F483195

General Info

Members Datasets Scaffolds Average Seq Length
843 391 773 464

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0019155|Ga0501031_0019155_33_1586
Length 517
Sequence MRAGIQWRWRRIDYARTEAILLRCVMLFFECDMPHGMPRMSPCRXXXXPLAGSPDAMPDARLDSLRATLPGLRLLTDPAELEHYGRDWTRRWTPAPLAIALPDSVEEVQVVVRWANANAVAIVPSGGRTGLSGGAVAANGELVVSLERMNRVLGFDAVDRTLTVQAGIPLQLAQEAARGHGLQYPVDFAARGSCSIGGNIATNAGGIRVVRYGNTREWIAGLKLVSGSGELLELGRGLVKNSSGYDLRHLAIASEGTLGIIVEATLRLADPAPPSNVMLLALPSFEALMQVFAAFRSRLQLQAFEFLTDVALKHVLVHGGQAPFAEPHPFYVVTEFASDEASEAEALAAFEQCVNDGLASDGVISASEAQAAQLWRLREGITESLAKYVPYKNDVSVRVSAMPAFLAEAQALLGREYPQFEVVWFGHIGDGNLHINILMPEGMAQADFVADCERVTRLLAEVLQRHGGSISAEHGIGLVKKPYLWCTRGAAEVAAMRGIKVALDPNGIMNPGKLFDL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
3 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
4 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
5 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
6 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
7 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
8 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
9 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
10 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
11 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
12 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
13 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
14 2734482264 Dyella sp. AD052 Isolate Unclassified
15 2738543009 Luteibacter sp. OK325 Isolate Unclassified
16 2739367700 Dyella sp. YR388 Isolate Unclassified
17 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
18 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
19 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
20 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
21 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
22 2818991457 Xanthomonas translucens 569 Isolate Unclassified
23 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
24 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
25 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
26 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
27 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
28 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
29 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
30 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
31 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
32 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
33 2884411467 Dyella sp. AD56 Isolate Rhizosphere
34 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
35 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
36 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
37 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
38 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
39 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
40 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
41 2919085039 Luteibacter sp. 1214 Isolate Unclassified
42 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
43 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
44 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
45 2919404418 Luteibacter sp. 3190 Isolate Unclassified
46 2919513703 Luteimonas sp. 3794 Isolate Unclassified
47 2919675420 Luteimonas terrae 4099 Isolate Unclassified
48 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
49 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
50 2928963466 Dyella japonica 1073 Isolate Unclassified
51 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
52 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
53 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
54 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
55 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
56 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
57 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
58 2941471342 Luteibacter sp. 621 Isolate Unclassified
59 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
60 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
61 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
62 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
63 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
64 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
65 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
66 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
67 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
68 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
69 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
70 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
71 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
72 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
73 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
74 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
75 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
76 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
77 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
78 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
79 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
80 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
81 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
82 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
83 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
84 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
85 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
86 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
87 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
88 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
89 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
90 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
91 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
92 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
93 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
94 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
95 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
96 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
97 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
98 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
99 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
100 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
101 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
102 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
103 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
104 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
105 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
106 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
107 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
108 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
109 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
110 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
111 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
112 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
113 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
114 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
115 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
116 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
117 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
118 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
119 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
120 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
121 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
122 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
123 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
124 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
125 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
126 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
127 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
128 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
129 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
130 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
131 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
132 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
133 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
134 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
135 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
136 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
137 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
138 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
139 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
140 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
141 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
142 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
143 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
144 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
145 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
146 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
147 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
148 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
149 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
150 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
151 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
152 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
153 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
154 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
155 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
156 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
157 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
158 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
159 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
160 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
161 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
162 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
163 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
164 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
165 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
166 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
167 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
168 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
169 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
170 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
171 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
172 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
173 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
174 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
175 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
176 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
177 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
178 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
179 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
186 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
187 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
189 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
190 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
191 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
193 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
194 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
195 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
199 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
202 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
204 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
250 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
253 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
254 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
255 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
256 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
257 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
258 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
259 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
260 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
261 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
262 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
263 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
264 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
265 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
266 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
267 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
268 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
269 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
270 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
271 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
272 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
273 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
275 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
276 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
277 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
278 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
279 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
280 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
281 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
282 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
283 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
284 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
285 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
286 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
287 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
288 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
289 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
290 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
291 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
292 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
293 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
294 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
295 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
296 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
297 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
298 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
299 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
300 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
301 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
302 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
303 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
304 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
305 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
306 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
307 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
308 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
309 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
310 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
311 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
312 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
313 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
314 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
315 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
316 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
317 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
318 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
319 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
320 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
321 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
322 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
323 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
324 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
325 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
326 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
327 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
328 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
329 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
330 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
331 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
332 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
333 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
334 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
335 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
336 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
337 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
338 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
339 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
340 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
341 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
346 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
347 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
350 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
351 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
352 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
353 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
354 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
355 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
356 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
357 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
358 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
359 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
360 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
361 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
362 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
363 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
374 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
375 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
376 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
377 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
381 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
382 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
383 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
384 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
385 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
386 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
387 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
388 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
389 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
390 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
391 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.22
Metatranscriptomes 0.47
Isolates 8.3

