F483313

General Info

Members Datasets Scaffolds Average Seq Length
847 388 796 631

Family's Representative Sequence

Representative Sequence 3300001904|JGI24736J21556_1001682|JGI24736J21556_10016822
Length 683
Sequence MTGIPGPVTSGIGRPRTVTFSIGGLRGPQGTARIHSQAGRPGDPHAPRENLLKSTLLASALXXALAGIGATAAFAADDVPAIKDGPFNGTVKVVVDATDTDHRIFRVKETVPAQPGKLTLLFPEWIPGHHSPTGPIDQFAGLIVKANGQRLEWTRDEYNVYAFHVDVPAGASSVDLEFQTLTPQDTRQGRIVMTPDIVNVQWNQVALYPAGYRADQVQFEPSVKLPAGFQFGTALEQASKDGDTVTFKNINFDDLVDSPIFAGRYFKRVDLDPNGRSPVHLNIVADSAKSLEIKPEALEIHRNLVKQMDKLYGARHYNHYDFLLALTDKLGGIGLEHHRSSENSASPNYFTEWDKSWLGRDLLAHEYNHSWDGKYRRGADLSTPSFNVPMGDSLLWVYEGQTQFWGNVVAARSGLVSQDQARDLLALVAATYDKGRPGLSWRNIQDTTNDPTIAQRRPLSYRNYQMSEDYYSGGQMIWLDVDTKLRELTKNKRSLDDFAKAFFGMKDGDWKVNPYTFDEVASTLNGIAPYDWAKYLRDRVDGHKGDIEGIERGGWKLVYNDKPSDAVKAFEARRHYTDLTYSAGFGVSSKGDISDVRWDSPAFNAGLSPGMHIVAVNGKEFDGDALKDAVTAAKGTSAPIELLVKNFDTYKTIKIEYHDGLMYPHLERDSSKPDWLSQLYKAK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
5 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
6 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
7 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
8 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
9 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
10 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
11 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
12 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
13 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
14 2734482264 Dyella sp. AD052 Isolate Unclassified
15 2738543009 Luteibacter sp. OK325 Isolate Unclassified
16 2739367700 Dyella sp. YR388 Isolate Unclassified
17 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
18 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
19 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
20 2818991457 Xanthomonas translucens 569 Isolate Unclassified
21 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
22 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
23 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
24 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
25 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
26 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
27 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
28 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
29 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
30 2884411467 Dyella sp. AD56 Isolate Rhizosphere
31 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
32 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
33 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
34 2919085039 Luteibacter sp. 1214 Isolate Unclassified
35 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
36 2919404418 Luteibacter sp. 3190 Isolate Unclassified
37 2928963466 Dyella japonica 1073 Isolate Unclassified
38 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
39 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
40 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
41 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
42 2941471342 Luteibacter sp. 621 Isolate Unclassified
43 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
44 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
45 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
46 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
47 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
48 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
49 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
50 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
51 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
52 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
53 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
54 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
55 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
56 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
57 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
58 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
59 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
60 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
61 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
62 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
63 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
64 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
65 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
66 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
67 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
68 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
69 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
70 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
71 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
72 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
73 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
74 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
75 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
76 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
77 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
78 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
79 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
80 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
81 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
82 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
83 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
84 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
85 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
86 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
87 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
88 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
89 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
90 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
91 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
92 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
93 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
94 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
95 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
96 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
97 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
98 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
99 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
100 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
101 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
102 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
103 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
104 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
105 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
106 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
107 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
108 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
109 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
110 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
111 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
112 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
113 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
114 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
115 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
116 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
117 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
118 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
119 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
120 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
121 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
122 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
123 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
124 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
125 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
126 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
127 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
128 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
129 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
130 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
131 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
132 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
134 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
135 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
136 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
137 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
138 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
139 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
140 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
141 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
143 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
144 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
145 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
146 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
147 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
148 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
149 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
150 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
151 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
152 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
158 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
159 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
160 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
161 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
162 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
163 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
164 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
165 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
166 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
167 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
168 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
169 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
170 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
171 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
172 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
174 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
175 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
176 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
183 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
184 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
186 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
187 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
188 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
191 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
192 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
193 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
199 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
201 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
247 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
251 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
252 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
253 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
254 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
255 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
256 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
257 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
258 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
259 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
262 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
263 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
264 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
265 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
266 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
267 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
268 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
271 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
272 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
273 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
274 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
275 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
276 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
277 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
278 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
279 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
280 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
281 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
282 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
283 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
284 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
285 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
286 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
287 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
288 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
289 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
290 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
291 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
292 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
293 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
294 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
295 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
296 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
297 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
298 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
299 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
300 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
301 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
302 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
303 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
304 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
305 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
306 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
307 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
308 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
309 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
310 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
311 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
312 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
313 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
314 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
315 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
316 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
317 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
318 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
319 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
320 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
323 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
324 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
325 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
326 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
327 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
330 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
331 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
332 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
333 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
334 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
335 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
336 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
337 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
338 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
339 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
340 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
341 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
342 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
343 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
344 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
345 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
346 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
347 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
348 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
349 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
350 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
351 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
352 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
353 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
354 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
355 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
356 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
364 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
365 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
366 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
367 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
368 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
369 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
370 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
371 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
374 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
375 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
376 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
377 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
378 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
379 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
380 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
381 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
382 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
383 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
384 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
385 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
386 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
387 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
388 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.62
Metatranscriptomes 0.35
Isolates 6.02

