F483252

General Info

Members Datasets Scaffolds Average Seq Length
845 320 1690 91

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10572927|Ga0157380_105729273
Length 105
Sequence MWASSFLHRERRHMAKRATKSARKPNPAFMKPMTPSPALSEVIGSKPMPRTEVTKRLWAYIKKNKLQDAKNKRMIKADSTLKAVFGGKATVNMFEMTKLVSKHLK

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
194 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
205 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
206 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
211 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
212 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
213 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
214 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
215 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
216 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
217 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
218 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
219 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
220 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
221 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
222 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
223 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
229 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
230 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
231 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
232 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
233 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
234 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
257 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
258 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
283 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
284 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
285 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
286 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
287 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
291 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
292 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
296 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
299 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
300 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
301 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
302 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
303 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
304 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
308 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
309 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
310 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
311 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
312 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
313 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
314 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
315 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
316 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
317 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
318 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
320 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.54
Nodule 0
Rhizoplane 4.14
Rhizosphere 93.37
Stem 0
Stem Tuber 0
Unclassified 6.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10572927 3300014326 Unclassified 1112
2 ARSoilOldRDRAFT_c023916 3300000044 Bacteria 548
3 JGI24746J21847_1000822 3300001977 Bacteria 4798
4 JGI24750J21931_1023674 3300002070 Bacteria 873
5 JGI24749J21850_1011113 3300002076 Bacteria 1263
6 JGI24033J26618_1005083 3300002155 Bacteria 1440
7 JGI24034J26672_10073417 3300002239 Unclassified 615
8 JGI24751J29686_10099292 3300002459 Bacteria 607
9 Ga0058859_11696539 3300004798 Bacteria 890
10 Ga0058859_11734270 3300004798 Bacteria 842
11 Ga0058859_11821480 3300004798 Bacteria 750
12 Ga0058860_10028117 3300004801 Bacteria 706
13 Ga0058860_12048476 3300004801 Bacteria 722
14 Ga0065714_10092071 3300005288 Bacteria 1890
15 Ga0065714_10299846 3300005288 Bacteria 696
16 Ga0065714_10323179 3300005288 Bacteria 666
17 Ga0065704_10028580 3300005289 Bacteria 1078
18 Ga0065704_10806494 3300005289 Bacteria 523
19 Ga0065712_10001046 3300005290 Bacteria 7327
20 Ga0065712_10003403 3300005290 Bacteria 6967
21 Ga0065712_10068906 3300005290 Bacteria 8603
22 Ga0065712_10130494 3300005290 Bacteria 1556
23 Ga0065712_10499758 3300005290 Bacteria 650
24 Ga0065715_10000581 3300005293 Bacteria 14312
25 Ga0065715_10004703 3300005293 Bacteria 4357
26 Ga0065715_10011604 3300005293 Bacteria 2071
27 Ga0065715_10024005 3300005293 Bacteria 2027
28 Ga0065715_10133606 3300005293 Viruses 1968
29 Ga0065715_10629012 3300005293 Bacteria 676
30 Ga0065715_11012658 3300005293 Bacteria 542
31 Ga0065707_10003441 3300005295 Bacteria 4986
32 Ga0065707_10100281 3300005295 Bacteria 2942
33 Ga0065707_10106177 3300005295 Unclassified 2608
34 Ga0065707_10112481 3300005295 Bacteria 2359
35 Ga0065707_10188352 3300005295 Bacteria 1375
36 Ga0065707_10977681 3300005295 Bacteria 545
37 Ga0065707_11031293 3300005295 Unclassified 531
38 Ga0070676_10183738 3300005328 Bacteria 1361
39 Ga0070676_10244922 3300005328 Bacteria 1194
40 Ga0070676_10633168 3300005328 Bacteria 775
41 Ga0070676_10913365 3300005328 Bacteria 655
42 Ga0070683_100710157 3300005329 Bacteria 963
43 Ga0070690_100176353 3300005330 Bacteria 1474
44 Ga0070690_100886445 3300005330 Bacteria 697
45 Ga0070690_101373624 3300005330 Bacteria 568
46 Ga0070670_100048911 3300005331 Bacteria 3638
47 Ga0070670_100077702 3300005331 Bacteria 2852
48 Ga0070670_100171936 3300005331 Bacteria 1879
49 Ga0070670_100994039 3300005331 Bacteria 763
50 Ga0070677_10003426 3300005333 Bacteria 5114
51 Ga0070677_10007651 3300005333 Bacteria 3614
52 Ga0070677_10428521 3300005333 Bacteria 703
53 Ga0068869_100086639 3300005334 Bacteria 2348
54 Ga0068869_100297730 3300005334 Bacteria 1302
55 Ga0068869_101493981 3300005334 Bacteria 600
56 Ga0068869_101846440 3300005334 Bacteria 541
57 Ga0070666_10016876 3300005335 Bacteria 4675
58 Ga0070666_10078906 3300005335 Bacteria 2248
59 Ga0070666_10507394 3300005335 Bacteria 875
60 Ga0070680_100841961 3300005336 Unclassified 791
61 Ga0068868_100052939 3300005338 Bacteria 3196
62 Ga0068868_100509123 3300005338 Bacteria 1055
63 Ga0068868_101335484 3300005338 Bacteria 667
64 Ga0070660_100482956 3300005339 Bacteria 1029
65 Ga0070689_100041895 3300005340 Bacteria 3515
66 Ga0070689_100137763 3300005340 Bacteria 1961
67 Ga0070691_10619784 3300005341 Unclassified 641
68 Ga0070687_100002212 3300005343 Bacteria 7207
69 Ga0070661_100004568 3300005344 Bacteria 9519
70 Ga0070692_10100341 3300005345 Bacteria 1586
71 Ga0070692_10454118 3300005345 Bacteria 821
72 Ga0070668_100025506 3300005347 Bacteria 4482
73 Ga0070668_100129676 3300005347 Bacteria 2023
74 Ga0070668_100231304 3300005347 Bacteria 1528
75 Ga0070668_100522437 3300005347 Bacteria 1030
76 Ga0070669_100002113 3300005353 Bacteria 14358
77 Ga0070669_100040146 3300005353 Bacteria 3401
78 Ga0070669_100101648 3300005353 Bacteria 2169
79 Ga0070675_100050974 3300005354 Bacteria 3400
80 Ga0070675_100066667 3300005354 Bacteria 2978
81 Ga0070675_100366345 3300005354 Bacteria 1280
82 Ga0070675_100513750 3300005354 Bacteria 1080
83 Ga0070675_100519632 3300005354 Bacteria 1074
84 Ga0070675_102101437 3300005354 Bacteria 521
85 Ga0070671_100025748 3300005355 Bacteria 4830
86 Ga0070671_100108435 3300005355 Bacteria 2332
87 Ga0070671_100335018 3300005355 Bacteria 1290
88 Ga0070671_100754393 3300005355 Bacteria 846
89 Ga0070671_100921602 3300005355 Bacteria 764
90 Ga0070674_100044795 3300005356 Bacteria 3019
91 Ga0070674_100099861 3300005356 Bacteria 2112
92 Ga0070674_100224870 3300005356 Bacteria 1462
93 Ga0070674_100501400 3300005356 Bacteria 1011
94 Ga0070674_100856494 3300005356 Unclassified 789
95 Ga0070673_100014246 3300005364 Bacteria 5530
96 Ga0070673_100071186 3300005364 Bacteria 2793
97 Ga0070673_100185303 3300005364 Bacteria 1784
98 Ga0070673_100473262 3300005364 Bacteria 1130
99 Ga0070673_101175969 3300005364 Bacteria 718
100 Ga0070673_101723214 3300005364 Unclassified 593
101 Ga0070688_100020371 3300005365 Bacteria 3856
102 Ga0070688_100064288 3300005365 Bacteria 2328
103 Ga0070659_100023676 3300005366 Bacteria 4702