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 20.17
Nodule 0.12
Rhizoplane 2.14
Rhizosphere 61.09
Stem 0
Stem Tuber 0
Unclassified 16.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_36842 2162886007 Bacteria 2220
2 JGI24740J21852_10002000 3300001979 Bacteria 9313
3 JGI24739J22299_10005709 3300001989 Bacteria 4716
4 JGI24737J22298_10013097 3300001990 Bacteria 2702
5 JGI24735J21928_10033230 3300002067 Bacteria 1524
6 JGI24735J21928_10033252 3300002067 Bacteria 1524
7 JGI24738J21930_10000181 3300002075 Bacteria 16257
8 JGI25156J39149_1000554 3300002705 Bacteria 21382
9 JGI25162J39368_1000294 3300002737 Bacteria 46103
10 JGI25162J39368_1000397 3300002737 Bacteria 36398
11 JGI25162J39368_1001712 3300002737 Bacteria 10640
12 JGI25162J39368_1001995 3300002737 Bacteria 9113
13 JGI25162J39368_1002269 3300002737 Bacteria 7771
14 JGI25162J39368_1002829 3300002737 Bacteria 6062
15 JGI25162J39368_1003087 3300002737 Bacteria 5338
16 JGI25162J39368_1003446 3300002737 Bacteria 4569
17 JGI25154J39366_1003210 3300002738 Bacteria 3582
18 JGI25157J39369_1000559 3300002741 Bacteria 22288
19 JGI25157J39369_1000571 3300002741 Bacteria 21932
20 JGI25157J39369_1002314 3300002741 Bacteria 4977
21 JGI25163J39215_1001719 3300002771 Bacteria 3091
22 JGI25164J39214_1000138 3300002772 Bacteria 70445
23 JGI25164J39214_1000203 3300002772 Bacteria 50386
24 JGI25164J39214_1000669 3300002772 Bacteria 13980
25 JGI25164J39214_1001921 3300002772 Bacteria 3832
26 JGI25152J39213_1000118 3300002773 Bacteria 55168
27 JGI25150J39212_1001719 3300002774 Bacteria 5884
28 JGI25151J46595_10000315 3300003187 Bacteria 52657
29 JGI25165J46597_1000234 3300003214 Bacteria 77220
30 JGI25165J46597_1000352 3300003214 Bacteria 51821
31 JGI25165J46597_1001324 3300003214 Bacteria 13970
32 JGI25165J46597_1003755 3300003214 Bacteria 3584
33 JGI25153J46596_10000167 3300003215 Bacteria 66040
34 JGI25153J46596_10016875 3300003215 Bacteria 2902
35 rootH2_10085211 3300003320 Bacteria 2180
36 Ga0006562J51391_1035570 3300003578 Bacteria 3100
37 Ga0055538_1000713 3300003751 Bacteria 9982
38 Ga0055539_1002855 3300003752 Bacteria 2524
39 Ga0055533_1000285 3300003756 Bacteria 26437
40 Ga0055533_1004809 3300003756 Bacteria 2328
41 Ga0055525_1000178 3300003759 Bacteria 79260
42 Ga0055527_1000031 3300003760 Bacteria 159089
43 Ga0055527_1000054 3300003760 Bacteria 100670
44 Ga0055527_1000803 3300003760 Bacteria 8493
45 Ga0055535_1000074 3300003761 Bacteria 111974
46 Ga0055535_1000203 3300003761 Bacteria 63507
47 Ga0055535_1000293 3300003761 Bacteria 51848
48 Ga0055535_1000725 3300003761 Bacteria 24974
49 Ga0055535_1000828 3300003761 Bacteria 22194
50 Ga0055535_1001977 3300003761 Bacteria 8487
51 Ga0055535_1002324 3300003761 Bacteria 6915
52 Ga0055542_1000083 3300003762 Bacteria 126426
53 Ga0055542_1000100 3300003762 Bacteria 117410
54 Ga0055542_1000357 3300003762 Bacteria 47785
55 Ga0055542_1000368 3300003762 Bacteria 46552
56 Ga0055542_1000621 3300003762 Bacteria 29952
57 Ga0055542_1000748 3300003762 Bacteria 24974
58 Ga0055529_1000073 3300003763 Bacteria 159093
59 Ga0055529_1000121 3300003763 Bacteria 114639
60 Ga0055529_1000288 3300003763 Bacteria 59495
61 Ga0055529_1000349 3300003763 Bacteria 51075
62 Ga0055529_1000567 3300003763 Bacteria 30392
63 Ga0055529_1001548 3300003763 Bacteria 6519
64 Ga0055526_1002395 3300003771 Bacteria 12700
65 Ga0055526_1011059 3300003771 Bacteria 4118
66 Ga0055537_1000091 3300003773 Bacteria 66379
67 Ga0055524_1005686 3300003775 Bacteria 5526
68 Ga0055524_1005776 3300003775 Bacteria 5467
69 Ga0055536_1000812 3300003781 Bacteria 20671
70 Ga0055536_1000925 3300003781 Bacteria 18922
71 Ga0055536_1003611 3300003781 Bacteria 8260
72 Ga0055536_1007843 3300003781 Bacteria 4704
73 Ga0055536_1019931 3300003781 Bacteria 2090
74 Ga0055534_1000043 3300003784 Bacteria 99338
75 Ga0055528_1000087 3300003790 Bacteria 72896
76 Ga0055530_10000673 3300003791 Bacteria 29109
77 Ga0055530_10000796 3300003791 Bacteria 26241
78 Ga0055530_10001562 3300003791 Bacteria 16407
79 Ga0055531_10001450 3300003794 Bacteria 17510
80 Ga0055531_10004122 3300003794 Bacteria 8979
81 Ga0055531_10007659 3300003794 Bacteria 5845
82 Ga0055531_10009101 3300003794 Bacteria 5121
83 Ga0055531_10015137 3300003794 Bacteria 3422
84 Ga0055531_10018662 3300003794 Bacteria 2851
85 Ga0055531_10018842 3300003794 Bacteria 2827
86 Ga0058692_1000031 3300003856 Bacteria 188488
87 Ga0058692_1000060 3300003856 Bacteria 98866
88 Ga0065165_1000186 3300005262 Bacteria 108712
89 Ga0065165_1006259 3300005262 Bacteria 6318
90 Ga0065704_10070367 3300005289 Bacteria 29287
91 Ga0065704_10070531 3300005289 Bacteria 21590
92 Ga0070658_10000825 3300005327 Bacteria 26519
93 Ga0070670_100000002 3300005331 Bacteria 568775
94 Ga0070670_100080904 3300005331 Bacteria 2792
95 Ga0070666_10000018 3300005335 Bacteria 187218
96 Ga0070666_10001323 3300005335 Bacteria 15024
97 Ga0070680_100080045 3300005336 Bacteria 2694
98 Ga0070682_100012019 3300005337 Bacteria 4953
99 Ga0070682_100081928 3300005337 Bacteria 2090
100 Ga0070689_100001806 3300005340 Bacteria 13754
101 Ga0070661_100022106 3300005344 Bacteria 4549
102 Ga0070668_100061553 3300005347 Bacteria 2908
103 Ga0070669_100007740 3300005353 Bacteria 7681
104 Ga0070675_100014764 3300005354 Bacteria 6163
105 Ga0070671_100000023 3300005355 Bacteria 123775
106 Ga0070671_100106387 3300005355 Bacteria 2355
107 Ga0070673_100043087 3300005364 Bacteria 3485
108 Ga0070688_100064916 3300005365 Bacteria 2318
109 Ga0070659_100010161 3300005366 Bacteria 6926
110 Ga0070659_100089902 3300005366 Bacteria 2460
111 Ga0070667_100000018 3300005367 Bacteria 226033
112 Ga0070667_100047135 3300005367 Bacteria 3626
113 Ga0070667_100067867 3300005367 Bacteria 3033
114 Ga0070667_100092097 3300005367 Bacteria 2607
115 Ga0070667_100101624 3300005367 Bacteria 2484
116 Ga0070714_100000030 3300005435 Bacteria 136610
117 Ga0070714_100056774 3300005435 Bacteria 3349
118 Ga0070713_100001194 3300005436 Bacteria 16600
119 Ga0070710_10061947 3300005437 Bacteria 2132
120 Ga0070663_100001649 3300005455 Bacteria 12338
121 Ga0070678_100135470 3300005456 Bacteria 1963
122 Ga0070662_100020438 3300005457 Bacteria 4509
123 Ga0070681_10042687 3300005458 Bacteria 4544
124 Ga0070681_10057495 3300005458 Bacteria 3870
125 Ga0070681_10089537 3300005458 Bacteria 3029
126 Ga0070681_10146756 3300005458 Bacteria 2288
127 Ga0070681_10211295 3300005458 Bacteria 1857
128 Ga0070685_10000011 3300005466 Bacteria 137723
129 Ga0070685_10000308 3300005466 Bacteria 30701
130 Ga0070679_100125175 3300005530 Bacteria 2553
131 Ga0068853_100011536 3300005539 Bacteria 7184
132 Ga0068853_100142629 3300005539 Bacteria 2151
133 Ga0070696_100006077 3300005546 Bacteria 8063
134 Ga0070696_100012566 3300005546 Bacteria 5685
135 Ga0070693_100005935 3300005547 Bacteria 5906
136 Ga0070693_100007027 3300005547 Bacteria 5481
137 Ga0070665_100000786 3300005548 Bacteria 41741
138 Ga0070665_100005073 3300005548 Bacteria 13664
139 Ga0070665_100061775 3300005548 Bacteria 3756
140 Ga0070665_100293396 3300005548 Bacteria 1628
141 Ga0068855_100021479 3300005563 Bacteria 7741
142 Ga0068855_100044098 3300005563 Bacteria 5279
143 Ga0068855_100150693 3300005563 Bacteria 2645
144 Ga0068854_100002904 3300005578 Bacteria 10640
145 Ga0068854_100003674 3300005578 Bacteria 9600
146 Ga0068854_100020234 3300005578 Bacteria 4499
147 Ga0068854_100050615 3300005578 Bacteria 2973
148 Ga0068856_100000012 3300005614 Bacteria 166032
149 Ga0068856_100001305 3300005614 Bacteria 26223
150 Ga0068852_100066737 3300005616 Bacteria 3143
151 Ga0068859_100063405 3300005617 Bacteria 3727
152 Ga0068859_100074657 3300005617 Bacteria 3430
153 Ga0068859_100105981 3300005617 Bacteria 2870
154 Ga0068864_100000003 3300005618 Bacteria 568775
155 Ga0068863_100024746 3300005841 Bacteria 5727
156 Ga0068863_100032819 3300005841 Bacteria 4947
157 Ga0068863_100073638 3300005841 Bacteria 3231
158 Ga0068858_100000799 3300005842 Bacteria 32951
159 Ga0068860_100018698 3300005843 Bacteria 6737
160 Ga0068860_100022725 3300005843 Bacteria 6063
161 Ga0068862_100005757 3300005844 Bacteria 10335
162 Ga0081455_10052948 3300005937 Bacteria 3470
163 Ga0075364_10000075 3300006051 Bacteria 38780
164 Ga0075364_10043609 3300006051 Bacteria 2917
165 Ga0075369_10022777 3300006186 Bacteria 2586
166 Ga0068871_100150842 3300006358 Bacteria 1982
167 Ga0068865_100009059 3300006881 Bacteria 6156
168 Ga0068865_100025111 3300006881 Bacteria 3916
169 Ga0097620_100063405 3300006931 Bacteria 3727
170 Ga0097620_100074654 3300006931 Bacteria 3430
171 Ga0097620_100105989 3300006931 Bacteria 2870
172 Ga0105251_10000684 3300009011 Bacteria 31292
173 Ga0105251_10011627 3300009011 Bacteria 5020
174 Ga0105240_10001717 3300009093 Bacteria 36977
175 Ga0105240_10002685 3300009093 Bacteria 28327
176 Ga0105240_10002894 3300009093 Bacteria 27102
177 Ga0105240_10014038 3300009093 Bacteria 10956
178 Ga0105240_10026393 3300009093 Bacteria 7620
179 Ga0105240_10064962 3300009093 Bacteria 4531
180 Ga0105240_10159723 3300009093 Bacteria 2678
181 Ga0105240_10256873 3300009093 Bacteria 2018
182 Ga0105240_10311171 3300009093 Bacteria 1799
183 Ga0111539_10001027 3300009094 Bacteria 36586
184 Ga0111539_10016831 3300009094 Bacteria 9055
185 Ga0105247_10003540 3300009101 Bacteria 10149
186 Ga0105247_10004696 3300009101 Bacteria 8702
187 Ga0105241_10002687 3300009174 Bacteria 13328
188 Ga0105241_10036548 3300009174 Bacteria 3697
189 Ga0105241_10181519 3300009174 Bacteria 1746
190 Ga0105242_10007059 3300009176 Bacteria 8675
191 Ga0105248_10096502 3300009177 Bacteria 3330
192 Ga0105237_10000543 3300009545 Bacteria 53109
193 Ga0105237_10000571 3300009545 Bacteria 51560
194 Ga0105237_10011644 3300009545 Bacteria 9306
195 Ga0105237_10022754 3300009545 Bacteria 6431
196 Ga0105237_10147533 3300009545 Bacteria 2347
197 Ga0105237_10288041 3300009545 Bacteria 1645
198 Ga0105238_10000224 3300009551 Bacteria 62846
199 Ga0105238_10002702 3300009551 Bacteria 17642
200 Ga0105238_10021104 3300009551 Bacteria 6637
201 Ga0105238_10023762 3300009551 Bacteria 6248
202 Ga0105238_10085161 3300009551 Bacteria 3150
203 Ga0105238_10138963 3300009551 Bacteria 2407
204 Ga0105238_10189516 3300009551 Bacteria 2033
205 Ga0105028_102892 3300009993 Bacteria 1801
206 Ga0105239_10000023 3300010375 Bacteria 257478
207 Ga0105239_10021526 3300010375 Bacteria 7109
208 Ga0105239_10046151 3300010375 Bacteria 4774
209 Ga0105239_10075734 3300010375 Bacteria 3700
210 Ga0105239_10179719 3300010375 Bacteria 2367
211 Ga0157373_10002185 3300013100 Bacteria 14812
212 Ga0157371_10002405 3300013102 Bacteria 17908
213 Ga0157371_10007880 3300013102 Bacteria 8552
214 Ga0157371_10014358 3300013102 Bacteria 5980
215 Ga0157371_10119685 3300013102 Bacteria 1872
216 Ga0157370_10000044 3300013104 Bacteria 131302
217 Ga0157370_10008181 3300013104 Bacteria 11306
218 Ga0157370_10022676 3300013104 Bacteria 6248
219 Ga0157370_10033352 3300013104 Bacteria 5021
220 Ga0157370_10085340 3300013104 Bacteria 2966
221 Ga0157369_10000057 3300013105 Bacteria 157096
222 Ga0157369_10004095 3300013105 Bacteria 17268
223 Ga0157369_10005110 3300013105 Bacteria 15361
224 Ga0157369_10127294 3300013105 Bacteria 2699
225 Ga0157374_10033453 3300013296 Bacteria 4691
226 Ga0163162_10000007 3300013306 Bacteria 368084
227 Ga0163162_10000284 3300013306 Bacteria 46182
228 Ga0163162_10019407 3300013306 Bacteria 6667
229 Ga0163162_10029630 3300013306 Bacteria 5418
230 Ga0157372_10004509 3300013307 Bacteria 14858
231 Ga0157372_10019325 3300013307 Bacteria 7338
232 Ga0157372_10027128 3300013307 Bacteria 6234
233 Ga0157372_10051334 3300013307 Bacteria 4589
234 Ga0157372_10062104 3300013307 Bacteria 4185
235 Ga0157375_10000206 3300013308 Bacteria 54667
236 Ga0157375_10003760 3300013308 Bacteria 13161
237 Ga0157375_10049967 3300013308 Bacteria 4101
238 Ga0157375_10072201 3300013308 Bacteria 3467
239 Ga0163163_10000537 3300014325 Bacteria 33554
240 Ga0163163_10130566 3300014325 Bacteria 2552
241 Ga0182008_10001914 3300014497 Bacteria 13466
242 Ga0182008_10003037 3300014497 Bacteria 10300
243 Ga0182008_10010938 3300014497 Bacteria 4841
244 Ga0182008_10032370 3300014497 Bacteria 2628
245 Ga0182008_10042068 3300014497 Bacteria 2277
246 Ga0157376_10000427 3300014969 Bacteria 27265
247 Ga0157376_10005743 3300014969 Bacteria 8691
248 Ga0182006_1000077 3300015261 Bacteria 127377
249 Ga0182006_1000427 3300015261 Bacteria 33649
250 Ga0182006_1008610 3300015261 Bacteria 4622
251 Ga0182006_1015992 3300015261 Bacteria 3206
252 Ga0182006_1037923 3300015261 Bacteria 1908
253 Ga0182006_1041468 3300015261 Bacteria 1807
254 Ga0182007_10000556 3300015262 Bacteria 22049
255 Ga0182007_10006254 3300015262 Bacteria 5123
256 Ga0182007_10006322 3300015262 Bacteria 5095
257 Ga0182005_1000060 3300015265 Bacteria 98664
258 Ga0182005_1000463 3300015265 Bacteria 21182
259 Ga0182005_1022260 3300015265 Bacteria 1737
260 Ga0183369_1007 3300015685 Bacteria 414878
261 Ga0183368_1003 3300015687 Bacteria 1276390
262 Ga0183361_10614 3300016635 Bacteria 1616
263 Ga0163161_10004924 3300017792 Bacteria 9293
264 Ga0163161_10083110 3300017792 Bacteria 2360
265 Ga0163161_10085650 3300017792 Bacteria 2325
266 Ga0206356_11480241 3300020070 Bacteria 2578
267 Ga0206354_10669824 3300020081 Bacteria 1466
268 Ga0206353_10435035 3300020082 Bacteria 2343
269 Ga0209760_100363 3300025207 Bacteria 12318
270 Ga0209784_100011 3300025224 Bacteria 546770
271 Ga0209674_100012 3300025226 Bacteria 950162
272 Ga0209674_100140 3300025226 Bacteria 109152
273 Ga0209674_100627 3300025226 Bacteria 13044
274 Ga0209674_100990 3300025226 Bacteria 8760
275 Ga0209672_100005 3300025228 Bacteria 1069303
276 Ga0209672_100016 3300025228 Bacteria 522604
277 Ga0209672_100341 3300025228 Bacteria 30044
278 Ga0209563_100023 3300025230 Bacteria 636844
279 Ga0207427_100026 3300025231 Bacteria 412764
280 Ga0207427_100057 3300025231 Bacteria 198202
281 Ga0207427_100253 3300025231 Bacteria 42374
282 Ga0207427_100265 3300025231 Bacteria 40397
283 Ga0207427_104288 3300025231 Bacteria 2473
284 Ga0209437_100020 3300025233 Bacteria 656374
285 Ga0209437_100184 3300025233 Bacteria 128650
286 Ga0209437_100202 3300025233 Bacteria 118709
287 Ga0209437_100359 3300025233 Bacteria 50926
288 Ga0209437_100422 3300025233 Bacteria 37894
289 Ga0209437_101541 3300025233 Bacteria 5402
290 Ga0209258_100006 3300025242 Bacteria 1069303
291 Ga0209258_100012 3300025242 Bacteria 825544
292 Ga0209258_100027 3300025242 Bacteria 518449
293 Ga0209258_100064 3300025242 Bacteria 293837
294 Ga0209258_100139 3300025242 Bacteria 167268
295 Ga0209258_106463 3300025242 Bacteria 1835
296 Ga0207425_1000097 3300025245 Bacteria 84719
297 Ga0209646_1000322 3300025246 Bacteria 36810
298 Ga0209646_1000820 3300025246 Bacteria 10498
299 Ga0209646_1002983 3300025246 Bacteria 3502
300 Ga0209026_1000018 3300025250 Bacteria 381351
301 Ga0209026_1000077 3300025250 Bacteria 200561
302 Ga0209026_1000098 3300025250 Bacteria 161845
303 Ga0209026_1000117 3300025250 Bacteria 131918
304 Ga0209026_1000451 3300025250 Bacteria 32750
305 Ga0209148_1000001 3300025254 Bacteria 2545271
306 Ga0209148_1000005 3300025254 Bacteria 1806504
307 Ga0209148_1000012 3300025254 Bacteria 1069303
308 Ga0209148_1000014 3300025254 Bacteria 925277
309 Ga0209148_1000073 3300025254 Bacteria 320851
310 Ga0209148_1000173 3300025254 Bacteria 130560
311 Ga0209148_1001681 3300025254 Bacteria 9906
312 Ga0209759_1000134 3300025256 Bacteria 126221
313 Ga0209759_1000550 3300025256 Bacteria 38618
314 Ga0209759_1001310 3300025256 Bacteria 14662
315 Ga0209759_1002234 3300025256 Bacteria 8827
316 Ga0209129_1000189 3300025258 Bacteria 84712
317 Ga0209129_1001261 3300025258 Bacteria 14508
318 Ga0209129_1002319 3300025258 Bacteria 9439
319 Ga0209233_1000002 3300025261 Bacteria 2501366
320 Ga0209233_1000020 3300025261 Bacteria 798224
321 Ga0209233_1000063 3300025261 Bacteria 395810
322 Ga0209233_1000147 3300025261 Bacteria 186517
323 Ga0209233_1008375 3300025261 Bacteria 3205
324 Ga0209565_1000063 3300025263 Bacteria 183711
325 Ga0209455_1000008 3300025272 Bacteria 1069303
326 Ga0209455_1000014 3300025272 Bacteria 806601
327 Ga0209455_1000018 3300025272 Bacteria 718034
328 Ga0209455_1000019 3300025272 Bacteria 705658
329 Ga0209455_1001025 3300025272 Bacteria 13911
330 Ga0209673_1000065 3300025273 Bacteria 252799
331 Ga0209130_1006433 3300025284 Bacteria 3818
332 Ga0209130_1006566 3300025284 Bacteria 3757
333 Ga0209675_1000011 3300025291 Bacteria 520597
334 Ga0209675_1007735 3300025291 Bacteria 4061
335 Ga0209676_1000011 3300025292 Bacteria 860463
336 Ga0209676_1000034 3300025292 Bacteria 460125
337 Ga0209676_1000068 3300025292 Bacteria 314068
338 Ga0209676_1000728 3300025292 Bacteria 45109
339 Ga0209676_1000981 3300025292 Bacteria 34140
340 Ga0209676_1002601 3300025292 Bacteria 12379
341 Ga0209676_1005433 3300025292 Bacteria 6660
342 Ga0209025_1000054 3300025294 Bacteria 317002
343 Ga0209025_1004511 3300025294 Bacteria 12025
344 Ga0209025_1036260 3300025294 Bacteria 2212
345 Ga0209564_1000433 3300025295 Bacteria 72594
346 Ga0209758_1000062 3300025297 Bacteria 317002
347 Ga0209758_1000644 3300025297 Bacteria 53122
348 Ga0209758_1029512 3300025297 Bacteria 2291
349 Ga0209050_1000239 3300025298 Bacteria 119530
350 Ga0209050_1000599 3300025298 Bacteria 57405
351 Ga0209050_1002692 3300025298 Bacteria 14452
352 Ga0209256_1002093 3300025299 Bacteria 17461
353 Ga0209256_1003080 3300025299 Bacteria 12238
354 Ga0209256_1003541 3300025299 Bacteria 10843
355 Ga0209256_1005136 3300025299 Bacteria 7741
356 Ga0209256_1008903 3300025299 Bacteria 4529
357 Ga0209051_1002354 3300025303 Bacteria 13679
358 Ga0209051_1004118 3300025303 Bacteria 9106
359 Ga0209051_1024719 3300025303 Bacteria 2462
360 Ga0209257_1000014 3300025304 Bacteria 946850
361 Ga0209257_1000263 3300025304 Bacteria 120530
362 Ga0209257_1000283 3300025304 Bacteria 113507
363 Ga0209257_1000645 3300025304 Bacteria 55704
364 Ga0209257_1001034 3300025304 Bacteria 37233
365 Ga0209257_1001651 3300025304 Bacteria 25402
366 Ga0209257_1002860 3300025304 Bacteria 16121
367 Ga0209257_1003306 3300025304 Bacteria 14041
368 Ga0209257_1004492 3300025304 Bacteria 10753
369 Ga0207656_10000302 3300025321 Bacteria 17096
370 Ga0207656_10014809 3300025321 Bacteria 3012
371 Ga0207692_10048626 3300025898 Bacteria 2136
372 Ga0207710_10003190 3300025900 Bacteria 7337
373 Ga0207680_10000002 3300025903 Bacteria 1018646
374 Ga0207680_10002436 3300025903 Bacteria 8677
375 Ga0207647_10000078 3300025904 Bacteria 73787
376 Ga0207647_10001332 3300025904 Bacteria 18967
377 Ga0207647_10006827 3300025904 Bacteria 8274
378 Ga0207647_10009507 3300025904 Bacteria 6904
379 Ga0207654_10008492 3300025911 Bacteria 5196
380 Ga0207707_10029048 3300025912 Bacteria 4832
381 Ga0207707_10151511 3300025912 Bacteria 2027
382 Ga0207695_10000033 3300025913 Bacteria 507477