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 15.82
Nodule 0
Rhizoplane 1.77
Rhizosphere 65.64
Stem 0
Stem Tuber 0
Unclassified 16.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3055844 2162886007 Bacteria 22848
2 JGI24736J21556_1001682 3300001904 Bacteria 4007
3 JGI24740J21852_10011041 3300001979 Bacteria 3453
4 JGI24739J22299_10001118 3300001989 Bacteria 10000
5 JGI24737J22298_10000507 3300001990 Bacteria 13598
6 JGI24735J21928_10009465 3300002067 Bacteria 3127
7 JGI24738J21930_10000386 3300002075 Bacteria 12279
8 JGI25156J39149_1005622 3300002705 Bacteria 3571
9 JGI25162J39368_1000156 3300002737 Bacteria 75086
10 JGI25162J39368_1000255 3300002737 Bacteria 50867
11 JGI25162J39368_1000580 3300002737 Bacteria 26829
12 JGI25162J39368_1000588 3300002737 Bacteria 26533
13 JGI25162J39368_1000830 3300002737 Bacteria 20342
14 JGI25162J39368_1002555 3300002737 Bacteria 6922
15 JGI25154J39366_1002703 3300002738 Bacteria 4322
16 JGI25157J39369_1000165 3300002741 Bacteria 55870
17 JGI25157J39369_1000659 3300002741 Bacteria 19127
18 JGI25157J39369_1000719 3300002741 Bacteria 17685
19 JGI25163J39215_1000430 3300002771 Bacteria 12989
20 JGI25164J39214_1000086 3300002772 Bacteria 91769
21 JGI25164J39214_1000136 3300002772 Bacteria 71176
22 JGI25164J39214_1000354 3300002772 Bacteria 28569
23 JGI25164J39214_1002298 3300002772 Bacteria 3064
24 JGI25152J39213_1000231 3300002773 Bacteria 37495
25 JGI25150J39212_1000095 3300002774 Bacteria 50881
26 JGI25151J46595_10000477 3300003187 Bacteria 37879
27 JGI25165J46597_1000144 3300003214 Bacteria 117624
28 JGI25165J46597_1000256 3300003214 Bacteria 71176
29 JGI25153J46596_10000291 3300003215 Bacteria 37879
30 rootH2_10016193 3300003320 Bacteria 38745
31 Ga0006562J51391_1023108 3300003578 Bacteria 8247
32 Ga0006562J51391_1023112 3300003578 Bacteria 3210
33 Ga0055538_1000254 3300003751 Bacteria 28466
34 Ga0055533_1001435 3300003756 Bacteria 6303
35 Ga0055525_1000043 3300003759 Bacteria 268656
36 Ga0055527_1000028 3300003760 Bacteria 172877
37 Ga0055527_1000147 3300003760 Bacteria 50195
38 Ga0055535_1000061 3300003761 Bacteria 117624
39 Ga0055535_1000303 3300003761 Bacteria 50195
40 Ga0055535_1000436 3300003761 Bacteria 38597
41 Ga0055535_1000497 3300003761 Bacteria 35185
42 Ga0055535_1000741 3300003761 Bacteria 24447
43 Ga0055542_1000053 3300003762 Bacteria 172877
44 Ga0055542_1000099 3300003762 Bacteria 117624
45 Ga0055542_1000107 3300003762 Bacteria 111897
46 Ga0055542_1000333 3300003762 Bacteria 50195
47 Ga0055542_1000513 3300003762 Bacteria 35185
48 Ga0055542_1000640 3300003762 Bacteria 29300
49 Ga0055529_1000067 3300003763 Bacteria 165941
50 Ga0055529_1000117 3300003763 Bacteria 117613
51 Ga0055529_1000356 3300003763 Bacteria 50195
52 Ga0055529_1000360 3300003763 Bacteria 49654
53 Ga0055526_1000464 3300003771 Bacteria 32229
54 Ga0055537_1000169 3300003773 Bacteria 48599
55 Ga0055536_1003537 3300003781 Bacteria 8365
56 Ga0055534_1000404 3300003784 Bacteria 26598
57 Ga0055528_1000587 3300003790 Bacteria 27449
58 Ga0055530_10001287 3300003791 Bacteria 18959
59 Ga0055530_10005941 3300003791 Bacteria 5623
60 Ga0055530_10005949 3300003791 Bacteria 5616
61 Ga0055531_10013620 3300003794 Bacteria 3733
62 Ga0058692_1000017 3300003856 Bacteria 274459
63 Ga0065165_1000199 3300005262 Bacteria 104204
64 Ga0065165_1000532 3300005262 Bacteria 58082
65 Ga0065165_1006565 3300005262 Bacteria 6056
66 Ga0065704_10000275 3300005289 Bacteria 50973
67 Ga0065707_10084906 3300005295 Bacteria 6649
68 Ga0070658_10000632 3300005327 Bacteria 30414
69 Ga0070658_10003827 3300005327 Bacteria 12334
70 Ga0070658_10005565 3300005327 Bacteria 10218
71 Ga0070690_100001336 3300005330 Bacteria 12818
72 Ga0070690_100028447 3300005330 Bacteria 3462
73 Ga0070670_100005186 3300005331 Bacteria 10969
74 Ga0070670_100008001 3300005331 Bacteria 8990
75 Ga0070666_10000008 3300005335 Bacteria 293415
76 Ga0070666_10000020 3300005335 Bacteria 177564
77 Ga0070680_100000757 3300005336 Bacteria 22564
78 Ga0070680_100001023 3300005336 Bacteria 19993
79 Ga0070680_100003859 3300005336 Bacteria 11202
80 Ga0070680_100081681 3300005336 Bacteria 2666
81 Ga0070682_100018605 3300005337 Bacteria 4065
82 Ga0070682_100057224 3300005337 Bacteria 2455
83 Ga0070689_100013250 3300005340 Bacteria 5961
84 Ga0070689_100016611 3300005340 Bacteria 5388
85 Ga0070691_10000173 3300005341 Bacteria 21089
86 Ga0070691_10008356 3300005341 Bacteria 4741
87 Ga0070661_100000592 3300005344 Bacteria 27294
88 Ga0070661_100020478 3300005344 Bacteria 4718
89 Ga0070661_100046241 3300005344 Bacteria 3184
90 Ga0070668_100047749 3300005347 Bacteria 3292
91 Ga0070669_100000003 3300005353 Bacteria 338807
92 Ga0070675_100000102 3300005354 Bacteria 50103
93 Ga0070675_100039998 3300005354 Bacteria 3827
94 Ga0070671_100004985 3300005355 Bacteria 10576
95 Ga0070671_100010066 3300005355 Bacteria 7594
96 Ga0070673_100003087 3300005364 Bacteria 10309
97 Ga0070659_100000645 3300005366 Bacteria 25489
98 Ga0070659_100001854 3300005366 Bacteria 15197
99 Ga0070659_100021687 3300005366 Bacteria 4897
100 Ga0070667_100000012 3300005367 Bacteria 258575
101 Ga0070667_100000238 3300005367 Bacteria 62518
102 Ga0070667_100005776 3300005367 Bacteria 10326
103 Ga0070667_100007898 3300005367 Bacteria 8826
104 Ga0070667_100015414 3300005367 Bacteria 6319
105 Ga0070714_100000285 3300005435 Bacteria 38892
106 Ga0070714_100011841 3300005435 Bacteria 6932
107 Ga0070714_100042692 3300005435 Bacteria 3832
108 Ga0070713_100002100 3300005436 Bacteria 12880
109 Ga0070711_100015889 3300005439 Bacteria 4769
110 Ga0070711_100028503 3300005439 Bacteria 3675
111 Ga0070708_100011892 3300005445 Bacteria 7087
112 Ga0070663_100000126 3300005455 Bacteria 36101
113 Ga0070663_100010476 3300005455 Bacteria 5777
114 Ga0070663_100018862 3300005455 Bacteria 4534
115 Ga0070663_100043261 3300005455 Bacteria 3169
116 Ga0070663_100081340 3300005455 Bacteria 2381
117 Ga0070662_100007301 3300005457 Bacteria 7159
118 Ga0070681_10001214 3300005458 Bacteria 22414
119 Ga0070681_10001772 3300005458 Bacteria 19367
120 Ga0070681_10002905 3300005458 Bacteria 15852
121 Ga0070681_10005388 3300005458 Bacteria 12349
122 Ga0070681_10006795 3300005458 Bacteria 11135
123 Ga0070685_10001037 3300005466 Bacteria 14899
124 Ga0070685_10001192 3300005466 Bacteria 13890
125 Ga0070685_10002768 3300005466 Bacteria 8965
126 Ga0070698_100018240 3300005471 Bacteria 7390
127 Ga0070699_100120221 3300005518 Bacteria 2309
128 Ga0070679_100000992 3300005530 Bacteria 24720
129 Ga0070679_100001076 3300005530 Bacteria 23858
130 Ga0070679_100001316 3300005530 Bacteria 21885
131 Ga0070684_100022717 3300005535 Bacteria 5236
132 Ga0070697_100012911 3300005536 Bacteria 6545
133 Ga0068853_100000191 3300005539 Bacteria 43207
134 Ga0068853_100001170 3300005539 Bacteria 18664
135 Ga0070672_100005812 3300005543 Bacteria 8228
136 Ga0070672_100015022 3300005543 Bacteria 5502
137 Ga0070696_100000382 3300005546 Bacteria 27135
138 Ga0070696_100013399 3300005546 Bacteria 5501
139 Ga0070696_100014957 3300005546 Bacteria 5210
140 Ga0070665_100000132 3300005548 Bacteria 140229
141 Ga0070665_100001521 3300005548 Bacteria 26874
142 Ga0070665_100003317 3300005548 Bacteria 17245
143 Ga0070665_100070395 3300005548 Bacteria 3505
144 Ga0068855_100000601 3300005563 Bacteria 44104
145 Ga0068855_100017609 3300005563 Bacteria 8591
146 Ga0068855_100087040 3300005563 Bacteria 3612
147 Ga0070664_100001090 3300005564 Bacteria 21405
148 Ga0070664_100001813 3300005564 Bacteria 17124
149 Ga0068857_100023963 3300005577 Bacteria 5372
150 Ga0068857_100074675 3300005577 Bacteria 3022
151 Ga0068857_100119646 3300005577 Bacteria 2371
152 Ga0068854_100000002 3300005578 Bacteria 362695
153 Ga0068854_100000481 3300005578 Bacteria 24413
154 Ga0068854_100003804 3300005578 Bacteria 9439
155 Ga0068854_100060028 3300005578 Bacteria 2749
156 Ga0068854_100066898 3300005578 Bacteria 2616
157 Ga0068856_100013197 3300005614 Bacteria 8002
158 Ga0068856_100024504 3300005614 Bacteria 5876
159 Ga0068852_100085078 3300005616 Bacteria 2816
160 Ga0068859_100001584 3300005617 Bacteria 23196
161 Ga0068859_100001612 3300005617 Bacteria 23064
162 Ga0068859_100182488 3300005617 Bacteria 2182
163 Ga0068864_100039204 3300005618 Bacteria 4048
164 Ga0068864_100055268 3300005618 Bacteria 3427
165 Ga0068851_10005497 3300005834 Bacteria 5742
166 Ga0068863_100002479 3300005841 Bacteria 18349
167 Ga0068863_100041259 3300005841 Bacteria 4387
168 Ga0068863_100105737 3300005841 Unclassified 2677
169 Ga0068858_100000132 3300005842 Bacteria 77767
170 Ga0068858_100006090 3300005842 Bacteria 11767
171 Ga0068858_100018210 3300005842 Bacteria 6577
172 Ga0068860_100000771 3300005843 Bacteria 36058
173 Ga0068860_100003593 3300005843 Bacteria 15941
174 Ga0068860_100008839 3300005843 Bacteria 10033
175 Ga0068860_100036499 3300005843 Bacteria 4709
176 Ga0068862_100052969 3300005844 Bacteria 3473
177 Ga0068862_100091506 3300005844 Bacteria 2650
178 Ga0097621_100037884 3300006237 Bacteria 3868
179 Ga0097621_100051245 3300006237 Bacteria 3359
180 Ga0068871_100068095 3300006358 Bacteria 2922
181 Ga0068871_100089700 3300006358 Bacteria 2560
182 Ga0075430_100076585 3300006846 Bacteria 2804
183 Ga0075434_100044197 3300006871 Bacteria 4420
184 Ga0068865_100008576 3300006881 Bacteria 6319
185 Ga0068865_100035847 3300006881 Bacteria 3340
186 Ga0075436_100017086 3300006914 Bacteria 4966
187 Ga0097620_100001584 3300006931 Bacteria 23196
188 Ga0097620_100001612 3300006931 Bacteria 23064
189 Ga0097620_100182478 3300006931 Bacteria 2182
190 Ga0105251_10001750 3300009011 Bacteria 18123
191 Ga0105240_10000049 3300009093 Bacteria 236718
192 Ga0105240_10000368 3300009093 Bacteria 84618
193 Ga0105240_10000624 3300009093 Bacteria 65382
194 Ga0105240_10002793 3300009093 Bacteria 27614
195 Ga0105240_10003217 3300009093 Bacteria 25589
196 Ga0105240_10039957 3300009093 Bacteria 6005
197 Ga0105240_10040933 3300009093 Bacteria 5920
198 Ga0105240_10057086 3300009093 Bacteria 4881
199 Ga0105240_10068042 3300009093 Bacteria 4412
200 Ga0105240_10089489 3300009093 Bacteria 3765
201 Ga0111539_10007836 3300009094 Bacteria 13640
202 Ga0105245_10008344 3300009098 Bacteria 9053
203 Ga0105247_10012918 3300009101 Bacteria 5008
204 Ga0114129_10002885 3300009147 Bacteria 24057
205 Ga0105243_10003262 3300009148 Bacteria 13207
206 Ga0105241_10027712 3300009174 Bacteria 4219
207 Ga0105248_10000179 3300009177 Bacteria 73845
208 Ga0105248_10000244 3300009177 Bacteria 62961
209 Ga0105248_10002189 3300009177 Bacteria 21624
210 Ga0105248_10045312 3300009177 Bacteria 4932
211 Ga0105237_10000097 3300009545 Bacteria 121349
212 Ga0105237_10001219 3300009545 Bacteria 34275
213 Ga0105237_10128855 3300009545 Bacteria 2525
214 Ga0105237_10151898 3300009545 Bacteria 2312
215 Ga0105237_10167622 3300009545 Bacteria 2196
216 Ga0105238_10000145 3300009551 Bacteria 77797
217 Ga0105238_10000335 3300009551 Bacteria 51399
218 Ga0105238_10003689 3300009551 Bacteria 15246
219 Ga0105238_10020116 3300009551 Bacteria 6795
220 Ga0105238_10033452 3300009551 Bacteria 5233
221 Ga0105249_10000262 3300009553 Bacteria 56551
222 Ga0105239_10000070 3300010375 Bacteria 144044
223 Ga0105239_10000967 3300010375 Bacteria 40367
224 Ga0105239_10032770 3300010375 Bacteria 5709
225 Ga0105239_10058346 3300010375 Bacteria 4235
226 Ga0157314_1000001 3300012500 Bacteria 57291
227 Ga0157373_10011039 3300013100 Bacteria 6653
228 Ga0157373_10038130 3300013100 Bacteria 3444
229 Ga0157371_10001503 3300013102 Bacteria 24118
230 Ga0157371_10003102 3300013102 Bacteria 15388
231 Ga0157370_10000224 3300013104 Bacteria 71976
232 Ga0157370_10000342 3300013104 Bacteria 58828
233 Ga0157370_10001344 3300013104 Bacteria 30527
234 Ga0157370_10039001 3300013104 Bacteria 4593
235 Ga0157369_10003305 3300013105 Bacteria 19174
236 Ga0157369_10004308 3300013105 Bacteria 16807
237 Ga0157369_10031478 3300013105 Bacteria 5840
238 Ga0157369_10041194 3300013105 Bacteria 5041
239 Ga0157369_10086800 3300013105 Bacteria 3341
240 Ga0157369_10107685 3300013105 Bacteria 2965
241 Ga0157378_10118007 3300013297 Bacteria 2442
242 Ga0163162_10001968 3300013306 Bacteria 19312
243 Ga0163162_10006577 3300013306 Bacteria 11263
244 Ga0163162_10013318 3300013306 Bacteria 8033
245 Ga0157372_10021320 3300013307 Bacteria 7000
246 Ga0157372_10030736 3300013307 Bacteria 5876
247 Ga0157375_10000216 3300013308 Bacteria 53883
248 Ga0157375_10013933 3300013308 Bacteria 7169
249 Ga0157375_10015954 3300013308 Bacteria 6738
250 Ga0163163_10074753 3300014325 Bacteria 3381
251 Ga0163163_10087332 3300014325 Bacteria 3129
252 Ga0157380_10026626 3300014326 Bacteria 4392
253 Ga0157380_10104227 3300014326 Bacteria 2368
254 Ga0182008_10000745 3300014497 Bacteria 22965
255 Ga0182008_10002859 3300014497 Bacteria 10697
256 Ga0182008_10015138 3300014497 Bacteria 4030
257 Ga0182008_10022630 3300014497 Bacteria 3218
258 Ga0157379_10000091 3300014968 Bacteria 61113
259 Ga0157376_10027808 3300014969 Bacteria 4487