104 Ga0070659_100586728 3300005366 Bacteria 957
105 Ga0070667_100015278 3300005367 Bacteria 6346
106 Ga0070667_100072773 3300005367 Bacteria 2929
107 Ga0070667_100839092 3300005367 Bacteria 854
108 Ga0070709_10643829 3300005434 Bacteria 820
109 Ga0070714_100021676 3300005435 Bacteria 5258
110 Ga0070713_100273372 3300005436 Bacteria 1548
111 Ga0070713_100785531 3300005436 Unclassified 912
112 Ga0070710_10924356 3300005437 Bacteria 631
113 Ga0070701_10004868 3300005438 Bacteria 5491
114 Ga0070701_10117588 3300005438 Bacteria 1493
115 Ga0070705_100150310 3300005440 Bacteria 1544
116 Ga0070700_100009261 3300005441 Bacteria 5400
117 Ga0070694_100070037 3300005444 Bacteria 2414
118 Ga0070694_101655583 3300005444 Bacteria 544
119 Ga0070708_100573582 3300005445 Bacteria 1064
120 Ga0070708_100765801 3300005445 Bacteria 908
121 Ga0070708_101506703 3300005445 Bacteria 627
122 Ga0070663_100220309 3300005455 Bacteria 1489
123 Ga0070678_100006322 3300005456 Bacteria 6945
124 Ga0070678_100015995 3300005456 Bacteria 4783
125 Ga0070678_100032407 3300005456 Bacteria 3617
126 Ga0070678_100117318 3300005456 Bacteria 2093
127 Ga0070678_100646991 3300005456 Bacteria 948
128 Ga0070678_101005289 3300005456 Bacteria 767
129 Ga0070678_101254941 3300005456 Bacteria 688
130 Ga0070662_100027328 3300005457 Bacteria 3959
131 Ga0070662_100114546 3300005457 Bacteria 2058
132 Ga0070662_100133600 3300005457 Bacteria 1916
133 Ga0070662_100205690 3300005457 Bacteria 1564
134 Ga0068867_100006808 3300005459 Bacteria 8080
135 Ga0068867_100035299 3300005459 Bacteria 3626
136 Ga0068867_100045741 3300005459 Bacteria 3211
137 Ga0068867_100134029 3300005459 Bacteria 1928
138 Ga0068867_100419499 3300005459 Bacteria 1133
139 Ga0068867_101446560 3300005459 Bacteria 638
140 Ga0070685_10123759 3300005466 Bacteria 1609
141 Ga0070685_10257128 3300005466 Bacteria 1159
142 Ga0070685_10313660 3300005466 Bacteria 1061
143 Ga0070707_100189373 3300005468 Bacteria 2006
144 Ga0070707_100426322 3300005468 Bacteria 1287
145 Ga0070698_100064592 3300005471 Bacteria 3687
146 Ga0070698_100514102 3300005471 Bacteria 1136
147 Ga0070698_100641453 3300005471 Bacteria 1003
148 Ga0070698_100832421 3300005471 Bacteria 867
149 Ga0070698_101486398 3300005471 Bacteria 629
150 Ga0070699_100297480 3300005518 Bacteria 1448
151 Ga0070699_101841347 3300005518 Bacteria 554
152 Ga0070697_100235101 3300005536 Bacteria 1564
153 Ga0070697_100724985 3300005536 Bacteria 878
154 Ga0068853_100686696 3300005539 Bacteria 976
155 Ga0068853_100884216 3300005539 Bacteria 858
156 Ga0070672_100001241 3300005543 Bacteria 15672
157 Ga0070672_100099345 3300005543 Bacteria 2359
158 Ga0070672_100118125 3300005543 Bacteria 2168
159 Ga0070672_100495712 3300005543 Bacteria 1056
160 Ga0070672_100538286 3300005543 Bacteria 1013
161 Ga0070672_101138552 3300005543 Unclassified 694
162 Ga0070686_100014346 3300005544 Bacteria 4566
163 Ga0070686_100323350 3300005544 Bacteria 1151
164 Ga0070686_101131486 3300005544 Bacteria 648
165 Ga0070686_101307211 3300005544 Bacteria 606
166 Ga0070695_100108003 3300005545 Bacteria 1884
167 Ga0070695_100303612 3300005545 Bacteria 1181
168 Ga0070695_100379929 3300005545 Bacteria 1066
169 Ga0070695_100868020 3300005545 Bacteria 727
170 Ga0070696_100322027 3300005546 Bacteria 1190
171 Ga0070696_100371785 3300005546 Bacteria 1112
172 Ga0070696_100379832 3300005546 Bacteria 1101
173 Ga0070696_101055641 3300005546 Bacteria 681
174 Ga0070665_100004684 3300005548 Bacteria 14278
175 Ga0070665_100068354 3300005548 Bacteria 3562
176 Ga0070665_101119945 3300005548 Bacteria 798
177 Ga0070665_101721951 3300005548 Bacteria 634
178 Ga0070704_100159640 3300005549 Bacteria 1782
179 Ga0070704_100171313 3300005549 Bacteria 1727
180 Ga0070664_100007220 3300005564 Bacteria 8964
181 Ga0070664_100432307 3300005564 Bacteria 1207
182 Ga0070664_101621690 3300005564 Bacteria 613
183 Ga0068857_100028753 3300005577 Bacteria 4905
184 Ga0068857_100236405 3300005577 Bacteria 1672
185 Ga0068857_101378248 3300005577 Bacteria 685
186 Ga0068856_101295331 3300005614 Bacteria 744
187 Ga0070702_100080815 3300005615 Bacteria 1946
188 Ga0070702_100085387 3300005615 Bacteria 1901
189 Ga0070702_100192609 3300005615 Bacteria 1343
190 Ga0070702_100700797 3300005615 Bacteria 772
191 Ga0070702_101503583 3300005615 Bacteria 554
192 Ga0068852_100296500 3300005616 Bacteria 1564
193 Ga0068859_100149707 3300005617 Bacteria 2410
194 Ga0068859_100190064 3300005617 Bacteria 2138
195 Ga0068859_100616066 3300005617 Bacteria 1178
196 Ga0068859_101029123 3300005617 Bacteria 905
197 Ga0068859_101296843 3300005617 Bacteria 802
198 Ga0068864_100033795 3300005618 Bacteria 4349
199 Ga0068864_100036429 3300005618 Bacteria 4193
200 Ga0068864_100321238 3300005618 Bacteria 1454
201 Ga0068864_100854766 3300005618 Bacteria 897
202 Ga0068864_101644119 3300005618 Bacteria 647
203 Ga0068864_101896637 3300005618 Bacteria 602
204 Ga0068866_10035462 3300005718 Bacteria 2437
205 Ga0068866_10638174 3300005718 Bacteria 723
206 Ga0068866_11040234 3300005718 Bacteria 584
207 Ga0068866_11377753 3300005718 Bacteria 515
208 Ga0068861_100076625 3300005719 Bacteria 2607
209 Ga0068861_100140934 3300005719 Bacteria 1967
210 Ga0068861_100190316 3300005719 Bacteria 1715
211 Ga0068861_101671982 3300005719 Bacteria 629
212 Ga0068851_10284795 3300005834 Bacteria 946
213 Ga0068870_10001021 3300005840 Bacteria 11076
214 Ga0068870_10016745 3300005840 Bacteria 3510
215 Ga0068863_100055480 3300005841 Bacteria 3752
216 Ga0068863_100540646 3300005841 Bacteria 1150
217 Ga0068863_100768357 3300005841 Bacteria 960
218 Ga0068863_101205543 3300005841 Bacteria 763
219 Ga0068858_100020186 3300005842 Bacteria 6230
220 Ga0068858_100145851 3300005842 Bacteria 2223
221 Ga0068860_100026033 3300005843 Bacteria 5643
222 Ga0068862_100044718 3300005844 Bacteria 3777
223 Ga0068862_100127785 3300005844 Bacteria 2246
224 Ga0068862_100160722 3300005844 Bacteria 2005
225 Ga0068862_100243863 3300005844 Bacteria 1635
226 Ga0068862_100268718 3300005844 Bacteria 1559
227 Ga0068862_100354527 3300005844 Bacteria 1362
228 Ga0068862_100420135 3300005844 Bacteria 1254
229 Ga0068862_100663811 3300005844 Bacteria 1007
230 Ga0068862_101851482 3300005844 Bacteria 613
231 Ga0081455_10115803 3300005937 Bacteria 2121
232 Ga0081455_10165655 3300005937 Bacteria 1689
233 Ga0081538_10115722 3300005981 Bacteria 1302
234 Ga0075363_100937770 3300006048 Bacteria 531
235 Ga0075432_10312463 3300006058 Bacteria 655
236 Ga0070715_10000006 3300006163 Bacteria 216296
237 Ga0070712_100123526 3300006175 Bacteria 1952
238 Ga0075367_10018831 3300006178 Bacteria 3816
239 Ga0075366_10092952 3300006195 Bacteria 1807
240 Ga0097621_100196586 3300006237 Bacteria 1749
241 Ga0097621_100375208 3300006237 Bacteria 1270
242 Ga0097621_100494827 3300006237 Bacteria 1107
243 Ga0075370_10578792 3300006353 Bacteria 680
244 Ga0068871_100120720 3300006358 Bacteria 2213
245 Ga0068871_100378022 3300006358 Bacteria 1258
246 Ga0068871_100428730 3300006358 Bacteria 1182
247 Ga0068871_101188472 3300006358 Bacteria 715
248 Ga0075428_100011112 3300006844 Bacteria 10020
249 Ga0075428_100011725 3300006844 Bacteria 9757
250 Ga0075428_100018506 3300006844 Bacteria 7702
251 Ga0075428_100035203 3300006844 Bacteria 5520
252 Ga0075428_100253814 3300006844 Bacteria 1894
253 Ga0075428_100334102 3300006844 Bacteria 1628
254 Ga0075428_100340511 3300006844 Bacteria 1610
255 Ga0075428_100431942 3300006844 Bacteria 1411
256 Ga0075428_101390848 3300006844 Bacteria 737
257 Ga0075430_100000134 3300006846 Bacteria 47259
258 Ga0075430_100009714 3300006846 Bacteria 8130
259 Ga0075430_100035788 3300006846 Bacteria 4211
260 Ga0075430_100110640 3300006846 Bacteria 2290
261 Ga0075430_100164743 3300006846 Bacteria 1845
262 Ga0075430_100220805 3300006846 Bacteria 1572
263 Ga0075430_100221468 3300006846 Bacteria 1570
264 Ga0075430_100678418 3300006846 Bacteria 849
265 Ga0075430_101335474 3300006846 Bacteria 590
266 Ga0075431_100000927 3300006847 Bacteria 25885
267 Ga0075431_100011812 3300006847 Bacteria 8813
268 Ga0075431_100018271 3300006847 Bacteria 7134
269 Ga0075431_100043528 3300006847 Bacteria 4632
270 Ga0075431_100053722 3300006847 Bacteria 4153
271 Ga0075431_100071770 3300006847 Bacteria 3573
272 Ga0075431_100096023 3300006847 Bacteria 3060
273 Ga0075431_100119877 3300006847 Bacteria 2714