383 Ga0207695_10000581 3300025913 Bacteria 74447
384 Ga0207695_10001880 3300025913 Bacteria 32856
385 Ga0207695_10002256 3300025913 Bacteria 28860
386 Ga0207695_10002259 3300025913 Bacteria 28854
387 Ga0207695_10009427 3300025913 Bacteria 12076
388 Ga0207695_10012614 3300025913 Bacteria 10127
389 Ga0207695_10019726 3300025913 Bacteria 7752
390 Ga0207695_10031732 3300025913 Bacteria 5789
391 Ga0207695_10063506 3300025913 Bacteria 3806
392 Ga0207671_10000038 3300025914 Bacteria 227066
393 Ga0207671_10001015 3300025914 Bacteria 34337
394 Ga0207671_10014832 3300025914 Bacteria 6137
395 Ga0207671_10022208 3300025914 Bacteria 4801
396 Ga0207671_10092144 3300025914 Bacteria 2285
397 Ga0207649_10129956 3300025920 Bacteria 1709
398 Ga0207652_10150608 3300025921 Bacteria 2083
399 Ga0207681_10001068 3300025923 Bacteria 17781
400 Ga0207681_10046782 3300025923 Bacteria 2911
401 Ga0207694_10000210 3300025924 Bacteria 56867
402 Ga0207694_10000487 3300025924 Bacteria 35975
403 Ga0207694_10001035 3300025924 Bacteria 24204
404 Ga0207694_10004749 3300025924 Bacteria 10562
405 Ga0207694_10059753 3300025924 Bacteria 2966
406 Ga0207694_10061178 3300025924 Bacteria 2930
407 Ga0207694_10118772 3300025924 Bacteria 2110
408 Ga0207650_10000003 3300025925 Bacteria 1123235
409 Ga0207650_10006416 3300025925 Bacteria 8015
410 Ga0207650_10067663 3300025925 Bacteria 2680
411 Ga0207700_10013029 3300025928 Bacteria 5392
412 Ga0207664_10000026 3300025929 Bacteria 194571
413 Ga0207664_10038881 3300025929 Bacteria 3691
414 Ga0207644_10000027 3300025931 Bacteria 143706
415 Ga0207690_10002055 3300025932 Bacteria 12330
416 Ga0207690_10018134 3300025932 Bacteria 4313
417 Ga0207706_10019337 3300025933 Bacteria 6126
418 Ga0207706_10067935 3300025933 Bacteria 3137
419 Ga0207709_10004205 3300025935 Bacteria 8353
420 Ga0207670_10001950 3300025936 Bacteria 10813
421 Ga0207670_10083399 3300025936 Bacteria 2242
422 Ga0207704_10011804 3300025938 Bacteria 4316
423 Ga0207704_10025598 3300025938 Bacteria 3222
424 Ga0207704_10048528 3300025938 Bacteria 2546
425 Ga0207691_10047647 3300025940 Bacteria 3932
426 Ga0207661_10179395 3300025944 Bacteria 1849
427 Ga0207667_10000693 3300025949 Bacteria 43651
428 Ga0207667_10007470 3300025949 Bacteria 13134
429 Ga0207667_10008397 3300025949 Bacteria 12273
430 Ga0207651_10031925 3300025960 Bacteria 3374
431 Ga0207712_10000288 3300025961 Bacteria 47902
432 Ga0207668_10018829 3300025972 Bacteria 4353
433 Ga0207668_10059861 3300025972 Bacteria 2671
434 Ga0207640_10004830 3300025981 Bacteria 7317
435 Ga0207640_10007281 3300025981 Bacteria 6104
436 Ga0207640_10020869 3300025981 Bacteria 3894
437 Ga0207640_10094207 3300025981 Bacteria 2082
438 Ga0207658_10000004 3300025986 Bacteria 569357
439 Ga0207658_10012049 3300025986 Bacteria 5899
440 Ga0207658_10027507 3300025986 Bacteria 3996
441 Ga0207658_10063939 3300025986 Bacteria 2759
442 Ga0207703_10001120 3300026035 Bacteria 25309
443 Ga0207703_10076430 3300026035 Bacteria 2778
444 Ga0207639_10005157 3300026041 Bacteria 8808
445 Ga0207678_10008203 3300026067 Bacteria 9208
446 Ga0207678_10014285 3300026067 Bacteria 6981
447 Ga0207678_10106775 3300026067 Bacteria 2388
448 Ga0207678_10215025 3300026067 Bacteria 1645
449 Ga0207702_10000108 3300026078 Bacteria 95976
450 Ga0207702_10000312 3300026078 Bacteria 55514
451 Ga0207641_10019264 3300026088 Bacteria 5599
452 Ga0207641_10035200 3300026088 Bacteria 4170
453 Ga0207641_10165082 3300026088 Bacteria 2016
454 Ga0207641_10179904 3300026088 Bacteria 1936
455 Ga0207676_10000003 3300026095 Bacteria 1123235
456 Ga0207674_10002019 3300026116 Bacteria 25743
457 Ga0207674_10039426 3300026116 Bacteria 4896
458 Ga0207675_100147765 3300026118 Bacteria 2236
459 Ga0207683_10013683 3300026121 Bacteria 6918
460 Ga0207683_10022504 3300026121 Bacteria 5409
461 Ga0207683_10037910 3300026121 Bacteria 4198
462 Ga0207683_10064767 3300026121 Bacteria 3222
463 Ga0207683_10081681 3300026121 Bacteria 2869
464 Ga0207698_10018844 3300026142 Bacteria 4713
465 Ga0209371_1000004 3300027312 Bacteria 1098197
466 Ga0209371_1000139 3300027312 Bacteria 120350
467 Ga0207428_10003984 3300027907 Bacteria 14174
468 Ga0207428_10116357 3300027907 Bacteria 2053
469 Ga0268266_10000004 3300028379 Bacteria 1495817
470 Ga0268266_10000006 3300028379 Bacteria 1410021
471 Ga0268266_10002297 3300028379 Bacteria 20736
472 Ga0268264_10000016 3300028381 Bacteria 502537
473 Ga0268264_10001303 3300028381 Bacteria 23523
474 Ga0268264_10062361 3300028381 Bacteria 3130
475 Ga0268264_10131959 3300028381 Bacteria 2216
476 Ga0265334_10028783 3300028573 Bacteria 2229
477 Ga0268256_1000005 3300030500 Bacteria 1082342
478 Ga0268256_1000109 3300030500 Bacteria 120350
479 Ga0316177_1014219 3300030731 Bacteria 6930
480 Ga0316178_1139308 3300030735 Bacteria 2031
481 Ga0316183_1078638 3300030742 Bacteria 5614
482 Ga0265327_10001419 3300031251 Bacteria 30507
483 Ga0265313_10022433 3300031595 Bacteria 3424
484 Ga0307508_10010230 3300031616 Bacteria 8582
485 Ga0316575_10004695 3300031665 Bacteria 4815
486 Ga0265314_10093203 3300031711 Bacteria 1956
487 Ga0316576_10005271 3300031727 Bacteria 7874
488 Ga0316576_10037332 3300031727 Bacteria 3477
489 Ga0307405_10051474 3300031731 Bacteria 2556
490 Ga0307412_10000203 3300031911 Bacteria 40488
491 Ga0307412_10001756 3300031911 Bacteria 11982
492 Ga0307414_10021507 3300032004 Bacteria 4049
493 Ga0307414_10076107 3300032004 Bacteria 2438
494 Ga0307414_10088213 3300032004 Bacteria 2295
495 Ga0307510_10011777 3300033180 Bacteria 10376
496 Ga0373944_0003053 3300035089 Bacteria 4305
497 Ga0373957_0030344 3300035120 Bacteria 1981
498 Ga0373955_0059394 3300035172 Bacteria 2106
499 Ga0373927_0076523 3300035695 Bacteria 2167
500 Ga0373937_0035551 3300036401 Bacteria 4535
501 Ga0373937_0137035 3300036401 Bacteria 2289
502 Ga0316584_0046555 3300036712 Bacteria 3240
503 Ga0373925_0103237 3300037068 Bacteria 2194
504 Ga0395899_0000089 3300037312 Bacteria 156851
505 Ga0395900_0000029 3300037418 Bacteria 281061
506 Ga0395900_0011616 3300037418 Bacteria 9011
507 Ga0395900_0239257 3300037418 Bacteria 1822
508 Ga0395898_0000018 3300037466 Bacteria 418600
509 Ga0395898_0000049 3300037466 Bacteria 284792
510 Ga0395898_0001843 3300037466 Bacteria 27253
511 Ga0395898_0092449 3300037466 Bacteria 2909
512 Ga0395905_0000934 3300037471 Bacteria 37728
513 Ga0395905_0001196 3300037471 Bacteria 32448
514 Ga0395901_0000773 3300038443 Bacteria 35853
515 Ga0395901_0008539 3300038443 Bacteria 10349
516 Ga0395901_0035111 3300038443 Bacteria 5181
517 Ga0395901_0049611 3300038443 Bacteria 4361
518 Ga0395901_0049898 3300038443 Bacteria 4348
519 Ga0395901_0124752 3300038443 Bacteria 2705
520 Ga0237819_00917 3300038705 Bacteria 9091
521 Ga0439436_0000006 3300041404 Bacteria 123245
522 Ga0439465_0000040 3300041413 Bacteria 26319
523 Ga0439465_0000833 3300041413 Bacteria 9715
524 Ga0451793_0073484 3300041452 Bacteria 3479
525 Ga0451797_0870357 3300041453 Bacteria 2604
526 Ga0451806_099755 3300041462 Bacteria 3948
527 Ga0451807_0145775 3300041486 Bacteria 4026
528 Ga0451807_1713052 3300041486 Bacteria 1790
529 Ga0451837_1686608 3300041494 Bacteria 2514
530 Ga0439445_0009603 3300042004 Bacteria 2282
531 Ga0439449_0000134 3300042007 Bacteria 25113
532 Ga0450908_000855 3300042184 Bacteria 5872
533 Ga0439440_0006951 3300042993 Bacteria 2290
534 Ga0466969_0006363 3300044656 Bacteria 6282
535 Ga0466969_0007873 3300044656 Bacteria 5658
536 Ga0466969_0023913 3300044656 Bacteria 3144
537 Ga0466969_0026182 3300044656 Bacteria 2992
538 Ga0466982_0000003 3300044672 Bacteria 417243
539 Ga0466982_0000231 3300044672 Bacteria 14748
540 Ga0466965_0028634 3300044683 Bacteria 2707
541 Ga0466966_0001912 3300044684 Bacteria 13504
542 Ga0466966_0005127 3300044684 Bacteria 8610
543 Ga0466966_0006879 3300044684 Bacteria 7533
544 Ga0466966_0047309 3300044684 Bacteria 2743
545 Ga0466961_0001342 3300044693 Bacteria 15159
546 Ga0466961_0007688 3300044693 Bacteria 6862
547 Ga0466961_0017725 3300044693 Bacteria 4575
548 Ga0466961_0036413 3300044693 Bacteria 3158
549 Ga0466961_0043622 3300044693 Bacteria 2871
550 Ga0453684_0002590 3300044712 Bacteria 43282
551 Ga0466971_0003646 3300044719 Bacteria 6585
552 Ga0466970_0053070 3300044765 Bacteria 2165
553 Ga0466970_0076834 3300044765 Bacteria 1799
554 Ga0466957_0009996 3300044842 Bacteria 5429
555 Ga0466957_0132197 3300044842 Bacteria 1600
556 Ga0466959_0000346 3300045049 Bacteria 27374
557 Ga0466959_0001514 3300045049 Bacteria 14264
558 Ga0466959_0089200 3300045049 Bacteria 2215
559 Ga0451576_0000840 3300045051 Bacteria 59794
560 Ga0466958_0002540 3300045836 Bacteria 9203
561 Ga0466958_0122088 3300045836 Bacteria 1631
562 Ga0466967_0085422 3300045976 Bacteria 2857
563 Ga0495617_000107 3300046452 Bacteria 60888
564 Ga0495617_000337 3300046452 Bacteria 25904
565 Ga0495629_0047720 3300046459 Bacteria 3004
566 Ga0495638_0000268 3300046460 Bacteria 70252
567 Ga0495638_0000430 3300046460 Bacteria 50741
568 Ga0495638_0002222 3300046460 Bacteria 16136
569 Ga0495638_0003275 3300046460 Bacteria 12775
570 Ga0495638_0039200 3300046460 Bacteria 3008
571 Ga0495650_0000444 3300046471 Bacteria 66241
572 Ga0495650_0000980 3300046471 Bacteria 32575
573 Ga0495650_0001591 3300046471 Bacteria 21278
574 Ga0495580_0018580 3300046472 Bacteria 5174
575 Ga0495582_0014227 3300046473 Bacteria 4377
576 Ga0495584_0005843 3300046491 Bacteria 6483
577 Ga0495585_0000028 3300046492 Bacteria 146662
578 Ga0495585_0000927 3300046492 Bacteria 24791
579 Ga0495594_0050003 3300046499 Bacteria 2299
580 Ga0495607_0000438 3300046501 Bacteria 42080
581 Ga0495607_0002438 3300046501 Bacteria 15147
582 Ga0495607_0025777 3300046501 Bacteria 3654
583 Ga0495606_0000216 3300046507 Bacteria 102891
584 Ga0495606_0000872 3300046507 Bacteria 45088
585 Ga0495606_0000934 3300046507 Bacteria 43034
586 Ga0495606_0012571 3300046507 Bacteria 6776
587 Ga0495606_0033187 3300046507 Bacteria 3564
588 Ga0495606_0038546 3300046507 Bacteria 3232
589 Ga0495610_0003255 3300046512 Bacteria 12817
590 Ga0495610_0006433 3300046512 Bacteria 8089
591 Ga0495610_0021328 3300046512 Bacteria 3565
592 Ga0495616_0000098 3300046513 Bacteria 74007
593 Ga0495620_0001664 3300046515 Bacteria 13134
594 Ga0495631_0001265 3300046518 Bacteria 15613
595 Ga0495631_0004267 3300046518 Bacteria 7643
596 Ga0495631_0006251 3300046518 Bacteria 6170
597 Ga0495632_0000032 3300046519 Bacteria 164561
598 Ga0495632_0063007 3300046519 Bacteria 1796
599 Ga0495643_0002752 3300046522 Bacteria 13485
600 Ga0495648_0002326 3300046524 Bacteria 17687
601 Ga0495663_0000499 3300046525 Bacteria 14134
602 Ga0495663_0011170 3300046525 Bacteria 2499
603 Ga0495622_0022919 3300046557 Bacteria 2910
604 Ga0495633_0004706 3300046558 Bacteria 8578
605 Ga0495668_0021466 3300046616 Bacteria 3702
606 Ga0495611_0000001 3300046648 Bacteria 2628469
607 Ga0495611_0000092 3300046648 Bacteria 62897
608 Ga0495625_0000037 3300046660 Bacteria 219383
609 Ga0495625_0016209 3300046660 Bacteria 5871
610 Ga0495625_0024483 3300046660 Bacteria 4593
611 Ga0495625_0064918 3300046660 Bacteria 2574
612 Ga0495661_0019881 3300046665 Bacteria 4393
613 Ga0495623_0096454 3300046679 Bacteria 1807
614 Ga0495658_0007277 3300046683 Bacteria 5470
615 Ga0495670_0002216 3300046691 Bacteria 9601
616 Ga0495670_0002434 3300046691 Bacteria 9190
617 Ga0495670_0012753 3300046691 Bacteria 4133
618 Ga0495671_0003326 3300046692 Bacteria 9929
619 Ga0495649_0001808 3300046694 Bacteria 15722
620 Ga0495589_0000523 3300046794 Bacteria 26993
621 Ga0495660_0000076 3300046810 Bacteria 105580
622 Ga0495660_0000567 3300046810 Bacteria 29946
623 Ga0495672_0000105 3300047320 Bacteria 133882
624 Ga0495680_0109638 3300047322 Bacteria 2047
625 Ga0495683_0001013 3300047323 Bacteria 19575
626 Ga0495679_000001 3300047446 Bacteria 1607568
627 Ga0495673_0000010 3300047469 Bacteria 709599
628 Ga0495673_0000087 3300047469 Bacteria 190669
629 Ga0495673_0001346 3300047469 Bacteria 19925
630 Ga0495686_0000123 3300047472 Bacteria 159841
631 Ga0495686_0000792 3300047472 Bacteria 41248
632 Ga0495686_0017669 3300047472 Bacteria 4800
633 Ga0495686_0057699 3300047472 Bacteria 2422
634 Ga0496100_0010984 3300048903 Bacteria 5139
635 Ga0496101_0003218 3300048904 Bacteria 10127
636 Ga0496101_0065594 3300048904 Bacteria 2647
637 Ga0496102_0140045 3300048905 Bacteria 2268
638 Ga0496104_0000017 3300048907 Bacteria 325877
639 Ga0496105_0000009 3300048908 Bacteria 325734
640 Ga0496105_0064090 3300048908 Bacteria 3032
641 Ga0496106_0000563 3300048909 Bacteria 26445
642 Ga0496114_0003989 3300048917 Bacteria 11398
643 Ga0496115_0000530 3300048918 Bacteria 29698
644 Ga0496115_0000924 3300048918 Bacteria 21293
645 Ga0496115_0029951 3300048918 Bacteria 4279
646 Ga0496115_0043831 3300048918 Bacteria 3568
647 Ga0496116_0005311 3300048919 Bacteria 12006
648 Ga0496117_0001191 3300048920 Bacteria 39121
649 Ga0496117_0002104 3300048920 Bacteria 26184
650 Ga0496117_0011556 3300048920 Bacteria 7899
651 Ga0496117_0019026 3300048920 Bacteria 5658
652 Ga0496117_0041533 3300048920 Bacteria 3368
653 Ga0496117_0062217 3300048920 Bacteria 2559
654 Ga0496118_0000858 3300048921 Bacteria 48244
655 Ga0496118_0004478 3300048921 Bacteria 16549
656 Ga0496118_0005348 3300048921 Bacteria 14620
657 Ga0496118_0006565 3300048921 Bacteria 12718
658 Ga0496118_0012820 3300048921 Bacteria 8002
659 Ga0496118_0014740 3300048921 Bacteria 7298
660 Ga0496118_0032826 3300048921 Bacteria 4268
661 Ga0496118_0036831 3300048921 Bacteria 3948
662 Ga0496118_0068986 3300048921 Bacteria 2563
663 Ga0496119_0000070 3300048922 Bacteria 154395
664 Ga0496119_0001416 3300048922 Bacteria 29034
665 Ga0496119_0002285 3300048922 Bacteria 21233
666 Ga0496119_0069083 3300048922 Bacteria 2077
667 Ga0496120_0000181 3300048923 Bacteria 107114
668 Ga0496120_0000676 3300048923 Bacteria 50058
669 Ga0496120_0000696 3300048923 Bacteria 49219
670 Ga0496120_0005912 3300048923 Bacteria 9539
671 Ga0496121_0000541 3300048924 Bacteria 71839
672 Ga0496121_0001673 3300048924 Bacteria 36526
673 Ga0496121_0002576 3300048924 Bacteria 27425
674 Ga0496121_0007321 3300048924 Bacteria 13347
675 Ga0496121_0008621 3300048924 Bacteria 11935
676 Ga0496121_0016007 3300048924 Bacteria 7776
677 Ga0496121_0043851 3300048924 Bacteria 3867
678 Ga0496121_0049290 3300048924 Bacteria 3572
679 Ga0496121_0068591 3300048924 Bacteria 2868
680 Ga0496121_0129210 3300048924 Bacteria 1894
681 Ga0496121_0155012 3300048924 Bacteria 1681
682 Ga0496122_0000372 3300048925 Bacteria 96314
683 Ga0496122_0000901 3300048925 Bacteria 54955
684 Ga0496122_0055190 3300048925 Bacteria 2975
685 Ga0496122_0055374 3300048925 Bacteria 2968
686 Ga0496122_0066848 3300048925 Bacteria 2593
687 Ga0496122_0099280 3300048925 Bacteria 1953
688 Ga0496123_0000694 3300048926 Bacteria 55393
689 Ga0496123_0000727 3300048926 Bacteria 53518
690 Ga0496123_0003232 3300048926 Bacteria 18540
691 Ga0496123_0004944 3300048926 Bacteria 13665
692 Ga0496123_0012754 3300048926 Bacteria 7127
693 Ga0496123_0020644 3300048926 Bacteria 5147
694 Ga0496123_0022327 3300048926 Bacteria 4881
695 Ga0496123_0083673 3300048926 Bacteria 1928
696 Ga0496124_0000009 3300048927 Bacteria 734820
697 Ga0496124_0001061 3300048927 Bacteria 43394
698 Ga0496124_0004084 3300048927 Bacteria 17267
699 Ga0496124_0005367 3300048927 Bacteria 14474
700 Ga0496124_0012178 3300048927 Bacteria 8513
701 Ga0496124_0013838 3300048927 Bacteria 7846
702 Ga0496124_0013858 3300048927 Bacteria 7841
703 Ga0496124_0025735 3300048927 Bacteria 5321
704 Ga0496124_0095133 3300048927 Bacteria 2421
705 Ga0496125_0000348 3300048928 Bacteria 87672
706 Ga0496125_0002711 3300048928 Bacteria 22502
707 Ga0496125_0004432 3300048928 Bacteria 16200
708 Ga0496125_0006197 3300048928 Bacteria 13028
709 Ga0496125_0010457 3300048928 Bacteria 9384
710 Ga0496125_0016678 3300048928 Bacteria 7041
711 Ga0496125_0075496 3300048928 Bacteria 2608
712 Ga0496126_0001731 3300048929 Bacteria 32382
713 Ga0496126_0004409 3300048929 Bacteria 16857
714 Ga0496126_0042023 3300048929 Bacteria 4225
715 Ga0496126_0053772 3300048929 Bacteria 3651
716 Ga0496126_0059566 3300048929 Bacteria 3438
717 Ga0495678_000028 3300049459 Bacteria 220080
718 Ga0495678_024415 3300049459 Bacteria 2611
719 Ga0495682_0015236 3300049460 Bacteria 2913
720 Ga0495682_0038251 3300049460 Bacteria 1763
721 Ga0501031_0011773 3300049568 Bacteria 5707
722 Ga0501031_0019155 3300049568 Bacteria 4456
723 Ga0501031_0052541 3300049568 Bacteria 2655
724 Ga0501032_0034432 3300049569 Bacteria 3468
725 Ga0501032_0125391 3300049569 Bacteria 1696
726 Ga0501033_0000539 3300049570 Bacteria 35280
727 Ga0501033_0045414 3300049570 Bacteria 3269
728 Ga0501033_0072967 3300049570 Bacteria 2520
729 Ga0501034_0000083 3300049571 Bacteria 169656
730 Ga0501034_0000091 3300049571 Bacteria 164456
731 Ga0501034_0000592 3300049571 Bacteria 57290
732 Ga0501034_0001599 3300049571 Bacteria 29470
733 Ga0501034_0039909 3300049571 Bacteria 4754
734 Ga0501034_0079414 3300049571 Bacteria 3284
735 Ga0501034_0098838 3300049571 Bacteria 2913
736 Ga0501037_0029032 3300049573 Bacteria 4085
737 Ga0501037_0030806 3300049573 Bacteria 3962
738 Ga0501037_0085388 3300049573 Bacteria 2285
739 Ga0501038_0082482 3300049574 Bacteria 2707
740 Ga0501043_0035321 3300049579 Bacteria 3931
741 Ga0501043_0042000 3300049579 Bacteria 3592
742 Ga0501043_0055361 3300049579 Bacteria 3116
743 Ga0501046_0010507 3300049580 Bacteria 7941
744 Ga0501046_0098181 3300049580 Bacteria 2249
745 Ga0501047_0045273 3300049581 Bacteria 4254
746 Ga0501047_0071692 3300049581 Bacteria 3334
747 Ga0501047_0076534 3300049581 Bacteria 3220
748 Ga0501047_0199733 3300049581 Bacteria 1861
749 Ga0501048_0046805 3300049582 Bacteria 3088
750 Ga0501048_0091233 3300049582 Bacteria 2149
751 Ga0501069_0010771 3300049585 Bacteria 4848
752 Ga0501070_0058089 3300049586 Bacteria 3207
753 Ga0501080_0217497 3300049742 Bacteria 1749
754 Ga0501083_0096064 3300049744 Bacteria 1955
755 Ga0501035_0000974 3300049822 Bacteria 30264
756 Ga0501035_0051319 3300049822 Bacteria 3693
757 Ga0501035_0066072 3300049822 Bacteria 3210
758 Ga0501035_0094360 3300049822 Bacteria 2631
759 Ga0501044_0003619 3300049823 Bacteria 17388
760 Ga0501044_0046734 3300049823 Bacteria 4480
761 Ga0501044_0068438 3300049823 Bacteria 3616
762 Ga0501044_0151092 3300049823 Bacteria 2304
763 Ga0501044_0275834 3300049823 Bacteria 1616
764 nmdc:mga08y16_12136_c1 3300050511 Bacteria 9054
765 Ga0500643_000152 3300053087 Bacteria 69800
766 Ga0500643_000460 3300053087 Bacteria 30091
767 Ga0500644_0002761 3300053088 Bacteria 4382
768 Ga0500651_0000033 3300053093 Bacteria 108567
769 Ga0500555_000409 3300053103 Bacteria 17896
770 Ga0500634_0000098 3300053161 Bacteria 34065
771 Ga0501084_0214821 3300054114 Bacteria 1623
772 Ga0466962_0015399 3300061719 Bacteria 3686
773 Ga0466962_0022655 3300061719 Bacteria 3019