260 Ga0182006_1000058 3300015261 Bacteria 167164
261 Ga0182006_1000098 3300015261 Bacteria 101707
262 Ga0182006_1029320 3300015261 Bacteria 2230
263 Ga0182007_10000311 3300015262 Bacteria 31137
264 Ga0182005_1000015 3300015265 Bacteria 387565
265 Ga0183369_1019 3300015685 Bacteria 115894
266 Ga0183368_1007 3300015687 Bacteria 405609
267 Ga0163161_10001852 3300017792 Bacteria 15455
268 Ga0163161_10003406 3300017792 Bacteria 11158
269 Ga0163161_10033273 3300017792 Bacteria 3684
270 Ga0206356_10268222 3300020070 Bacteria 11936
271 Ga0213872_10000601 3300021361 Bacteria 27442
272 Ga0213872_10002289 3300021361 Bacteria 11410
273 Ga0213872_10003100 3300021361 Bacteria 9362
274 Ga0213872_10004729 3300021361 Bacteria 7141
275 Ga0213872_10008108 3300021361 Bacteria 5099
276 Ga0213872_10009756 3300021361 Bacteria 4590
277 Ga0213872_10029877 3300021361 Bacteria 2499
278 Ga0213876_10000303 3300021384 Bacteria 44145
279 Ga0213875_10010605 3300021388 Bacteria 4611
280 Ga0209760_100243 3300025207 Bacteria 22600
281 Ga0209784_100043 3300025224 Bacteria 217823
282 Ga0209566_102982 3300025225 Bacteria 2807
283 Ga0209674_100037 3300025226 Bacteria 404339
284 Ga0209674_100059 3300025226 Bacteria 282517
285 Ga0209674_101158 3300025226 Bacteria 7626
286 Ga0209672_100004 3300025228 Bacteria 1467504
287 Ga0209672_100008 3300025228 Bacteria 946876
288 Ga0209672_100274 3300025228 Bacteria 37549
289 Ga0209672_100473 3300025228 Bacteria 22550
290 Ga0209563_100036 3300025230 Bacteria 448275
291 Ga0207427_100044 3300025231 Bacteria 242623
292 Ga0207427_100087 3300025231 Bacteria 140098
293 Ga0207427_100088 3300025231 Bacteria 137220
294 Ga0207427_100145 3300025231 Bacteria 82641
295 Ga0207427_100191 3300025231 Bacteria 60860
296 Ga0207427_101926 3300025231 Bacteria 6419
297 Ga0209437_100005 3300025233 Bacteria 1071596
298 Ga0209437_100167 3300025233 Bacteria 144661
299 Ga0209437_100173 3300025233 Bacteria 140098
300 Ga0209437_100266 3300025233 Bacteria 79564
301 Ga0209437_100431 3300025233 Bacteria 36840
302 Ga0209437_101228 3300025233 Bacteria 7282
303 Ga0209437_101348 3300025233 Bacteria 6394
304 Ga0209258_100003 3300025242 Bacteria 1467504
305 Ga0209258_100004 3300025242 Bacteria 1376422
306 Ga0209258_100008 3300025242 Bacteria 1009355
307 Ga0209258_100092 3300025242 Bacteria 226544
308 Ga0209258_100265 3300025242 Bacteria 90172
309 Ga0209258_100372 3300025242 Bacteria 58847
310 Ga0209258_100798 3300025242 Bacteria 18582
311 Ga0207425_1000028 3300025245 Bacteria 286333
312 Ga0209646_1000576 3300025246 Bacteria 15271
313 Ga0209646_1001067 3300025246 Bacteria 8227
314 Ga0209026_1000010 3300025250 Bacteria 511986
315 Ga0209026_1000081 3300025250 Bacteria 196861
316 Ga0209026_1000112 3300025250 Bacteria 140098
317 Ga0209026_1001377 3300025250 Bacteria 10854
318 Ga0209026_1003633 3300025250 Bacteria 4952
319 Ga0209026_1004232 3300025250 Bacteria 4363
320 Ga0209677_100814 3300025253 Bacteria 15605
321 Ga0209148_1000016 3300025254 Bacteria 804369
322 Ga0209148_1000042 3300025254 Bacteria 464111
323 Ga0209148_1000047 3300025254 Bacteria 434369
324 Ga0209148_1000055 3300025254 Bacteria 367500
325 Ga0209148_1000065 3300025254 Bacteria 344489
326 Ga0209148_1000222 3300025254 Bacteria 93775
327 Ga0209759_1000468 3300025256 Bacteria 45634
328 Ga0209759_1000934 3300025256 Bacteria 21037
329 Ga0209759_1001497 3300025256 Bacteria 12906
330 Ga0209129_1000065 3300025258 Bacteria 232568
331 Ga0209129_1000907 3300025258 Bacteria 18130
332 Ga0209233_1000011 3300025261 Bacteria 1071611
333 Ga0209233_1000046 3300025261 Bacteria 470971
334 Ga0209233_1000179 3300025261 Bacteria 140518
335 Ga0209233_1000254 3300025261 Bacteria 82641
336 Ga0209565_1000031 3300025263 Bacteria 320341
337 Ga0209455_1000004 3300025272 Bacteria 1467504
338 Ga0209455_1000007 3300025272 Bacteria 1157983
339 Ga0209455_1000016 3300025272 Bacteria 753097
340 Ga0209455_1000056 3300025272 Bacteria 349821
341 Ga0209455_1000103 3300025272 Bacteria 201664
342 Ga0209455_1000295 3300025272 Bacteria 52412
343 Ga0209455_1004681 3300025272 Bacteria 4406
344 Ga0209673_1000484 3300025273 Bacteria 66361
345 Ga0209675_1000015 3300025291 Bacteria 403517
346 Ga0209676_1000182 3300025292 Bacteria 146373
347 Ga0209025_1000002 3300025294 Bacteria 1393142
348 Ga0209564_1000480 3300025295 Bacteria 66421
349 Ga0209758_1000003 3300025297 Bacteria 1398533
350 Ga0209758_1000696 3300025297 Bacteria 49847
351 Ga0209758_1001407 3300025297 Bacteria 28504
352 Ga0209050_1000141 3300025298 Bacteria 173116
353 Ga0209050_1000201 3300025298 Bacteria 134028
354 Ga0209050_1001448 3300025298 Bacteria 25493
355 Ga0209256_1010915 3300025299 Bacteria 3724
356 Ga0209051_1001660 3300025303 Bacteria 17957
357 Ga0209051_1002093 3300025303 Bacteria 15039
358 Ga0209257_1000180 3300025304 Bacteria 158090
359 Ga0209257_1000208 3300025304 Bacteria 141393
360 Ga0209257_1000484 3300025304 Bacteria 72044
361 Ga0209257_1000636 3300025304 Bacteria 56284
362 Ga0209257_1002229 3300025304 Bacteria 19909
363 Ga0209257_1016563 3300025304 Bacteria 2971
364 Ga0207656_10001699 3300025321 Bacteria 7309
365 Ga0207713_1000393 3300025735 Bacteria 47322
366 Ga0207680_10000001 3300025903 Bacteria 1091453
367 Ga0207680_10000005 3300025903 Bacteria 660983
368 Ga0207680_10048918 3300025903 Bacteria 2514
369 Ga0207647_10000019 3300025904 Bacteria 123924
370 Ga0207647_10000031 3300025904 Bacteria 104231
371 Ga0207647_10004652 3300025904 Bacteria 10167
372 Ga0207647_10008443 3300025904 Bacteria 7386
373 Ga0207647_10014983 3300025904 Bacteria 5328
374 Ga0207647_10020725 3300025904 Bacteria 4404
375 Ga0207705_10000641 3300025909 Bacteria 29186
376 Ga0207705_10001258 3300025909 Bacteria 20379
377 Ga0207705_10011802 3300025909 Bacteria 6314
378 Ga0207684_10009533 3300025910 Bacteria 8566
379 Ga0207654_10026208 3300025911 Bacteria 3154
380 Ga0207707_10000248 3300025912 Bacteria 59206
381 Ga0207707_10000267 3300025912 Bacteria 56162
382 Ga0207707_10001078 3300025912 Bacteria 26123
383 Ga0207707_10005096 3300025912 Bacteria 11523
384 Ga0207707_10008813 3300025912 Bacteria 8758
385 Ga0207707_10019320 3300025912 Bacteria 5947
386 Ga0207707_10030671 3300025912 Bacteria 4703
387 Ga0207707_10032484 3300025912 Bacteria 4568
388 Ga0207695_10000014 3300025913 Bacteria 812599
389 Ga0207695_10000100 3300025913 Bacteria 258626
390 Ga0207695_10000114 3300025913 Bacteria 242465
391 Ga0207695_10000704 3300025913 Bacteria 65282
392 Ga0207695_10001693 3300025913 Bacteria 35385
393 Ga0207695_10002625 3300025913 Bacteria 26298
394 Ga0207695_10007072 3300025913 Bacteria 14389
395 Ga0207695_10012442 3300025913 Bacteria 10216
396 Ga0207695_10017563 3300025913 Bacteria 8318
397 Ga0207695_10030334 3300025913 Bacteria 5954
398 Ga0207671_10000119 3300025914 Bacteria 121359
399 Ga0207671_10000409 3300025914 Bacteria 60086
400 Ga0207671_10024108 3300025914 Bacteria 4579
401 Ga0207660_10006597 3300025917 Bacteria 7534
402 Ga0207660_10056984 3300025917 Bacteria 2798
403 Ga0207657_10080404 3300025919 Bacteria 2740
404 Ga0207649_10001813 3300025920 Bacteria 12193
405 Ga0207649_10001942 3300025920 Bacteria 11779
406 Ga0207649_10011905 3300025920 Bacteria 4813
407 Ga0207649_10017407 3300025920 Bacteria 4072
408 Ga0207652_10000025 3300025921 Bacteria 157704
409 Ga0207652_10001915 3300025921 Bacteria 18022
410 Ga0207652_10002103 3300025921 Bacteria 17102
411 Ga0207681_10000007 3300025923 Bacteria 483669
412 Ga0207694_10001078 3300025924 Bacteria 23707
413 Ga0207694_10001535 3300025924 Bacteria 19628
414 Ga0207694_10006773 3300025924 Bacteria 8701
415 Ga0207694_10016576 3300025924 Bacteria 5564
416 Ga0207694_10037547 3300025924 Bacteria 3721
417 Ga0207650_10001635 3300025925 Bacteria 15954
418 Ga0207659_10000802 3300025926 Bacteria 18581
419 Ga0207659_10004529 3300025926 Bacteria 8407
420 Ga0207659_10008284 3300025926 Bacteria 6445
421 Ga0207687_10011627 3300025927 Bacteria 5753
422 Ga0207700_10019467 3300025928 Bacteria 4586
423 Ga0207664_10000092 3300025929 Bacteria 83276
424 Ga0207664_10001368 3300025929 Bacteria 16021
425 Ga0207644_10008561 3300025931 Bacteria 6693
426 Ga0207690_10000768 3300025932 Bacteria 20778
427 Ga0207690_10012171 3300025932 Bacteria 5148
428 Ga0207690_10032344 3300025932 Bacteria 3356
429 Ga0207690_10041998 3300025932 Bacteria 3000
430 Ga0207690_10044971 3300025932 Bacteria 2914
431 Ga0207706_10000898 3300025933 Bacteria 30553
432 Ga0207706_10003006 3300025933 Bacteria 16254
433 Ga0207706_10039207 3300025933 Bacteria 4200
434 Ga0207706_10039256 3300025933 Bacteria 4197
435 Ga0207706_10062435 3300025933 Bacteria 3281
436 Ga0207670_10016152 3300025936 Unclassified 4479
437 Ga0207691_10011979 3300025940 Bacteria 8318
438 Ga0207711_10000406 3300025941 Bacteria 45644
439 Ga0207711_10004808 3300025941 Bacteria 11469
440 Ga0207711_10040247 3300025941 Bacteria 3976
441 Ga0207679_10001906 3300025945 Bacteria 12951
442 Ga0207667_10000134 3300025949 Bacteria 112086
443 Ga0207667_10000195 3300025949 Bacteria 88237
444 Ga0207667_10008255 3300025949 Bacteria 12394
445 Ga0207667_10010193 3300025949 Bacteria 11007
446 Ga0207667_10012338 3300025949 Bacteria 9856
447 Ga0207667_10033996 3300025949 Bacteria 5476
448 Ga0207667_10064449 3300025949 Bacteria 3826
449 Ga0207667_10080129 3300025949 Bacteria 3383
450 Ga0207667_10097354 3300025949 Bacteria 3037
451 Ga0207712_10000215 3300025961 Bacteria 57704
452 Ga0207640_10000003 3300025981 Bacteria 505282
453 Ga0207640_10000025 3300025981 Bacteria 143903
454 Ga0207640_10001460 3300025981 Bacteria 12780
455 Ga0207640_10006300 3300025981 Bacteria 6506
456 Ga0207640_10011194 3300025981 Bacteria 5073
457 Ga0207640_10021651 3300025981 Bacteria 3835
458 Ga0207658_10000027 3300025986 Bacteria 174626
459 Ga0207658_10009737 3300025986 Bacteria 6525
460 Ga0207658_10014695 3300025986 Bacteria 5365
461 Ga0207658_10027601 3300025986 Bacteria 3990
462 Ga0207703_10000590 3300026035 Bacteria 36957
463 Ga0207703_10000753 3300026035 Bacteria 31952
464 Ga0207703_10006133 3300026035 Bacteria 9621
465 Ga0207639_10000117 3300026041 Bacteria 61185
466 Ga0207639_10026564 3300026041 Bacteria 4207
467 Ga0207678_10004533 3300026067 Bacteria 12490
468 Ga0207678_10020176 3300026067 Bacteria 5852
469 Ga0207678_10022401 3300026067 Bacteria 5532
470 Ga0207678_10033569 3300026067 Bacteria 4470
471 Ga0207678_10040625 3300026067 Bacteria 4034
472 Ga0207678_10061222 3300026067 Bacteria 3237
473 Ga0207678_10096985 3300026067 Bacteria 2520
474 Ga0207702_10000037 3300026078 Bacteria 153366
475 Ga0207702_10000374 3300026078 Bacteria 51061
476 Ga0207702_10036900 3300026078 Bacteria 4088
477 Ga0207641_10000491 3300026088 Bacteria 44561
478 Ga0207641_10001423 3300026088 Bacteria 23551
479 Ga0207641_10006026 3300026088 Bacteria 10273
480 Ga0207676_10001405 3300026095 Bacteria 17908
481 Ga0207676_10068299 3300026095 Bacteria 2842
482 Ga0207674_10001703 3300026116 Bacteria 28127
483 Ga0207674_10002408 3300026116 Bacteria 23603
484 Ga0207674_10042961 3300026116 Bacteria 4663
485 Ga0207674_10074079 3300026116 Bacteria 3417
486 Ga0207674_10105795 3300026116 Bacteria 2791
487 Ga0207698_10001294 3300026142 Bacteria 14583
488 Ga0207698_10005275 3300026142 Bacteria 7953
489 Ga0209371_1000044 3300027312 Bacteria 327086
490 Ga0207428_10005919 3300027907 Bacteria 11322
491 Ga0268266_10000007 3300028379 Bacteria 1372921
492 Ga0268266_10000051 3300028379 Bacteria 296231
493 Ga0268266_10000067 3300028379 Bacteria 241577
494 Ga0268266_10002151 3300028379 Bacteria 21661
495 Ga0268265_10061495 3300028380 Bacteria 2882
496 Ga0268264_10000102 3300028381 Bacteria 222526
497 Ga0268264_10003055 3300028381 Bacteria 14503
498 Ga0265319_1005768 3300028563 Bacteria 5858
499 Ga0268256_1000046 3300030500 Bacteria 327003
500 Ga0307511_10009921 3300030521 Bacteria 9477
501 Ga0307413_10001009 3300031824 Bacteria 10163
502 Ga0307406_10012231 3300031901 Bacteria 4891
503 Ga0307412_10002015 3300031911 Bacteria 11275
504 Ga0307412_10002443 3300031911 Bacteria 10338
505 Ga0307510_10000707 3300033180 Bacteria 34254
506 Ga0307510_10002809 3300033180 Bacteria 19958
507 Ga0373961_0000030 3300035241 Bacteria 90416
508 Ga0373927_0000200 3300035695 Bacteria 48402
509 Ga0373927_0003547 3300035695 Bacteria 11154
510 Ga0373937_0019790 3300036401 Bacteria 6029
511 Ga0373937_0021549 3300036401 Bacteria 5783
512 Ga0373925_0000032 3300037068 Bacteria 145357
513 Ga0395899_0000047 3300037312 Bacteria 233482
514 Ga0395899_0002204 3300037312 Bacteria 15967
515 Ga0395899_0004280 3300037312 Bacteria 11160
516 Ga0395899_0017397 3300037312 Bacteria 5476
517 Ga0395899_0035158 3300037312 Bacteria 3761
518 Ga0395899_0036795 3300037312 Bacteria 3670
519 Ga0395899_0092174 3300037312 Bacteria 2194
520 Ga0395900_0000011 3300037418 Bacteria 421926
521 Ga0395900_0000648 3300037418 Bacteria 46594
522 Ga0395900_0001660 3300037418 Bacteria 26042
523 Ga0395900_0047107 3300037418 Bacteria 4438
524 Ga0395898_0000013 3300037466 Bacteria 458788
525 Ga0395898_0000058 3300037466 Bacteria 277701
526 Ga0395898_0008566 3300037466 Bacteria 10797