274 Ga0075431_100361279 3300006847 Bacteria 1458
275 Ga0075431_100797529 3300006847 Bacteria 918
276 Ga0075431_101263383 3300006847 Bacteria 700
277 Ga0075433_10008760 3300006852 Bacteria 8073
278 Ga0075433_10037184 3300006852 Bacteria 4198
279 Ga0075433_10081580 3300006852 Bacteria 2852
280 Ga0075433_10265934 3300006852 Bacteria 1520
281 Ga0075433_10434755 3300006852 Bacteria 1157
282 Ga0075434_100027241 3300006871 Bacteria 5609
283 Ga0075434_100045701 3300006871 Bacteria 4344
284 Ga0075434_100880305 3300006871 Bacteria 911
285 Ga0075429_100002939 3300006880 Bacteria 14447
286 Ga0075429_100011009 3300006880 Bacteria 7825
287 Ga0075429_100026938 3300006880 Bacteria 4991
288 Ga0075429_100047421 3300006880 Bacteria 3737
289 Ga0075429_100095793 3300006880 Bacteria 2588
290 Ga0075429_100219280 3300006880 Bacteria 1666
291 Ga0075429_100250491 3300006880 Bacteria 1551
292 Ga0068865_100509358 3300006881 Bacteria 1005
293 Ga0068865_100652350 3300006881 Bacteria 895
294 Ga0068865_100707842 3300006881 Bacteria 861
295 Ga0068865_101117512 3300006881 Bacteria 695
296 Ga0068865_102194755 3300006881 Bacteria 503
297 Ga0097620_100149700 3300006931 Bacteria 2410
298 Ga0097620_100190054 3300006931 Bacteria 2138
299 Ga0097620_100616002 3300006931 Bacteria 1178
300 Ga0097620_101029225 3300006931 Bacteria 905
301 Ga0097620_101296831 3300006931 Bacteria 802
302 Ga0075435_100092652 3300007076 Bacteria 2495
303 Ga0075435_100101883 3300007076 Bacteria 2379
304 Ga0105240_11003476 3300009093 Bacteria 893
305 Ga0111539_10000615 3300009094 Bacteria 46129
306 Ga0111539_10001913 3300009094 Bacteria 27727
307 Ga0111539_10004464 3300009094 Bacteria 18296
308 Ga0111539_10019208 3300009094 Bacteria 8442
309 Ga0111539_10097062 3300009094 Bacteria 3462
310 Ga0111539_10160958 3300009094 Bacteria 2625
311 Ga0111539_10302555 3300009094 Bacteria 1861
312 Ga0111539_10408221 3300009094 Bacteria 1582
313 Ga0111539_10677067 3300009094 Bacteria 1201
314 Ga0111539_10787146 3300009094 Bacteria 1107
315 Ga0105245_10125849 3300009098 Bacteria 2399
316 Ga0105245_10314082 3300009098 Bacteria 1542
317 Ga0105247_10284669 3300009101 Bacteria 1141
318 Ga0114129_10003815 3300009147 Bacteria 21246
319 Ga0114129_10010159 3300009147 Bacteria 13422
320 Ga0114129_10015898 3300009147 Bacteria 10704
321 Ga0114129_10081662 3300009147 Bacteria 4493
322 Ga0114129_10099417 3300009147 Bacteria 4026
323 Ga0114129_10099778 3300009147 Bacteria 4018
324 Ga0114129_10355268 3300009147 Bacteria 1940
325 Ga0114129_10918531 3300009147 Bacteria 1108
326 Ga0114129_11730638 3300009147 Bacteria 762
327 Ga0114129_12387029 3300009147 Unclassified 634
328 Ga0105243_10283201 3300009148 Bacteria 1494
329 Ga0105243_10363583 3300009148 Bacteria 1333
330 Ga0105243_10472947 3300009148 Bacteria 1181
331 Ga0105243_10545714 3300009148 Bacteria 1107
332 Ga0105243_10548797 3300009148 Unclassified 1104
333 Ga0105241_10191221 3300009174 Bacteria 1704
334 Ga0105242_10045413 3300009176 Bacteria 3561
335 Ga0105242_10426383 3300009176 Bacteria 1244
336 Ga0105242_10770303 3300009176 Bacteria 949
337 Ga0105242_11113013 3300009176 Bacteria 804
338 Ga0105242_12574650 3300009176 Bacteria 557
339 Ga0105248_10033347 3300009177 Bacteria 5752
340 Ga0105248_10040222 3300009177 Bacteria 5241
341 Ga0105248_10186848 3300009177 Bacteria 2335
342 Ga0105248_10930432 3300009177 Bacteria 982
343 Ga0105248_11522023 3300009177 Bacteria 757
344 Ga0105237_12149452 3300009545 Bacteria 567
345 Ga0105238_10683509 3300009551 Bacteria 1038
346 Ga0105249_10000428 3300009553 Bacteria 40134
347 Ga0105249_10037296 3300009553 Bacteria 4411
348 Ga0105249_11077569 3300009553 Bacteria 873
349 Ga0105249_12335601 3300009553 Bacteria 607
350 Ga0105246_10026325 3300011119 Bacteria 3798
351 Ga0105246_10037450 3300011119 Bacteria 3256
352 Ga0105246_10115066 3300011119 Bacteria 1983
353 Ga0105246_10268062 3300011119 Bacteria 1364
354 Ga0105246_11023627 3300011119 Bacteria 749
355 Ga0105246_12139951 3300011119 Bacteria 543
356 Ga0157347_1011957 3300012502 Bacteria 930
357 Ga0157371_11004402 3300013102 Bacteria 636
358 Ga0157370_11366147 3300013104 Bacteria 638
359 Ga0157374_10090342 3300013296 Bacteria 2920
360 Ga0157378_10447959 3300013297 Bacteria 1281
361 Ga0157378_11480375 3300013297 Bacteria 723
362 Ga0163162_10139116 3300013306 Bacteria 2540
363 Ga0163162_10603038 3300013306 Bacteria 1224
364 Ga0163162_11124601 3300013306 Bacteria 890
365 Ga0163162_11734261 3300013306 Bacteria 713
366 Ga0157375_10047796 3300013308 Bacteria 4181
367 Ga0157375_10120410 3300013308 Bacteria 2733
368 Ga0157375_10134620 3300013308 Bacteria 2593
369 Ga0157375_10165302 3300013308 Bacteria 2357
370 Ga0157375_12820227 3300013308 Bacteria 581
371 Ga0163163_10160814 3300014325 Bacteria 2291
372 Ga0163163_10428280 3300014325 Bacteria 1382
373 Ga0163163_10604817 3300014325 Bacteria 1159
374 Ga0157380_10853951 3300014326 Bacteria 932
375 Ga0157380_11634311 3300014326 Bacteria 700
376 Ga0157380_12389490 3300014326 Bacteria 594
377 Ga0157377_10004104 3300014745 Bacteria 6650
378 Ga0157377_10121385 3300014745 Bacteria 1584
379 Ga0157377_10209007 3300014745 Bacteria 1243
380 Ga0157377_10244866 3300014745 Bacteria 1159
381 Ga0157377_10260759 3300014745 Bacteria 1128
382 Ga0157379_10093226 3300014968 Bacteria 2702
383 Ga0157379_10353854 3300014968 Bacteria 1345
384 Ga0157379_10846098 3300014968 Bacteria 865
385 Ga0157379_11062374 3300014968 Bacteria 774
386 Ga0157379_11613497 3300014968 Bacteria 633
387 Ga0157376_11530193 3300014969 Bacteria 700
388 Ga0163161_10002809 3300017792 Bacteria 12352
389 Ga0163161_10077543 3300017792 Bacteria 2441
390 Ga0163161_10122892 3300017792 Bacteria 1952
391 Ga0163161_10904032 3300017792 Bacteria 748
392 Ga0163161_11503188 3300017792 Bacteria 591
393 Ga0207697_10004014 3300025315 Bacteria 7136
394 Ga0207697_10020493 3300025315 Bacteria 2706
395 Ga0207697_10255844 3300025315 Bacteria 775
396 Ga0207682_10001460 3300025893 Bacteria 10923
397 Ga0207682_10006626 3300025893 Bacteria 4656
398 Ga0207682_10199036 3300025893 Bacteria 921
399 Ga0207642_10068548 3300025899 Bacteria 1679
400 Ga0207642_10215671 3300025899 Bacteria 1069
401 Ga0207642_10650591 3300025899 Bacteria 660
402 Ga0207642_11002144 3300025899 Bacteria 538
403 Ga0207688_10000703 3300025901 Bacteria 16518
404 Ga0207688_10258797 3300025901 Bacteria 1056
405 Ga0207688_10270047 3300025901 Bacteria 1034
406 Ga0207680_10046509 3300025903 Bacteria 2566
407 Ga0207680_10082875 3300025903 Bacteria 2020
408 Ga0207680_10125110 3300025903 Bacteria 1687
409 Ga0207680_10504000 3300025903 Bacteria 862
410 Ga0207685_10000010 3300025905 Bacteria 216792
411 Ga0207699_10333635 3300025906 Bacteria 1067
412 Ga0207645_10000065 3300025907 Bacteria 76331
413 Ga0207645_10121288 3300025907 Bacteria 1697
414 Ga0207643_10001402 3300025908 Bacteria 13819
415 Ga0207643_10008096 3300025908 Bacteria 5640
416 Ga0207643_10074218 3300025908 Bacteria 1961
417 Ga0207684_10666518 3300025910 Bacteria 886
418 Ga0207707_10672963 3300025912 Bacteria 871
419 Ga0207707_11034457 3300025912 Bacteria 672
420 Ga0207695_10803587 3300025913 Bacteria 821
421 Ga0207693_10222525 3300025915 Bacteria 1483
422 Ga0207662_10112081 3300025918 Bacteria 1702
423 Ga0207646_10203257 3300025922 Bacteria 1790
424 Ga0207646_11245931 3300025922 Bacteria 651
425 Ga0207646_11921164 3300025922 Unclassified 504
426 Ga0207681_10011850 3300025923 Bacteria 5366
427 Ga0207681_10073826 3300025923 Unclassified 2387
428 Ga0207681_10139029 3300025923 Bacteria 1806
429 Ga0207681_10341314 3300025923 Bacteria 1196
430 Ga0207694_11044371 3300025924 Bacteria 691
431 Ga0207650_10037052 3300025925 Bacteria 3552
432 Ga0207650_10088665 3300025925 Unclassified 2360
433 Ga0207650_10533149 3300025925 Bacteria 983
434 Ga0207659_10024304 3300025926 Bacteria 4057
435 Ga0207659_10033239 3300025926 Bacteria 3548
436 Ga0207659_10045591 3300025926 Bacteria 3092
437 Ga0207659_10083984 3300025926 Bacteria 2362
438 Ga0207687_10319104 3300025927 Bacteria 1257
439 Ga0207687_10351137 3300025927 Bacteria 1202
440 Ga0207687_10879929 3300025927 Bacteria 766
441 Ga0207700_10011013 3300025928 Bacteria 5745
442 Ga0207700_10648826 3300025928 Unclassified 941
443 Ga0207664_10054644 3300025929 Bacteria 3165
444 Ga0207644_10072096 3300025931 Bacteria 2529
445 Ga0207644_10288919 3300025931 Bacteria 1318