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003794 Ga0055531_10015137 Ga0055531_100151373 394
2 3300009094 Ga0111539_10001027 Ga0111539_1000102725 394
3 3300037418 Ga0395900_0239257 Ga0395900_0239257_60_1268 396
4 3300027907 Ga0207428_10003984 Ga0207428_100039849 405
5 3300048922 Ga0496119_0069083 Ga0496119_0069083_195_1424 409
6 3300049744 Ga0501083_0096064 Ga0501083_0096064_31_1287 415
7 3300025321 Ga0207656_10014809 Ga0207656_100148091 427
8 3300005331 Ga0070670_100000002 Ga0070670_100000002209 433
9 3300005353 Ga0070669_100007740 Ga0070669_1000077404 433
10 3300005355 Ga0070671_100000023 Ga0070671_10000002373 433
11 3300005365 Ga0070688_100064916 Ga0070688_1000649161 433
12 3300005367 Ga0070667_100000018 Ga0070667_100000018208 433
13 3300005466 Ga0070685_10000011 Ga0070685_10000011102 433
14 3300005548 Ga0070665_100005073 Ga0070665_1000050732 433
15 3300005617 Ga0068859_100105981 Ga0068859_1001059812 433
16 3300005618 Ga0068864_100000003 Ga0068864_100000003211 433
17 3300005843 Ga0068860_100022725 Ga0068860_1000227254 433
18 3300005844 Ga0068862_100005757 Ga0068862_1000057572 433
19 3300006931 Ga0097620_100105989 Ga0097620_1001059892 433
20 3300009101 Ga0105247_10004696 Ga0105247_100046962 433
21 3300009177 Ga0105248_10096502 Ga0105248_100965023 433
22 3300014325 Ga0163163_10000537 Ga0163163_1000053713 433
23 3300025923 Ga0207681_10001068 Ga0207681_100010682 433
24 3300025925 Ga0207650_10000003 Ga0207650_10000003761 433
25 3300025931 Ga0207644_10000027 Ga0207644_1000002791 433
26 3300025986 Ga0207658_10000004 Ga0207658_10000004208 433
27 3300026088 Ga0207641_10019264 Ga0207641_100192642 433
28 3300026095 Ga0207676_10000003 Ga0207676_10000003334 433
29 3300028379 Ga0268266_10002297 Ga0268266_1000229714 433
30 3300028381 Ga0268264_10000016 Ga0268264_10000016258 433
31 3300005354 Ga0070675_100014764 Ga0070675_1000147645 434
32 3300035695 Ga0373927_0076523 Ga0373927_0076523_66_1463 434
33 3300037068 Ga0373925_0103237 Ga0373925_0103237_185_1582 434
34 3300031727 Ga0316576_10037332 Ga0316576_100373321 437
35 3300036712 Ga0316584_0046555 Ga0316584_0046555_837_2240 437
36 3300031727 Ga0316576_10005271 Ga0316576_100052712 438
37 3300005331 Ga0070670_100080904 Ga0070670_1000809042 440
38 3300025925 Ga0207650_10067663 Ga0207650_100676632 440
39 3300031595 Ga0265313_10022433 Ga0265313_100224332 440
40 3300054114 Ga0501084_0214821 Ga0501084_0214821_145_1563 440
41 3300005616 Ga0068852_100066737 Ga0068852_1000667372 445
42 3300026035 Ga0207703_10076430 Ga0207703_100764302 445
43 3300026142 Ga0207698_10018844 Ga0207698_100188443 445
44 3300013308 Ga0157375_10003760 Ga0157375_100037604 448
45 3300049570 Ga0501033_0045414 Ga0501033_0045414_680_2065 448
46 3300005327 Ga0070658_10000825 Ga0070658_100008257 449
47 3300005335 Ga0070666_10000018 Ga0070666_1000001862 449
48 3300005344 Ga0070661_100022106 Ga0070661_1000221063 449
49 3300005367 Ga0070667_100101624 Ga0070667_1001016242 449
50 3300009551 Ga0105238_10000224 Ga0105238_1000022429 449
51 3300013306 Ga0163162_10000284 Ga0163162_100002846 449
52 3300025903 Ga0207680_10000002 Ga0207680_10000002448 449
53 3300025920 Ga0207649_10129956 Ga0207649_101299561 449
54 3300025924 Ga0207694_10000210 Ga0207694_1000021043 449
55 3300025972 Ga0207668_10059861 Ga0207668_100598612 449
56 3300025986 Ga0207658_10027507 Ga0207658_100275074 449
57 3300028379 Ga0268266_10000004 Ga0268266_10000004445 449
58 3300033180 Ga0307510_10011777 Ga0307510_100117774 449
59 3300046471 Ga0495650_0000980 Ga0495650_0000980_12633_14015 449
60 3300046660 Ga0495625_0016209 Ga0495625_0016209_3119_4501 449
61 3300048924 Ga0496121_0068591 Ga0496121_0068591_599_2071 449
62 3300048929 Ga0496126_0042023 Ga0496126_0042023_394_1866 449
63 3300006051 Ga0075364_10000075 Ga0075364_1000007524 450
64 3300005262 Ga0065165_1000186 Ga0065165_100018667 451
65 3300006186 Ga0075369_10022777 Ga0075369_100227772 451
66 3300009174 Ga0105241_10181519 Ga0105241_101815192 451
67 3300025258 Ga0209129_1002319 Ga0209129_10023198 451
68 3300025297 Ga0209758_1029512 Ga0209758_10295122 451
69 3300031711 Ga0265314_10093203 Ga0265314_100932032 451
70 3300049571 Ga0501034_0000592 Ga0501034_0000592_36261_37631 451
71 3300013102 Ga0157371_10119685 Ga0157371_101196852 452
72 3300025261 Ga0209233_1008375 Ga0209233_10083753 452
73 3300053088 Ga0500644_0002761 Ga0500644_0002761_1441_2826 453
74 3300025936 Ga0207670_10083399 Ga0207670_100833992 455
75 3300031616 Ga0307508_10010230 Ga0307508_100102306 455
76 3300046648 Ga0495611_0000001 Ga0495611_0000001_274884_276266 455
77 3300046660 Ga0495625_0000037 Ga0495625_0000037_15738_17120 455
78 iso_pu_bacteria 2593339238 2595448294 455
79 3300025944 Ga0207661_10179395 Ga0207661_101793952 456
80 iso_pu_bacteria 2593339239 2595451589 456
81 iso_pu_bacteria 2718218334 2721028363 456
82 iso_pu_bacteria 2734482264 2735836056 456
83 iso_pu_bacteria 2738543009 2739227767 456
84 iso_pu_bacteria 2739367700 2739730103 456
85 iso_pu_bacteria 2818991440 2819563415 456
86 iso_pu_bacteria 2842918807 2842921591 456
87 iso_pu_bacteria 2884338543 2884339849 456
88 iso_pu_bacteria 2884411467 2884414294 456
89 iso_pu_bacteria 2904463128 2904464277 456
90 iso_pu_bacteria 2919085039 2919088491 456
91 iso_pu_bacteria 2919404418 2919404669 456
92 iso_pu_bacteria 2928963466 2928965648 456
93 iso_pu_bacteria 2941471342 2941472455 456
94 iso_pu_bacteria 2953994433 2953997605 456
95 3300005466 Ga0070685_10000308 Ga0070685_1000030817 457
96 3300005548 Ga0070665_100061775 Ga0070665_1000617752 457
97 3300009093 Ga0105240_10001717 Ga0105240_1000171733 457
98 3300009093 Ga0105240_10014038 Ga0105240_1001403810 457
99 3300009174 Ga0105241_10036548 Ga0105241_100365483 457
100 3300009545 Ga0105237_10011644 Ga0105237_100116445 457
101 3300009551 Ga0105238_10002702 Ga0105238_100027025 457
102 3300010375 Ga0105239_10179719 Ga0105239_101797193 457
103 3300025913 Ga0207695_10000033 Ga0207695_10000033191 457
104 3300025913 Ga0207695_10063506 Ga0207695_100635063 457
105 3300025914 Ga0207671_10014832 Ga0207671_100148325 457
106 3300025924 Ga0207694_10000487 Ga0207694_100004875 457
107 3300037471 Ga0395905_0000934 Ga0395905_0000934_20878_22284 457
108 3300037471 Ga0395905_0001196 Ga0395905_0001196_17280_18686 457
109 iso_pu_bacteria 2842914999 2842915248 457
110 iso_pu_bacteria 2894414249 2894417675 457
111 iso_pu_bacteria 2919513703 2919517206 457
112 iso_pu_bacteria 2919675420 2919677057 457
113 3300005456 Ga0070678_100135470 Ga0070678_1001354702 458
114 3300026118 Ga0207675_100147765 Ga0207675_1001477652 458
115 3300026121 Ga0207683_10081681 Ga0207683_100816812 458
116 iso_pu_bacteria 2537561836 2538832126 458
117 iso_pu_bacteria 2547132130 2547502953 458
118 iso_pu_bacteria 2576861471 2578458509 458
119 iso_pu_bacteria 2643221562 2643829616 458
120 iso_pu_bacteria 2643221577 2643896909 458
121 iso_pu_bacteria 2643221579 2643907996 458
122 iso_pu_bacteria 2643221581 2643915801 458
123 iso_pu_bacteria 2643221685 2644479115 458
124 iso_pu_bacteria 2687453130 2687584149 458
125 iso_pu_bacteria 2747842428 2747949477 458
126 iso_pu_bacteria 2747842501 2748019767 458
127 iso_pu_bacteria 2765235840 2765578881 458
128 iso_pu_bacteria 2816332141 2816516951 458
129 iso_pu_bacteria 2818991457 2819659675 458
130 iso_pu_bacteria 2842391507 2842393066 458
131 iso_pu_bacteria 2842757796 2842760210 458
132 iso_pu_bacteria 2842780639 2842780907 458
133 iso_pu_bacteria 2852649853 2852650927 458
134 iso_pu_bacteria 2852684882 2852685522 458
135 iso_pu_bacteria 2857442823 2857443771 458
136 iso_pu_bacteria 2874220319 2874221527 458
137 iso_pu_bacteria 2895395659 2895397555 458
138 iso_pu_bacteria 2895498888 2895500767 458
139 iso_pu_bacteria 2895511927 2895516363 458
140 iso_pu_bacteria 2895522137 2895523718 458
141 iso_pu_bacteria 2895525241 2895526701 458
142 iso_pu_bacteria 2919089067 2919089806 458
143 iso_pu_bacteria 2919130084 2919131677 458
144 iso_pu_bacteria 2919134579 2919137743 458
145 iso_pu_bacteria 2923516293 2923518646 458
146 iso_pu_bacteria 2928496128 2928500244 458
147 iso_pu_bacteria 2929195423 2929197953 458
148 iso_pu_bacteria 2931380184 2931380849 458
149 iso_pu_bacteria 2937610967 2937612344 458
150 iso_pu_bacteria 2939589442 2939591368 458
151 iso_pu_bacteria 2939611941 2939612650 458
152 iso_pu_bacteria 2939622612 2939623155 458
153 iso_pu_bacteria 2939626828 2939630913 458
154 iso_pu_bacteria 2941475908 2941478224 458
155 iso_pu_bacteria 2961047084 2961048294 458
156 iso_pu_bacteria 2961064222 2961065292 458
157 iso_pu_bacteria 2974307012 2974309069 458
158 iso_pu_bacteria 2977247770 2977249787 458
159 iso_pu_bacteria 2984514374 2984515724 458
160 iso_pu_bacteria 2987605356 2987606341 458
161 iso_pu_bacteria 8002869464 8002871863 458
162 iso_pu_bacteria 8021622325 8021624263 458
163 iso_pu_bacteria 8021626552 8021626606 458
164 iso_pu_bacteria 8021648035 8021649098 458
165 3300002737 JGI25162J39368_1003087 JGI25162J39368_10030873 459
166 3300005937 Ga0081455_10052948 Ga0081455_100529482 459
167 3300009094 Ga0111539_10016831 Ga0111539_100168317 459
168 3300025233 Ga0209437_101541 Ga0209437_1015413 459
169 3300025254 Ga0209148_1001681 Ga0209148_10016813 459
170 3300027907 Ga0207428_10116357 Ga0207428_101163572 459
171 3300028573 Ga0265334_10028783 Ga0265334_100287831 459
172 3300036401 Ga0373937_0137035 Ga0373937_0137035_595_2016 459
173 3300044672 Ga0466982_0000231 Ga0466982_0000231_8603_9982 459
174 3300049581 Ga0501047_0199733 Ga0501047_0199733_123_1526 459
175 3300049822 Ga0501035_0000974 Ga0501035_0000974_1312_2730 459
176 3300050511 nmdc:mga08y16_12136_c1 nmdc:mga08y16_12136_c1_3444_4871 459
177 3300001979 JGI24740J21852_10002000 JGI24740J21852_100020007 460
178 3300001989 JGI24739J22299_10005709 JGI24739J22299_100057093 460
179 3300001990 JGI24737J22298_10013097 JGI24737J22298_100130972 460
180 3300002067 JGI24735J21928_10033230 JGI24735J21928_100332301 460
181 3300002067 JGI24735J21928_10033252 JGI24735J21928_100332521 460
182 3300002075 JGI24738J21930_10000181 JGI24738J21930_100001812 460
183 3300002737 JGI25162J39368_1000294 JGI25162J39368_10002949 460
184 3300002737 JGI25162J39368_1000397 JGI25162J39368_100039710 460
185 3300002737 JGI25162J39368_1002269 JGI25162J39368_10022694 460
186 3300002741 JGI25157J39369_1000559 JGI25157J39369_100055914 460
187 3300002771 JGI25163J39215_1001719 JGI25163J39215_10017192 460
188 3300002772 JGI25164J39214_1000203 JGI25164J39214_100020326 460
189 3300003214 JGI25165J46597_1000352 JGI25165J46597_100035226 460
190 3300003215 JGI25153J46596_10016875 JGI25153J46596_100168752 460
191 3300003578 Ga0006562J51391_1035570 Ga0006562J51391_10355702 460
192 3300003751 Ga0055538_1000713 Ga0055538_10007135 460
193 3300003756 Ga0055533_1000285 Ga0055533_100028517 460
194 3300003761 Ga0055535_1000074 Ga0055535_100007491 460
195 3300003761 Ga0055535_1000293 Ga0055535_100029326 460
196 3300003762 Ga0055542_1000357 Ga0055542_10003574 460
197 3300003762 Ga0055542_1000368 Ga0055542_100036826 460
198 3300003763 Ga0055529_1000121 Ga0055529_100012192 460
199 3300003763 Ga0055529_1000349 Ga0055529_100034926 460
200 3300005262 Ga0065165_1006259 Ga0065165_10062595 460
201 3300005340 Ga0070689_100001806 Ga0070689_1000018061 460
202 3300005364 Ga0070673_100043087 Ga0070673_1000430873 460
203 3300005367 Ga0070667_100092097 Ga0070667_1000920972 460
204 3300005563 Ga0068855_100021479 Ga0068855_1000214796 460
205 3300005563 Ga0068855_100044098 Ga0068855_1000440983 460
206 3300005578 Ga0068854_100002904 Ga0068854_10000290410 460
207 3300005578 Ga0068854_100020234 Ga0068854_1000202342 460
208 3300005617 Ga0068859_100063405 Ga0068859_1000634052 460
209 3300005617 Ga0068859_100074657 Ga0068859_1000746572 460
210 3300005841 Ga0068863_100024746 Ga0068863_1000247466 460
211 3300005841 Ga0068863_100032819 Ga0068863_1000328195 460
212 3300005841 Ga0068863_100073638 Ga0068863_1000736383 460
213 3300006358 Ga0068871_100150842 Ga0068871_1001508422 460
214 3300006881 Ga0068865_100009059 Ga0068865_1000090592 460
215 3300006931 Ga0097620_100063405 Ga0097620_1000634052 460
216 3300006931 Ga0097620_100074654 Ga0097620_1000746542 460
217 3300009093 Ga0105240_10002685 Ga0105240_100026857 460
218 3300009093 Ga0105240_10026393 Ga0105240_100263936 460
219 3300009093 Ga0105240_10064962 Ga0105240_100649624 460
220 3300009093 Ga0105240_10256873 Ga0105240_102568732 460
221 3300009101 Ga0105247_10003540 Ga0105247_100035404 460
222 3300009545 Ga0105237_10000543 Ga0105237_1000054337 460
223 3300009545 Ga0105237_10288041 Ga0105237_102880411 460
224 3300009551 Ga0105238_10189516 Ga0105238_101895162 460
225 3300010375 Ga0105239_10000023 Ga0105239_10000023146 460