527 Ga0395898_0021551 3300037466 Bacteria 6533
528 Ga0395898_0063376 3300037466 Bacteria 3587
529 Ga0395898_0110031 3300037466 Bacteria 2641
530 Ga0395905_0053804 3300037471 Bacteria 3767
531 Ga0436364_0644604 3300037853 Bacteria 15914
532 Ga0395901_0000435 3300038443 Bacteria 48931
533 Ga0395901_0007887 3300038443 Bacteria 10741
534 Ga0395901_0015375 3300038443 Bacteria 7790
535 Ga0395901_0019340 3300038443 Bacteria 6961
536 Ga0395901_0047331 3300038443 Bacteria 4465
537 Ga0395901_0074576 3300038443 Bacteria 3540
538 Ga0395901_0076054 3300038443 Bacteria 3503
539 Ga0395901_0221620 3300038443 Bacteria 1977
540 Ga0237819_00006 3300038705 Bacteria 78253
541 Ga0237816_00140 3300039145 Bacteria 5646
542 Ga0436365_0854233 3300039437 Bacteria 41356
543 Ga0436361_0110651 3300039447 Bacteria 3925
544 Ga0436361_0169760 3300039447 Bacteria 8191
545 Ga0436361_0201010 3300039447 Bacteria 3615
546 Ga0436361_0252460 3300039447 Bacteria 41857
547 Ga0436361_0519031 3300039447 Bacteria 16348
548 Ga0436361_0713206 3300039447 Bacteria 50586
549 Ga0436361_0714695 3300039447 Bacteria 5139
550 Ga0436361_0965373 3300039447 Bacteria 5678
551 Ga0439436_0000003 3300041404 Bacteria 186684
552 Ga0439465_0000406 3300041413 Bacteria 12511
553 Ga0451806_541229 3300041462 Bacteria 7600
554 Ga0451804_0812598 3300041463 Bacteria 3111
555 Ga0451807_2369243 3300041486 Bacteria 4021
556 Ga0450908_000296 3300042184 Bacteria 9873
557 Ga0466969_0004902 3300044656 Bacteria 7129
558 Ga0466969_0014377 3300044656 Bacteria 4160
559 Ga0466982_0000022 3300044672 Bacteria 95114
560 Ga0466982_0000041 3300044672 Bacteria 40889
561 Ga0466965_0001607 3300044683 Bacteria 9223
562 Ga0466966_0003909 3300044684 Bacteria 9836
563 Ga0466966_0010372 3300044684 Bacteria 6185
564 Ga0466966_0021019 3300044684 Bacteria 4288
565 Ga0466961_0002235 3300044693 Bacteria 12057
566 Ga0466961_0008197 3300044693 Bacteria 6656
567 Ga0466971_0012675 3300044719 Bacteria 3697
568 Ga0466968_0002639 3300044735 Bacteria 6598
569 Ga0466970_0011483 3300044765 Bacteria 4515
570 Ga0466957_0004765 3300044842 Bacteria 7592
571 Ga0466957_0014329 3300044842 Bacteria 4615
572 Ga0466960_0004781 3300044901 Bacteria 5320
573 Ga0466959_0002514 3300045049 Bacteria 11755
574 Ga0466959_0041762 3300045049 Bacteria 3385
575 Ga0466958_0001258 3300045836 Bacteria 11879
576 Ga0466958_0013819 3300045836 Bacteria 4603
577 Ga0466958_0026423 3300045836 Bacteria 3431
578 Ga0495617_000031 3300046452 Bacteria 151115
579 Ga0495592_0007607 3300046454 Bacteria 8115
580 Ga0495638_0000081 3300046460 Bacteria 155203
581 Ga0495638_0000089 3300046460 Bacteria 151067
582 Ga0495638_0000211 3300046460 Bacteria 82400
583 Ga0495638_0000242 3300046460 Bacteria 74758
584 Ga0495638_0002424 3300046460 Bacteria 15245
585 Ga0495638_0023833 3300046460 Bacteria 3998
586 Ga0495650_0000027 3300046471 Bacteria 475071
587 Ga0495650_0000465 3300046471 Bacteria 62638
588 Ga0495650_0001170 3300046471 Bacteria 28030
589 Ga0495650_0001248 3300046471 Bacteria 26317
590 Ga0495584_0003103 3300046491 Bacteria 9234
591 Ga0495585_0000035 3300046492 Bacteria 136801
592 Ga0495596_0000154 3300046500 Bacteria 47820
593 Ga0495607_0000008 3300046501 Bacteria 265274
594 Ga0495607_0000020 3300046501 Bacteria 164851
595 Ga0495607_0000553 3300046501 Bacteria 36595
596 Ga0495583_0007433 3300046506 Bacteria 6882
597 Ga0495606_0000174 3300046507 Bacteria 113955
598 Ga0495606_0001389 3300046507 Bacteria 32713
599 Ga0495606_0001420 3300046507 Bacteria 32141
600 Ga0495608_0062059 3300046511 Bacteria 2456
601 Ga0495610_0001741 3300046512 Bacteria 19066
602 Ga0495610_0002267 3300046512 Bacteria 16255
603 Ga0495610_0037869 3300046512 Bacteria 2451
604 Ga0495616_0000028 3300046513 Bacteria 133873
605 Ga0495618_0026351 3300046514 Bacteria 3614
606 Ga0495620_0000088 3300046515 Bacteria 74950
607 Ga0495620_0002919 3300046515 Bacteria 9819
608 Ga0495631_0000212 3300046518 Bacteria 39918
609 Ga0495631_0000425 3300046518 Bacteria 29180
610 Ga0495631_0001762 3300046518 Bacteria 12834
611 Ga0495632_0000005 3300046519 Bacteria 362872
612 Ga0495643_0001267 3300046522 Bacteria 24200
613 Ga0495643_0023874 3300046522 Bacteria 3472
614 Ga0495648_0000360 3300046524 Bacteria 50159
615 Ga0495663_0002348 3300046525 Bacteria 5719
616 Ga0495609_0007391 3300046538 Bacteria 5491
617 Ga0495621_0002958 3300046539 Bacteria 4629
618 Ga0495597_0032817 3300046542 Bacteria 2355
619 Ga0495622_0034512 3300046557 Bacteria 2359
620 Ga0495633_0004675 3300046558 Bacteria 8614
621 Ga0495633_0008488 3300046558 Bacteria 5778
622 Ga0495633_0035610 3300046558 Bacteria 2389
623 Ga0495667_0000845 3300046559 Bacteria 19806
624 Ga0495656_0000648 3300046615 Bacteria 11157
625 Ga0495611_0000005 3300046648 Bacteria 284271
626 Ga0495611_0000049 3300046648 Bacteria 85148
627 Ga0495625_0000285 3300046660 Bacteria 78065
628 Ga0495625_0003741 3300046660 Bacteria 14802
629 Ga0495625_0023682 3300046660 Bacteria 4686
630 Ga0495661_0000566 3300046665 Bacteria 38323
631 Ga0495657_0000586 3300046675 Bacteria 33357
632 Ga0495599_0058830 3300046678 Bacteria 2404
633 Ga0495613_0028717 3300046689 Bacteria 4138
634 Ga0495670_0000268 3300046691 Bacteria 24390
635 Ga0495670_0001095 3300046691 Bacteria 13137
636 Ga0495671_0001264 3300046692 Bacteria 17243
637 Ga0495649_0000929 3300046694 Bacteria 23212
638 Ga0495589_0000056 3300046794 Bacteria 109990
639 Ga0495660_0000108 3300046810 Bacteria 88833
640 Ga0495660_0000217 3300046810 Bacteria 57840
641 Ga0495636_0023614 3300047318 Bacteria 2490
642 Ga0495674_0077234 3300047319 Bacteria 2863
643 Ga0495672_0001346 3300047320 Bacteria 24356
644 Ga0495683_0003298 3300047323 Bacteria 9432
645 Ga0495679_000010 3300047446 Bacteria 337760
646 Ga0495673_0000038 3300047469 Bacteria 303785
647 Ga0495673_0000045 3300047469 Bacteria 280765
648 Ga0495673_0001199 3300047469 Bacteria 21627
649 Ga0495686_0000007 3300047472 Bacteria 732622
650 Ga0495686_0000227 3300047472 Bacteria 103680
651 Ga0495686_0000311 3300047472 Bacteria 82066
652 Ga0495686_0005468 3300047472 Bacteria 10011
653 Ga0495686_0010095 3300047472 Bacteria 6742
654 Ga0495686_0010337 3300047472 Bacteria 6643
655 Ga0495686_0012040 3300047472 Bacteria 6078
656 Ga0495686_0013009 3300047472 Bacteria 5796
657 Ga0495686_0053931 3300047472 Bacteria 2518
658 Ga0496101_0056308 3300048904 Bacteria 2842
659 Ga0496104_0053871 3300048907 Bacteria 3802
660 Ga0496105_0008153 3300048908 Bacteria 8143
661 Ga0496106_0002598 3300048909 Bacteria 13443
662 Ga0496107_0092688 3300048910 Bacteria 2209
663 Ga0496110_0041447 3300048913 Bacteria 4018
664 Ga0496112_0004629 3300048915 Bacteria 11704
665 Ga0496113_0022710 3300048916 Bacteria 4442
666 Ga0496114_0123111 3300048917 Bacteria 2232
667 Ga0496115_0000738 3300048918 Bacteria 24162
668 Ga0496115_0001079 3300048918 Bacteria 19755
669 Ga0496115_0024016 3300048918 Bacteria 4736
670 Ga0496116_0000045 3300048919 Bacteria 324307
671 Ga0496116_0002334 3300048919 Bacteria 20087
672 Ga0496117_0001068 3300048920 Bacteria 41562
673 Ga0496117_0001420 3300048920 Bacteria 34726
674 Ga0496117_0001484 3300048920 Bacteria 33643
675 Ga0496117_0003379 3300048920 Bacteria 18595
676 Ga0496117_0003579 3300048920 Bacteria 17931
677 Ga0496118_0000719 3300048921 Bacteria 53455
678 Ga0496118_0001160 3300048921 Bacteria 40619
679 Ga0496118_0001249 3300048921 Bacteria 39060
680 Ga0496118_0001496 3300048921 Bacteria 34894
681 Ga0496118_0002452 3300048921 Bacteria 24974
682 Ga0496118_0002549 3300048921 Bacteria 24408
683 Ga0496118_0003641 3300048921 Bacteria 19134
684 Ga0496118_0003682 3300048921 Bacteria 19006
685 Ga0496118_0006497 3300048921 Bacteria 12817
686 Ga0496118_0006654 3300048921 Bacteria 12613
687 Ga0496118_0018257 3300048921 Bacteria 6336
688 Ga0496119_0000094 3300048922 Bacteria 130089
689 Ga0496119_0000929 3300048922 Bacteria 37913
690 Ga0496119_0001859 3300048922 Bacteria 24380
691 Ga0496119_0002453 3300048922 Bacteria 20369
692 Ga0496120_0000013 3300048923 Bacteria 331109
693 Ga0496120_0000183 3300048923 Bacteria 106937
694 Ga0496120_0000839 3300048923 Bacteria 43743
695 Ga0496120_0000943 3300048923 Bacteria 39981
696 Ga0496120_0002147 3300048923 Bacteria 21033
697 Ga0496121_0000162 3300048924 Bacteria 145682
698 Ga0496121_0000403 3300048924 Bacteria 86293
699 Ga0496121_0000464 3300048924 Bacteria 79337
700 Ga0496121_0001456 3300048924 Bacteria 39986
701 Ga0496121_0001922 3300048924 Bacteria 33169
702 Ga0496121_0003492 3300048924 Bacteria 22370
703 Ga0496121_0006431 3300048924 Bacteria 14587
704 Ga0496121_0007118 3300048924 Bacteria 13577
705 Ga0496121_0031306 3300048924 Bacteria 4862
706 Ga0496122_0001331 3300048925 Bacteria 40422
707 Ga0496122_0001959 3300048925 Bacteria 30816
708 Ga0496122_0002854 3300048925 Bacteria 23661
709 Ga0496122_0003345 3300048925 Bacteria 21155
710 Ga0496122_0009868 3300048925 Bacteria 9953
711 Ga0496122_0020910 3300048925 Bacteria 5883
712 Ga0496122_0041374 3300048925 Bacteria 3644
713 Ga0496123_0000107 3300048926 Bacteria 166923
714 Ga0496123_0001677 3300048926 Bacteria 29647
715 Ga0496123_0002372 3300048926 Bacteria 23618
716 Ga0496123_0002721 3300048926 Bacteria 21201
717 Ga0496123_0003093 3300048926 Bacteria 19114
718 Ga0496123_0007280 3300048926 Bacteria 10504
719 Ga0496123_0018592 3300048926 Bacteria 5518
720 Ga0496123_0044558 3300048926 Bacteria 3032
721 Ga0496124_0000032 3300048927 Bacteria 332524
722 Ga0496124_0000844 3300048927 Bacteria 50021
723 Ga0496124_0001447 3300048927 Bacteria 35077
724 Ga0496124_0001753 3300048927 Bacteria 30327
725 Ga0496124_0001946 3300048927 Bacteria 28229
726 Ga0496124_0002067 3300048927 Bacteria 27205
727 Ga0496124_0003171 3300048927 Bacteria 20326
728 Ga0496124_0003791 3300048927 Bacteria 18160
729 Ga0496124_0003995 3300048927 Bacteria 17569
730 Ga0496124_0004289 3300048927 Bacteria 16749
731 Ga0496124_0004843 3300048927 Bacteria 15479
732 Ga0496125_0000435 3300048928 Bacteria 76312
733 Ga0496125_0003037 3300048928 Bacteria 20991
734 Ga0496125_0003210 3300048928 Bacteria 20186
735 Ga0496125_0004340 3300048928 Bacteria 16456
736 Ga0496125_0005558 3300048928 Bacteria 13942
737 Ga0496125_0008045 3300048928 Bacteria 11130
738 Ga0496125_0033060 3300048928 Bacteria 4584
739 Ga0496125_0077875 3300048928 Bacteria 2552
740 Ga0496126_0000301 3300048929 Bacteria 104981
741 Ga0496126_0000568 3300048929 Bacteria 70707
742 Ga0496126_0004357 3300048929 Bacteria 16974
743 Ga0496126_0026807 3300048929 Bacteria 5518
744 Ga0496126_0095419 3300048929 Bacteria 2609
745 Ga0496126_0103110 3300048929 Bacteria 2493
746 Ga0496126_0122343 3300048929 Bacteria 2255
747 Ga0495678_000321 3300049459 Bacteria 51252
748 Ga0501032_0021495 3300049569 Bacteria 4484
749 Ga0501032_0048657 3300049569 Bacteria 2862
750 Ga0501033_0002743 3300049570 Bacteria 14769
751 Ga0501037_0076632 3300049573 Bacteria 2427
752 Ga0501038_0046681 3300049574 Bacteria 3754
753 Ga0501039_0080576 3300049575 Bacteria 2533
754 Ga0501043_0041143 3300049579 Bacteria 3631
755 Ga0501048_0019221 3300049582 Bacteria 5016
756 Ga0501048_0024202 3300049582 Bacteria 4432
757 Ga0501067_0000058 3300049583 Bacteria 64397
758 Ga0501070_0004463 3300049586 Bacteria 12018
759 Ga0501070_0008874 3300049586 Bacteria 8497
760 Ga0501070_0011226 3300049586 Bacteria 7563
761 Ga0501070_0018570 3300049586 Bacteria 5832
762 Ga0501070_0064971 3300049586 Bacteria 3021
763 Ga0501071_0010063 3300049587 Bacteria 6321
764 Ga0501073_0000154 3300049589 Bacteria 45306
765 Ga0501074_0038428 3300049590 Bacteria 3468
766 Ga0501077_0000148 3300049593 Bacteria 38929
767 Ga0501077_0033537 3300049593 Bacteria 3268
768 Ga0501080_0009035 3300049742 Bacteria 9070
769 Ga0501080_0013459 3300049742 Bacteria 7526
770 Ga0501083_0000925 3300049744 Bacteria 19477
771 Ga0501035_0010503 3300049822 Bacteria 8579
772 Ga0501035_0069062 3300049822 Bacteria 3132
773 Ga0501044_0035501 3300049823 Bacteria 5220
774 Ga0501044_0074928 3300049823 Bacteria 3437
775 Ga0501044_0110617 3300049823 Bacteria 2756
776 Ga0501044_0117568 3300049823 Bacteria 2662
777 nmdc:mga05p37_21979_c1 3300050507 Bacteria 7728
778 nmdc:mga08y16_12695_c1 3300050511 Bacteria 8863
779 nmdc:mga08y16_7120_c1 3300050511 Bacteria 11738
780 nmdc:mga08y16_81919_c1 3300050511 Bacteria 3364
781 nmdc:mga08y16_96115_c1 3300050511 Bacteria 3085
782 nmdc:mga08x19_13309_c1 3300050514 Bacteria 4970
783 Ga0500643_000051 3300053087 Bacteria 145619
784 Ga0500643_000897 3300053087 Bacteria 18863
785 Ga0500651_0005237 3300053093 Bacteria 7388
786 Ga0500555_000953 3300053103 Bacteria 10062
787 Ga0500595_001986 3300053119 Bacteria 10496
788 Ga0500595_006184 3300053119 Bacteria 5120
789 Ga0500597_000488 3300053120 Bacteria 8453
790 Ga0500559_0017948 3300053136 Bacteria 2991
791 Ga0500634_0000094 3300053161 Bacteria 34789
792 Ga0500637_0036552 3300053178 Unclassified 2758
793 Ga0500645_002198 3300053730 Bacteria 8922
794 Ga0500645_004384 3300053730 Bacteria 5426
795 Ga0466962_0001688 3300061719 Bacteria 10360
796 Ga0466962_0004875 3300061719 Bacteria 6454