446 Ga0207644_10396386 3300025931 Bacteria 1128
447 Ga0207690_10437916 3300025932 Bacteria 1048
448 Ga0207706_10013309 3300025933 Bacteria 7485
449 Ga0207706_10068026 3300025933 Bacteria 3135
450 Ga0207706_10076405 3300025933 Bacteria 2945
451 Ga0207706_10242643 3300025933 Bacteria 1575
452 Ga0207686_10321217 3300025934 Bacteria 1157
453 Ga0207686_10337897 3300025934 Bacteria 1130
454 Ga0207686_10436559 3300025934 Bacteria 1005
455 Ga0207709_10057323 3300025935 Bacteria 2415
456 Ga0207709_10498293 3300025935 Bacteria 950
457 Ga0207709_11384495 3300025935 Bacteria 582
458 Ga0207670_10042489 3300025936 Bacteria 2996
459 Ga0207670_10173122 3300025936 Bacteria 1620
460 Ga0207670_11044550 3300025936 Bacteria 688
461 Ga0207669_10091843 3300025937 Bacteria 1979
462 Ga0207669_10306401 3300025937 Bacteria 1209
463 Ga0207669_11599978 3300025937 Bacteria 556
464 Ga0207704_10052480 3300025938 Bacteria 2472
465 Ga0207704_10090214 3300025938 Bacteria 2010
466 Ga0207704_10635580 3300025938 Bacteria 877
467 Ga0207691_10006683 3300025940 Bacteria 11128
468 Ga0207691_10013074 3300025940 Bacteria 7947
469 Ga0207691_10511520 3300025940 Bacteria 1019
470 Ga0207691_10533542 3300025940 Bacteria 996
471 Ga0207691_10937740 3300025940 Bacteria 724
472 Ga0207711_10062031 3300025941 Bacteria 3224
473 Ga0207711_10210645 3300025941 Bacteria 1775
474 Ga0207711_10348250 3300025941 Bacteria 1371
475 Ga0207711_11004429 3300025941 Bacteria 774
476 Ga0207689_10016849 3300025942 Bacteria 6184
477 Ga0207689_10093996 3300025942 Bacteria 2463
478 Ga0207689_10210783 3300025942 Bacteria 1605
479 Ga0207689_10361906 3300025942 Bacteria 1206
480 Ga0207661_10885902 3300025944 Bacteria 822
481 Ga0207679_10010580 3300025945 Bacteria 5944
482 Ga0207679_11175581 3300025945 Bacteria 704
483 Ga0207651_10124808 3300025960 Bacteria 1959
484 Ga0207651_10431186 3300025960 Bacteria 1127
485 Ga0207651_11082875 3300025960 Bacteria 718
486 Ga0207651_11384842 3300025960 Unclassified 633
487 Ga0207712_10012927 3300025961 Bacteria 5343
488 Ga0207712_10014271 3300025961 Bacteria 5106
489 Ga0207712_10200265 3300025961 Bacteria 1583
490 Ga0207712_10504475 3300025961 Unclassified 1035
491 Ga0207712_10564921 3300025961 Bacteria 980
492 Ga0207712_10595075 3300025961 Bacteria 956
493 Ga0207712_11502376 3300025961 Bacteria 603
494 Ga0207668_10075539 3300025972 Bacteria 2423
495 Ga0207668_10077822 3300025972 Bacteria 2393
496 Ga0207668_10080580 3300025972 Bacteria 2359
497 Ga0207668_10368182 3300025972 Bacteria 1206
498 Ga0207668_11031175 3300025972 Bacteria 736
499 Ga0207668_11609342 3300025972 Unclassified 586
500 Ga0207640_11105611 3300025981 Unclassified 701
501 Ga0207658_10142087 3300025986 Bacteria 1944
502 Ga0207658_10251299 3300025986 Bacteria 1502
503 Ga0207658_10417956 3300025986 Bacteria 1182
504 Ga0207677_10012541 3300026023 Bacteria 4877
505 Ga0207677_10018313 3300026023 Bacteria 4200
506 Ga0207703_10106951 3300026035 Bacteria 2380
507 Ga0207703_10304703 3300026035 Bacteria 1454
508 Ga0207678_10105341 3300026067 Bacteria 2406
509 Ga0207678_11678271 3300026067 Bacteria 558
510 Ga0207708_10012122 3300026075 Bacteria 6427
511 Ga0207708_10194840 3300026075 Bacteria 1615
512 Ga0207708_10235602 3300026075 Bacteria 1471
513 Ga0207708_10804762 3300026075 Bacteria 809
514 Ga0207708_11015305 3300026075 Bacteria 721
515 Ga0207708_11643219 3300026075 Bacteria 564
516 Ga0207641_10010195 3300026088 Bacteria 7728
517 Ga0207641_10096679 3300026088 Bacteria 2594
518 Ga0207641_10345976 3300026088 Bacteria 1416
519 Ga0207641_10751872 3300026088 Bacteria 962
520 Ga0207648_10023641 3300026089 Bacteria 5502
521 Ga0207648_10063414 3300026089 Bacteria 3221
522 Ga0207648_10106830 3300026089 Bacteria 2456
523 Ga0207648_10223454 3300026089 Bacteria 1674
524 Ga0207648_10366120 3300026089 Bacteria 1301
525 Ga0207648_10968882 3300026089 Bacteria 796
526 Ga0207648_11321488 3300026089 Bacteria 677
527 Ga0207648_11532619 3300026089 Bacteria 627
528 Ga0207676_10019782 3300026095 Bacteria 4917
529 Ga0207676_10082454 3300026095 Bacteria 2616
530 Ga0207676_10304349 3300026095 Bacteria 1457
531 Ga0207676_10474926 3300026095 Bacteria 1183
532 Ga0207676_10619564 3300026095 Bacteria 1041
533 Ga0207674_10026419 3300026116 Bacteria 6166
534 Ga0207674_10123058 3300026116 Bacteria 2560
535 Ga0207674_10196272 3300026116 Bacteria 1968
536 Ga0207674_11466008 3300026116 Bacteria 652
537 Ga0207675_100036003 3300026118 Bacteria 4616
538 Ga0207675_100080760 3300026118 Unclassified 3049
539 Ga0207675_100144306 3300026118 Bacteria 2263
540 Ga0207675_101782767 3300026118 Bacteria 635
541 Ga0207675_102115521 3300026118 Bacteria 579
542 Ga0207683_10004189 3300026121 Bacteria 12475
543 Ga0207683_10026435 3300026121 Bacteria 5009
544 Ga0207683_10036059 3300026121 Bacteria 4304
545 Ga0207683_10096992 3300026121 Bacteria 2629
546 Ga0207683_10225473 3300026121 Bacteria 1708
547 Ga0207683_10236195 3300026121 Bacteria 1667
548 Ga0207698_10177208 3300026142 Bacteria 1884
549 Ga0207698_10546481 3300026142 Bacteria 1134
550 Ga0209996_1048531 3300027395 Bacteria 640
551 Ga0209971_1073673 3300027682 Bacteria 829
552 Ga0209966_1076339 3300027695 Bacteria 739
553 Ga0209966_1094405 3300027695 Bacteria 672
554 Ga0209813_10170245 3300027866 Bacteria 791
555 Ga0207428_10000145 3300027907 Bacteria 96603
556 Ga0207428_10001320 3300027907 Bacteria 26408
557 Ga0207428_10016469 3300027907 Bacteria 6358
558 Ga0207428_10016906 3300027907 Bacteria 6269
559 Ga0207428_10414799 3300027907 Bacteria 985
560 Ga0207428_10868373 3300027907 Bacteria 638
561 Ga0207428_10872268 3300027907 Unclassified 637
562 Ga0207428_10954322 3300027907 Bacteria 604
563 Ga0268266_10201258 3300028379 Bacteria 1823
564 Ga0268266_10312672 3300028379 Bacteria 1468
565 Ga0268266_10454172 3300028379 Bacteria 1218
566 Ga0268265_10052647 3300028380 Bacteria 3080
567 Ga0268265_10380506 3300028380 Bacteria 1298
568 Ga0268265_10582327 3300028380 Bacteria 1067
569 Ga0268265_11021814 3300028380 Bacteria 817
570 Ga0268264_10034986 3300028381 Bacteria 4135
571 Ga0268264_10364356 3300028381 Bacteria 1380
572 Ga0268264_12170231 3300028381 Bacteria 563
573 Ga0307408_100144977 3300031548 Bacteria 1868
574 Ga0307408_100881294 3300031548 Bacteria 818
575 Ga0307408_101094173 3300031548 Bacteria 739
576 Ga0307405_10068651 3300031731 Bacteria 2269
577 Ga0307405_10649592 3300031731 Bacteria 867
578 Ga0307413_11520415 3300031824 Bacteria 592
579 Ga0307410_10636298 3300031852 Bacteria 893
580 Ga0307407_10548329 3300031903 Bacteria 854
581 Ga0307412_10734238 3300031911 Unclassified 851
582 Ga0307412_10793872 3300031911 Bacteria 821
583 Ga0307412_11142175 3300031911 Bacteria 695
584 Ga0307416_100019139 3300032002 Bacteria 4847
585 Ga0307416_100235251 3300032002 Bacteria 1770
586 Ga0307416_100436162 3300032002 Bacteria 1359
587 Ga0307414_10492304 3300032004 Bacteria 1083
588 Ga0307414_11361221 3300032004 Bacteria 659
589 Ga0307411_10413033 3300032005 Bacteria 1119
590 Ga0373930_0165563 3300034816 Bacteria 561
591 Ga0373949_0270711 3300035090 Unclassified 531
592 Ga0373932_0407254 3300035112 Bacteria 527
593 Ga0373941_0025063 3300035115 Bacteria 1719
594 Ga0373941_0467946 3300035115 Bacteria 531
595 Ga0373946_0469923 3300035171 Bacteria 642
596 Ga0373955_0666729 3300035172 Bacteria 638
597 Ga0373942_0047470 3300035207 Bacteria 1193
598 Ga0373937_0840103 3300036401 Unclassified 867
599 Ga0395905_0344401 3300037471 Bacteria 1382
600 Ga0436364_0212192 3300037853 Bacteria 914
601 Ga0439436_0095566 3300041404 Unclassified 828
602 Ga0439453_0010722 3300041408 Bacteria 1517
603 Ga0451798_0651593 3300041458 Bacteria 627
604 Ga0451802_0658135 3300041460 Bacteria 868
605 Ga0451807_0292969 3300041486 Bacteria 709
606 Ga0451847_0936856 3300041503 Bacteria 1081
607 Ga0451853_2730727 3300041512 Bacteria 808
608 Ga0439441_114782 3300042001 Unclassified 614
609 Ga0439441_117313 3300042001 Bacteria 608
610 Ga0439443_079300 3300042003 Bacteria 608
611 Ga0439450_108418 3300042008 Bacteria 709
612 Ga0439457_068018 3300042014 Bacteria 810
613 Ga0439446_0048413 3300042156 Unclassified 1266
614 Ga0439446_0353809 3300042156 Bacteria 524
615 Ga0450908_036715 3300042184 Bacteria 849
616 Ga0439434_0176042 3300042435 Bacteria 715
617 Ga0439435_0034084 3300042436 Bacteria 1397
618 Ga0439444_0040513 3300042437 Bacteria 913