226 3300010375 Ga0105239_10046151 Ga0105239_100461512 460
227 3300010375 Ga0105239_10075734 Ga0105239_100757343 460
228 3300013104 Ga0157370_10000044 Ga0157370_1000004412 460
229 3300013105 Ga0157369_10004095 Ga0157369_100040957 460
230 3300013296 Ga0157374_10033453 Ga0157374_100334533 460
231 3300013306 Ga0163162_10019407 Ga0163162_100194072 460
232 3300013306 Ga0163162_10029630 Ga0163162_100296305 460
233 3300013307 Ga0157372_10019325 Ga0157372_100193252 460
234 3300013308 Ga0157375_10049967 Ga0157375_100499672 460
235 3300013308 Ga0157375_10072201 Ga0157375_100722011 460
236 3300014325 Ga0163163_10130566 Ga0163163_101305662 460
237 3300014497 Ga0182008_10003037 Ga0182008_100030379 460
238 3300014969 Ga0157376_10000427 Ga0157376_1000042725 460
239 3300015261 Ga0182006_1000077 Ga0182006_100007798 460
240 3300015261 Ga0182006_1000427 Ga0182006_10004279 460
241 3300015262 Ga0182007_10006322 Ga0182007_100063223 460
242 3300015265 Ga0182005_1000060 Ga0182005_100006084 460
243 3300015265 Ga0182005_1022260 Ga0182005_10222602 460
244 3300015687 Ga0183368_1003 Ga0183368_1003567 460
245 3300017792 Ga0163161_10083110 Ga0163161_100831102 460
246 3300025207 Ga0209760_100363 Ga0209760_1003632 460
247 3300025224 Ga0209784_100011 Ga0209784_100011138 460
248 3300025226 Ga0209674_100012 Ga0209674_100012311 460
249 3300025231 Ga0207427_100026 Ga0207427_10002626 460
250 3300025231 Ga0207427_104288 Ga0207427_1042882 460
251 3300025233 Ga0209437_100202 Ga0209437_10020286 460
252 3300025233 Ga0209437_100359 Ga0209437_10035926 460
253 3300025242 Ga0209258_100027 Ga0209258_100027409 460
254 3300025242 Ga0209258_106463 Ga0209258_1064631 460
255 3300025246 Ga0209646_1000322 Ga0209646_100032221 460
256 3300025246 Ga0209646_1002983 Ga0209646_10029832 460
257 3300025250 Ga0209026_1000018 Ga0209026_1000018303 460
258 3300025254 Ga0209148_1000001 Ga0209148_10000011147 460
259 3300025254 Ga0209148_1000005 Ga0209148_10000051142 460
260 3300025256 Ga0209759_1000550 Ga0209759_100055021 460
261 3300025258 Ga0209129_1001261 Ga0209129_100126119 460
262 3300025261 Ga0209233_1000002 Ga0209233_10000021083 460
263 3300025272 Ga0209455_1000019 Ga0209455_1000019476 460
264 3300025297 Ga0209758_1000644 Ga0209758_100064424 460
265 3300025299 Ga0209256_1008903 Ga0209256_10089032 460
266 3300025303 Ga0209051_1004118 Ga0209051_10041187 460
267 3300025900 Ga0207710_10003190 Ga0207710_100031904 460
268 3300025904 Ga0207647_10000078 Ga0207647_1000007851 460
269 3300025904 Ga0207647_10009507 Ga0207647_100095076 460
270 3300025913 Ga0207695_10001880 Ga0207695_1000188020 460
271 3300025913 Ga0207695_10009427 Ga0207695_100094273 460
272 3300025913 Ga0207695_10019726 Ga0207695_100197266 460
273 3300025913 Ga0207695_10031732 Ga0207695_100317324 460
274 3300025914 Ga0207671_10000038 Ga0207671_1000003857 460
275 3300025924 Ga0207694_10118772 Ga0207694_101187721 460
276 3300025936 Ga0207670_10001950 Ga0207670_100019501 460
277 3300025938 Ga0207704_10011804 Ga0207704_100118044 460
278 3300025940 Ga0207691_10047647 Ga0207691_100476472 460
279 3300025949 Ga0207667_10000693 Ga0207667_1000069312 460
280 3300025949 Ga0207667_10008397 Ga0207667_100083977 460
281 3300025960 Ga0207651_10031925 Ga0207651_100319252 460
282 3300025981 Ga0207640_10004830 Ga0207640_100048302 460
283 3300025981 Ga0207640_10020869 Ga0207640_100208691 460
284 3300026067 Ga0207678_10106775 Ga0207678_101067752 460
285 3300026067 Ga0207678_10215025 Ga0207678_102150251 460
286 3300026088 Ga0207641_10035200 Ga0207641_100352004 460
287 3300026088 Ga0207641_10165082 Ga0207641_101650822 460
288 3300026088 Ga0207641_10179904 Ga0207641_101799041 460
289 3300026116 Ga0207674_10002019 Ga0207674_1000201919 460
290 3300026121 Ga0207683_10013683 Ga0207683_100136836 460
291 3300026121 Ga0207683_10022504 Ga0207683_100225046 460
292 3300028381 Ga0268264_10131959 Ga0268264_101319591 460
293 3300031731 Ga0307405_10051474 Ga0307405_100514741 460
294 3300031911 Ga0307412_10000203 Ga0307412_1000020325 460
295 3300041404 Ga0439436_0000006 Ga0439436_0000006_54618_56000 460
296 3300041413 Ga0439465_0000833 Ga0439465_0000833_8196_9578 460
297 3300041453 Ga0451797_0870357 Ga0451797_0870357_371_1846 460
298 3300041486 Ga0451807_0145775 Ga0451807_0145775_542_2017 460
299 3300041494 Ga0451837_1686608 Ga0451837_1686608_953_2443 460
300 3300042184 Ga0450908_000855 Ga0450908_000855_834_2216 460
301 3300044656 Ga0466969_0023913 Ga0466969_0023913_1436_2899 460
302 3300044672 Ga0466982_0000003 Ga0466982_0000003_149638_151041 460
303 3300044684 Ga0466966_0001912 Ga0466966_0001912_1538_2941 460
304 3300044684 Ga0466966_0047309 Ga0466966_0047309_1024_2487 460
305 3300044719 Ga0466971_0003646 Ga0466971_0003646_614_2017 460
306 3300046452 Ga0495617_000107 Ga0495617_000107_10531_11913 460
307 3300046452 Ga0495617_000337 Ga0495617_000337_5225_6607 460
308 3300046460 Ga0495638_0000430 Ga0495638_0000430_23859_25241 460
309 3300046460 Ga0495638_0002222 Ga0495638_0002222_13223_14605 460
310 3300046460 Ga0495638_0039200 Ga0495638_0039200_16_1467 460
311 3300046471 Ga0495650_0000444 Ga0495650_0000444_38717_40099 460
312 3300046471 Ga0495650_0001591 Ga0495650_0001591_1171_2622 460
313 3300046491 Ga0495584_0005843 Ga0495584_0005843_2987_4438 460
314 3300046492 Ga0495585_0000028 Ga0495585_0000028_14077_15459 460
315 3300046492 Ga0495585_0000927 Ga0495585_0000927_131_1582 460
316 3300046501 Ga0495607_0000438 Ga0495607_0000438_6954_8336 460
317 3300046501 Ga0495607_0002438 Ga0495607_0002438_5590_6972 460
318 3300046501 Ga0495607_0025777 Ga0495607_0025777_2168_3550 460
319 3300046507 Ga0495606_0000216 Ga0495606_0000216_20134_21597 460
320 3300046507 Ga0495606_0000872 Ga0495606_0000872_31028_32479 460
321 3300046507 Ga0495606_0000934 Ga0495606_0000934_7688_9070 460
322 3300046507 Ga0495606_0033187 Ga0495606_0033187_1168_2550 460
323 3300046507 Ga0495606_0038546 Ga0495606_0038546_1751_3202 460
324 3300046512 Ga0495610_0006433 Ga0495610_0006433_469_1851 460
325 3300046512 Ga0495610_0021328 Ga0495610_0021328_1143_2594 460
326 3300046513 Ga0495616_0000098 Ga0495616_0000098_36170_37621 460
327 3300046515 Ga0495620_0001664 Ga0495620_0001664_1179_2561 460
328 3300046518 Ga0495631_0001265 Ga0495631_0001265_1648_3099 460
329 3300046518 Ga0495631_0004267 Ga0495631_0004267_6124_7506 460
330 3300046519 Ga0495632_0000032 Ga0495632_0000032_2664_4046 460
331 3300046519 Ga0495632_0063007 Ga0495632_0063007_171_1553 460
332 3300046524 Ga0495648_0002326 Ga0495648_0002326_7205_8587 460
333 3300046557 Ga0495622_0022919 Ga0495622_0022919_436_1818 460
334 3300046616 Ga0495668_0021466 Ga0495668_0021466_516_1898 460
335 3300046648 Ga0495611_0000092 Ga0495611_0000092_33694_35145 460
336 3300046660 Ga0495625_0064918 Ga0495625_0064918_1075_2457 460
337 3300046665 Ga0495661_0019881 Ga0495661_0019881_1946_3328 460
338 3300046691 Ga0495670_0002216 Ga0495670_0002216_6971_8353 460
339 3300046691 Ga0495670_0002434 Ga0495670_0002434_425_1876 460
340 3300046691 Ga0495670_0012753 Ga0495670_0012753_2136_3518 460
341 3300046692 Ga0495671_0003326 Ga0495671_0003326_5852_7234 460
342 3300046694 Ga0495649_0001808 Ga0495649_0001808_10385_11848 460
343 3300046794 Ga0495589_0000523 Ga0495589_0000523_25449_26831 460
344 3300046810 Ga0495660_0000076 Ga0495660_0000076_94759_96141 460
345 3300046810 Ga0495660_0000567 Ga0495660_0000567_13075_14457 460
346 3300047323 Ga0495683_0001013 Ga0495683_0001013_202_1653 460
347 3300047446 Ga0495679_000001 Ga0495679_000001_1314087_1315469 460
348 3300047469 Ga0495673_0000010 Ga0495673_0000010_501671_503122 460
349 3300047469 Ga0495673_0000087 Ga0495673_0000087_63867_65249 460
350 3300047469 Ga0495673_0001346 Ga0495673_0001346_12168_13550 460
351 3300047472 Ga0495686_0000123 Ga0495686_0000123_84379_85761 460
352 3300047472 Ga0495686_0000792 Ga0495686_0000792_5731_7182 460
353 3300047472 Ga0495686_0017669 Ga0495686_0017669_580_1962 460
354 3300047472 Ga0495686_0057699 Ga0495686_0057699_76_1527 460
355 3300048903 Ga0496100_0010984 Ga0496100_0010984_701_2101 460
356 3300048904 Ga0496101_0003218 Ga0496101_0003218_7530_8912 460
357 3300048904 Ga0496101_0065594 Ga0496101_0065594_670_2070 460
358 3300048905 Ga0496102_0140045 Ga0496102_0140045_91_1473 460
359 3300048908 Ga0496105_0064090 Ga0496105_0064090_560_1960 460
360 3300048909 Ga0496106_0000563 Ga0496106_0000563_23723_25105 460
361 3300048917 Ga0496114_0003989 Ga0496114_0003989_6849_8279 460
362 3300048918 Ga0496115_0000530 Ga0496115_0000530_905_2287 460
363 3300048918 Ga0496115_0000924 Ga0496115_0000924_19637_21100 460
364 3300048918 Ga0496115_0029951 Ga0496115_0029951_1539_2921 460
365 3300048918 Ga0496115_0043831 Ga0496115_0043831_1204_2604 460
366 3300048920 Ga0496117_0041533 Ga0496117_0041533_238_1638 460
367 3300048920 Ga0496117_0062217 Ga0496117_0062217_361_1743 460
368 3300048921 Ga0496118_0005348 Ga0496118_0005348_1623_3005 460
369 3300048921 Ga0496118_0014740 Ga0496118_0014740_1683_3083 460
370 3300048921 Ga0496118_0036831 Ga0496118_0036831_1128_2528 460
371 3300048922 Ga0496119_0000070 Ga0496119_0000070_44975_46375 460
372 3300048923 Ga0496120_0000696 Ga0496120_0000696_43449_44849 460
373 3300048924 Ga0496121_0000541 Ga0496121_0000541_69353_70735 460
374 3300048924 Ga0496121_0001673 Ga0496121_0001673_26943_28325 460
375 3300048924 Ga0496121_0002576 Ga0496121_0002576_2968_4368 460
376 3300048924 Ga0496121_0007321 Ga0496121_0007321_4069_5520 460
377 3300048924 Ga0496121_0016007 Ga0496121_0016007_5732_7228 460
378 3300048924 Ga0496121_0155012 Ga0496121_0155012_246_1628 460
379 3300048925 Ga0496122_0055374 Ga0496122_0055374_1560_2942 460
380 3300048926 Ga0496123_0003232 Ga0496123_0003232_14940_16379 460
381 3300048927 Ga0496124_0013838 Ga0496124_0013838_5391_6830 460
382 3300048927 Ga0496124_0013858 Ga0496124_0013858_1017_2456 460
383 3300048928 Ga0496125_0000348 Ga0496125_0000348_43328_44824 460
384 3300048928 Ga0496125_0075496 Ga0496125_0075496_1108_2490 460
385 3300048929 Ga0496126_0001731 Ga0496126_0001731_29832_31232 460
386 3300048929 Ga0496126_0059566 Ga0496126_0059566_636_2099 460
387 3300049459 Ga0495678_000028 Ga0495678_000028_41881_43263 460
388 3300049459 Ga0495678_024415 Ga0495678_024415_898_2280 460
389 3300049460 Ga0495682_0015236 Ga0495682_0015236_1257_2639 460
390 3300049460 Ga0495682_0038251 Ga0495682_0038251_267_1649 460
391 3300049585 Ga0501069_0010771 Ga0501069_0010771_2817_4199 460
392 3300053087 Ga0500643_000152 Ga0500643_000152_33334_34716 460
393 3300053087 Ga0500643_000460 Ga0500643_000460_3529_4953 460
394 3300053103 Ga0500555_000409 Ga0500555_000409_11574_12956 460
395 3300061719 Ga0466962_0015399 Ga0466962_0015399_32_1435 460
396 iso_pu_bacteria 8003014200 8003016197 460
397 3300002705 JGI25156J39149_1000554 JGI25156J39149_10005544 461
398 3300002737 JGI25162J39368_1001712 JGI25162J39368_10017128 461
399 3300002738 JGI25154J39366_1003210 JGI25154J39366_10032102 461
400 3300002741 JGI25157J39369_1000571 JGI25157J39369_10005714 461
401 3300002741 JGI25157J39369_1002314 JGI25157J39369_10023142 461
402 3300002772 JGI25164J39214_1000138 JGI25164J39214_100013819 461
403 3300003214 JGI25165J46597_1000234 JGI25165J46597_100023449 461
404 3300003752 Ga0055539_1002855 Ga0055539_10028552 461
405 3300003756 Ga0055533_1004809 Ga0055533_10048092 461
406 3300003759 Ga0055525_1000178 Ga0055525_10001783 461
407 3300003760 Ga0055527_1000031 Ga0055527_1000031145 461
408 3300003760 Ga0055527_1000054 Ga0055527_10000547 461
409 3300003760 Ga0055527_1000803 Ga0055527_10008035 461
410 3300003761 Ga0055535_1000203 Ga0055535_10002035 461
411 3300003761 Ga0055535_1000725 Ga0055535_100072519 461
412 3300003761 Ga0055535_1000828 Ga0055535_100082813 461
413 3300003761 Ga0055535_1001977 Ga0055535_10019774 461
414 3300003761 Ga0055535_1002324 Ga0055535_10023245 461
415 3300003762 Ga0055542_1000083 Ga0055542_1000083103 461
416 3300003762 Ga0055542_1000100 Ga0055542_100010098 461
417 3300003762 Ga0055542_1000621 Ga0055542_10006215 461
418 3300003762 Ga0055542_1000748 Ga0055542_100074819 461
419 3300003763 Ga0055529_1000073 Ga0055529_10000735 461
420 3300003763 Ga0055529_1000288 Ga0055529_100028855 461
421 3300003763 Ga0055529_1000567 Ga0055529_100056719 461
422 3300003763 Ga0055529_1001548 Ga0055529_10015484 461
423 3300005335 Ga0070666_10001323 Ga0070666_100013239 461
424 3300005355 Ga0070671_100106387 Ga0070671_1001063872 461
425 3300005367 Ga0070667_100047135 Ga0070667_1000471352 461
426 3300005367 Ga0070667_100067867 Ga0070667_1000678672 461
427 3300005455 Ga0070663_100001649 Ga0070663_1000016493 461
428 3300005457 Ga0070662_100020438 Ga0070662_1000204383 461
429 3300005458 Ga0070681_10057495 Ga0070681_100574951 461