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002067 JGI24735J21928_10009465 JGI24735J21928_100094653 552
2 3300025912 Ga0207707_10019320 Ga0207707_100193202 558
3 3300025926 Ga0207659_10008284 Ga0207659_100082843 565
4 3300038443 Ga0395901_0221620 Ga0395901_0221620_231_1934 565
5 3300009098 Ga0105245_10008344 Ga0105245_100083443 572
6 3300013297 Ga0157378_10118007 Ga0157378_101180072 572
7 3300025927 Ga0207687_10011627 Ga0207687_100116273 572
8 3300053136 Ga0500559_0017948 Ga0500559_0017948_1044_2963 582
9 3300005842 Ga0068858_100000132 Ga0068858_10000013275 584
10 3300026035 Ga0207703_10000753 Ga0207703_100007538 584
11 3300048924 Ga0496121_0001456 Ga0496121_0001456_26885_28735 584
12 3300021388 Ga0213875_10010605 Ga0213875_100106053 586
13 3300037853 Ga0436364_0644604 Ga0436364_0644604_620_2533 586
14 3300048915 Ga0496112_0004629 Ga0496112_0004629_8671_10479 586
15 3300005844 Ga0068862_100091506 Ga0068862_1000915062 588
16 3300005327 Ga0070658_10003827 Ga0070658_100038277 589
17 3300039447 Ga0436361_0714695 Ga0436361_0714695_958_2760 589
18 3300005455 Ga0070663_100043261 Ga0070663_1000432612 590
19 3300009177 Ga0105248_10000244 Ga0105248_1000024457 592
20 3300013306 Ga0163162_10001968 Ga0163162_1000196810 592
21 3300013308 Ga0157375_10000216 Ga0157375_100002167 592
22 3300014326 Ga0157380_10104227 Ga0157380_101042271 592
23 3300014968 Ga0157379_10000091 Ga0157379_1000009111 592
24 3300014969 Ga0157376_10027808 Ga0157376_100278083 592
25 3300046689 Ga0495613_0028717 Ga0495613_0028717_1545_3332 592
26 3300048913 Ga0496110_0041447 Ga0496110_0041447_1822_3609 592
27 3300050511 nmdc:mga08y16_12695_c1 nmdc:mga08y16_12695_c1_6027_7814 592
28 3300005563 Ga0068855_100000601 Ga0068855_10000060144 593
29 3300009545 Ga0105237_10167622 Ga0105237_101676221 593
30 3300025949 Ga0207667_10000134 Ga0207667_10000134114 593
31 3300005455 Ga0070663_100010476 Ga0070663_1000104763 595
32 3300025949 Ga0207667_10033996 Ga0207667_100339965 595
33 3300026067 Ga0207678_10022401 Ga0207678_100224015 595
34 3300035695 Ga0373927_0000200 Ga0373927_0000200_32994_34913 598
35 3300037068 Ga0373925_0000032 Ga0373925_0000032_43460_45379 598
36 3300005347 Ga0070668_100047749 Ga0070668_1000477492 600
37 3300009093 Ga0105240_10040933 Ga0105240_100409337 600
38 3300025913 Ga0207695_10030334 Ga0207695_100303347 600
39 3300005578 Ga0068854_100000002 Ga0068854_100000002346 601
40 3300020070 Ga0206356_10268222 Ga0206356_1026822211 601
41 3300025981 Ga0207640_10000003 Ga0207640_10000003454 601
42 3300035695 Ga0373927_0003547 Ga0373927_0003547_6232_8085 601
43 3300044842 Ga0466957_0014329 Ga0466957_0014329_218_2137 601
44 3300045049 Ga0466959_0041762 Ga0466959_0041762_135_2162 601
45 3300045836 Ga0466958_0013819 Ga0466958_0013819_2357_4384 601
46 3300061719 Ga0466962_0001688 Ga0466962_0001688_583_2610 601
47 3300005458 Ga0070681_10006795 Ga0070681_100067952 602
48 3300006358 Ga0068871_100089700 Ga0068871_1000897002 602
49 3300044683 Ga0466965_0001607 Ga0466965_0001607_252_2231 602
50 3300005335 Ga0070666_10000008 Ga0070666_10000008172 603
51 3300005843 Ga0068860_100036499 Ga0068860_1000364995 603
52 3300009094 Ga0111539_10007836 Ga0111539_100078366 603
53 3300009551 Ga0105238_10000335 Ga0105238_1000033539 603
54 3300013306 Ga0163162_10013318 Ga0163162_100133187 603
55 3300013308 Ga0157375_10015954 Ga0157375_100159546 603
56 3300014326 Ga0157380_10026626 Ga0157380_100266263 603
57 3300025903 Ga0207680_10000005 Ga0207680_1000000568 603
58 3300025912 Ga0207707_10032484 Ga0207707_100324844 603
59 3300025924 Ga0207694_10006773 Ga0207694_100067734 603
60 3300026116 Ga0207674_10105795 Ga0207674_101057951 603
61 3300028379 Ga0268266_10000051 Ga0268266_1000005165 603
62 3300050511 nmdc:mga08y16_81919_c1 nmdc:mga08y16_81919_c1_72_1907 603
63 3300047472 Ga0495686_0000007 Ga0495686_0000007_23910_25847 604
64 3300047472 Ga0495686_0012040 Ga0495686_0012040_3698_5635 604
65 3300048919 Ga0496116_0000045 Ga0496116_0000045_140385_142328 604
66 3300048921 Ga0496118_0018257 Ga0496118_0018257_866_2809 604
67 3300048925 Ga0496122_0009868 Ga0496122_0009868_7358_9301 604
68 3300048926 Ga0496123_0003093 Ga0496123_0003093_14996_16939 604
69 3300048927 Ga0496124_0003171 Ga0496124_0003171_7412_9355 604
70 3300048928 Ga0496125_0003210 Ga0496125_0003210_11548_13491 604
71 3300048929 Ga0496126_0000568 Ga0496126_0000568_5031_6974 604
72 3300006881 Ga0068865_100008576 Ga0068865_1000085764 605
73 3300010375 Ga0105239_10032770 Ga0105239_100327702 605
74 3300025912 Ga0207707_10005096 Ga0207707_100050965 605
75 3300031824 Ga0307413_10001009 Ga0307413_100010095 605
76 3300037312 Ga0395899_0036795 Ga0395899_0036795_1544_3442 605
77 3300048921 Ga0496118_0000719 Ga0496118_0000719_19581_21452 606
78 3300048927 Ga0496124_0000844 Ga0496124_0000844_10227_12170 606
79 3300048929 Ga0496126_0000301 Ga0496126_0000301_71107_72978 606
80 3300005439 Ga0070711_100028503 Ga0070711_1000285032 607
81 3300049823 Ga0501044_0074928 Ga0501044_0074928_38_1897 607
82 3300053730 Ga0500645_002198 Ga0500645_002198_4421_6346 607
83 3300003791 Ga0055530_10001287 Ga0055530_100012872 608
84 3300005353 Ga0070669_100000003 Ga0070669_100000003137 608
85 3300025923 Ga0207681_10000007 Ga0207681_1000000785 608
86 3300046501 Ga0495607_0000008 Ga0495607_0000008_129145_131028 608
87 3300049744 Ga0501083_0000925 Ga0501083_0000925_14142_16034 608
88 3300005366 Ga0070659_100000645 Ga0070659_10000064511 609
89 3300005445 Ga0070708_100011892 Ga0070708_1000118922 609
90 3300005536 Ga0070697_100012911 Ga0070697_1000129111 609
91 3300005617 Ga0068859_100182488 Ga0068859_1001824881 609
92 3300006931 Ga0097620_100182478 Ga0097620_1001824782 609
93 3300013105 Ga0157369_10107685 Ga0157369_101076852 609
94 3300021384 Ga0213876_10000303 Ga0213876_100003037 609
95 3300025932 Ga0207690_10041998 Ga0207690_100419981 609
96 3300031901 Ga0307406_10012231 Ga0307406_100122314 609
97 3300036401 Ga0373937_0019790 Ga0373937_0019790_1654_3564 609
98 3300037471 Ga0395905_0053804 Ga0395905_0053804_1386_3311 609
99 3300039437 Ga0436365_0854233 Ga0436365_0854233_19360_21261 609
100 3300039447 Ga0436361_0965373 Ga0436361_0965373_2816_4735 609
101 3300048918 Ga0496115_0024016 Ga0496115_0024016_1194_3149 609
102 3300005458 Ga0070681_10001772 Ga0070681_100017725 610
103 3300009093 Ga0105240_10039957 Ga0105240_100399573 610
104 3300009551 Ga0105238_10033452 Ga0105238_100334522 610
105 3300021361 Ga0213872_10009756 Ga0213872_100097561 610
106 3300025913 Ga0207695_10017563 Ga0207695_100175637 610
107 3300037312 Ga0395899_0092174 Ga0395899_0092174_17_1915 610
108 3300037418 Ga0395900_0047107 Ga0395900_0047107_2524_4422 610
109 3300037466 Ga0395898_0063376 Ga0395898_0063376_1372_3270 610
110 3300038443 Ga0395901_0019340 Ga0395901_0019340_17_1915 610
111 3300046471 Ga0495650_0000027 Ga0495650_0000027_356785_358683 610
112 3300005340 Ga0070689_100016611 Ga0070689_1000166113 611
113 3300005471 Ga0070698_100018240 Ga0070698_1000182402 611
114 3300005518 Ga0070699_100120221 Ga0070699_1001202211 611
115 3300006871 Ga0075434_100044197 Ga0075434_1000441972 611
116 3300006914 Ga0075436_100017086 Ga0075436_1000170863 611
117 3300009147 Ga0114129_10002885 Ga0114129_1000288513 611
118 3300025910 Ga0207684_10009533 Ga0207684_100095335 611
119 3300041462 Ga0451806_541229 Ga0451806_541229_5670_7514 611
120 3300041463 Ga0451804_0812598 Ga0451804_0812598_24_1868 611
121 3300041486 Ga0451807_2369243 Ga0451807_2369243_2090_3934 611
122 3300050507 nmdc:mga05p37_21979_c1 nmdc:mga05p37_21979_c1_5025_6941 611
123 3300050514 nmdc:mga08x19_13309_c1 nmdc:mga08x19_13309_c1_1581_3497 611
124 3300005548 Ga0070665_100000132 Ga0070665_10000013298 612
125 3300021361 Ga0213872_10000601 Ga0213872_1000060123 612
126 3300028379 Ga0268266_10002151 Ga0268266_1000215110 612
127 3300039447 Ga0436361_0713206 Ga0436361_0713206_17763_19694 612
128 3300048925 Ga0496122_0002854 Ga0496122_0002854_21102_23021 612
129 3300048926 Ga0496123_0044558 Ga0496123_0044558_703_2622 612
130 3300050511 nmdc:mga08y16_96115_c1 nmdc:mga08y16_96115_c1_135_2060 612
131 3300005262 Ga0065165_1006565 Ga0065165_10065653 613
132 3300005330 Ga0070690_100028447 Ga0070690_1000284472 613
133 3300005337 Ga0070682_100057224 Ga0070682_1000572242 613
134 3300025225 Ga0209566_102982 Ga0209566_1029821 613
135 3300025233 Ga0209437_101348 Ga0209437_1013483 613
136 3300025912 Ga0207707_10030671 Ga0207707_100306713 613
137 3300035241 Ga0373961_0000030 Ga0373961_0000030_16211_18115 613
138 3300037312 Ga0395899_0017397 Ga0395899_0017397_1267_3228 613
139 3300037466 Ga0395898_0110031 Ga0395898_0110031_184_2145 613
140 3300038443 Ga0395901_0047331 Ga0395901_0047331_2288_4249 613
141 3300048929 Ga0496126_0095419 Ga0496126_0095419_14_1891 613
142 3300002737 JGI25162J39368_1000580 JGI25162J39368_100058012 614
143 3300002737 JGI25162J39368_1000830 JGI25162J39368_100083012 614
144 3300002772 JGI25164J39214_1000354 JGI25164J39214_100035412 614
145 3300002772 JGI25164J39214_1002298 JGI25164J39214_10022982 614
146 3300005336 Ga0070680_100001023 Ga0070680_1000010238 614
147 3300005354 Ga0070675_100000102 Ga0070675_10000010233 614
148 3300005355 Ga0070671_100004985 Ga0070671_1000049855 614
149 3300005364 Ga0070673_100003087 Ga0070673_1000030875 614
150 3300005367 Ga0070667_100007898 Ga0070667_1000078985 614
151 3300005435 Ga0070714_100000285 Ga0070714_10000028514 614
152 3300005435 Ga0070714_100011841 Ga0070714_1000118415 614
153 3300005435 Ga0070714_100042692 Ga0070714_1000426922 614
154 3300005436 Ga0070713_100002100 Ga0070713_1000021008 614
155 3300005458 Ga0070681_10002905 Ga0070681_100029058 614
156 3300005466 Ga0070685_10001037 Ga0070685_100010378 614
157 3300005530 Ga0070679_100001316 Ga0070679_10000131611 614
158 3300005543 Ga0070672_100015022 Ga0070672_1000150223 614
159 3300005617 Ga0068859_100001612 Ga0068859_1000016123 614
160 3300005618 Ga0068864_100055268 Ga0068864_1000552682 614
161 3300005841 Ga0068863_100002479 Ga0068863_10000247911 614
162 3300005843 Ga0068860_100003593 Ga0068860_1000035934 614
163 3300006358 Ga0068871_100068095 Ga0068871_1000680952 614
164 3300006931 Ga0097620_100001612 Ga0097620_1000016123 614
165 3300009093 Ga0105240_10002793 Ga0105240_1000279318 614
166 3300009545 Ga0105237_10151898 Ga0105237_101518981 614
167 3300009551 Ga0105238_10003689 Ga0105238_1000368913 614
168 3300013104 Ga0157370_10001344 Ga0157370_1000134413 614
169 3300013105 Ga0157369_10041194 Ga0157369_100411943 614
170 3300013307 Ga0157372_10030736 Ga0157372_100307365 614
171 3300021361 Ga0213872_10002289 Ga0213872_100022896 614
172 3300025231 Ga0207427_100044 Ga0207427_10004460 614
173 3300025231 Ga0207427_100088 Ga0207427_10008859 614
174 3300025231 Ga0207427_100191 Ga0207427_10019112 614
175 3300025233 Ga0209437_100005 Ga0209437_100005316 614
176 3300025233 Ga0209437_100167 Ga0209437_10016761 614
177 3300025261 Ga0209233_1000011 Ga0209233_1000011625 614
178 3300025261 Ga0209233_1000046 Ga0209233_100004661 614
179 3300025903 Ga0207680_10048918 Ga0207680_100489182 614
180 3300025904 Ga0207647_10008443 Ga0207647_100084436 614
181 3300025909 Ga0207705_10011802 Ga0207705_100118023 614
182 3300025912 Ga0207707_10000267 Ga0207707_1000026711 614
183 3300025913 Ga0207695_10012442 Ga0207695_100124427 614
184 3300025919 Ga0207657_10080404 Ga0207657_100804041 614
185 3300025926 Ga0207659_10000802 Ga0207659_100008023 614
186 3300025928 Ga0207700_10019467 Ga0207700_100194673 614
187 3300025929 Ga0207664_10000092 Ga0207664_1000009217 614
188 3300025929 Ga0207664_10001368 Ga0207664_100013685 614
189 3300025931 Ga0207644_10008561 Ga0207644_100085613 614
190 3300025932 Ga0207690_10012171 Ga0207690_100121713 614
191 3300025932 Ga0207690_10032344 Ga0207690_100323441 614
192 3300025933 Ga0207706_10039256 Ga0207706_100392563 614
193 3300025941 Ga0207711_10004808 Ga0207711_100048088 614
194 3300025949 Ga0207667_10010193 Ga0207667_100101937 614
195 3300025949 Ga0207667_10097354 Ga0207667_100973543 614
196 3300025986 Ga0207658_10014695 Ga0207658_100146953 614
197 3300026088 Ga0207641_10001423 Ga0207641_100014234 614
198 3300026095 Ga0207676_10068299 Ga0207676_100682992 614
199 3300028381 Ga0268264_10003055 Ga0268264_100030555 614
200 3300031911 Ga0307412_10002015 Ga0307412_100020155 614
201 3300038443 Ga0395901_0000435 Ga0395901_0000435_14899_16797 614
202 3300039447 Ga0436361_0519031 Ga0436361_0519031_2371_4290 614
203 3300045836 Ga0466958_0001258 Ga0466958_0001258_6393_8315 614
204 3300002741 JGI25157J39369_1000659 JGI25157J39369_10006593 615
205 3300005546 Ga0070696_100013399 Ga0070696_1000133992 615
206 3300025250 Ga0209026_1000010 Ga0209026_1000010279 615
207 3300025297 Ga0209758_1000696 Ga0209758_100069630 615
208 3300025298 Ga0209050_1000141 Ga0209050_100014122 615
209 3300025304 Ga0209257_1000636 Ga0209257_100063639 615
210 3300033180 Ga0307510_10002809 Ga0307510_1000280915 615
211 3300005455 Ga0070663_100018862 Ga0070663_1000188625 616
212 3300005457 Ga0070662_100007301 Ga0070662_1000073014 616
213 3300005466 Ga0070685_10001192 Ga0070685_1000119213 616
214 3300005548 Ga0070665_100001521 Ga0070665_1000015219 616
215 3300005578 Ga0068854_100060028 Ga0068854_1000600281 616
216 3300005616 Ga0068852_100085078 Ga0068852_1000850783 616
217 3300005841 Ga0068863_100105737 Ga0068863_1001057372 616
218 3300005842 Ga0068858_100006090 Ga0068858_1000060908 616
219 3300005842 Ga0068858_100018210 Ga0068858_1000182104 616
220 3300005843 Ga0068860_100000771 Ga0068860_1000007716 616
221 3300006881 Ga0068865_100035847 Ga0068865_1000358473 616
222 3300009093 Ga0105240_10003217 Ga0105240_100032177 616
223 3300009101 Ga0105247_10012918 Ga0105247_100129183 616
224 3300009545 Ga0105237_10128855 Ga0105237_101288552 616
225 3300025904 Ga0207647_10000019 Ga0207647_1000001949 616
226 3300025913 Ga0207695_10000014 Ga0207695_10000014244 616
227 3300025914 Ga0207671_10024108 Ga0207671_100241083 616
228 3300025924 Ga0207694_10001535 Ga0207694_1000153516 616
229 3300025924 Ga0207694_10016576 Ga0207694_100165764 616
230 3300025933 Ga0207706_10003006 Ga0207706_1000300617 616
231 3300025981 Ga0207640_10006300 Ga0207640_100063003 616
232 3300026035 Ga0207703_10000590 Ga0207703_100005903 616
233 3300026035 Ga0207703_10006133 Ga0207703_100061334 616
234 3300026041 Ga0207639_10000117 Ga0207639_1000011744 616
235 3300026067 Ga0207678_10020176 Ga0207678_1002017610 616
236 3300026078 Ga0207702_10036900 Ga0207702_100369002 616
237 3300026116 Ga0207674_10074079 Ga0207674_100740792 616
238 3300028379 Ga0268266_10000007 Ga0268266_10000007518 616
239 3300028381 Ga0268264_10000102 Ga0268264_10000102141 616
240 3300028563 Ga0265319_1005768 Ga0265319_10057683 616
241 3300048921 Ga0496118_0006654 Ga0496118_0006654_7431_9314 616
242 3300048928 Ga0496125_0004340 Ga0496125_0004340_11428_13473 616
243 3300053178 Ga0500637_0036552 Ga0500637_0036552_21_1943 616
244 iso_pu_bacteria 2818991438 2819551254 616
245 3300005262 Ga0065165_1000532 Ga0065165_100053231 617
246 3300005336 Ga0070680_100081681 Ga0070680_1000816812 617
247 3300005577 Ga0068857_100074675 Ga0068857_1000746752 617
248 3300009093 Ga0105240_10000049 Ga0105240_1000004926 617
249 3300009093 Ga0105240_10000368 Ga0105240_1000036847 617
250 3300009093 Ga0105240_10000624 Ga0105240_1000062431 617
251 3300009093 Ga0105240_10068042 Ga0105240_100680421 617
252 3300009177 Ga0105248_10045312 Ga0105248_100453122 617
253 3300010375 Ga0105239_10000070 Ga0105239_1000007097 617
254 3300010375 Ga0105239_10000967 Ga0105239_1000096716 617
255 3300025207 Ga0209760_100243 Ga0209760_10024313 617
256 3300025224 Ga0209784_100043 Ga0209784_10004374 617
257 3300025231 Ga0207427_100087 Ga0207427_10008774 617
258 3300025233 Ga0209437_100173 Ga0209437_10017374 617
259 3300025242 Ga0209258_100092 Ga0209258_100092145 617
260 3300025250 Ga0209026_1000112 Ga0209026_100011274 617
261 3300025254 Ga0209148_1000047 Ga0209148_1000047342 617
262 3300025261 Ga0209233_1000179 Ga0209233_100017975 617
263 3300025272 Ga0209455_1000056 Ga0209455_1000056266 617
264 3300025912 Ga0207707_10008813 Ga0207707_100088133 617
265 3300025913 Ga0207695_10000100 Ga0207695_10000100141 617
266 3300025913 Ga0207695_10000704 Ga0207695_1000070429 617
267 3300044656 Ga0466969_0004902 Ga0466969_0004902_2915_4873 617
268 3300044684 Ga0466966_0021019 Ga0466966_0021019_1631_3589 617
269 3300044719 Ga0466971_0012675 Ga0466971_0012675_214_2172 617
270 3300044765 Ga0466970_0011483 Ga0466970_0011483_1861_3819 617
271 3300045836 Ga0466958_0026423 Ga0466958_0026423_904_2862 617
272 3300048907 Ga0496104_0053871 Ga0496104_0053871_802_2673 617
273 3300048908 Ga0496105_0008153 Ga0496105_0008153_1391_3262 617
274 3300048920 Ga0496117_0003579 Ga0496117_0003579_1574_3445 617
275 3300048921 Ga0496118_0002549 Ga0496118_0002549_11916_13787 617
276 3300048922 Ga0496119_0000094 Ga0496119_0000094_103783_105654 617
277 3300048922 Ga0496119_0001859 Ga0496119_0001859_13378_15249 617
278 3300048923 Ga0496120_0000013 Ga0496120_0000013_225412_227283 617
279 3300048923 Ga0496120_0000183 Ga0496120_0000183_69276_71147 617
280 3300048924 Ga0496121_0000162 Ga0496121_0000162_121892_123763 617
281 3300049823 Ga0501044_0110617 Ga0501044_0110617_777_2669 617