619 Ga0439464_0049752 3300042439 Bacteria 1210
620 Ga0439460_0055851 3300042461 Unclassified 1195
621 Ga0451577_1872515 3300042876 Bacteria 526
622 Ga0439440_0166329 3300042993 Bacteria 639
623 Ga0466963_0278579 3300044694 Bacteria 1175
624 Ga0451576_0167607 3300045051 Bacteria 2292
625 Ga0451576_0342767 3300045051 Bacteria 1564
626 Ga0451576_0692468 3300045051 Bacteria 1071
627 Ga0466967_1006806 3300045976 Bacteria 830
628 Ga0495629_0147284 3300046459 Unclassified 1637
629 Ga0495594_0094745 3300046499 Bacteria 1676
630 Ga0495644_0067774 3300046523 Bacteria 1341
631 Ga0495598_0021009 3300046537 Bacteria 1731
632 Ga0495621_0122564 3300046539 Bacteria 1006
633 Ga0495622_0129340 3300046557 Bacteria 1151
634 Ga0495633_0374296 3300046558 Bacteria 645
635 Ga0495656_0221025 3300046615 Bacteria 947
636 Ga0495659_0007000 3300046664 Bacteria 3572
637 Ga0495588_0567895 3300046674 Bacteria 594
638 Ga0495647_0200880 3300046681 Unclassified 874
639 Ga0495670_0027263 3300046691 Bacteria 2830
640 Ga0495589_0601755 3300046794 Bacteria 501
641 Ga0495604_1054687 3300047317 Bacteria 501
642 Ga0495676_0932165 3300047321 Unclassified 556
643 Ga0496100_0458457 3300048903 Bacteria 978
644 Ga0496100_0525880 3300048903 Bacteria 913
645 Ga0496101_0029122 3300048904 Bacteria 3862
646 Ga0496101_0195813 3300048904 Bacteria 1561
647 Ga0496101_0212710 3300048904 Bacteria 1498
648 Ga0496101_0403837 3300048904 Bacteria 1076
649 Ga0496102_0052076 3300048905 Bacteria 3729
650 Ga0496102_0152436 3300048905 Bacteria 2173
651 Ga0496103_0005501 3300048906 Bacteria 7577
652 Ga0496104_0001907 3300048907 Bacteria 18075
653 Ga0496104_0093240 3300048907 Bacteria 2880
654 Ga0496105_0358319 3300048908 Bacteria 1164
655 Ga0496106_1067673 3300048909 Bacteria 633
656 Ga0496107_0359816 3300048910 Bacteria 1083
657 Ga0496107_0811708 3300048910 Bacteria 685
658 Ga0496108_0019469 3300048911 Bacteria 5575
659 Ga0496108_0139429 3300048911 Bacteria 2089
660 Ga0496109_0056733 3300048912 Bacteria 3573
661 Ga0496109_0138246 3300048912 Bacteria 2277
662 Ga0496109_0383949 3300048912 Bacteria 1327
663 Ga0496109_0395410 3300048912 Bacteria 1306
664 Ga0496109_1663340 3300048912 Unclassified 572
665 Ga0496110_0089521 3300048913 Bacteria 2751
666 Ga0496110_0155837 3300048913 Bacteria 2069
667 Ga0496110_1517691 3300048913 Bacteria 580
668 Ga0496112_0040527 3300048915 Bacteria 4554
669 Ga0496112_0056241 3300048915 Bacteria 3871
670 Ga0496112_0150678 3300048915 Bacteria 2293
671 Ga0496113_0096380 3300048916 Bacteria 2287
672 Ga0496113_0944589 3300048916 Bacteria 681
673 Ga0496114_0056960 3300048917 Bacteria 3262
674 Ga0496115_0235989 3300048918 Bacteria 1508
675 Ga0501299_073019 3300049522 Bacteria 748
676 Ga0501300_069723 3300049523 Bacteria 567
677 Ga0501312_123065 3300049528 Bacteria 503
678 Ga0501031_0058179 3300049568 Unclassified 2519
679 Ga0501031_0108693 3300049568 Unclassified 1811
680 Ga0501032_0000237 3300049569 Bacteria 45922
681 Ga0501033_0023912 3300049570 Bacteria 4609
682 Ga0501033_0259118 3300049570 Bacteria 1231
683 Ga0501034_0004031 3300049571 Bacteria 16482
684 Ga0501036_0142401 3300049572 Bacteria 2023
685 Ga0501036_0821563 3300049572 Unclassified 765
686 Ga0501036_1000781 3300049572 Bacteria 684
687 Ga0501037_0003596 3300049573 Bacteria 11246
688 Ga0501038_0210359 3300049574 Bacteria 1556
689 Ga0501038_0234752 3300049574 Bacteria 1458
690 Ga0501038_0981877 3300049574 Unclassified 621
691 Ga0501039_0097073 3300049575 Bacteria 2298
692 Ga0501039_0111936 3300049575 Bacteria 2134
693 Ga0501039_0663414 3300049575 Bacteria 816
694 Ga0501039_1349872 3300049575 Unclassified 549
695 Ga0501040_0040606 3300049576 Bacteria 3166
696 Ga0501040_0120184 3300049576 Bacteria 1843
697 Ga0501040_0570250 3300049576 Bacteria 817
698 Ga0501040_1179575 3300049576 Bacteria 556
699 Ga0501041_0032044 3300049577 Bacteria 3177
700 Ga0501041_0325733 3300049577 Bacteria 969
701 Ga0501042_0012774 3300049578 Bacteria 5700
702 Ga0501042_0641865 3300049578 Bacteria 772
703 Ga0501043_0006788 3300049579 Bacteria 9137
704 Ga0501043_0603017 3300049579 Bacteria 811
705 Ga0501043_0806154 3300049579 Bacteria 679
706 Ga0501043_1078951 3300049579 Bacteria 568
707 Ga0501046_0049296 3300049580 Bacteria 3331
708 Ga0501046_0146437 3300049580 Bacteria 1783
709 Ga0501046_0716587 3300049580 Bacteria 704
710 Ga0501048_0066823 3300049582 Bacteria 2542
711 Ga0501048_0186578 3300049582 Bacteria 1470
712 Ga0501048_0377829 3300049582 Unclassified 1012
713 Ga0501069_0253416 3300049585 Unclassified 1027
714 Ga0501070_0772901 3300049586 Bacteria 756
715 Ga0501071_0018955 3300049587 Bacteria 4773
716 Ga0501071_0051359 3300049587 Bacteria 2971
717 Ga0501071_0066136 3300049587 Bacteria 2627
718 Ga0501071_0082276 3300049587 Unclassified 2357
719 Ga0501071_0509548 3300049587 Bacteria 923
720 Ga0501071_0585481 3300049587 Bacteria 858
721 Ga0501072_0020012 3300049588 Bacteria 5183
722 Ga0501072_0037121 3300049588 Bacteria 3822
723 Ga0501072_0150109 3300049588 Bacteria 1858
724 Ga0501072_0253178 3300049588 Bacteria 1402
725 Ga0501073_0136550 3300049589 Bacteria 1700
726 Ga0501074_0076991 3300049590 Bacteria 2394
727 Ga0501074_0094123 3300049590 Bacteria 2146
728 Ga0501074_0293119 3300049590 Unclassified 1156
729 Ga0501074_0521770 3300049590 Bacteria 841
730 Ga0501075_0030925 3300049591 Bacteria 3970
731 Ga0501075_0033244 3300049591 Bacteria 3837
732 Ga0501075_0057989 3300049591 Bacteria 2916
733 Ga0501076_0007854 3300049592 Bacteria 7775
734 Ga0501076_0016494 3300049592 Bacteria 5601
735 Ga0501076_0129878 3300049592 Bacteria 2043
736 Ga0501076_1114906 3300049592 Bacteria 650
737 Ga0501077_0006427 3300049593 Bacteria 7212
738 Ga0501077_0419295 3300049593 Bacteria 856
739 Ga0501077_0571107 3300049593 Bacteria 726
740 Ga0501209_177775 3300049656 Bacteria 649
741 Ga0501216_050558 3300049660 Bacteria 816
742 Ga0501223_113948 3300049663 Bacteria 567
743 Ga0501249_009633 3300049679 Bacteria 2010
744 Ga0501253_128055 3300049683 Bacteria 621
745 Ga0501260_027901 3300049689 Bacteria 639
746 Ga0501079_0013651 3300049741 Bacteria 6195
747 Ga0501079_0019924 3300049741 Bacteria 5124
748 Ga0501079_0087473 3300049741 Bacteria 2412
749 Ga0501079_0271479 3300049741 Bacteria 1326
750 Ga0501080_0056776 3300049742 Bacteria 3645
751 Ga0501080_0340565 3300049742 Bacteria 1355
752 Ga0501080_0983245 3300049742 Unclassified 733
753 Ga0501081_0008664 3300049743 Bacteria 6609
754 Ga0501081_0021457 3300049743 Bacteria 4310
755 Ga0501081_0027295 3300049743 Unclassified 3851
756 Ga0501081_0054764 3300049743 Bacteria 2756
757 Ga0501081_0326114 3300049743 Bacteria 1129
758 Ga0501081_0367165 3300049743 Bacteria 1062
759 Ga0501083_0554255 3300049744 Bacteria 748
760 Ga0501271_006991 3300049768 Bacteria 1130
761 Ga0501035_0657051 3300049822 Bacteria 849
762 Ga0501035_1152792 3300049822 Bacteria 603
763 Ga0501045_0056781 3300049824 Bacteria 2864
764 Ga0501045_0059388 3300049824 Unclassified 2801
765 Ga0501204_094790 3300049850 Bacteria 525
766 nmdc:mga03n38_835046_c1 3300050490 Bacteria 538
767 nmdc:mga0k408_13163_c1 3300050493 Bacteria 4532
768 nmdc:mga06z11_58516_c1 3300050494 Bacteria 2000
769 nmdc:mga06z11_887620_c1 3300050494 Bacteria 543
770 nmdc:mga04h51_269664_c1 3300050495 Bacteria 687
771 nmdc:mga07m45_783021_c1 3300050496 Bacteria 547
772 nmdc:mga05p37_100853_c1 3300050507 Bacteria 3556
773 nmdc:mga05p37_2157211_c1 3300050507 Bacteria 519
774 nmdc:mga05p37_2493_c1 3300050507 Bacteria 21412
775 nmdc:mga05p37_271912_c1 3300050507 Bacteria 2024
776 nmdc:mga05p37_278270_c1 3300050507 Unclassified 1997
777 nmdc:mga05p37_570624_c1 3300050507 Bacteria 1284
778 nmdc:mga05p37_593006_c1 3300050507 Bacteria 1252
779 nmdc:mga05p37_840252_c1 3300050507 Unclassified 999
780 nmdc:mga05p37_843046_c1 3300050507 Bacteria 997
781 nmdc:mga05p37_9859_c1 3300050507 Bacteria 11339
782 nmdc:mga09592_14575_c1 3300050508 Bacteria 6417
783 nmdc:mga09592_163737_c1 3300050508 Bacteria 1922
784 nmdc:mga09592_236080_c1 3300050508 Bacteria 1584
785 nmdc:mga09592_36899_c1 3300050508 Bacteria 4096
786 nmdc:mga09592_80046_c1 3300050508 Bacteria 2782
787 nmdc:mga09592_838_c1 3300050508 Bacteria 23869
788 nmdc:mga0qj67_20507_c1 3300050509 Bacteria 5062
789 nmdc:mga0qj67_395379_c1 3300050509 Bacteria 1116
790 nmdc:mga0qj67_456040_c1 3300050509 Bacteria 1029
791 nmdc:mga0qj67_47913_c1 3300050509 Bacteria 3377