430 3300005458 Ga0070681_10146756 Ga0070681_101467562 461
431 3300005530 Ga0070679_100125175 Ga0070679_1001251751 461
432 3300005539 Ga0068853_100142629 Ga0068853_1001426292 461
433 3300005547 Ga0070693_100007027 Ga0070693_1000070277 461
434 3300005548 Ga0070665_100000786 Ga0070665_10000078612 461
435 3300005563 Ga0068855_100150693 Ga0068855_1001506932 461
436 3300005578 Ga0068854_100003674 Ga0068854_1000036748 461
437 3300005578 Ga0068854_100050615 Ga0068854_1000506152 461
438 3300005614 Ga0068856_100000012 Ga0068856_10000001232 461
439 3300005614 Ga0068856_100001305 Ga0068856_1000013052 461
440 3300005842 Ga0068858_100000799 Ga0068858_10000079914 461
441 3300005843 Ga0068860_100018698 Ga0068860_1000186984 461
442 3300006051 Ga0075364_10043609 Ga0075364_100436092 461
443 3300006881 Ga0068865_100025111 Ga0068865_1000251112 461
444 3300009093 Ga0105240_10002894 Ga0105240_100028943 461
445 3300009093 Ga0105240_10159723 Ga0105240_101597232 461
446 3300009093 Ga0105240_10311171 Ga0105240_103111711 461
447 3300009174 Ga0105241_10002687 Ga0105241_100026879 461
448 3300009176 Ga0105242_10007059 Ga0105242_100070598 461
449 3300009545 Ga0105237_10000571 Ga0105237_1000057142 461
450 3300009545 Ga0105237_10022754 Ga0105237_100227541 461
451 3300009551 Ga0105238_10021104 Ga0105238_100211044 461
452 3300009551 Ga0105238_10085161 Ga0105238_100851612 461
453 3300010375 Ga0105239_10021526 Ga0105239_100215262 461
454 3300013105 Ga0157369_10000057 Ga0157369_1000005767 461
455 3300013105 Ga0157369_10005110 Ga0157369_100051102 461
456 3300013306 Ga0163162_10000007 Ga0163162_10000007113 461
457 3300013307 Ga0157372_10027128 Ga0157372_100271286 461
458 3300013307 Ga0157372_10062104 Ga0157372_100621043 461
459 3300013308 Ga0157375_10000206 Ga0157375_1000020640 461
460 3300014969 Ga0157376_10005743 Ga0157376_100057436 461
461 3300020070 Ga0206356_11480241 Ga0206356_114802411 461
462 3300020081 Ga0206354_10669824 Ga0206354_106698241 461
463 3300020082 Ga0206353_10435035 Ga0206353_104350352 461
464 3300025226 Ga0209674_100140 Ga0209674_10014012 461
465 3300025226 Ga0209674_100990 Ga0209674_1009902 461
466 3300025228 Ga0209672_100005 Ga0209672_100005511 461
467 3300025228 Ga0209672_100016 Ga0209672_100016171 461
468 3300025228 Ga0209672_100341 Ga0209672_10034119 461
469 3300025230 Ga0209563_100023 Ga0209563_100023167 461
470 3300025231 Ga0207427_100057 Ga0207427_10005720 461
471 3300025233 Ga0209437_100184 Ga0209437_10018420 461
472 3300025242 Ga0209258_100006 Ga0209258_100006511 461
473 3300025242 Ga0209258_100012 Ga0209258_100012312 461
474 3300025242 Ga0209258_100064 Ga0209258_10006464 461
475 3300025242 Ga0209258_100139 Ga0209258_10013948 461
476 3300025246 Ga0209646_1000820 Ga0209646_10008204 461
477 3300025250 Ga0209026_1000077 Ga0209026_1000077126 461
478 3300025250 Ga0209026_1000117 Ga0209026_100011797 461
479 3300025250 Ga0209026_1000451 Ga0209026_10004518 461
480 3300025254 Ga0209148_1000012 Ga0209148_1000012511 461
481 3300025254 Ga0209148_1000014 Ga0209148_1000014343 461
482 3300025254 Ga0209148_1000073 Ga0209148_1000073246 461
483 3300025254 Ga0209148_1000173 Ga0209148_100017362 461
484 3300025256 Ga0209759_1000134 Ga0209759_100013419 461
485 3300025256 Ga0209759_1001310 Ga0209759_100131011 461
486 3300025256 Ga0209759_1002234 Ga0209759_10022345 461
487 3300025261 Ga0209233_1000063 Ga0209233_1000063131 461
488 3300025272 Ga0209455_1000008 Ga0209455_1000008511 461
489 3300025272 Ga0209455_1000014 Ga0209455_1000014231 461
490 3300025272 Ga0209455_1000018 Ga0209455_1000018483 461
491 3300025272 Ga0209455_1001025 Ga0209455_10010257 461
492 3300025321 Ga0207656_10000302 Ga0207656_1000030210 461
493 3300025903 Ga0207680_10002436 Ga0207680_100024368 461
494 3300025904 Ga0207647_10001332 Ga0207647_1000133214 461
495 3300025911 Ga0207654_10008492 Ga0207654_100084922 461
496 3300025912 Ga0207707_10151511 Ga0207707_101515112 461
497 3300025913 Ga0207695_10000581 Ga0207695_100005818 461
498 3300025913 Ga0207695_10002256 Ga0207695_1000225613 461
499 3300025913 Ga0207695_10002259 Ga0207695_1000225913 461
500 3300025913 Ga0207695_10012614 Ga0207695_100126143 461
501 3300025914 Ga0207671_10001015 Ga0207671_100010158 461
502 3300025914 Ga0207671_10022208 Ga0207671_100222083 461
503 3300025921 Ga0207652_10150608 Ga0207652_101506081 461
504 3300025924 Ga0207694_10001035 Ga0207694_100010352 461
505 3300025924 Ga0207694_10004749 Ga0207694_100047497 461
506 3300025933 Ga0207706_10019337 Ga0207706_100193373 461
507 3300025938 Ga0207704_10025598 Ga0207704_100255982 461
508 3300025938 Ga0207704_10048528 Ga0207704_100485282 461
509 3300025961 Ga0207712_10000288 Ga0207712_1000028831 461
510 3300025981 Ga0207640_10007281 Ga0207640_100072813 461
511 3300025981 Ga0207640_10094207 Ga0207640_100942071 461
512 3300025986 Ga0207658_10012049 Ga0207658_100120495 461
513 3300025986 Ga0207658_10063939 Ga0207658_100639392 461
514 3300026035 Ga0207703_10001120 Ga0207703_1000112015 461
515 3300026067 Ga0207678_10008203 Ga0207678_100082032 461
516 3300026067 Ga0207678_10014285 Ga0207678_100142854 461
517 3300026078 Ga0207702_10000108 Ga0207702_1000010869 461
518 3300026078 Ga0207702_10000312 Ga0207702_1000031248 461
519 3300026116 Ga0207674_10039426 Ga0207674_100394263 461
520 3300026121 Ga0207683_10064767 Ga0207683_100647673 461
521 3300028379 Ga0268266_10000006 Ga0268266_10000006123 461
522 3300028381 Ga0268264_10001303 Ga0268264_1000130321 461
523 3300028381 Ga0268264_10062361 Ga0268264_100623612 461
524 3300030731 Ga0316177_1014219 Ga0316177_10142195 461
525 3300030735 Ga0316178_1139308 Ga0316178_11393082 461
526 3300031251 Ga0265327_10001419 Ga0265327_1000141917 461
527 3300031665 Ga0316575_10004695 Ga0316575_100046956 461
528 3300035089 Ga0373944_0003053 Ga0373944_0003053_2492_3877 461
529 3300035120 Ga0373957_0030344 Ga0373957_0030344_161_1546 461
530 3300035172 Ga0373955_0059394 Ga0373955_0059394_27_1412 461
531 3300036401 Ga0373937_0035551 Ga0373937_0035551_1804_3189 461
532 3300037312 Ga0395899_0000089 Ga0395899_0000089_49373_50758 461
533 3300037418 Ga0395900_0000029 Ga0395900_0000029_277184_278569 461
534 3300037418 Ga0395900_0011616 Ga0395900_0011616_6339_7724 461
535 3300037466 Ga0395898_0000018 Ga0395898_0000018_160619_162004 461
536 3300037466 Ga0395898_0000049 Ga0395898_0000049_49734_51119 461
537 3300037466 Ga0395898_0001843 Ga0395898_0001843_2994_4379 461
538 3300037466 Ga0395898_0092449 Ga0395898_0092449_1164_2549 461
539 3300038443 Ga0395901_0008539 Ga0395901_0008539_5723_7108 461
540 3300038443 Ga0395901_0035111 Ga0395901_0035111_1374_2759 461
541 3300038443 Ga0395901_0049611 Ga0395901_0049611_1642_3027 461
542 3300038443 Ga0395901_0049898 Ga0395901_0049898_2174_3559 461
543 3300038443 Ga0395901_0124752 Ga0395901_0124752_156_1541 461
544 3300041452 Ga0451793_0073484 Ga0451793_0073484_867_2252 461
545 3300044656 Ga0466969_0006363 Ga0466969_0006363_1362_2747 461
546 3300044656 Ga0466969_0007873 Ga0466969_0007873_1401_2786 461
547 3300044656 Ga0466969_0026182 Ga0466969_0026182_246_1631 461
548 3300044683 Ga0466965_0028634 Ga0466965_0028634_1125_2621 461
549 3300044684 Ga0466966_0005127 Ga0466966_0005127_5983_7368 461
550 3300044684 Ga0466966_0006879 Ga0466966_0006879_1365_2750 461
551 3300044693 Ga0466961_0001342 Ga0466961_0001342_12697_14082 461
552 3300044693 Ga0466961_0007688 Ga0466961_0007688_3327_4712 461
553 3300044693 Ga0466961_0017725 Ga0466961_0017725_2423_3808 461
554 3300044693 Ga0466961_0036413 Ga0466961_0036413_198_1694 461
555 3300044693 Ga0466961_0043622 Ga0466961_0043622_91_1476 461
556 3300044712 Ga0453684_0002590 Ga0453684_0002590_17069_18454 461
557 3300044765 Ga0466970_0053070 Ga0466970_0053070_445_1830 461
558 3300044765 Ga0466970_0076834 Ga0466970_0076834_15_1400 461
559 3300044842 Ga0466957_0009996 Ga0466957_0009996_3363_4748 461
560 3300044842 Ga0466957_0132197 Ga0466957_0132197_108_1493 461
561 3300045049 Ga0466959_0000346 Ga0466959_0000346_18127_19512 461
562 3300045049 Ga0466959_0001514 Ga0466959_0001514_3546_4931 461
563 3300045049 Ga0466959_0089200 Ga0466959_0089200_415_1911 461
564 3300045051 Ga0451576_0000840 Ga0451576_0000840_24829_26214 461
565 3300045836 Ga0466958_0002540 Ga0466958_0002540_346_1842 461
566 3300045836 Ga0466958_0122088 Ga0466958_0122088_198_1583 461
567 3300045976 Ga0466967_0085422 Ga0466967_0085422_1429_2814 461
568 3300046459 Ga0495629_0047720 Ga0495629_0047720_1515_2900 461
569 3300046460 Ga0495638_0000268 Ga0495638_0000268_49575_50960 461
570 3300046472 Ga0495580_0018580 Ga0495580_0018580_2720_4105 461
571 3300046473 Ga0495582_0014227 Ga0495582_0014227_1805_3190 461
572 3300046499 Ga0495594_0050003 Ga0495594_0050003_623_2008 461
573 3300046679 Ga0495623_0096454 Ga0495623_0096454_149_1534 461
574 3300046683 Ga0495658_0007277 Ga0495658_0007277_3212_4597 461
575 3300047322 Ga0495680_0109638 Ga0495680_0109638_184_1569 461
576 3300048907 Ga0496104_0000017 Ga0496104_0000017_236868_238253 461
577 3300048908 Ga0496105_0000009 Ga0496105_0000009_37754_39139 461
578 3300048923 Ga0496120_0005912 Ga0496120_0005912_2408_3811 461
579 3300048924 Ga0496121_0049290 Ga0496121_0049290_1987_3390 461
580 3300048927 Ga0496124_0005367 Ga0496124_0005367_7899_9308 461
581 3300048929 Ga0496126_0053772 Ga0496126_0053772_755_2158 461
582 3300049568 Ga0501031_0019155 Ga0501031_0019155_33_1586 461
583 3300049568 Ga0501031_0052541 Ga0501031_0052541_457_1845 461
584 3300049569 Ga0501032_0125391 Ga0501032_0125391_115_1503 461
585 3300049570 Ga0501033_0000539 Ga0501033_0000539_13175_14563 461
586 3300049571 Ga0501034_0039909 Ga0501034_0039909_2202_3587 461
587 3300049573 Ga0501037_0029032 Ga0501037_0029032_1655_3043 461
588 3300049573 Ga0501037_0085388 Ga0501037_0085388_385_1770 461
589 3300049574 Ga0501038_0082482 Ga0501038_0082482_1197_2585 461
590 3300049579 Ga0501043_0035321 Ga0501043_0035321_1391_2779 461
591 3300049579 Ga0501043_0042000 Ga0501043_0042000_646_2034 461
592 3300049579 Ga0501043_0055361 Ga0501043_0055361_1446_2831 461
593 3300049580 Ga0501046_0098181 Ga0501046_0098181_827_2215 461
594 3300049581 Ga0501047_0045273 Ga0501047_0045273_2802_4187 461
595 3300049581 Ga0501047_0071692 Ga0501047_0071692_1089_2477 461
596 3300049581 Ga0501047_0076534 Ga0501047_0076534_1531_2916 461
597 3300049582 Ga0501048_0091233 Ga0501048_0091233_538_1926 461
598 3300049586 Ga0501070_0058089 Ga0501070_0058089_1559_2944 461
599 3300049742 Ga0501080_0217497 Ga0501080_0217497_131_1519 461
600 3300049822 Ga0501035_0051319 Ga0501035_0051319_1849_3237 461
601 3300049822 Ga0501035_0066072 Ga0501035_0066072_409_1797 461
602 3300049822 Ga0501035_0094360 Ga0501035_0094360_966_2354 461
603 3300049823 Ga0501044_0003619 Ga0501044_0003619_2415_3803 461
604 3300049823 Ga0501044_0046734 Ga0501044_0046734_1379_2764 461
605 3300049823 Ga0501044_0068438 Ga0501044_0068438_1166_2554 461
606 3300053161 Ga0500634_0000098 Ga0500634_0000098_623_2008 461
607 3300061719 Ga0466962_0022655 Ga0466962_0022655_1325_2821 461
608 2162886007 SwRhRL2b_contig_36842 SwRhRL2b_0101.00008590 462
609 3300002737 JGI25162J39368_1001995 JGI25162J39368_10019955 462
610 3300002737 JGI25162J39368_1002829 JGI25162J39368_10028292 462
611 3300002737 JGI25162J39368_1003446 JGI25162J39368_10034466 462
612 3300002772 JGI25164J39214_1000669 JGI25164J39214_100066911 462
613 3300002772 JGI25164J39214_1001921 JGI25164J39214_10019215 462
614 3300002773 JGI25152J39213_1000118 JGI25152J39213_100011837 462
615 3300002774 JGI25150J39212_1001719 JGI25150J39212_10017192 462
616 3300003187 JGI25151J46595_10000315 JGI25151J46595_1000031537 462
617 3300003214 JGI25165J46597_1001324 JGI25165J46597_100132411 462
618 3300003214 JGI25165J46597_1003755 JGI25165J46597_10037552 462
619 3300003215 JGI25153J46596_10000167 JGI25153J46596_1000016737 462
620 3300003320 rootH2_10085211 rootH2_100852112 462
621 3300003771 Ga0055526_1002395 Ga0055526_10023951 462
622 3300003771 Ga0055526_1011059 Ga0055526_10110593 462
623 3300003773 Ga0055537_1000091 Ga0055537_100009148 462
624 3300003775 Ga0055524_1005686 Ga0055524_10056865 462
625 3300003775 Ga0055524_1005776 Ga0055524_10057762 462
626 3300003781 Ga0055536_1000812 Ga0055536_100081217 462
627 3300003781 Ga0055536_1000925 Ga0055536_10009254 462
628 3300003781 Ga0055536_1003611 Ga0055536_10036112 462
629 3300003781 Ga0055536_1007843 Ga0055536_10078434 462
630 3300003781 Ga0055536_1019931 Ga0055536_10199312 462
631 3300003784 Ga0055534_1000043 Ga0055534_100004349 462
632 3300003790 Ga0055528_1000087 Ga0055528_100008714 462
633 3300003791 Ga0055530_10000673 Ga0055530_1000067317 462
634 3300003791 Ga0055530_10000796 Ga0055530_100007965 462
635 3300003791 Ga0055530_10001562 Ga0055530_1000156213 462