282 3300053119 Ga0500595_006184 Ga0500595_006184_88_2067 617
283 3300003781 Ga0055536_1003537 Ga0055536_10035373 618
284 3300005337 Ga0070682_100018605 Ga0070682_1000186052 618
285 3300005366 Ga0070659_100021687 Ga0070659_1000216871 618
286 3300005563 Ga0068855_100017609 Ga0068855_1000176094 618
287 3300005578 Ga0068854_100003804 Ga0068854_1000038045 618
288 3300013100 Ga0157373_10011039 Ga0157373_100110393 618
289 3300013104 Ga0157370_10039001 Ga0157370_100390012 618
290 3300025292 Ga0209676_1000182 Ga0209676_10001824 618
291 3300025304 Ga0209257_1000484 Ga0209257_10004845 618
292 3300025932 Ga0207690_10044971 Ga0207690_100449711 618
293 3300025949 Ga0207667_10080129 Ga0207667_100801292 618
294 3300037312 Ga0395899_0004280 Ga0395899_0004280_996_2894 618
295 3300037418 Ga0395900_0001660 Ga0395900_0001660_6511_8409 618
296 3300037466 Ga0395898_0008566 Ga0395898_0008566_3242_5218 618
297 3300038443 Ga0395901_0007887 Ga0395901_0007887_8762_10660 618
298 3300038443 Ga0395901_0015375 Ga0395901_0015375_173_2149 618
299 3300039447 Ga0436361_0169760 Ga0436361_0169760_4106_6016 618
300 3300005295 Ga0065707_10084906 Ga0065707_100849062 619
301 3300005327 Ga0070658_10005565 Ga0070658_100055653 619
302 3300005336 Ga0070680_100003859 Ga0070680_1000038597 619
303 3300005340 Ga0070689_100013250 Ga0070689_1000132506 619
304 3300005344 Ga0070661_100000592 Ga0070661_1000005922 619
305 3300005366 Ga0070659_100001854 Ga0070659_1000018546 619
306 3300005367 Ga0070667_100000238 Ga0070667_10000023810 619
307 3300005530 Ga0070679_100000992 Ga0070679_1000009924 619
308 3300005535 Ga0070684_100022717 Ga0070684_1000227174 619
309 3300005539 Ga0068853_100000191 Ga0068853_1000001912 619
310 3300005564 Ga0070664_100001090 Ga0070664_1000010904 619
311 3300005577 Ga0068857_100023963 Ga0068857_1000239633 619
312 3300005614 Ga0068856_100024504 Ga0068856_1000245045 619
313 3300005617 Ga0068859_100001584 Ga0068859_10000158417 619
314 3300005843 Ga0068860_100008839 Ga0068860_10000883910 619
315 3300006931 Ga0097620_100001584 Ga0097620_10000158417 619
316 3300013100 Ga0157373_10038130 Ga0157373_100381303 619
317 3300013102 Ga0157371_10003102 Ga0157371_1000310210 619
318 3300013105 Ga0157369_10031478 Ga0157369_100314783 619
319 3300025917 Ga0207660_10006597 Ga0207660_100065974 619
320 3300025920 Ga0207649_10001942 Ga0207649_100019426 619
321 3300025926 Ga0207659_10004529 Ga0207659_100045297 619
322 3300025932 Ga0207690_10000768 Ga0207690_1000076822 619
323 3300025933 Ga0207706_10000898 Ga0207706_100008987 619
324 3300025936 Ga0207670_10016152 Ga0207670_100161522 619
325 3300025949 Ga0207667_10064449 Ga0207667_100644493 619
326 3300025981 Ga0207640_10011194 Ga0207640_100111942 619
327 3300026088 Ga0207641_10006026 Ga0207641_100060263 619
328 3300030521 Ga0307511_10009921 Ga0307511_100099213 619
329 3300036401 Ga0373937_0021549 Ga0373937_0021549_1495_3435 619
330 3300046500 Ga0495596_0000154 Ga0495596_0000154_9310_11253 619
331 3300046512 Ga0495610_0001741 Ga0495610_0001741_1855_3798 619
332 3300048926 Ga0496123_0007280 Ga0496123_0007280_4402_6396 619
333 3300048928 Ga0496125_0008045 Ga0496125_0008045_4272_6215 619
334 3300048910 Ga0496107_0092688 Ga0496107_0092688_265_2193 620
335 3300048923 Ga0496120_0000839 Ga0496120_0000839_21903_23945 620
336 iso_pu_bacteria 2916178963 2916182433 620
337 3300005548 Ga0070665_100070395 Ga0070665_1000703951 621
338 3300006237 Ga0097621_100037884 Ga0097621_1000378843 621
339 3300006846 Ga0075430_100076585 Ga0075430_1000765851 621
340 3300021361 Ga0213872_10003100 Ga0213872_100031005 621
341 3300021361 Ga0213872_10004729 Ga0213872_100047295 621
342 3300021361 Ga0213872_10008108 Ga0213872_100081085 621
343 3300021361 Ga0213872_10029877 Ga0213872_100298772 621
344 3300026088 Ga0207641_10000491 Ga0207641_1000049117 621
345 3300033180 Ga0307510_10000707 Ga0307510_100007079 621
346 3300039447 Ga0436361_0110651 Ga0436361_0110651_1974_3893 621
347 3300039447 Ga0436361_0201010 Ga0436361_0201010_823_2751 621
348 3300039447 Ga0436361_0252460 Ga0436361_0252460_4232_6151 621
349 3300046471 Ga0495650_0000465 Ga0495650_0000465_4320_6203 621
350 3300046539 Ga0495621_0002958 Ga0495621_0002958_2179_4104 621
351 3300046660 Ga0495625_0023682 Ga0495625_0023682_314_2197 621
352 3300047318 Ga0495636_0023614 Ga0495636_0023614_436_2361 621
353 3300050511 nmdc:mga08y16_7120_c1 nmdc:mga08y16_7120_c1_7788_9710 621
354 iso_pu_bacteria 2857442823 2857442992 621
355 iso_pu_bacteria 2941485952 2941486913 621
356 3300005327 Ga0070658_10000632 Ga0070658_1000063216 622
357 3300005335 Ga0070666_10000020 Ga0070666_10000020160 622
358 3300005344 Ga0070661_100046241 Ga0070661_1000462412 622
359 3300005367 Ga0070667_100015414 Ga0070667_1000154147 622
360 3300005466 Ga0070685_10002768 Ga0070685_100027688 622
361 3300005548 Ga0070665_100003317 Ga0070665_10000331712 622
362 3300009551 Ga0105238_10000145 Ga0105238_1000014553 622
363 3300013306 Ga0163162_10006577 Ga0163162_100065773 622
364 3300025903 Ga0207680_10000001 Ga0207680_10000001962 622
365 3300025909 Ga0207705_10000641 Ga0207705_1000064114 622
366 3300025920 Ga0207649_10017407 Ga0207649_100174074 622
367 3300025924 Ga0207694_10001078 Ga0207694_1000107820 622
368 3300025986 Ga0207658_10009737 Ga0207658_100097373 622
369 3300028379 Ga0268266_10000067 Ga0268266_1000006768 622
370 3300048924 Ga0496121_0031306 Ga0496121_0031306_2810_4696 622
371 3300048929 Ga0496126_0103110 Ga0496126_0103110_383_2269 622
372 iso_pu_bacteria 2537561836 2538832072 622
373 iso_pu_bacteria 2643221562 2643828837 622
374 iso_pu_bacteria 2643221577 2643896652 622
375 iso_pu_bacteria 2643221685 2644478598 622
376 iso_pu_bacteria 2739367700 2739732828 622
377 iso_pu_bacteria 2747842501 2748017181 622
378 iso_pu_bacteria 2848694841 2848700144 622
379 iso_pu_bacteria 2852649853 2852651519 622
380 iso_pu_bacteria 2884411467 2884414214 622
381 iso_pu_bacteria 2895395659 2895395894 622
382 iso_pu_bacteria 2928963466 2928966454 622
383 iso_pu_bacteria 2939611941 2939613411 622
384 iso_pu_bacteria 2941475908 2941476947 622
385 3300003794 Ga0055531_10013620 Ga0055531_100136204 623
386 3300005439 Ga0070711_100015889 Ga0070711_1000158893 623
387 3300014497 Ga0182008_10002859 Ga0182008_100028595 623
388 3300015261 Ga0182006_1000098 Ga0182006_100009810 623
389 3300025304 Ga0209257_1000180 Ga0209257_100018069 623
390 3300031911 Ga0307412_10002443 Ga0307412_100024435 623
391 3300041404 Ga0439436_0000003 Ga0439436_0000003_83842_85725 623
392 3300042184 Ga0450908_000296 Ga0450908_000296_6702_8585 623
393 3300046691 Ga0495670_0001095 Ga0495670_0001095_1750_3633 623
394 3300048925 Ga0496122_0001331 Ga0496122_0001331_16337_18259 623
395 3300048926 Ga0496123_0000107 Ga0496123_0000107_129169_131091 623
396 3300053087 Ga0500643_000897 Ga0500643_000897_1504_3426 623
397 3300053120 Ga0500597_000488 Ga0500597_000488_3444_5366 623
398 iso_pu_bacteria 2576861471 2578459159 623
399 iso_pu_bacteria 2593339238 2595449254 623
400 iso_pu_bacteria 2593339239 2595450544 623
401 iso_pu_bacteria 2643221574 2643884801 623
402 iso_pu_bacteria 2643221663 2644353735 623
403 iso_pu_bacteria 2643221699 2644548500 623
404 iso_pu_bacteria 2643221699 2644550762 623
405 iso_pu_bacteria 2687453130 2687581440 623
406 iso_pu_bacteria 2718218334 2721029276 623
407 iso_pu_bacteria 2734482264 2735835126 623
408 iso_pu_bacteria 2738543009 2739228986 623
409 iso_pu_bacteria 2818991440 2819566399 623
410 iso_pu_bacteria 2842757796 2842759375 623
411 iso_pu_bacteria 2842780639 2842783590 623
412 iso_pu_bacteria 2842914999 2842916813 623
413 iso_pu_bacteria 2842918807 2842922560 623
414 iso_pu_bacteria 2884338543 2884342475 623
415 iso_pu_bacteria 2904463128 2904467028 623
416 iso_pu_bacteria 2919085039 2919088138 623
417 iso_pu_bacteria 2919130084 2919130405 623
418 iso_pu_bacteria 2919404418 2919407532 623
419 iso_pu_bacteria 2939589442 2939592224 623
420 iso_pu_bacteria 2939622612 2939625070 623
421 iso_pu_bacteria 2953994433 2953996731 623
422 iso_pu_bacteria 2974307012 2974309599 623
423 iso_pu_bacteria 2977247770 2977250346 623
424 iso_pu_bacteria 2984514374 2984515188 623
425 3300005330 Ga0070690_100001336 Ga0070690_1000013361 624
426 3300005331 Ga0070670_100008001 Ga0070670_1000080013 624
427 3300005344 Ga0070661_100020478 Ga0070661_1000204782 624
428 3300005355 Ga0070671_100010066 Ga0070671_1000100662 624
429 3300005367 Ga0070667_100000012 Ga0070667_100000012147 624
430 3300005367 Ga0070667_100005776 Ga0070667_1000057765 624
431 3300005455 Ga0070663_100000126 Ga0070663_10000012620 624
432 3300005539 Ga0068853_100001170 Ga0068853_1000011708 624
433 3300005543 Ga0070672_100005812 Ga0070672_1000058124 624
434 3300005564 Ga0070664_100001813 Ga0070664_10000181312 624
435 3300009177 Ga0105248_10000179 Ga0105248_1000017938 624
436 3300009177 Ga0105248_10002189 Ga0105248_1000218911 624
437 3300009553 Ga0105249_10000262 Ga0105249_1000026239 624
438 3300013308 Ga0157375_10013933 Ga0157375_100139335 624
439 3300014325 Ga0163163_10074753 Ga0163163_100747531 624
440 3300025913 Ga0207695_10000114 Ga0207695_10000114128 624
441 3300025920 Ga0207649_10011905 Ga0207649_100119052 624
442 3300025925 Ga0207650_10001635 Ga0207650_1000163513 624
443 3300025940 Ga0207691_10011979 Ga0207691_100119795 624
444 3300025941 Ga0207711_10000406 Ga0207711_100004062 624
445 3300025941 Ga0207711_10040247 Ga0207711_100402474 624
446 3300025945 Ga0207679_10001906 Ga0207679_100019062 624
447 3300025961 Ga0207712_10000215 Ga0207712_1000021511 624
448 3300025986 Ga0207658_10000027 Ga0207658_10000027104 624
449 3300025986 Ga0207658_10027601 Ga0207658_100276014 624
450 3300026067 Ga0207678_10004533 Ga0207678_100045332 624
451 3300026095 Ga0207676_10001405 Ga0207676_100014059 624
452 3300046514 Ga0495618_0026351 Ga0495618_0026351_174_2099 624
453 3300047319 Ga0495674_0077234 Ga0495674_0077234_553_2478 624
454 3300048921 Ga0496118_0003641 Ga0496118_0003641_14940_16892 624
455 3300048928 Ga0496125_0005558 Ga0496125_0005558_10952_12826 624
456 iso_pu_bacteria 2929195423 2929198587 624
457 3300002705 JGI25156J39149_1005622 JGI25156J39149_10056223 625
458 3300002741 JGI25157J39369_1000719 JGI25157J39369_10007197 625
459 3300005336 Ga0070680_100000757 Ga0070680_1000007572 625
460 3300005341 Ga0070691_10000173 Ga0070691_100001732 625
461 3300005341 Ga0070691_10008356 Ga0070691_100083562 625
462 3300005354 Ga0070675_100039998 Ga0070675_1000399983 625
463 3300005458 Ga0070681_10001214 Ga0070681_1000121415 625
464 3300005530 Ga0070679_100001076 Ga0070679_10000107617 625
465 3300005546 Ga0070696_100014957 Ga0070696_1000149572 625
466 3300005563 Ga0068855_100087040 Ga0068855_1000870402 625
467 3300005841 Ga0068863_100041259 Ga0068863_1000412593 625
468 3300006237 Ga0097621_100051245 Ga0097621_1000512452 625
469 3300009093 Ga0105240_10057086 Ga0105240_100570862 625
470 3300009174 Ga0105241_10027712 Ga0105241_100277122 625
471 3300009551 Ga0105238_10020116 Ga0105238_100201162 625
472 3300013307 Ga0157372_10021320 Ga0157372_100213202 625
473 3300014325 Ga0163163_10087332 Ga0163163_100873322 625
474 3300025250 Ga0209026_1000081 Ga0209026_100008153 625
475 3300025256 Ga0209759_1000468 Ga0209759_100046834 625
476 3300025904 Ga0207647_10004652 Ga0207647_100046523 625
477 3300025909 Ga0207705_10001258 Ga0207705_100012588 625
478 3300025911 Ga0207654_10026208 Ga0207654_100262082 625
479 3300025912 Ga0207707_10000248 Ga0207707_1000024823 625
480 3300025912 Ga0207707_10001078 Ga0207707_100010784 625
481 3300025913 Ga0207695_10007072 Ga0207695_100070728 625
482 3300025917 Ga0207660_10056984 Ga0207660_100569842 625
483 3300025920 Ga0207649_10001813 Ga0207649_100018132 625
484 3300025921 Ga0207652_10000025 Ga0207652_1000002567 625
485 3300025921 Ga0207652_10001915 Ga0207652_100019157 625
486 3300025921 Ga0207652_10002103 Ga0207652_100021032 625
487 3300025933 Ga0207706_10062435 Ga0207706_100624352 625
488 3300025949 Ga0207667_10012338 Ga0207667_100123382 625
489 3300025981 Ga0207640_10021651 Ga0207640_100216512 625
490 3300026041 Ga0207639_10026564 Ga0207639_100265642 625
491 3300026067 Ga0207678_10061222 Ga0207678_100612222 625
492 3300026116 Ga0207674_10001703 Ga0207674_100017037 625
493 3300026142 Ga0207698_10001294 Ga0207698_1000129411 625
494 3300026142 Ga0207698_10005275 Ga0207698_100052752 625
495 3300027907 Ga0207428_10005919 Ga0207428_1000591924 625
496 3300046511 Ga0495608_0062059 Ga0495608_0062059_177_2105 625
497 3300046512 Ga0495610_0037869 Ga0495610_0037869_132_2027 625
498 3300046559 Ga0495667_0000845 Ga0495667_0000845_9320_11248 625
499 3300046675 Ga0495657_0000586 Ga0495657_0000586_22106_24034 625
500 3300049569 Ga0501032_0021495 Ga0501032_0021495_1095_3023 625
501 3300049583 Ga0501067_0000058 Ga0501067_0000058_57282_59210 625
502 3300049586 Ga0501070_0004463 Ga0501070_0004463_1334_3229 625
503 3300049586 Ga0501070_0008874 Ga0501070_0008874_2897_4858 625
504 3300049586 Ga0501070_0064971 Ga0501070_0064971_220_2172 625
505 3300049589 Ga0501073_0000154 Ga0501073_0000154_18317_20245 625
506 3300049590 Ga0501074_0038428 Ga0501074_0038428_1300_3252 625
507 3300049593 Ga0501077_0000148 Ga0501077_0000148_27847_29775 625
508 3300049593 Ga0501077_0033537 Ga0501077_0033537_31_1992 625
509 3300049742 Ga0501080_0009035 Ga0501080_0009035_682_2610 625
510 3300049822 Ga0501035_0069062 Ga0501035_0069062_850_2802 625
511 3300049823 Ga0501044_0035501 Ga0501044_0035501_140_2092 625
512 3300053119 Ga0500595_001986 Ga0500595_001986_2973_4994 625
513 iso_pu_bacteria 2818991457 2819660323 625
514 iso_pu_bacteria 2852684882 2852689141 625
515 iso_pu_bacteria 8021622325 8021624866 625
516 iso_pu_bacteria 8021626552 8021627847 625
517 iso_pu_bacteria 8021648035 8021650779 625
518 3300001979 JGI24740J21852_10011041 JGI24740J21852_100110411 626
519 3300001989 JGI24739J22299_10001118 JGI24739J22299_100011183 626
520 3300001990 JGI24737J22298_10000507 JGI24737J22298_100005079 626
521 3300002737 JGI25162J39368_1000156 JGI25162J39368_100015646 626
522 3300002737 JGI25162J39368_1000255 JGI25162J39368_100025548 626
523 3300002738 JGI25154J39366_1002703 JGI25154J39366_10027035 626
524 3300002741 JGI25157J39369_1000165 JGI25157J39369_100016513 626
525 3300002771 JGI25163J39215_1000430 JGI25163J39215_10004306 626
526 3300002772 JGI25164J39214_1000086 JGI25164J39214_100008655 626
527 3300002773 JGI25152J39213_1000231 JGI25152J39213_100023117 626
528 3300002774 JGI25150J39212_1000095 JGI25150J39212_100009520 626
529 3300003187 JGI25151J46595_10000477 JGI25151J46595_1000047726 626
530 3300003214 JGI25165J46597_1000144 JGI25165J46597_100014448 626
531 3300003215 JGI25153J46596_10000291 JGI25153J46596_1000029126 626
532 3300003320 rootH2_10016193 rootH2_100161931 626
533 3300003578 Ga0006562J51391_1023108 Ga0006562J51391_10231088 626
534 3300003578 Ga0006562J51391_1023112 Ga0006562J51391_10231122 626
535 3300003751 Ga0055538_1000254 Ga0055538_10002544 626
536 3300003756 Ga0055533_1001435 Ga0055533_10014354 626
537 3300003759 Ga0055525_1000043 Ga0055525_1000043211 626
538 3300003760 Ga0055527_1000028 Ga0055527_100002827 626
539 3300003760 Ga0055527_1000147 Ga0055527_100014726 626
540 3300003761 Ga0055535_1000061 Ga0055535_100006155 626
541 3300003761 Ga0055535_1000303 Ga0055535_100030325 626
542 3300003761 Ga0055535_1000436 Ga0055535_100043615 626
543 3300003762 Ga0055542_1000053 Ga0055542_100005327 626
544 3300003762 Ga0055542_1000099 Ga0055542_100009948 626
545 3300003762 Ga0055542_1000333 Ga0055542_100033326 626
546 3300003763 Ga0055529_1000117 Ga0055529_100011748 626
547 3300003763 Ga0055529_1000356 Ga0055529_100035626 626
548 3300003763 Ga0055529_1000360 Ga0055529_100036027 626
549 3300005455 Ga0070663_100081340 Ga0070663_1000813401 626
550 3300005458 Ga0070681_10005388 Ga0070681_100053885 626
551 3300005546 Ga0070696_100000382 Ga0070696_1000003829 626
552 3300005577 Ga0068857_100119646 Ga0068857_1001196461 626
553 3300005578 Ga0068854_100000481 Ga0068854_1000004813 626
554 3300005614 Ga0068856_100013197 Ga0068856_1000131974 626
555 3300005834 Ga0068851_10005497 Ga0068851_100054972 626
556 3300009093 Ga0105240_10089489 Ga0105240_100894893 626
557 3300009545 Ga0105237_10001219 Ga0105237_100012196 626
558 3300013102 Ga0157371_10001503 Ga0157371_1000150320 626
559 3300013105 Ga0157369_10004308 Ga0157369_100043084 626
560 3300015262 Ga0182007_10000311 Ga0182007_1000031111 626
561 3300015687 Ga0183368_1007 Ga0183368_1007243 626
562 3300025226 Ga0209674_100037 Ga0209674_100037117 626
563 3300025226 Ga0209674_100059 Ga0209674_10005921 626
564 3300025226 Ga0209674_101158 Ga0209674_1011587 626
565 3300025228 Ga0209672_100004 Ga0209672_100004562 626
566 3300025228 Ga0209672_100008 Ga0209672_100008464 626
567 3300025230 Ga0209563_100036 Ga0209563_100036336 626
568 3300025242 Ga0209258_100003 Ga0209258_100003562 626
569 3300025242 Ga0209258_100004 Ga0209258_100004727 626
570 3300025242 Ga0209258_100008 Ga0209258_100008352 626
571 3300025242 Ga0209258_100798 Ga0209258_10079815 626
572 3300025245 Ga0207425_1000028 Ga0207425_1000028134 626
573 3300025246 Ga0209646_1000576 Ga0209646_100057612 626
574 3300025253 Ga0209677_100814 Ga0209677_1008148 626