792 nmdc:mga0qj67_515112_c1 3300050509 Bacteria 961
793 nmdc:mga0qj67_974685_c1 3300050509 Bacteria 666
794 nmdc:mga06r32_1000793_c1 3300050510 Unclassified 789
795 nmdc:mga06r32_37468_c1 3300050510 Bacteria 4586
796 nmdc:mga06r32_381870_c1 3300050510 Bacteria 1392
797 nmdc:mga06r32_423290_c1 3300050510 Bacteria 1313
798 nmdc:mga06r32_52997_c1 3300050510 Bacteria 3886
799 nmdc:mga06r32_58399_c1 3300050510 Bacteria 3708
800 nmdc:mga06r32_730467_c1 3300050510 Bacteria 954
801 nmdc:mga06r32_767541_c1 3300050510 Bacteria 926
802 nmdc:mga06r32_831309_c1 3300050510 Bacteria 883
803 nmdc:mga06r32_839620_c1 3300050510 Bacteria 877
804 nmdc:mga08y16_1257571_c1 3300050511 Unclassified 709
805 nmdc:mga08y16_161231_c1 3300050511 Bacteria 2330
806 nmdc:mga08y16_1751026_c1 3300050511 Bacteria 575
807 nmdc:mga08y16_1791_c1 3300050511 Bacteria 21772
808 nmdc:mga08y16_193035_c1 3300050511 Unclassified 2112
809 nmdc:mga08y16_19556_c1 3300050511 Bacteria 7140
810 nmdc:mga08y16_217942_c1 3300050511 Bacteria 1976
811 nmdc:mga08y16_24356_c1 3300050511 Bacteria 6389
812 nmdc:mga08y16_678244_c1 3300050511 Bacteria 1032
813 nmdc:mga0n895_1828258_c1 3300050512 Bacteria 568
814 nmdc:mga0n895_1837840_c1 3300050512 Bacteria 566
815 nmdc:mga0n895_485897_c1 3300050512 Bacteria 1245
816 nmdc:mga0n895_776185_c1 3300050512 Bacteria 950
817 nmdc:mga0n895_884380_c1 3300050512 Bacteria 879
818 nmdc:mga0rr50_89377_c1 3300050513 Bacteria 2395
819 nmdc:mga08x19_727369_c1 3300050514 Unclassified 704
820 nmdc:mga0a205_314213_c1 3300050515 Bacteria 1438
821 nmdc:mga0a205_483408_c1 3300050515 Bacteria 1096
822 nmdc:mga0a205_48581_c1 3300050515 Bacteria 4095
823 nmdc:mga0a205_704147_c1 3300050515 Bacteria 860
824 nmdc:mga0a205_95604_c1 3300050515 Bacteria 2870
825 Ga0495601_0576111 3300053077 Bacteria 723
826 Ga0500557_104041 3300053105 Bacteria 943
827 Ga0500628_192836 3300053129 Bacteria 585
828 Ga0501084_0030994 3300054114 Bacteria 4472
829 Ga0501084_0072474 3300054114 Bacteria 2885
830 Ga0501084_0074252 3300054114 Bacteria 2848
831 Ga0501084_0766805 3300054114 Bacteria 813
832 Ga0501084_0939790 3300054114 Bacteria 727
833 Ga0590071_000004 3300059421 Bacteria 63957
834 Ga0590074_006611 3300059423 Bacteria 1924
835 Ga0590075_000034 3300059424 Bacteria 36053
836 Ga0590075_005531 3300059424 Bacteria 2983
837 Ga0590077_000015 3300059426 Bacteria 38773
838 Ga0590077_035691 3300059426 Bacteria 1095
839 Ga0587084_082551 3300059477 Bacteria 625
840 Ga0501082_0057335 3300060353 Bacteria 3356
841 Ga0501082_0174094 3300060353 Bacteria 1871
842 Ga0501082_0503468 3300060353 Bacteria 1059
843 Ga0501082_1312796 3300060353 Unclassified 632
844 Ga0530510_0002721 3300061734 Bacteria 12172
845 Ga0530510_0060475 3300061734 Bacteria 2742
846 Ga0157380_10572927
847 ARSoilOldRDRAFT_c023916
848 JGI24746J21847_1000822
849 JGI24750J21931_1023674
850 JGI24749J21850_1011113
851 JGI24033J26618_1005083
852 JGI24034J26672_10073417
853 JGI24751J29686_10099292
854 Ga0058859_11696539
855 Ga0058859_11734270
856 Ga0058859_11821480
857 Ga0058860_10028117
858 Ga0058860_12048476
859 Ga0065714_10092071
860 Ga0065714_10299846
861 Ga0065714_10323179
862 Ga0065704_10028580
863 Ga0065704_10806494
864 Ga0065712_10001046
865 Ga0065712_10003403
866 Ga0065712_10068906
867 Ga0065712_10130494
868 Ga0065712_10499758
869 Ga0065715_10000581
870 Ga0065715_10004703
871 Ga0065715_10011604
872 Ga0065715_10024005
873 Ga0065715_10133606
874 Ga0065715_10629012
875 Ga0065715_11012658
876 Ga0065707_10003441
877 Ga0065707_10100281
878 Ga0065707_10106177
879 Ga0065707_10112481
880 Ga0065707_10188352
881 Ga0065707_10977681
882 Ga0065707_11031293
883 Ga0070676_10183738
884 Ga0070676_10244922
885 Ga0070676_10633168
886 Ga0070676_10913365
887 Ga0070683_100710157
888 Ga0070690_100176353
889 Ga0070690_100886445
890 Ga0070690_101373624
891 Ga0070670_100048911
892 Ga0070670_100077702
893 Ga0070670_100171936
894 Ga0070670_100994039
895 Ga0070677_10003426
896 Ga0070677_10007651
897 Ga0070677_10428521
898 Ga0068869_100086639
899 Ga0068869_100297730
900 Ga0068869_101493981
901 Ga0068869_101846440
902 Ga0070666_10016876
903 Ga0070666_10078906
904 Ga0070666_10507394
905 Ga0070680_100841961
906 Ga0068868_100052939
907 Ga0068868_100509123
908 Ga0068868_101335484
909 Ga0070660_100482956
910 Ga0070689_100041895
911 Ga0070689_100137763
912 Ga0070691_10619784
913 Ga0070687_100002212
914 Ga0070661_100004568
915 Ga0070692_10100341
916 Ga0070692_10454118
917 Ga0070668_100025506
918 Ga0070668_100129676
919 Ga0070668_100231304
920 Ga0070668_100522437
921 Ga0070669_100002113
922 Ga0070669_100040146
923 Ga0070669_100101648
924 Ga0070675_100050974
925 Ga0070675_100066667
926 Ga0070675_100366345
927 Ga0070675_100513750
928 Ga0070675_100519632
929 Ga0070675_102101437
930 Ga0070671_100025748
931 Ga0070671_100108435
932 Ga0070671_100335018
933 Ga0070671_100754393
934 Ga0070671_100921602
935 Ga0070674_100044795
936 Ga0070674_100099861
937 Ga0070674_100224870
938 Ga0070674_100501400
939 Ga0070674_100856494
940 Ga0070673_100014246
941 Ga0070673_100071186
942 Ga0070673_100185303
943 Ga0070673_100473262
944 Ga0070673_101175969
945 Ga0070673_101723214
946 Ga0070688_100020371
947 Ga0070688_100064288
948 Ga0070659_100023676
949 Ga0070659_100586728
950 Ga0070667_100015278
951 Ga0070667_100072773
952 Ga0070667_100839092
953 Ga0070709_10643829
954 Ga0070714_100021676
955 Ga0070713_100273372
956 Ga0070713_100785531
957 Ga0070710_10924356
958 Ga0070701_10004868
959 Ga0070701_10117588
960 Ga0070705_100150310
961 Ga0070700_100009261
962 Ga0070694_100070037
963 Ga0070694_101655583
964 Ga0070708_100573582
965 Ga0070708_100765801
966 Ga0070708_101506703
967 Ga0070663_100220309
968 Ga0070678_100006322
969 Ga0070678_100015995
970 Ga0070678_100032407
971 Ga0070678_100117318
972 Ga0070678_100646991
973 Ga0070678_101005289
974 Ga0070678_101254941
975 Ga0070662_100027328
976 Ga0070662_100114546
977 Ga0070662_100133600
978 Ga0070662_100205690
979 Ga0068867_100006808
980 Ga0068867_100035299
981 Ga0068867_100045741
982 Ga0068867_100134029
983 Ga0068867_100419499
984 Ga0068867_101446560
985 Ga0070685_10123759
986 Ga0070685_10257128
987 Ga0070685_10313660
988 Ga0070707_100189373
989 Ga0070707_100426322
990 Ga0070698_100064592
991 Ga0070698_100514102
992 Ga0070698_100641453
993 Ga0070698_100832421
994 Ga0070698_101486398
995 Ga0070699_100297480
996 Ga0070699_101841347
997 Ga0070697_100235101
998 Ga0070697_100724985
999 Ga0068853_100686696
1000 Ga0068853_100884216
1001 Ga0070672_100001241
1002 Ga0070672_100099345
1003 Ga0070672_100118125
1004 Ga0070672_100495712
1005 Ga0070672_100538286
1006 Ga0070672_101138552
1007 Ga0070686_100014346
1008 Ga0070686_100323350
1009 Ga0070686_101131486
1010 Ga0070686_101307211
1011 Ga0070695_100108003
1012 Ga0070695_100303612
1013 Ga0070695_100379929
1014 Ga0070695_100868020
1015 Ga0070696_100322027
1016 Ga0070696_100371785
1017 Ga0070696_100379832
1018 Ga0070696_101055641
1019 Ga0070665_100004684
1020 Ga0070665_100068354
1021 Ga0070665_101119945
1022 Ga0070665_101721951
1023 Ga0070704_100159640
1024 Ga0070704_100171313
1025 Ga0070664_100007220
1026 Ga0070664_100432307
1027 Ga0070664_101621690
1028 Ga0068857_100028753
1029 Ga0068857_100236405
1030 Ga0068857_101378248
1031 Ga0068856_101295331
1032 Ga0070702_100080815
1033 Ga0070702_100085387
1034 Ga0070702_100192609
1035 Ga0070702_100700797
1036 Ga0070702_101503583
1037 Ga0068852_100296500
1038 Ga0068859_100149707
1039 Ga0068859_100190064
1040 Ga0068859_100616066
1041 Ga0068859_101029123
1042 Ga0068859_101296843
1043 Ga0068864_100033795
1044 Ga0068864_100036429
1045 Ga0068864_100321238
1046 Ga0068864_100854766
1047 Ga0068864_101644119
1048 Ga0068864_101896637
1049 Ga0068866_10035462
1050 Ga0068866_10638174
1051 Ga0068866_11040234
1052 Ga0068866_11377753
1053 Ga0068861_100076625
1054 Ga0068861_100140934
1055 Ga0068861_100190316
1056 Ga0068861_101671982
1057 Ga0068851_10284795
1058 Ga0068870_10001021
1059 Ga0068870_10016745
1060 Ga0068863_100055480
1061 Ga0068863_100540646
1062 Ga0068863_100768357
1063 Ga0068863_101205543
1064 Ga0068858_100020186
1065 Ga0068858_100145851
1066 Ga0068860_100026033
1067 Ga0068862_100044718
1068 Ga0068862_100127785
1069 Ga0068862_100160722
1070 Ga0068862_100243863
1071 Ga0068862_100268718
1072 Ga0068862_100354527
1073 Ga0068862_100420135
1074 Ga0068862_100663811
1075 Ga0068862_101851482