636 3300003794 Ga0055531_10001450 Ga0055531_1000145017 462
637 3300003794 Ga0055531_10004122 Ga0055531_100041229 462
638 3300003794 Ga0055531_10007659 Ga0055531_100076596 462
639 3300003794 Ga0055531_10009101 Ga0055531_100091012 462
640 3300003794 Ga0055531_10018662 Ga0055531_100186622 462
641 3300003794 Ga0055531_10018842 Ga0055531_100188421 462
642 3300003856 Ga0058692_1000031 Ga0058692_1000031114 462
643 3300003856 Ga0058692_1000060 Ga0058692_100006038 462
644 3300005289 Ga0065704_10070367 Ga0065704_100703671 462
645 3300005289 Ga0065704_10070531 Ga0065704_100705316 462
646 3300005336 Ga0070680_100080045 Ga0070680_1000800452 462
647 3300005337 Ga0070682_100012019 Ga0070682_1000120193 462
648 3300005337 Ga0070682_100081928 Ga0070682_1000819281 462
649 3300005347 Ga0070668_100061553 Ga0070668_1000615532 462
650 3300005366 Ga0070659_100010161 Ga0070659_1000101612 462
651 3300005366 Ga0070659_100089902 Ga0070659_1000899022 462
652 3300005435 Ga0070714_100000030 Ga0070714_1000000308 462
653 3300005435 Ga0070714_100056774 Ga0070714_1000567743 462
654 3300005436 Ga0070713_100001194 Ga0070713_10000119410 462
655 3300005437 Ga0070710_10061947 Ga0070710_100619472 462
656 3300005458 Ga0070681_10042687 Ga0070681_100426871 462
657 3300005458 Ga0070681_10089537 Ga0070681_100895371 462
658 3300005458 Ga0070681_10211295 Ga0070681_102112951 462
659 3300005539 Ga0068853_100011536 Ga0068853_1000115366 462
660 3300005546 Ga0070696_100006077 Ga0070696_1000060776 462
661 3300005546 Ga0070696_100012566 Ga0070696_1000125662 462
662 3300005547 Ga0070693_100005935 Ga0070693_1000059353 462
663 3300005548 Ga0070665_100293396 Ga0070665_1002933961 462
664 3300009011 Ga0105251_10000684 Ga0105251_100006843 462
665 3300009011 Ga0105251_10011627 Ga0105251_100116272 462
666 3300009545 Ga0105237_10147533 Ga0105237_101475332 462
667 3300009551 Ga0105238_10023762 Ga0105238_100237624 462
668 3300009551 Ga0105238_10138963 Ga0105238_101389632 462
669 3300009993 Ga0105028_102892 Ga0105028_1028921 462
670 3300013100 Ga0157373_10002185 Ga0157373_100021856 462
671 3300013102 Ga0157371_10002405 Ga0157371_1000240516 462
672 3300013102 Ga0157371_10007880 Ga0157371_100078803 462
673 3300013102 Ga0157371_10014358 Ga0157371_100143584 462
674 3300013104 Ga0157370_10008181 Ga0157370_100081813 462
675 3300013104 Ga0157370_10022676 Ga0157370_100226766 462
676 3300013104 Ga0157370_10033352 Ga0157370_100333522 462
677 3300013104 Ga0157370_10085340 Ga0157370_100853402 462
678 3300013105 Ga0157369_10127294 Ga0157369_101272942 462
679 3300013307 Ga0157372_10004509 Ga0157372_1000450910 462
680 3300013307 Ga0157372_10051334 Ga0157372_100513342 462
681 3300014497 Ga0182008_10001914 Ga0182008_1000191410 462
682 3300014497 Ga0182008_10010938 Ga0182008_100109383 462
683 3300014497 Ga0182008_10032370 Ga0182008_100323702 462
684 3300014497 Ga0182008_10042068 Ga0182008_100420682 462
685 3300015261 Ga0182006_1008610 Ga0182006_10086103 462
686 3300015261 Ga0182006_1015992 Ga0182006_10159923 462
687 3300015261 Ga0182006_1037923 Ga0182006_10379232 462
688 3300015261 Ga0182006_1041468 Ga0182006_10414682 462
689 3300015262 Ga0182007_10000556 Ga0182007_1000055624 462
690 3300015262 Ga0182007_10006254 Ga0182007_100062542 462
691 3300015265 Ga0182005_1000463 Ga0182005_100046322 462
692 3300015685 Ga0183369_1007 Ga0183369_100726 462
693 3300016635 Ga0183361_10614 Ga0183361_106141 462
694 3300017792 Ga0163161_10004924 Ga0163161_100049247 462
695 3300017792 Ga0163161_10085650 Ga0163161_100856501 462
696 3300025226 Ga0209674_100627 Ga0209674_1006275 462
697 3300025231 Ga0207427_100253 Ga0207427_10025328 462
698 3300025231 Ga0207427_100265 Ga0207427_10026526 462
699 3300025233 Ga0209437_100020 Ga0209437_100020542 462
700 3300025233 Ga0209437_100422 Ga0209437_10042229 462
701 3300025245 Ga0207425_1000097 Ga0207425_100009752 462
702 3300025250 Ga0209026_1000098 Ga0209026_100009890 462
703 3300025258 Ga0209129_1000189 Ga0209129_100018952 462
704 3300025261 Ga0209233_1000020 Ga0209233_100002084 462
705 3300025261 Ga0209233_1000147 Ga0209233_1000147182 462
706 3300025263 Ga0209565_1000063 Ga0209565_100006339 462
707 3300025273 Ga0209673_1000065 Ga0209673_1000065100 462
708 3300025284 Ga0209130_1006433 Ga0209130_10064332 462
709 3300025284 Ga0209130_1006566 Ga0209130_10065661 462
710 3300025291 Ga0209675_1000011 Ga0209675_1000011243 462
711 3300025291 Ga0209675_1007735 Ga0209675_10077353 462
712 3300025292 Ga0209676_1000011 Ga0209676_1000011602 462
713 3300025292 Ga0209676_1000034 Ga0209676_1000034449 462
714 3300025292 Ga0209676_1000068 Ga0209676_1000068166 462
715 3300025292 Ga0209676_1000728 Ga0209676_100072830 462
716 3300025292 Ga0209676_1000981 Ga0209676_100098117 462
717 3300025292 Ga0209676_1002601 Ga0209676_10026013 462
718 3300025292 Ga0209676_1005433 Ga0209676_10054332 462
719 3300025294 Ga0209025_1000054 Ga0209025_100005452 462
720 3300025294 Ga0209025_1004511 Ga0209025_10045116 462
721 3300025294 Ga0209025_1036260 Ga0209025_10362602 462
722 3300025295 Ga0209564_1000433 Ga0209564_100043326 462
723 3300025297 Ga0209758_1000062 Ga0209758_100006252 462
724 3300025298 Ga0209050_1000239 Ga0209050_100023969 462
725 3300025298 Ga0209050_1000599 Ga0209050_100059917 462
726 3300025298 Ga0209050_1002692 Ga0209050_10026925 462
727 3300025299 Ga0209256_1002093 Ga0209256_100209314 462
728 3300025299 Ga0209256_1003080 Ga0209256_10030806 462
729 3300025299 Ga0209256_1003541 Ga0209256_10035417 462
730 3300025299 Ga0209256_1005136 Ga0209256_10051361 462
731 3300025303 Ga0209051_1002354 Ga0209051_100235413 462
732 3300025303 Ga0209051_1024719 Ga0209051_10247192 462
733 3300025304 Ga0209257_1000014 Ga0209257_1000014661 462
734 3300025304 Ga0209257_1000263 Ga0209257_100026349 462
735 3300025304 Ga0209257_1000283 Ga0209257_10002839 462
736 3300025304 Ga0209257_1000645 Ga0209257_100064514 462
737 3300025304 Ga0209257_1001034 Ga0209257_100103417 462
738 3300025304 Ga0209257_1001651 Ga0209257_100165120 462
739 3300025304 Ga0209257_1002860 Ga0209257_100286011 462
740 3300025304 Ga0209257_1003306 Ga0209257_10033062 462
741 3300025304 Ga0209257_1004492 Ga0209257_10044926 462
742 3300025898 Ga0207692_10048626 Ga0207692_100486262 462
743 3300025904 Ga0207647_10006827 Ga0207647_100068276 462
744 3300025912 Ga0207707_10029048 Ga0207707_100290485 462
745 3300025914 Ga0207671_10092144 Ga0207671_100921442 462
746 3300025923 Ga0207681_10046782 Ga0207681_100467822 462
747 3300025924 Ga0207694_10059753 Ga0207694_100597532 462
748 3300025924 Ga0207694_10061178 Ga0207694_100611781 462
749 3300025925 Ga0207650_10006416 Ga0207650_100064163 462
750 3300025928 Ga0207700_10013029 Ga0207700_100130296 462
751 3300025929 Ga0207664_10000026 Ga0207664_10000026146 462
752 3300025929 Ga0207664_10038881 Ga0207664_100388814 462
753 3300025932 Ga0207690_10002055 Ga0207690_100020554 462
754 3300025932 Ga0207690_10018134 Ga0207690_100181343 462
755 3300025933 Ga0207706_10067935 Ga0207706_100679353 462
756 3300025935 Ga0207709_10004205 Ga0207709_100042054 462
757 3300025949 Ga0207667_10007470 Ga0207667_1000747011 462
758 3300025972 Ga0207668_10018829 Ga0207668_100188292 462
759 3300026041 Ga0207639_10005157 Ga0207639_100051577 462
760 3300026121 Ga0207683_10037910 Ga0207683_100379104 462
761 3300027312 Ga0209371_1000004 Ga0209371_100000464 462
762 3300027312 Ga0209371_1000139 Ga0209371_100013938 462
763 3300030500 Ga0268256_1000005 Ga0268256_1000005981 462
764 3300030500 Ga0268256_1000109 Ga0268256_100010964 462
765 3300030742 Ga0316183_1078638 Ga0316183_10786383 462
766 3300031911 Ga0307412_10001756 Ga0307412_1000175611 462
767 3300032004 Ga0307414_10021507 Ga0307414_100215072 462
768 3300032004 Ga0307414_10076107 Ga0307414_100761073 462
769 3300032004 Ga0307414_10088213 Ga0307414_100882133 462
770 3300038443 Ga0395901_0000773 Ga0395901_0000773_19204_20613 462
771 3300038705 Ga0237819_00917 Ga0237819_00917_3502_5046 462
772 3300041413 Ga0439465_0000040 Ga0439465_0000040_11543_12934 462
773 3300041462 Ga0451806_099755 Ga0451806_099755_352_1740 462
774 3300041486 Ga0451807_1713052 Ga0451807_1713052_195_1583 462
775 3300042004 Ga0439445_0009603 Ga0439445_0009603_152_1543 462
776 3300042007 Ga0439449_0000134 Ga0439449_0000134_7998_9389 462
777 3300042993 Ga0439440_0006951 Ga0439440_0006951_539_1927 462
778 3300046460 Ga0495638_0003275 Ga0495638_0003275_11018_12406 462
779 3300046507 Ga0495606_0012571 Ga0495606_0012571_4783_6171 462
780 3300046512 Ga0495610_0003255 Ga0495610_0003255_10879_12267 462
781 3300046518 Ga0495631_0006251 Ga0495631_0006251_489_1877 462
782 3300046522 Ga0495643_0002752 Ga0495643_0002752_1216_2604 462
783 3300046525 Ga0495663_0000499 Ga0495663_0000499_5267_6655 462
784 3300046525 Ga0495663_0011170 Ga0495663_0011170_108_1496 462
785 3300046558 Ga0495633_0004706 Ga0495633_0004706_4219_5607 462
786 3300046660 Ga0495625_0024483 Ga0495625_0024483_2618_4006 462
787 3300047320 Ga0495672_0000105 Ga0495672_0000105_118220_119608 462
788 3300048919 Ga0496116_0005311 Ga0496116_0005311_246_1634 462
789 3300048920 Ga0496117_0001191 Ga0496117_0001191_23063_24484 462
790 3300048920 Ga0496117_0002104 Ga0496117_0002104_20338_21726 462
791 3300048920 Ga0496117_0011556 Ga0496117_0011556_1182_2570 462
792 3300048920 Ga0496117_0019026 Ga0496117_0019026_920_2308 462
793 3300048921 Ga0496118_0000858 Ga0496118_0000858_22338_23726 462
794 3300048921 Ga0496118_0004478 Ga0496118_0004478_4060_5448 462
795 3300048921 Ga0496118_0006565 Ga0496118_0006565_1134_2522 462
796 3300048921 Ga0496118_0012820 Ga0496118_0012820_5379_6767 462
797 3300048921 Ga0496118_0032826 Ga0496118_0032826_2681_4102 462
798 3300048921 Ga0496118_0068986 Ga0496118_0068986_228_1616 462
799 3300048922 Ga0496119_0001416 Ga0496119_0001416_10720_12108 462
800 3300048922 Ga0496119_0002285 Ga0496119_0002285_5181_6602 462
801 3300048923 Ga0496120_0000181 Ga0496120_0000181_90462_91850 462
802 3300048923 Ga0496120_0000676 Ga0496120_0000676_14658_16079 462
803 3300048924 Ga0496121_0008621 Ga0496121_0008621_198_1586 462
804 3300048924 Ga0496121_0043851 Ga0496121_0043851_1956_3344 462
805 3300048924 Ga0496121_0129210 Ga0496121_0129210_17_1405 462
806 3300048925 Ga0496122_0000372 Ga0496122_0000372_84210_85598 462
807 3300048925 Ga0496122_0000901 Ga0496122_0000901_37215_38636 462
808 3300048925 Ga0496122_0055190 Ga0496122_0055190_1150_2538 462
809 3300048925 Ga0496122_0066848 Ga0496122_0066848_225_1613 462
810 3300048925 Ga0496122_0099280 Ga0496122_0099280_389_1795 462
811 3300048926 Ga0496123_0000694 Ga0496123_0000694_10704_12092 462
812 3300048926 Ga0496123_0000727 Ga0496123_0000727_37481_38902 462
813 3300048926 Ga0496123_0004944 Ga0496123_0004944_11522_13048 462
814 3300048926 Ga0496123_0012754 Ga0496123_0012754_1182_2588 462
815 3300048926 Ga0496123_0020644 Ga0496123_0020644_708_2096 462
816 3300048926 Ga0496123_0022327 Ga0496123_0022327_486_1874 462
817 3300048926 Ga0496123_0083673 Ga0496123_0083673_169_1557 462
818 3300048927 Ga0496124_0000009 Ga0496124_0000009_421179_422567 462
819 3300048927 Ga0496124_0001061 Ga0496124_0001061_27354_28775 462
820 3300048927 Ga0496124_0004084 Ga0496124_0004084_1176_2564 462
821 3300048927 Ga0496124_0012178 Ga0496124_0012178_6652_8040 462
822 3300048927 Ga0496124_0025735 Ga0496124_0025735_327_1715 462
823 3300048927 Ga0496124_0095133 Ga0496124_0095133_702_2090 462
824 3300048928 Ga0496125_0002711 Ga0496125_0002711_3119_4507 462
825 3300048928 Ga0496125_0004432 Ga0496125_0004432_13596_14984 462
826 3300048928 Ga0496125_0006197 Ga0496125_0006197_305_1693 462
827 3300048928 Ga0496125_0010457 Ga0496125_0010457_7769_9157 462
828 3300048928 Ga0496125_0016678 Ga0496125_0016678_4756_6144 462
829 3300048929 Ga0496126_0004409 Ga0496126_0004409_15275_16663 462
830 3300049568 Ga0501031_0011773 Ga0501031_0011773_2479_3867 462
831 3300049569 Ga0501032_0034432 Ga0501032_0034432_657_2048 462
832 3300049570 Ga0501033_0072967 Ga0501033_0072967_220_1608 462
833 3300049571 Ga0501034_0000083 Ga0501034_0000083_45822_47210 462
834 3300049571 Ga0501034_0000091 Ga0501034_0000091_42662_44056 462
835 3300049571 Ga0501034_0001599 Ga0501034_0001599_1259_2647 462
836 3300049571 Ga0501034_0079414 Ga0501034_0079414_1576_2967 462
837 3300049571 Ga0501034_0098838 Ga0501034_0098838_1099_2490 462
838 3300049573 Ga0501037_0030806 Ga0501037_0030806_1097_2488 462
839 3300049580 Ga0501046_0010507 Ga0501046_0010507_5137_6528 462
840 3300049582 Ga0501048_0046805 Ga0501048_0046805_1427_2836 462
841 3300049823 Ga0501044_0151092 Ga0501044_0151092_514_1932 462
842 3300049823 Ga0501044_0275834 Ga0501044_0275834_24_1415 462
843 3300053093 Ga0500651_0000033 Ga0500651_0000033_90426_91817 462

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01565

FAD_binding_4

FAD binding domain

96

235

0.98

PF02913

FAD-oxidase_C

FAD linked oxidases, C-terminal domain

272

514

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pm9-assembly1.cif.gz_A crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution 0.9275 1 460
7qh2-assembly1.cif.gz_F cryo-em structure of ldh-etfab complex from acetobacterium woodii 0.9225 6 459
3pm9-assembly1.cif.gz_A crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution 0.9217 1 460
7qh2-assembly1.cif.gz_F cryo-em structure of ldh-etfab complex from acetobacterium woodii 0.9035 6 459
6lpq-assembly1.cif.gz_A crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) 0.8997 1 462
ID Description Score Start End Superfamily
af_K7K4A7_386_505_3.30.70.2190 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9607 218 330 3.30.70.2190
af_Q55E52_251_370_3.30.70.2190 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9602 219 330 3.30.70.2190
3pm9F02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9591 94 215 3.30.465.10
af_P46681_278_399_3.30.70.2190 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.959 216 331 3.30.70.2190
af_Q9C1X2_273_393_3.30.70.2190 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9586 216 331 3.30.70.2190
ID Description Score Start End GO Terms
AF-A0A2N1XLV5-F1-model_v4 deleted 0.9836 1 332
AF-A0A4S0JYZ6-F1-model_v4 FAD-binding oxidoreductase 0.9823 78 213 GO:0022904
GO:0071949
AF-A0A848QDE5-F1-model_v4 deleted 0.9768 71 304
AF-A0A4S0JYZ6-F1-model_v4 FAD-binding oxidoreductase 0.9752 78 213 GO:0022904
GO:0071949
AF-A0A848QDE5-F1-model_v4 deleted 0.9686 71 304

Feature Viewer

pLDDT pTM Quality
90.94 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map