575 3300025254 Ga0209148_1000016 Ga0209148_1000016562 626
576 3300025254 Ga0209148_1000222 Ga0209148_100022246 626
577 3300025256 Ga0209759_1000934 Ga0209759_100093413 626
578 3300025258 Ga0209129_1000065 Ga0209129_100006582 626
579 3300025272 Ga0209455_1000004 Ga0209455_1000004562 626
580 3300025272 Ga0209455_1000007 Ga0209455_1000007472 626
581 3300025272 Ga0209455_1000103 Ga0209455_100010351 626
582 3300025294 Ga0209025_1000002 Ga0209025_1000002138 626
583 3300025297 Ga0209758_1000003 Ga0209758_1000003145 626
584 3300025297 Ga0209758_1001407 Ga0209758_100140719 626
585 3300025321 Ga0207656_10001699 Ga0207656_100016992 626
586 3300025904 Ga0207647_10014983 Ga0207647_100149832 626
587 3300025913 Ga0207695_10001693 Ga0207695_1000169319 626
588 3300025914 Ga0207671_10000119 Ga0207671_100001198 626
589 3300025924 Ga0207694_10037547 Ga0207694_100375473 626
590 3300025933 Ga0207706_10039207 Ga0207706_100392074 626
591 3300025949 Ga0207667_10000195 Ga0207667_1000019538 626
592 3300025949 Ga0207667_10008255 Ga0207667_100082555 626
593 3300025981 Ga0207640_10000025 Ga0207640_1000002538 626
594 3300026067 Ga0207678_10096985 Ga0207678_100969851 626
595 3300026078 Ga0207702_10000037 Ga0207702_1000003785 626
596 3300026078 Ga0207702_10000374 Ga0207702_1000037414 626
597 3300026116 Ga0207674_10002408 Ga0207674_1000240812 626
598 3300026116 Ga0207674_10042961 Ga0207674_100429613 626
599 3300037312 Ga0395899_0000047 Ga0395899_0000047_84781_86685 626
600 3300037312 Ga0395899_0035158 Ga0395899_0035158_250_2148 626
601 3300037418 Ga0395900_0000011 Ga0395900_0000011_200169_202073 626
602 3300037418 Ga0395900_0000648 Ga0395900_0000648_25963_27861 626
603 3300037466 Ga0395898_0000058 Ga0395898_0000058_221695_223599 626
604 3300037466 Ga0395898_0021551 Ga0395898_0021551_1624_3522 626
605 3300038443 Ga0395901_0074576 Ga0395901_0074576_250_2148 626
606 3300038705 Ga0237819_00006 Ga0237819_00006_66204_68096 626
607 3300044656 Ga0466969_0014377 Ga0466969_0014377_1686_3590 626
608 3300044684 Ga0466966_0003909 Ga0466966_0003909_7376_9280 626
609 3300044693 Ga0466961_0002235 Ga0466961_0002235_6087_7991 626
610 3300044842 Ga0466957_0004765 Ga0466957_0004765_93_1997 626
611 3300045049 Ga0466959_0002514 Ga0466959_0002514_3820_5724 626
612 3300046454 Ga0495592_0007607 Ga0495592_0007607_4825_6846 626
613 3300046460 Ga0495638_0000211 Ga0495638_0000211_79907_81805 626
614 3300046460 Ga0495638_0000242 Ga0495638_0000242_71976_73874 626
615 3300046471 Ga0495650_0001170 Ga0495650_0001170_4670_6568 626
616 3300046507 Ga0495606_0001420 Ga0495606_0001420_9354_11252 626
617 3300046542 Ga0495597_0032817 Ga0495597_0032817_76_1974 626
618 3300046557 Ga0495622_0034512 Ga0495622_0034512_375_2273 626
619 3300046558 Ga0495633_0035610 Ga0495633_0035610_264_2144 626
620 3300046678 Ga0495599_0058830 Ga0495599_0058830_11_2032 626
621 3300046694 Ga0495649_0000929 Ga0495649_0000929_363_2261 626
622 3300047472 Ga0495686_0005468 Ga0495686_0005468_7585_9471 626
623 3300048918 Ga0496115_0000738 Ga0496115_0000738_21896_23794 626
624 3300048919 Ga0496116_0002334 Ga0496116_0002334_16393_18273 626
625 3300048922 Ga0496119_0000929 Ga0496119_0000929_25872_27752 626
626 3300048923 Ga0496120_0000943 Ga0496120_0000943_12197_14077 626
627 3300048925 Ga0496122_0020910 Ga0496122_0020910_3311_5191 626
628 3300048927 Ga0496124_0004843 Ga0496124_0004843_977_2857 626
629 3300048928 Ga0496125_0077875 Ga0496125_0077875_36_1916 626
630 3300048929 Ga0496126_0004357 Ga0496126_0004357_2510_4390 626
631 3300049569 Ga0501032_0048657 Ga0501032_0048657_483_2384 626
632 3300049570 Ga0501033_0002743 Ga0501033_0002743_4126_6027 626
633 3300049573 Ga0501037_0076632 Ga0501037_0076632_47_1948 626
634 3300049574 Ga0501038_0046681 Ga0501038_0046681_302_2203 626
635 3300049575 Ga0501039_0080576 Ga0501039_0080576_89_1990 626
636 3300049579 Ga0501043_0041143 Ga0501043_0041143_1313_3211 626
637 3300049582 Ga0501048_0024202 Ga0501048_0024202_811_2712 626
638 3300049586 Ga0501070_0011226 Ga0501070_0011226_5015_6985 626
639 3300049586 Ga0501070_0018570 Ga0501070_0018570_789_2759 626
640 3300049587 Ga0501071_0010063 Ga0501071_0010063_675_2645 626
641 3300049742 Ga0501080_0013459 Ga0501080_0013459_221_2191 626
642 3300049822 Ga0501035_0010503 Ga0501035_0010503_4263_6161 626
643 3300049823 Ga0501044_0117568 Ga0501044_0117568_540_2438 626
644 3300002075 JGI24738J21930_10000386 JGI24738J21930_100003864 627
645 3300002737 JGI25162J39368_1000588 JGI25162J39368_100058810 627
646 3300002737 JGI25162J39368_1002555 JGI25162J39368_10025555 627
647 3300002772 JGI25164J39214_1000136 JGI25164J39214_100013656 627
648 3300003214 JGI25165J46597_1000256 JGI25165J46597_100025611 627
649 3300003761 Ga0055535_1000497 Ga0055535_100049718 627
650 3300003761 Ga0055535_1000741 Ga0055535_100074111 627
651 3300003762 Ga0055542_1000107 Ga0055542_10001071 627
652 3300003762 Ga0055542_1000513 Ga0055542_100051318 627
653 3300003762 Ga0055542_1000640 Ga0055542_100064011 627
654 3300003763 Ga0055529_1000067 Ga0055529_100006743 627
655 3300003771 Ga0055526_1000464 Ga0055526_100046421 627
656 3300003773 Ga0055537_1000169 Ga0055537_100016916 627
657 3300003784 Ga0055534_1000404 Ga0055534_10004048 627
658 3300003790 Ga0055528_1000587 Ga0055528_100058714 627
659 3300003791 Ga0055530_10005941 Ga0055530_100059412 627
660 3300003791 Ga0055530_10005949 Ga0055530_100059492 627
661 3300005262 Ga0065165_1000199 Ga0065165_100019992 627
662 3300005578 Ga0068854_100066898 Ga0068854_1000668982 627
663 3300005844 Ga0068862_100052969 Ga0068862_1000529693 627
664 3300009545 Ga0105237_10000097 Ga0105237_100000978 627
665 3300010375 Ga0105239_10058346 Ga0105239_100583462 627
666 3300012500 Ga0157314_1000001 Ga0157314_10000018 627
667 3300013104 Ga0157370_10000224 Ga0157370_1000022415 627
668 3300013104 Ga0157370_10000342 Ga0157370_1000034238 627
669 3300013105 Ga0157369_10003305 Ga0157369_100033052 627
670 3300013105 Ga0157369_10086800 Ga0157369_100868003 627
671 3300014497 Ga0182008_10000745 Ga0182008_1000074514 627
672 3300014497 Ga0182008_10015138 Ga0182008_100151382 627
673 3300014497 Ga0182008_10022630 Ga0182008_100226302 627
674 3300015261 Ga0182006_1000058 Ga0182006_1000058131 627
675 3300015265 Ga0182005_1000015 Ga0182005_1000015241 627
676 3300015685 Ga0183369_1019 Ga0183369_101979 627
677 3300017792 Ga0163161_10001852 Ga0163161_1000185210 627
678 3300017792 Ga0163161_10003406 Ga0163161_100034065 627
679 3300017792 Ga0163161_10033273 Ga0163161_100332732 627
680 3300025228 Ga0209672_100274 Ga0209672_10027433 627
681 3300025228 Ga0209672_100473 Ga0209672_1004731 627
682 3300025231 Ga0207427_100145 Ga0207427_10014558 627
683 3300025231 Ga0207427_101926 Ga0207427_1019261 627
684 3300025233 Ga0209437_100266 Ga0209437_10026620 627
685 3300025233 Ga0209437_100431 Ga0209437_10043130 627
686 3300025233 Ga0209437_101228 Ga0209437_1012281 627
687 3300025242 Ga0209258_100265 Ga0209258_10026552 627
688 3300025242 Ga0209258_100372 Ga0209258_10037241 627
689 3300025246 Ga0209646_1001067 Ga0209646_10010677 627
690 3300025250 Ga0209026_1001377 Ga0209026_10013774 627
691 3300025250 Ga0209026_1003633 Ga0209026_10036333 627
692 3300025250 Ga0209026_1004232 Ga0209026_10042323 627
693 3300025254 Ga0209148_1000042 Ga0209148_1000042101 627
694 3300025254 Ga0209148_1000055 Ga0209148_1000055105 627
695 3300025254 Ga0209148_1000065 Ga0209148_1000065259 627
696 3300025256 Ga0209759_1001497 Ga0209759_10014979 627
697 3300025258 Ga0209129_1000907 Ga0209129_10009078 627
698 3300025261 Ga0209233_1000254 Ga0209233_100025458 627
699 3300025263 Ga0209565_1000031 Ga0209565_1000031318 627
700 3300025272 Ga0209455_1000016 Ga0209455_1000016356 627
701 3300025272 Ga0209455_1000295 Ga0209455_10002953 627
702 3300025272 Ga0209455_1004681 Ga0209455_10046812 627
703 3300025273 Ga0209673_1000484 Ga0209673_100048447 627
704 3300025291 Ga0209675_1000015 Ga0209675_1000015417 627
705 3300025295 Ga0209564_1000480 Ga0209564_100048050 627
706 3300025298 Ga0209050_1000201 Ga0209050_1000201104 627
707 3300025298 Ga0209050_1001448 Ga0209050_10014486 627
708 3300025299 Ga0209256_1010915 Ga0209256_10109151 627
709 3300025303 Ga0209051_1001660 Ga0209051_10016604 627
710 3300025303 Ga0209051_1002093 Ga0209051_10020939 627
711 3300025304 Ga0209257_1000208 Ga0209257_1000208107 627
712 3300025304 Ga0209257_1002229 Ga0209257_100222917 627
713 3300025304 Ga0209257_1016563 Ga0209257_10165632 627
714 3300025904 Ga0207647_10020725 Ga0207647_100207251 627
715 3300025913 Ga0207695_10002625 Ga0207695_100026259 627
716 3300025914 Ga0207671_10000409 Ga0207671_1000040922 627
717 3300025981 Ga0207640_10001460 Ga0207640_100014602 627
718 3300026067 Ga0207678_10033569 Ga0207678_100335693 627
719 3300026067 Ga0207678_10040625 Ga0207678_100406253 627
720 3300028380 Ga0268265_10061495 Ga0268265_100614952 627
721 3300037312 Ga0395899_0002204 Ga0395899_0002204_3708_5615 627
722 3300037466 Ga0395898_0000013 Ga0395898_0000013_204174_206081 627
723 3300038443 Ga0395901_0076054 Ga0395901_0076054_977_2884 627
724 3300044672 Ga0466982_0000022 Ga0466982_0000022_5952_7868 627
725 3300044672 Ga0466982_0000041 Ga0466982_0000041_32640_34538 627
726 3300044684 Ga0466966_0010372 Ga0466966_0010372_1994_3910 627
727 3300044693 Ga0466961_0008197 Ga0466961_0008197_489_2396 627
728 3300044735 Ga0466968_0002639 Ga0466968_0002639_3889_5805 627
729 3300044901 Ga0466960_0004781 Ga0466960_0004781_906_2822 627
730 3300046452 Ga0495617_000031 Ga0495617_000031_91295_93190 627
731 3300046460 Ga0495638_0000081 Ga0495638_0000081_67376_69343 627
732 3300046460 Ga0495638_0000089 Ga0495638_0000089_115249_117144 627
733 3300046460 Ga0495638_0002424 Ga0495638_0002424_506_2389 627
734 3300046460 Ga0495638_0023833 Ga0495638_0023833_110_2047 627
735 3300046471 Ga0495650_0001248 Ga0495650_0001248_6211_8106 627
736 3300046491 Ga0495584_0003103 Ga0495584_0003103_3160_5055 627
737 3300046492 Ga0495585_0000035 Ga0495585_0000035_95087_96982 627
738 3300046501 Ga0495607_0000020 Ga0495607_0000020_129725_131620 627
739 3300046501 Ga0495607_0000553 Ga0495607_0000553_18031_19926 627
740 3300046506 Ga0495583_0007433 Ga0495583_0007433_1095_2990 627
741 3300046507 Ga0495606_0000174 Ga0495606_0000174_69665_71560 627
742 3300046507 Ga0495606_0001389 Ga0495606_0001389_13973_15868 627
743 3300046512 Ga0495610_0002267 Ga0495610_0002267_6147_8030 627
744 3300046513 Ga0495616_0000028 Ga0495616_0000028_65542_67437 627
745 3300046515 Ga0495620_0000088 Ga0495620_0000088_48376_50271 627
746 3300046515 Ga0495620_0002919 Ga0495620_0002919_4775_6670 627
747 3300046518 Ga0495631_0000212 Ga0495631_0000212_12483_14378 627
748 3300046518 Ga0495631_0000425 Ga0495631_0000425_15344_17239 627
749 3300046518 Ga0495631_0001762 Ga0495631_0001762_8492_10375 627
750 3300046519 Ga0495632_0000005 Ga0495632_0000005_84605_86500 627
751 3300046522 Ga0495643_0023874 Ga0495643_0023874_994_2889 627
752 3300046524 Ga0495648_0000360 Ga0495648_0000360_24094_25989 627
753 3300046525 Ga0495663_0002348 Ga0495663_0002348_3290_5173 627
754 3300046538 Ga0495609_0007391 Ga0495609_0007391_186_2081 627
755 3300046558 Ga0495633_0004675 Ga0495633_0004675_2579_4462 627
756 3300046558 Ga0495633_0008488 Ga0495633_0008488_1728_3617 627
757 3300046648 Ga0495611_0000005 Ga0495611_0000005_22235_24130 627
758 3300046648 Ga0495611_0000049 Ga0495611_0000049_40798_42693 627
759 3300046660 Ga0495625_0000285 Ga0495625_0000285_53512_55407 627
760 3300046660 Ga0495625_0003741 Ga0495625_0003741_12743_14638 627
761 3300046665 Ga0495661_0000566 Ga0495661_0000566_23953_25848 627
762 3300046691 Ga0495670_0000268 Ga0495670_0000268_20432_22327 627
763 3300046692 Ga0495671_0001264 Ga0495671_0001264_2962_4857 627
764 3300046794 Ga0495589_0000056 Ga0495589_0000056_5100_6995 627
765 3300046810 Ga0495660_0000108 Ga0495660_0000108_14707_16602 627
766 3300046810 Ga0495660_0000217 Ga0495660_0000217_16652_18547 627
767 3300047323 Ga0495683_0003298 Ga0495683_0003298_1259_3154 627
768 3300047446 Ga0495679_000010 Ga0495679_000010_232944_234839 627
769 3300047469 Ga0495673_0000038 Ga0495673_0000038_281543_283438 627
770 3300047469 Ga0495673_0000045 Ga0495673_0000045_236758_238653 627
771 3300047469 Ga0495673_0001199 Ga0495673_0001199_15301_17196 627
772 3300047472 Ga0495686_0000227 Ga0495686_0000227_82629_84524 627
773 3300047472 Ga0495686_0000311 Ga0495686_0000311_10810_12705 627
774 3300047472 Ga0495686_0010095 Ga0495686_0010095_2292_4187 627
775 3300047472 Ga0495686_0010337 Ga0495686_0010337_4500_6395 627
776 3300047472 Ga0495686_0013009 Ga0495686_0013009_2539_4434 627
777 3300048909 Ga0496106_0002598 Ga0496106_0002598_9757_11652 627
778 3300048916 Ga0496113_0022710 Ga0496113_0022710_2487_4370 627
779 3300048918 Ga0496115_0001079 Ga0496115_0001079_426_2369 627
780 3300048920 Ga0496117_0001068 Ga0496117_0001068_13825_15708 627
781 3300048920 Ga0496117_0001484 Ga0496117_0001484_4362_6245 627
782 3300048920 Ga0496117_0003379 Ga0496117_0003379_7708_9591 627
783 3300048921 Ga0496118_0001160 Ga0496118_0001160_27417_29300 627
784 3300048921 Ga0496118_0001249 Ga0496118_0001249_23951_25834 627
785 3300048921 Ga0496118_0001496 Ga0496118_0001496_16692_18590 627
786 3300048921 Ga0496118_0002452 Ga0496118_0002452_17518_19413 627
787 3300048921 Ga0496118_0003682 Ga0496118_0003682_592_2475 627
788 3300048921 Ga0496118_0006497 Ga0496118_0006497_677_2560 627
789 3300048924 Ga0496121_0000403 Ga0496121_0000403_21265_23160 627
790 3300048924 Ga0496121_0000464 Ga0496121_0000464_70024_71922 627
791 3300048924 Ga0496121_0001922 Ga0496121_0001922_11309_13192 627
792 3300048924 Ga0496121_0003492 Ga0496121_0003492_19468_21363 627
793 3300048924 Ga0496121_0006431 Ga0496121_0006431_9395_11320 627
794 3300048924 Ga0496121_0007118 Ga0496121_0007118_6503_8398 627
795 3300048925 Ga0496122_0001959 Ga0496122_0001959_19106_20989 627
796 3300048925 Ga0496122_0041374 Ga0496122_0041374_1729_3612 627
797 3300048926 Ga0496123_0001677 Ga0496123_0001677_8659_10542 627
798 3300048926 Ga0496123_0002372 Ga0496123_0002372_18851_20734 627
799 3300048926 Ga0496123_0018592 Ga0496123_0018592_1067_2965 627
800 3300048927 Ga0496124_0000032 Ga0496124_0000032_300720_302708 627
801 3300048927 Ga0496124_0001753 Ga0496124_0001753_2374_4257 627
802 3300048927 Ga0496124_0001946 Ga0496124_0001946_455_2338 627
803 3300048927 Ga0496124_0002067 Ga0496124_0002067_18148_20031 627
804 3300048927 Ga0496124_0004289 Ga0496124_0004289_12427_14310 627
805 3300048928 Ga0496125_0000435 Ga0496125_0000435_4720_6645 627
806 3300048928 Ga0496125_0003037 Ga0496125_0003037_13145_15043 627
807 3300048928 Ga0496125_0033060 Ga0496125_0033060_1999_3882 627
808 3300048929 Ga0496126_0026807 Ga0496126_0026807_2403_4301 627
809 3300048929 Ga0496126_0122343 Ga0496126_0122343_171_2102 627
810 3300049459 Ga0495678_000321 Ga0495678_000321_22496_24391 627
811 3300049582 Ga0501048_0019221 Ga0501048_0019221_2224_4128 627
812 3300053087 Ga0500643_000051 Ga0500643_000051_40585_42480 627
813 3300053093 Ga0500651_0005237 Ga0500651_0005237_1594_3549 627
814 3300053103 Ga0500555_000953 Ga0500555_000953_1239_3134 627
815 3300053161 Ga0500634_0000094 Ga0500634_0000094_841_2730 627
816 3300053730 Ga0500645_004384 Ga0500645_004384_16_1911 627
817 3300061719 Ga0466962_0004875 Ga0466962_0004875_2571_4487 627
818 3300001904 JGI24736J21556_1001682 JGI24736J21556_10016822 628
819 3300005618 Ga0068864_100039204 Ga0068864_1000392043 628
820 3300025904 Ga0207647_10000031 Ga0207647_1000003156 628
821 3300041413 Ga0439465_0000406 Ga0439465_0000406_1280_3211 628
822 3300046522 Ga0495643_0001267 Ga0495643_0001267_12050_13951 628
823 3300046615 Ga0495656_0000648 Ga0495656_0000648_5771_7696 628
824 3300047320 Ga0495672_0001346 Ga0495672_0001346_10396_12297 628
825 3300047472 Ga0495686_0053931 Ga0495686_0053931_345_2246 628
826 3300048904 Ga0496101_0056308 Ga0496101_0056308_765_2693 628
827 3300048917 Ga0496114_0123111 Ga0496114_0123111_77_2005 628
828 3300048927 Ga0496124_0001447 Ga0496124_0001447_13273_15267 628
829 3300048927 Ga0496124_0003995 Ga0496124_0003995_12320_14314 628
830 iso_pu_bacteria 2941471342 2941475316 628
831 2162886007 SwRhRL2b_contig_3055844 SwRhRL2b_0833.00004660 629
832 3300003856 Ga0058692_1000017 Ga0058692_1000017176 629
833 3300005289 Ga0065704_10000275 Ga0065704_1000027543 629
834 3300005331 Ga0070670_100005186 Ga0070670_1000051868 629
835 3300009011 Ga0105251_10001750 Ga0105251_100017502 629
836 3300009148 Ga0105243_10003262 Ga0105243_100032629 629
837 3300015261 Ga0182006_1029320 Ga0182006_10293202 629
838 3300025735 Ga0207713_1000393 Ga0207713_100039325 629
839 3300027312 Ga0209371_1000044 Ga0209371_1000044231 629
840 3300030500 Ga0268256_1000046 Ga0268256_1000046231 629
841 3300039145 Ga0237816_00140 Ga0237816_00140_2893_4800 629
842 3300048920 Ga0496117_0001420 Ga0496117_0001420_28408_30297 629
843 3300048922 Ga0496119_0002453 Ga0496119_0002453_14866_16755 629
844 3300048923 Ga0496120_0002147 Ga0496120_0002147_4265_6154 629
845 3300048925 Ga0496122_0003345 Ga0496122_0003345_15103_16992 629
846 3300048926 Ga0496123_0002721 Ga0496123_0002721_15061_16950 629
847 3300048927 Ga0496124_0003791 Ga0496124_0003791_12100_13989 629

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17899

Peptidase_M61_N

Peptidase M61 N-terminal domain

92

264

0.96

PF05299

Peptidase_M61

M61 glycyl aminopeptidase

359

477

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3id1-assembly1.cif.gz_A crystal structure of rsep pdz1 domain 0.8604 536 602
2zpl-assembly2.cif.gz_B crystal structure analysis of pdz domain a 0.8592 534 602
3pv4-assembly1.cif.gz_A structure of legionella fallonii degq (delta-pdz2 variant) 0.8544 538 604
8e2k-assembly1.cif.gz_X cryo-em structure of birc6/htra2-s306a 0.8453 538 614
2zpl-assembly4.cif.gz_C crystal structure analysis of pdz domain a 0.8414 536 602
ID Description Score Start End Superfamily
3id1A00 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8604 536 602 2.30.42.10
3pv4A03 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8544 538 604 2.30.42.10
4fgmA01 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8537 38 209 2.60.40.3650
af_I1MZD3_905_978_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8482 538 602 2.30.42.10
af_F1R7L1_125_207_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8461 538 602 2.30.42.10
ID Description Score Start End GO Terms
AF-A0A2S7EKP5-F1-model_v4 deleted 0.9987 64 629
AF-A0A2S7EKP5-F1-model_v4 deleted 0.9969 64 629
AF-A0A3C0X9S4-F1-model_v4 deleted 0.9962 64 629
AF-A0A836ZTA2-F1-model_v4 Peptidase M61 0.9952 245 629 GO:0005737
AF-A0A3C0X9S4-F1-model_v4 deleted 0.9944 64 629

Feature Viewer

pLDDT pTM Quality
94.76 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map