1076 Ga0081455_10115803
1077 Ga0081455_10165655
1078 Ga0081538_10115722
1079 Ga0075363_100937770
1080 Ga0075432_10312463
1081 Ga0070715_10000006
1082 Ga0070712_100123526
1083 Ga0075367_10018831
1084 Ga0075366_10092952
1085 Ga0097621_100196586
1086 Ga0097621_100375208
1087 Ga0097621_100494827
1088 Ga0075370_10578792
1089 Ga0068871_100120720
1090 Ga0068871_100378022
1091 Ga0068871_100428730
1092 Ga0068871_101188472
1093 Ga0075428_100011112
1094 Ga0075428_100011725
1095 Ga0075428_100018506
1096 Ga0075428_100035203
1097 Ga0075428_100253814
1098 Ga0075428_100334102
1099 Ga0075428_100340511
1100 Ga0075428_100431942
1101 Ga0075428_101390848
1102 Ga0075430_100000134
1103 Ga0075430_100009714
1104 Ga0075430_100035788
1105 Ga0075430_100110640
1106 Ga0075430_100164743
1107 Ga0075430_100220805
1108 Ga0075430_100221468
1109 Ga0075430_100678418
1110 Ga0075430_101335474
1111 Ga0075431_100000927
1112 Ga0075431_100011812
1113 Ga0075431_100018271
1114 Ga0075431_100043528
1115 Ga0075431_100053722
1116 Ga0075431_100071770
1117 Ga0075431_100096023
1118 Ga0075431_100119877
1119 Ga0075431_100361279
1120 Ga0075431_100797529
1121 Ga0075431_101263383
1122 Ga0075433_10008760
1123 Ga0075433_10037184
1124 Ga0075433_10081580
1125 Ga0075433_10265934
1126 Ga0075433_10434755
1127 Ga0075434_100027241
1128 Ga0075434_100045701
1129 Ga0075434_100880305
1130 Ga0075429_100002939
1131 Ga0075429_100011009
1132 Ga0075429_100026938
1133 Ga0075429_100047421
1134 Ga0075429_100095793
1135 Ga0075429_100219280
1136 Ga0075429_100250491
1137 Ga0068865_100509358
1138 Ga0068865_100652350
1139 Ga0068865_100707842
1140 Ga0068865_101117512
1141 Ga0068865_102194755
1142 Ga0097620_100149700
1143 Ga0097620_100190054
1144 Ga0097620_100616002
1145 Ga0097620_101029225
1146 Ga0097620_101296831
1147 Ga0075435_100092652
1148 Ga0075435_100101883
1149 Ga0105240_11003476
1150 Ga0111539_10000615
1151 Ga0111539_10001913
1152 Ga0111539_10004464
1153 Ga0111539_10019208
1154 Ga0111539_10097062
1155 Ga0111539_10160958
1156 Ga0111539_10302555
1157 Ga0111539_10408221
1158 Ga0111539_10677067
1159 Ga0111539_10787146
1160 Ga0105245_10125849
1161 Ga0105245_10314082
1162 Ga0105247_10284669
1163 Ga0114129_10003815
1164 Ga0114129_10010159
1165 Ga0114129_10015898
1166 Ga0114129_10081662
1167 Ga0114129_10099417
1168 Ga0114129_10099778
1169 Ga0114129_10355268
1170 Ga0114129_10918531
1171 Ga0114129_11730638
1172 Ga0114129_12387029
1173 Ga0105243_10283201
1174 Ga0105243_10363583
1175 Ga0105243_10472947
1176 Ga0105243_10545714
1177 Ga0105243_10548797
1178 Ga0105241_10191221
1179 Ga0105242_10045413
1180 Ga0105242_10426383
1181 Ga0105242_10770303
1182 Ga0105242_11113013
1183 Ga0105242_12574650
1184 Ga0105248_10033347
1185 Ga0105248_10040222
1186 Ga0105248_10186848
1187 Ga0105248_10930432
1188 Ga0105248_11522023
1189 Ga0105237_12149452
1190 Ga0105238_10683509
1191 Ga0105249_10000428
1192 Ga0105249_10037296
1193 Ga0105249_11077569
1194 Ga0105249_12335601
1195 Ga0105246_10026325
1196 Ga0105246_10037450
1197 Ga0105246_10115066
1198 Ga0105246_10268062
1199 Ga0105246_11023627
1200 Ga0105246_12139951
1201 Ga0157347_1011957
1202 Ga0157371_11004402
1203 Ga0157370_11366147
1204 Ga0157374_10090342
1205 Ga0157378_10447959
1206 Ga0157378_11480375
1207 Ga0163162_10139116
1208 Ga0163162_10603038
1209 Ga0163162_11124601
1210 Ga0163162_11734261
1211 Ga0157375_10047796
1212 Ga0157375_10120410
1213 Ga0157375_10134620
1214 Ga0157375_10165302
1215 Ga0157375_12820227
1216 Ga0163163_10160814
1217 Ga0163163_10428280
1218 Ga0163163_10604817
1219 Ga0157380_10853951
1220 Ga0157380_11634311
1221 Ga0157380_12389490
1222 Ga0157377_10004104
1223 Ga0157377_10121385
1224 Ga0157377_10209007
1225 Ga0157377_10244866
1226 Ga0157377_10260759
1227 Ga0157379_10093226
1228 Ga0157379_10353854
1229 Ga0157379_10846098
1230 Ga0157379_11062374
1231 Ga0157379_11613497
1232 Ga0157376_11530193
1233 Ga0163161_10002809
1234 Ga0163161_10077543
1235 Ga0163161_10122892
1236 Ga0163161_10904032
1237 Ga0163161_11503188
1238 Ga0207697_10004014
1239 Ga0207697_10020493
1240 Ga0207697_10255844
1241 Ga0207682_10001460
1242 Ga0207682_10006626
1243 Ga0207682_10199036
1244 Ga0207642_10068548
1245 Ga0207642_10215671
1246 Ga0207642_10650591
1247 Ga0207642_11002144
1248 Ga0207688_10000703
1249 Ga0207688_10258797
1250 Ga0207688_10270047
1251 Ga0207680_10046509
1252 Ga0207680_10082875
1253 Ga0207680_10125110
1254 Ga0207680_10504000
1255 Ga0207685_10000010
1256 Ga0207699_10333635
1257 Ga0207645_10000065
1258 Ga0207645_10121288
1259 Ga0207643_10001402
1260 Ga0207643_10008096
1261 Ga0207643_10074218
1262 Ga0207684_10666518
1263 Ga0207707_10672963
1264 Ga0207707_11034457
1265 Ga0207695_10803587
1266 Ga0207693_10222525
1267 Ga0207662_10112081
1268 Ga0207646_10203257
1269 Ga0207646_11245931
1270 Ga0207646_11921164
1271 Ga0207681_10011850
1272 Ga0207681_10073826
1273 Ga0207681_10139029
1274 Ga0207681_10341314
1275 Ga0207694_11044371
1276 Ga0207650_10037052
1277 Ga0207650_10088665
1278 Ga0207650_10533149
1279 Ga0207659_10024304
1280 Ga0207659_10033239
1281 Ga0207659_10045591
1282 Ga0207659_10083984
1283 Ga0207687_10319104
1284 Ga0207687_10351137
1285 Ga0207687_10879929
1286 Ga0207700_10011013
1287 Ga0207700_10648826
1288 Ga0207664_10054644
1289 Ga0207644_10072096
1290 Ga0207644_10288919
1291 Ga0207644_10396386
1292 Ga0207690_10437916
1293 Ga0207706_10013309
1294 Ga0207706_10068026
1295 Ga0207706_10076405
1296 Ga0207706_10242643
1297 Ga0207686_10321217
1298 Ga0207686_10337897
1299 Ga0207686_10436559
1300 Ga0207709_10057323
1301 Ga0207709_10498293
1302 Ga0207709_11384495
1303 Ga0207670_10042489
1304 Ga0207670_10173122
1305 Ga0207670_11044550
1306 Ga0207669_10091843
1307 Ga0207669_10306401
1308 Ga0207669_11599978
1309 Ga0207704_10052480
1310 Ga0207704_10090214
1311 Ga0207704_10635580
1312 Ga0207691_10006683
1313 Ga0207691_10013074
1314 Ga0207691_10511520
1315 Ga0207691_10533542
1316 Ga0207691_10937740
1317 Ga0207711_10062031
1318 Ga0207711_10210645
1319 Ga0207711_10348250
1320 Ga0207711_11004429
1321 Ga0207689_10016849
1322 Ga0207689_10093996
1323 Ga0207689_10210783
1324 Ga0207689_10361906
1325 Ga0207661_10885902
1326 Ga0207679_10010580
1327 Ga0207679_11175581
1328 Ga0207651_10124808
1329 Ga0207651_10431186
1330 Ga0207651_11082875
1331 Ga0207651_11384842
1332 Ga0207712_10012927
1333 Ga0207712_10014271
1334 Ga0207712_10200265
1335 Ga0207712_10504475
1336 Ga0207712_10564921
1337 Ga0207712_10595075
1338 Ga0207712_11502376
1339 Ga0207668_10075539
1340 Ga0207668_10077822
1341 Ga0207668_10080580
1342 Ga0207668_10368182
1343 Ga0207668_11031175
1344 Ga0207668_11609342
1345 Ga0207640_11105611
1346 Ga0207658_10142087
1347 Ga0207658_10251299
1348 Ga0207658_10417956
1349 Ga0207677_10012541
1350 Ga0207677_10018313
1351 Ga0207703_10106951
1352 Ga0207703_10304703
1353 Ga0207678_10105341
1354 Ga0207678_11678271
1355 Ga0207708_10012122
1356 Ga0207708_10194840
1357 Ga0207708_10235602
1358 Ga0207708_10804762
1359 Ga0207708_11015305
1360 Ga0207708_11643219
1361 Ga0207641_10010195
1362 Ga0207641_10096679
1363 Ga0207641_10345976
1364 Ga0207641_10751872
1365 Ga0207648_10023641
1366 Ga0207648_10063414
1367 Ga0207648_10106830
1368 Ga0207648_10223454
1369 Ga0207648_10366120
1370 Ga0207648_10968882
1371 Ga0207648_11321488
1372 Ga0207648_11532619
1373 Ga0207676_10019782
1374 Ga0207676_10082454
1375 Ga0207676_10304349
1376 Ga0207676_10474926
1377 Ga0207676_10619564
1378 Ga0207674_10026419
1379 Ga0207674_10123058
1380 Ga0207674_10196272
1381 Ga0207674_11466008
1382 Ga0207675_100036003
1383 Ga0207675_100080760
1384 Ga0207675_100144306
1385 Ga0207675_101782767
1386 Ga0207675_102115521
1387 Ga0207683_10004189
1388 Ga0207683_10026435
1389 Ga0207683_10036059
1390 Ga0207683_10096992
1391 Ga0207683_10225473
1392 Ga0207683_10236195
1393 Ga0207698_10177208
1394 Ga0207698_10546481
1395 Ga0209996_1048531
1396 Ga0209971_1073673
1397 Ga0209966_1076339
1398 Ga0209966_1094405
1399 Ga0209813_10170245
1400 Ga0207428_10000145
1401 Ga0207428_10001320
1402 Ga0207428_10016469
1403 Ga0207428_10016906
1404 Ga0207428_10414799
1405 Ga0207428_10868373
1406 Ga0207428_10872268
1407 Ga0207428_10954322
1408 Ga0268266_10201258
1409 Ga0268266_10312672
1410 Ga0268266_10454172
1411 Ga0268265_10052647
1412 Ga0268265_10380506
1413 Ga0268265_10582327
1414 Ga0268265_11021814
1415 Ga0268264_10034986
1416 Ga0268264_10364356
1417 Ga0268264_12170231
1418 Ga0307408_100144977
1419 Ga0307408_100881294
1420 Ga0307408_101094173
1421 Ga0307405_10068651
1422 Ga0307405_10649592
1423 Ga0307413_11520415
1424 Ga0307410_10636298
1425 Ga0307407_10548329
1426 Ga0307412_10734238
1427 Ga0307412_10793872
1428 Ga0307412_11142175
1429 Ga0307416_100019139
1430 Ga0307416_100235251
1431 Ga0307416_100436162
1432 Ga0307414_10492304
1433 Ga0307414_11361221
1434 Ga0307411_10413033
1435 Ga0373930_0165563
1436 Ga0373949_0270711
1437 Ga0373932_0407254
1438 Ga0373941_0025063
1439 Ga0373941_0467946
1440 Ga0373946_0469923
1441 Ga0373955_0666729
1442 Ga0373942_0047470
1443 Ga0373937_0840103
1444 Ga0395905_0344401
1445 Ga0436364_0212192
1446 Ga0439436_0095566
1447 Ga0439453_0010722
1448 Ga0451798_0651593
1449 Ga0451802_0658135
1450 Ga0451807_0292969
1451 Ga0451847_0936856
1452 Ga0451853_2730727
1453 Ga0439441_114782
1454 Ga0439441_117313
1455 Ga0439443_079300
1456 Ga0439450_108418
1457 Ga0439457_068018
1458 Ga0439446_0048413
1459 Ga0439446_0353809
1460 Ga0450908_036715
1461 Ga0439434_0176042
1462 Ga0439435_0034084
1463 Ga0439444_0040513
1464 Ga0439464_0049752
1465 Ga0439460_0055851
1466 Ga0451577_1872515
1467 Ga0439440_0166329
1468 Ga0466963_0278579
1469 Ga0451576_0167607
1470 Ga0451576_0342767
1471 Ga0451576_0692468
1472 Ga0466967_1006806
1473 Ga0495629_0147284
1474 Ga0495594_0094745
1475 Ga0495644_0067774
1476 Ga0495598_0021009
1477 Ga0495621_0122564
1478 Ga0495622_0129340
1479 Ga0495633_0374296
1480 Ga0495656_0221025
1481 Ga0495659_0007000
1482 Ga0495588_0567895
1483 Ga0495647_0200880
1484 Ga0495670_0027263
1485 Ga0495589_0601755
1486 Ga0495604_1054687
1487 Ga0495676_0932165
1488 Ga0496100_0458457
1489 Ga0496100_0525880
1490 Ga0496101_0029122
1491 Ga0496101_0195813
1492 Ga0496101_0212710
1493 Ga0496101_0403837
1494 Ga0496102_0052076
1495 Ga0496102_0152436
1496 Ga0496103_0005501
1497 Ga0496104_0001907
1498 Ga0496104_0093240
1499 Ga0496105_0358319
1500 Ga0496106_1067673
1501 Ga0496107_0359816
1502 Ga0496107_0811708
1503 Ga0496108_0019469
1504 Ga0496108_0139429
1505 Ga0496109_0056733
1506 Ga0496109_0138246
1507 Ga0496109_0383949
1508 Ga0496109_0395410
1509 Ga0496109_1663340
1510 Ga0496110_0089521
1511 Ga0496110_0155837
1512 Ga0496110_1517691
1513 Ga0496112_0040527
1514 Ga0496112_0056241
1515 Ga0496112_0150678
1516 Ga0496113_0096380
1517 Ga0496113_0944589
1518 Ga0496114_0056960
1519 Ga0496115_0235989
1520 Ga0501299_073019
1521 Ga0501300_069723
1522 Ga0501312_123065
1523 Ga0501031_0058179
1524 Ga0501031_0108693
1525 Ga0501032_0000237
1526 Ga0501033_0023912
1527 Ga0501033_0259118
1528 Ga0501034_0004031
1529 Ga0501036_0142401
1530 Ga0501036_0821563
1531 Ga0501036_1000781
1532 Ga0501037_0003596
1533 Ga0501038_0210359
1534 Ga0501038_0234752
1535 Ga0501038_0981877
1536 Ga0501039_0097073
1537 Ga0501039_0111936
1538 Ga0501039_0663414
1539 Ga0501039_1349872
1540 Ga0501040_0040606
1541 Ga0501040_0120184
1542 Ga0501040_0570250
1543 Ga0501040_1179575
1544 Ga0501041_0032044
1545 Ga0501041_0325733
1546 Ga0501042_0012774
1547 Ga0501042_0641865
1548 Ga0501043_0006788
1549 Ga0501043_0603017
1550 Ga0501043_0806154
1551 Ga0501043_1078951
1552 Ga0501046_0049296
1553 Ga0501046_0146437
1554 Ga0501046_0716587
1555 Ga0501048_0066823
1556 Ga0501048_0186578
1557 Ga0501048_0377829
1558 Ga0501069_0253416
1559 Ga0501070_0772901
1560 Ga0501071_0018955
1561 Ga0501071_0051359
1562 Ga0501071_0066136
1563 Ga0501071_0082276
1564 Ga0501071_0509548
1565 Ga0501071_0585481
1566 Ga0501072_0020012
1567 Ga0501072_0037121
1568 Ga0501072_0150109
1569 Ga0501072_0253178
1570 Ga0501073_0136550
1571 Ga0501074_0076991
1572 Ga0501074_0094123
1573 Ga0501074_0293119
1574 Ga0501074_0521770
1575 Ga0501075_0030925
1576 Ga0501075_0033244
1577 Ga0501075_0057989
1578 Ga0501076_0007854
1579 Ga0501076_0016494
1580 Ga0501076_0129878
1581 Ga0501076_1114906
1582 Ga0501077_0006427
1583 Ga0501077_0419295
1584 Ga0501077_0571107
1585 Ga0501209_177775
1586 Ga0501216_050558
1587 Ga0501223_113948
1588 Ga0501249_009633
1589 Ga0501253_128055
1590 Ga0501260_027901
1591 Ga0501079_0013651
1592 Ga0501079_0019924
1593 Ga0501079_0087473
1594 Ga0501079_0271479
1595 Ga0501080_0056776
1596 Ga0501080_0340565
1597 Ga0501080_0983245
1598 Ga0501081_0008664
1599 Ga0501081_0021457
1600 Ga0501081_0027295
1601 Ga0501081_0054764
1602 Ga0501081_0326114
1603 Ga0501081_0367165
1604 Ga0501083_0554255
1605 Ga0501271_006991
1606 Ga0501035_0657051
1607 Ga0501035_1152792
1608 Ga0501045_0056781
1609 Ga0501045_0059388
1610 Ga0501204_094790
1611 nmdc:mga03n38_835046_c1
1612 nmdc:mga0k408_13163_c1
1613 nmdc:mga06z11_58516_c1
1614 nmdc:mga06z11_887620_c1
1615 nmdc:mga04h51_269664_c1
1616 nmdc:mga07m45_783021_c1
1617 nmdc:mga05p37_100853_c1
1618 nmdc:mga05p37_2157211_c1
1619 nmdc:mga05p37_2493_c1
1620 nmdc:mga05p37_271912_c1
1621 nmdc:mga05p37_278270_c1
1622 nmdc:mga05p37_570624_c1
1623 nmdc:mga05p37_593006_c1
1624 nmdc:mga05p37_840252_c1
1625 nmdc:mga05p37_843046_c1
1626 nmdc:mga05p37_9859_c1
1627 nmdc:mga09592_14575_c1
1628 nmdc:mga09592_163737_c1
1629 nmdc:mga09592_236080_c1
1630 nmdc:mga09592_36899_c1
1631 nmdc:mga09592_80046_c1
1632 nmdc:mga09592_838_c1
1633 nmdc:mga0qj67_20507_c1
1634 nmdc:mga0qj67_395379_c1
1635 nmdc:mga0qj67_456040_c1
1636 nmdc:mga0qj67_47913_c1
1637 nmdc:mga0qj67_515112_c1
1638 nmdc:mga0qj67_974685_c1
1639 nmdc:mga06r32_1000793_c1
1640 nmdc:mga06r32_37468_c1
1641 nmdc:mga06r32_381870_c1
1642 nmdc:mga06r32_423290_c1
1643 nmdc:mga06r32_52997_c1
1644 nmdc:mga06r32_58399_c1
1645 nmdc:mga06r32_730467_c1
1646 nmdc:mga06r32_767541_c1
1647 nmdc:mga06r32_831309_c1
1648 nmdc:mga06r32_839620_c1
1649 nmdc:mga08y16_1257571_c1
1650 nmdc:mga08y16_161231_c1
1651 nmdc:mga08y16_1751026_c1
1652 nmdc:mga08y16_1791_c1
1653 nmdc:mga08y16_193035_c1
1654 nmdc:mga08y16_19556_c1
1655 nmdc:mga08y16_217942_c1
1656 nmdc:mga08y16_24356_c1
1657 nmdc:mga08y16_678244_c1
1658 nmdc:mga0n895_1828258_c1
1659 nmdc:mga0n895_1837840_c1
1660 nmdc:mga0n895_485897_c1
1661 nmdc:mga0n895_776185_c1
1662 nmdc:mga0n895_884380_c1
1663 nmdc:mga0rr50_89377_c1
1664 nmdc:mga08x19_727369_c1
1665 nmdc:mga0a205_314213_c1
1666 nmdc:mga0a205_483408_c1
1667 nmdc:mga0a205_48581_c1
1668 nmdc:mga0a205_704147_c1
1669 nmdc:mga0a205_95604_c1
1670 Ga0495601_0576111
1671 Ga0500557_104041
1672 Ga0500628_192836
1673 Ga0501084_0030994
1674 Ga0501084_0072474
1675 Ga0501084_0074252
1676 Ga0501084_0766805
1677 Ga0501084_0939790
1678 Ga0590071_000004
1679 Ga0590074_006611
1680 Ga0590075_000034
1681 Ga0590075_005531
1682 Ga0590077_000015
1683 Ga0590077_035691
1684 Ga0587084_082551
1685 Ga0501082_0057335
1686 Ga0501082_0174094
1687 Ga0501082_0503468
1688 Ga0501082_1312796
1689 Ga0530510_0002721
1690 Ga0530510_0060475

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02201

SWIB

SWIB/MDM2 domain

31

104

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ltj-assembly1.cif.gz_P structure of nucleosome-bound human baf complex 0.9123 23 94
1uhr-assembly1.cif.gz_A solution structure of the swib domain of mouse brg1-associated factor 60a 0.9035 21 94
1v31-assembly1.cif.gz_A solution structure of the swib/mdm2 domain of the hypothetical protein at5g14170 from arabidopsis thaliana 0.9014 20 95
7y8r-assembly1.cif.gz_P the nucleosome-bound human pbaf complex 0.8831 20 94
8f0z-assembly1.cif.gz_A structure of the mdm2 p53 binding domain in complex with h101, an all-d helicon polypeptide 0.8804 21 94
ID Description Score Start End Superfamily
af_Q08747_115_201_1.10.245.10 Mainly Alpha;Orthogonal Bundle;MDM2;SWIB/MDM2 domain 0.9524 19 95 1.10.245.10
af_Q09646_219_301_1.10.245.10 Mainly Alpha;Orthogonal Bundle;MDM2;SWIB/MDM2 domain 0.9463 21 95 1.10.245.10
af_I1MR08_137_228_1.10.245.10 Mainly Alpha;Orthogonal Bundle;MDM2;SWIB/MDM2 domain 0.9401 13 94 1.10.245.10
af_E7EYW7_274_358_1.10.245.10 Mainly Alpha;Orthogonal Bundle;MDM2;SWIB/MDM2 domain 0.9399 21 95 1.10.245.10
af_A0A1D6EB49_6_63_1.10.245.10 Mainly Alpha;Orthogonal Bundle;MDM2;SWIB/MDM2 domain 0.9353 47 93 1.10.245.10
ID Description Score Start End GO Terms
AF-A0A2A4U4K1-F1-model_v4 DM2 domain-containing protein 1.005 20 95
AF-A0A2V7RRV3-F1-model_v4 DM2 domain-containing protein 1.004 15 95
AF-T0ITF1-F1-model_v4 DM2 domain-containing protein 1.002 22 95
AF-A0A1G1JWV9-F1-model_v4 DNA topoisomerase III 0.9989 13 95 GO:0016853
AF-A0A2V7YJ75-F1-model_v4 DM2 domain-containing protein 0.9986 19 95

Map