927 | Ga0496124_0001753 | Ga0496124_0001753_2374_4257 | 627 |
| 802 | 3300048927 | Ga0496124_0001946 | Ga0496124_0001946_455_2338 | 627 |
| 803 | 3300048927 | Ga0496124_0002067 | Ga0496124_0002067_18148_20031 | 627 |
| 804 | 3300048927 | Ga0496124_0004289 | Ga0496124_0004289_12427_14310 | 627 |
| 805 | 3300048928 | Ga0496125_0000435 | Ga0496125_0000435_4720_6645 | 627 |
| 806 | 3300048928 | Ga0496125_0003037 | Ga0496125_0003037_13145_15043 | 627 |
| 807 | 3300048928 | Ga0496125_0033060 | Ga0496125_0033060_1999_3882 | 627 |
| 808 | 3300048929 | Ga0496126_0026807 | Ga0496126_0026807_2403_4301 | 627 |
| 809 | 3300048929 | Ga0496126_0122343 | Ga0496126_0122343_171_2102 | 627 |
| 810 | 3300049459 | Ga0495678_000321 | Ga0495678_000321_22496_24391 | 627 |
| 811 | 3300049582 | Ga0501048_0019221 | Ga0501048_0019221_2224_4128 | 627 |
| 812 | 3300053087 | Ga0500643_000051 | Ga0500643_000051_40585_42480 | 627 |
| 813 | 3300053093 | Ga0500651_0005237 | Ga0500651_0005237_1594_3549 | 627 |
| 814 | 3300053103 | Ga0500555_000953 | Ga0500555_000953_1239_3134 | 627 |
| 815 | 3300053161 | Ga0500634_0000094 | Ga0500634_0000094_841_2730 | 627 |
| 816 | 3300053730 | Ga0500645_004384 | Ga0500645_004384_16_1911 | 627 |
| 817 | 3300061719 | Ga0466962_0004875 | Ga0466962_0004875_2571_4487 | 627 |
| 818 | 3300001904 | JGI24736J21556_1001682 | JGI24736J21556_10016822 | 628 |
| 819 | 3300005618 | Ga0068864_100039204 | Ga0068864_1000392043 | 628 |
| 820 | 3300025904 | Ga0207647_10000031 | Ga0207647_1000003156 | 628 |
| 821 | 3300041413 | Ga0439465_0000406 | Ga0439465_0000406_1280_3211 | 628 |
| 822 | 3300046522 | Ga0495643_0001267 | Ga0495643_0001267_12050_13951 | 628 |
| 823 | 3300046615 | Ga0495656_0000648 | Ga0495656_0000648_5771_7696 | 628 |
| 824 | 3300047320 | Ga0495672_0001346 | Ga0495672_0001346_10396_12297 | 628 |
| 825 | 3300047472 | Ga0495686_0053931 | Ga0495686_0053931_345_2246 | 628 |
| 826 | 3300048904 | Ga0496101_0056308 | Ga0496101_0056308_765_2693 | 628 |
| 827 | 3300048917 | Ga0496114_0123111 | Ga0496114_0123111_77_2005 | 628 |
| 828 | 3300048927 | Ga0496124_0001447 | Ga0496124_0001447_13273_15267 | 628 |
| 829 | 3300048927 | Ga0496124_0003995 | Ga0496124_0003995_12320_14314 | 628 |
| 830 | iso_pu_bacteria | 2941471342 | 2941475316 | 628 |
| 831 | 2162886007 | SwRhRL2b_contig_3055844 | SwRhRL2b_0833.00004660 | 629 |
| 832 | 3300003856 | Ga0058692_1000017 | Ga0058692_1000017176 | 629 |
| 833 | 3300005289 | Ga0065704_10000275 | Ga0065704_1000027543 | 629 |
| 834 | 3300005331 | Ga0070670_100005186 | Ga0070670_1000051868 | 629 |
| 835 | 3300009011 | Ga0105251_10001750 | Ga0105251_100017502 | 629 |
| 836 | 3300009148 | Ga0105243_10003262 | Ga0105243_100032629 | 629 |
| 837 | 3300015261 | Ga0182006_1029320 | Ga0182006_10293202 | 629 |
| 838 | 3300025735 | Ga0207713_1000393 | Ga0207713_100039325 | 629 |
| 839 | 3300027312 | Ga0209371_1000044 | Ga0209371_1000044231 | 629 |
| 840 | 3300030500 | Ga0268256_1000046 | Ga0268256_1000046231 | 629 |
| 841 | 3300039145 | Ga0237816_00140 | Ga0237816_00140_2893_4800 | 629 |
| 842 | 3300048920 | Ga0496117_0001420 | Ga0496117_0001420_28408_30297 | 629 |
| 843 | 3300048922 | Ga0496119_0002453 | Ga0496119_0002453_14866_16755 | 629 |
| 844 | 3300048923 | Ga0496120_0002147 | Ga0496120_0002147_4265_6154 | 629 |
| 845 | 3300048925 | Ga0496122_0003345 | Ga0496122_0003345_15103_16992 | 629 |
| 846 | 3300048926 | Ga0496123_0002721 | Ga0496123_0002721_15061_16950 | 629 |
| 847 | 3300048927 | Ga0496124_0003791 | Ga0496124_0003791_12100_13989 | 629 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3id1-assembly1.cif.gz_A | crystal structure of rsep pdz1 domain | 0.8604 | 536 | 602 |
| 2zpl-assembly2.cif.gz_B | crystal structure analysis of pdz domain a | 0.8592 | 534 | 602 |
| 3pv4-assembly1.cif.gz_A | structure of legionella fallonii degq (delta-pdz2 variant) | 0.8544 | 538 | 604 |
| 8e2k-assembly1.cif.gz_X | cryo-em structure of birc6/htra2-s306a | 0.8453 | 538 | 614 |
| 2zpl-assembly4.cif.gz_C | crystal structure analysis of pdz domain a | 0.8414 | 536 | 602 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3id1A00 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.8604 | 536 | 602 | 2.30.42.10 |
| 3pv4A03 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.8544 | 538 | 604 | 2.30.42.10 |
| 4fgmA01 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8537 | 38 | 209 | 2.60.40.3650 |
| af_I1MZD3_905_978_2.30.42.10 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.8482 | 538 | 602 | 2.30.42.10 |
| af_F1R7L1_125_207_2.30.42.10 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.8461 | 538 | 602 | 2.30.42.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S7EKP5-F1-model_v4 | deleted | 0.9987 | 64 | 629 |
|
| AF-A0A2S7EKP5-F1-model_v4 | deleted | 0.9969 | 64 | 629 |
|
| AF-A0A3C0X9S4-F1-model_v4 | deleted | 0.9962 | 64 | 629 |
|
| AF-A0A836ZTA2-F1-model_v4 | Peptidase M61 | 0.9952 | 245 | 629 |
GO:0005737
|
| AF-A0A3C0X9S4-F1-model_v4 | deleted | 0.9944 | 64 | 629 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar