F483195
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 843 | 391 | 773 | 464 |
Family's Representative Sequence
| Representative Sequence | 3300049568|Ga0501031_0019155|Ga0501031_0019155_33_1586 |
| Length | 517 |
| Sequence | MRAGIQWRWRRIDYARTEAILLRCVMLFFECDMPHGMPRMSPCRXXXXPLAGSPDAMPDARLDSLRATLPGLRLLTDPAELEHYGRDWTRRWTPAPLAIALPDSVEEVQVVVRWANANAVAIVPSGGRTGLSGGAVAANGELVVSLERMNRVLGFDAVDRTLTVQAGIPLQLAQEAARGHGLQYPVDFAARGSCSIGGNIATNAGGIRVVRYGNTREWIAGLKLVSGSGELLELGRGLVKNSSGYDLRHLAIASEGTLGIIVEATLRLADPAPPSNVMLLALPSFEALMQVFAAFRSRLQLQAFEFLTDVALKHVLVHGGQAPFAEPHPFYVVTEFASDEASEAEALAAFEQCVNDGLASDGVISASEAQAAQLWRLREGITESLAKYVPYKNDVSVRVSAMPAFLAEAQALLGREYPQFEVVWFGHIGDGNLHINILMPEGMAQADFVADCERVTRLLAEVLQRHGGSISAEHGIGLVKKPYLWCTRGAAEVAAMRGIKVALDPNGIMNPGKLFDL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 3 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 4 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 5 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 6 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 7 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 8 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 9 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 10 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 11 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 12 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 13 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 14 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 15 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 16 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 17 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 18 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 19 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 20 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 21 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 22 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 23 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 24 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 25 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 26 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 27 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 28 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 29 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 30 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 31 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 32 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 33 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 34 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 35 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 36 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 37 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 38 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 39 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 40 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 41 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 42 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 43 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 44 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 45 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 46 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 47 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 48 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 49 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 50 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 51 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 52 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 53 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 54 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 55 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 56 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 57 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 58 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 59 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 60 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 61 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 62 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 63 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 64 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 65 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 66 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 67 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 68 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 69 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 70 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 71 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 72 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 73 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 74 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 75 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 76 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 77 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 78 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 79 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 80 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 81 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 82 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 83 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 84 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 85 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 86 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 87 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 88 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 89 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 90 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 91 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 92 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 93 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 94 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 95 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 96 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 97 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 98 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 99 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 100 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 101 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 102 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 103 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 104 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 108 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 109 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 110 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 117 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 122 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 126 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 127 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 128 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 129 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 133 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 134 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 135 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 136 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 137 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 138 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 139 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 140 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 141 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 142 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 143 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 144 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 145 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 146 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 147 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 158 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 169 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 171 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 172 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 173 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 174 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 175 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 176 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 178 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 179 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 180 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 190 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 191 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 193 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 196 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 198 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 203 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 206 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 250 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 253 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 254 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 255 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 256 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 257 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 258 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 259 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 260 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 261 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 262 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 263 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 264 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 265 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 266 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 267 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 268 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 269 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 271 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 273 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 275 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 276 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 277 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 278 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 279 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 280 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 281 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 282 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 287 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 288 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 289 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 290 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 291 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 292 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 293 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 294 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 295 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 296 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 297 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 298 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 299 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 300 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 301 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 302 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 303 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 304 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 345 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 346 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 347 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 348 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 349 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 350 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 351 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 352 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 353 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 354 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 355 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 356 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 357 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 358 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 359 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 360 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 361 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 381 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 382 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 383 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 384 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 385 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 387 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 388 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 389 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 390 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 391 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.22 |
| Metatranscriptomes | 0.47 |
| Isolates | 8.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 20.17 |
| Nodule | 0.12 |
| Rhizoplane | 2.14 |
| Rhizosphere | 61.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_36842 | 2162886007 | Bacteria | 2220 |
| 2 | JGI24740J21852_10002000 | 3300001979 | Bacteria | 9313 |
| 3 | JGI24739J22299_10005709 | 3300001989 | Bacteria | 4716 |
| 4 | JGI24737J22298_10013097 | 3300001990 | Bacteria | 2702 |
| 5 | JGI24735J21928_10033230 | 3300002067 | Bacteria | 1524 |
| 6 | JGI24735J21928_10033252 | 3300002067 | Bacteria | 1524 |
| 7 | JGI24738J21930_10000181 | 3300002075 | Bacteria | 16257 |
| 8 | JGI25156J39149_1000554 | 3300002705 | Bacteria | 21382 |
| 9 | JGI25162J39368_1000294 | 3300002737 | Bacteria | 46103 |
| 10 | JGI25162J39368_1000397 | 3300002737 | Bacteria | 36398 |
| 11 | JGI25162J39368_1001712 | 3300002737 | Bacteria | 10640 |
| 12 | JGI25162J39368_1001995 | 3300002737 | Bacteria | 9113 |
| 13 | JGI25162J39368_1002269 | 3300002737 | Bacteria | 7771 |
| 14 | JGI25162J39368_1002829 | 3300002737 | Bacteria | 6062 |
| 15 | JGI25162J39368_1003087 | 3300002737 | Bacteria | 5338 |
| 16 | JGI25162J39368_1003446 | 3300002737 | Bacteria | 4569 |
| 17 | JGI25154J39366_1003210 | 3300002738 | Bacteria | 3582 |
| 18 | JGI25157J39369_1000559 | 3300002741 | Bacteria | 22288 |
| 19 | JGI25157J39369_1000571 | 3300002741 | Bacteria | 21932 |
| 20 | JGI25157J39369_1002314 | 3300002741 | Bacteria | 4977 |
| 21 | JGI25163J39215_1001719 | 3300002771 | Bacteria | 3091 |
| 22 | JGI25164J39214_1000138 | 3300002772 | Bacteria | 70445 |
| 23 | JGI25164J39214_1000203 | 3300002772 | Bacteria | 50386 |
| 24 | JGI25164J39214_1000669 | 3300002772 | Bacteria | 13980 |
| 25 | JGI25164J39214_1001921 | 3300002772 | Bacteria | 3832 |
| 26 | JGI25152J39213_1000118 | 3300002773 | Bacteria | 55168 |
| 27 | JGI25150J39212_1001719 | 3300002774 | Bacteria | 5884 |
| 28 | JGI25151J46595_10000315 | 3300003187 | Bacteria | 52657 |
| 29 | JGI25165J46597_1000234 | 3300003214 | Bacteria | 77220 |
| 30 | JGI25165J46597_1000352 | 3300003214 | Bacteria | 51821 |
| 31 | JGI25165J46597_1001324 | 3300003214 | Bacteria | 13970 |
| 32 | JGI25165J46597_1003755 | 3300003214 | Bacteria | 3584 |
| 33 | JGI25153J46596_10000167 | 3300003215 | Bacteria | 66040 |
| 34 | JGI25153J46596_10016875 | 3300003215 | Bacteria | 2902 |
| 35 | rootH2_10085211 | 3300003320 | Bacteria | 2180 |
| 36 | Ga0006562J51391_1035570 | 3300003578 | Bacteria | 3100 |
| 37 | Ga0055538_1000713 | 3300003751 | Bacteria | 9982 |
| 38 | Ga0055539_1002855 | 3300003752 | Bacteria | 2524 |
| 39 | Ga0055533_1000285 | 3300003756 | Bacteria | 26437 |
| 40 | Ga0055533_1004809 | 3300003756 | Bacteria | 2328 |
| 41 | Ga0055525_1000178 | 3300003759 | Bacteria | 79260 |
| 42 | Ga0055527_1000031 | 3300003760 | Bacteria | 159089 |
| 43 | Ga0055527_1000054 | 3300003760 | Bacteria | 100670 |
| 44 | Ga0055527_1000803 | 3300003760 | Bacteria | 8493 |
| 45 | Ga0055535_1000074 | 3300003761 | Bacteria | 111974 |
| 46 | Ga0055535_1000203 | 3300003761 | Bacteria | 63507 |
| 47 | Ga0055535_1000293 | 3300003761 | Bacteria | 51848 |
| 48 | Ga0055535_1000725 | 3300003761 | Bacteria | 24974 |
| 49 | Ga0055535_1000828 | 3300003761 | Bacteria | 22194 |
| 50 | Ga0055535_1001977 | 3300003761 | Bacteria | 8487 |
| 51 | Ga0055535_1002324 | 3300003761 | Bacteria | 6915 |
| 52 | Ga0055542_1000083 | 3300003762 | Bacteria | 126426 |
| 53 | Ga0055542_1000100 | 3300003762 | Bacteria | 117410 |
| 54 | Ga0055542_1000357 | 3300003762 | Bacteria | 47785 |
| 55 | Ga0055542_1000368 | 3300003762 | Bacteria | 46552 |
| 56 | Ga0055542_1000621 | 3300003762 | Bacteria | 29952 |
| 57 | Ga0055542_1000748 | 3300003762 | Bacteria | 24974 |
| 58 | Ga0055529_1000073 | 3300003763 | Bacteria | 159093 |
| 59 | Ga0055529_1000121 | 3300003763 | Bacteria | 114639 |
| 60 | Ga0055529_1000288 | 3300003763 | Bacteria | 59495 |
| 61 | Ga0055529_1000349 | 3300003763 | Bacteria | 51075 |
| 62 | Ga0055529_1000567 | 3300003763 | Bacteria | 30392 |
| 63 | Ga0055529_1001548 | 3300003763 | Bacteria | 6519 |
| 64 | Ga0055526_1002395 | 3300003771 | Bacteria | 12700 |
| 65 | Ga0055526_1011059 | 3300003771 | Bacteria | 4118 |
| 66 | Ga0055537_1000091 | 3300003773 | Bacteria | 66379 |
| 67 | Ga0055524_1005686 | 3300003775 | Bacteria | 5526 |
| 68 | Ga0055524_1005776 | 3300003775 | Bacteria | 5467 |
| 69 | Ga0055536_1000812 | 3300003781 | Bacteria | 20671 |
| 70 | Ga0055536_1000925 | 3300003781 | Bacteria | 18922 |
| 71 | Ga0055536_1003611 | 3300003781 | Bacteria | 8260 |
| 72 | Ga0055536_1007843 | 3300003781 | Bacteria | 4704 |
| 73 | Ga0055536_1019931 | 3300003781 | Bacteria | 2090 |
| 74 | Ga0055534_1000043 | 3300003784 | Bacteria | 99338 |
| 75 | Ga0055528_1000087 | 3300003790 | Bacteria | 72896 |
| 76 | Ga0055530_10000673 | 3300003791 | Bacteria | 29109 |
| 77 | Ga0055530_10000796 | 3300003791 | Bacteria | 26241 |
| 78 | Ga0055530_10001562 | 3300003791 | Bacteria | 16407 |
| 79 | Ga0055531_10001450 | 3300003794 | Bacteria | 17510 |
| 80 | Ga0055531_10004122 | 3300003794 | Bacteria | 8979 |
| 81 | Ga0055531_10007659 | 3300003794 | Bacteria | 5845 |
| 82 | Ga0055531_10009101 | 3300003794 | Bacteria | 5121 |
| 83 | Ga0055531_10015137 | 3300003794 | Bacteria | 3422 |
| 84 | Ga0055531_10018662 | 3300003794 | Bacteria | 2851 |
| 85 | Ga0055531_10018842 | 3300003794 | Bacteria | 2827 |
| 86 | Ga0058692_1000031 | 3300003856 | Bacteria | 188488 |
| 87 | Ga0058692_1000060 | 3300003856 | Bacteria | 98866 |
| 88 | Ga0065165_1000186 | 3300005262 | Bacteria | 108712 |
| 89 | Ga0065165_1006259 | 3300005262 | Bacteria | 6318 |
| 90 | Ga0065704_10070367 | 3300005289 | Bacteria | 29287 |
| 91 | Ga0065704_10070531 | 3300005289 | Bacteria | 21590 |
| 92 | Ga0070658_10000825 | 3300005327 | Bacteria | 26519 |
| 93 | Ga0070670_100000002 | 3300005331 | Bacteria | 568775 |
| 94 | Ga0070670_100080904 | 3300005331 | Bacteria | 2792 |
| 95 | Ga0070666_10000018 | 3300005335 | Bacteria | 187218 |
| 96 | Ga0070666_10001323 | 3300005335 | Bacteria | 15024 |
| 97 | Ga0070680_100080045 | 3300005336 | Bacteria | 2694 |
| 98 | Ga0070682_100012019 | 3300005337 | Bacteria | 4953 |
| 99 | Ga0070682_100081928 | 3300005337 | Bacteria | 2090 |
| 100 | Ga0070689_100001806 | 3300005340 | Bacteria | 13754 |
| 101 | Ga0070661_100022106 | 3300005344 | Bacteria | 4549 |
| 102 | Ga0070668_100061553 | 3300005347 | Bacteria | 2908 |
| 103 | Ga0070669_100007740 | 3300005353 | Bacteria | 7681 |
| 104 | Ga0070675_100014764 | 3300005354 | Bacteria | 6163 |
| 105 | Ga0070671_100000023 | 3300005355 | Bacteria | 123775 |
| 106 | Ga0070671_100106387 | 3300005355 | Bacteria | 2355 |
| 107 | Ga0070673_100043087 | 3300005364 | Bacteria | 3485 |
| 108 | Ga0070688_100064916 | 3300005365 | Bacteria | 2318 |
| 109 | Ga0070659_100010161 | 3300005366 | Bacteria | 6926 |
| 110 | Ga0070659_100089902 | 3300005366 | Bacteria | 2460 |
| 111 | Ga0070667_100000018 | 3300005367 | Bacteria | 226033 |
| 112 | Ga0070667_100047135 | 3300005367 | Bacteria | 3626 |
| 113 | Ga0070667_100067867 | 3300005367 | Bacteria | 3033 |
| 114 | Ga0070667_100092097 | 3300005367 | Bacteria | 2607 |
| 115 | Ga0070667_100101624 | 3300005367 | Bacteria | 2484 |
| 116 | Ga0070714_100000030 | 3300005435 | Bacteria | 136610 |
| 117 | Ga0070714_100056774 | 3300005435 | Bacteria | 3349 |
| 118 | Ga0070713_100001194 | 3300005436 | Bacteria | 16600 |
| 119 | Ga0070710_10061947 | 3300005437 | Bacteria | 2132 |
| 120 | Ga0070663_100001649 | 3300005455 | Bacteria | 12338 |
| 121 | Ga0070678_100135470 | 3300005456 | Bacteria | 1963 |
| 122 | Ga0070662_100020438 | 3300005457 | Bacteria | 4509 |
| 123 | Ga0070681_10042687 | 3300005458 | Bacteria | 4544 |
| 124 | Ga0070681_10057495 | 3300005458 | Bacteria | 3870 |
| 125 | Ga0070681_10089537 | 3300005458 | Bacteria | 3029 |
| 126 | Ga0070681_10146756 | 3300005458 | Bacteria | 2288 |
| 127 | Ga0070681_10211295 | 3300005458 | Bacteria | 1857 |
| 128 | Ga0070685_10000011 | 3300005466 | Bacteria | 137723 |
| 129 | Ga0070685_10000308 | 3300005466 | Bacteria | 30701 |
| 130 | Ga0070679_100125175 | 3300005530 | Bacteria | 2553 |
| 131 | Ga0068853_100011536 | 3300005539 | Bacteria | 7184 |
| 132 | Ga0068853_100142629 | 3300005539 | Bacteria | 2151 |
| 133 | Ga0070696_100006077 | 3300005546 | Bacteria | 8063 |
| 134 | Ga0070696_100012566 | 3300005546 | Bacteria | 5685 |
| 135 | Ga0070693_100005935 | 3300005547 | Bacteria | 5906 |
| 136 | Ga0070693_100007027 | 3300005547 | Bacteria | 5481 |
| 137 | Ga0070665_100000786 | 3300005548 | Bacteria | 41741 |
| 138 | Ga0070665_100005073 | 3300005548 | Bacteria | 13664 |
| 139 | Ga0070665_100061775 | 3300005548 | Bacteria | 3756 |
| 140 | Ga0070665_100293396 | 3300005548 | Bacteria | 1628 |
| 141 | Ga0068855_100021479 | 3300005563 | Bacteria | 7741 |
| 142 | Ga0068855_100044098 | 3300005563 | Bacteria | 5279 |
| 143 | Ga0068855_100150693 | 3300005563 | Bacteria | 2645 |
| 144 | Ga0068854_100002904 | 3300005578 | Bacteria | 10640 |
| 145 | Ga0068854_100003674 | 3300005578 | Bacteria | 9600 |
| 146 | Ga0068854_100020234 | 3300005578 | Bacteria | 4499 |
| 147 | Ga0068854_100050615 | 3300005578 | Bacteria | 2973 |
| 148 | Ga0068856_100000012 | 3300005614 | Bacteria | 166032 |
| 149 | Ga0068856_100001305 | 3300005614 | Bacteria | 26223 |
| 150 | Ga0068852_100066737 | 3300005616 | Bacteria | 3143 |
| 151 | Ga0068859_100063405 | 3300005617 | Bacteria | 3727 |
| 152 | Ga0068859_100074657 | 3300005617 | Bacteria | 3430 |
| 153 | Ga0068859_100105981 | 3300005617 | Bacteria | 2870 |
| 154 | Ga0068864_100000003 | 3300005618 | Bacteria | 568775 |
| 155 | Ga0068863_100024746 | 3300005841 | Bacteria | 5727 |
| 156 | Ga0068863_100032819 | 3300005841 | Bacteria | 4947 |
| 157 | Ga0068863_100073638 | 3300005841 | Bacteria | 3231 |
| 158 | Ga0068858_100000799 | 3300005842 | Bacteria | 32951 |
| 159 | Ga0068860_100018698 | 3300005843 | Bacteria | 6737 |
| 160 | Ga0068860_100022725 | 3300005843 | Bacteria | 6063 |
| 161 | Ga0068862_100005757 | 3300005844 | Bacteria | 10335 |
| 162 | Ga0081455_10052948 | 3300005937 | Bacteria | 3470 |
| 163 | Ga0075364_10000075 | 3300006051 | Bacteria | 38780 |
| 164 | Ga0075364_10043609 | 3300006051 | Bacteria | 2917 |
| 165 | Ga0075369_10022777 | 3300006186 | Bacteria | 2586 |
| 166 | Ga0068871_100150842 | 3300006358 | Bacteria | 1982 |
| 167 | Ga0068865_100009059 | 3300006881 | Bacteria | 6156 |
| 168 | Ga0068865_100025111 | 3300006881 | Bacteria | 3916 |
| 169 | Ga0097620_100063405 | 3300006931 | Bacteria | 3727 |
| 170 | Ga0097620_100074654 | 3300006931 | Bacteria | 3430 |
| 171 | Ga0097620_100105989 | 3300006931 | Bacteria | 2870 |
| 172 | Ga0105251_10000684 | 3300009011 | Bacteria | 31292 |
| 173 | Ga0105251_10011627 | 3300009011 | Bacteria | 5020 |
| 174 | Ga0105240_10001717 | 3300009093 | Bacteria | 36977 |
| 175 | Ga0105240_10002685 | 3300009093 | Bacteria | 28327 |
| 176 | Ga0105240_10002894 | 3300009093 | Bacteria | 27102 |
| 177 | Ga0105240_10014038 | 3300009093 | Bacteria | 10956 |
| 178 | Ga0105240_10026393 | 3300009093 | Bacteria | 7620 |
| 179 | Ga0105240_10064962 | 3300009093 | Bacteria | 4531 |
| 180 | Ga0105240_10159723 | 3300009093 | Bacteria | 2678 |
| 181 | Ga0105240_10256873 | 3300009093 | Bacteria | 2018 |
| 182 | Ga0105240_10311171 | 3300009093 | Bacteria | 1799 |
| 183 | Ga0111539_10001027 | 3300009094 | Bacteria | 36586 |
| 184 | Ga0111539_10016831 | 3300009094 | Bacteria | 9055 |
| 185 | Ga0105247_10003540 | 3300009101 | Bacteria | 10149 |
| 186 | Ga0105247_10004696 | 3300009101 | Bacteria | 8702 |
| 187 | Ga0105241_10002687 | 3300009174 | Bacteria | 13328 |
| 188 | Ga0105241_10036548 | 3300009174 | Bacteria | 3697 |
| 189 | Ga0105241_10181519 | 3300009174 | Bacteria | 1746 |
| 190 | Ga0105242_10007059 | 3300009176 | Bacteria | 8675 |
| 191 | Ga0105248_10096502 | 3300009177 | Bacteria | 3330 |
| 192 | Ga0105237_10000543 | 3300009545 | Bacteria | 53109 |
| 193 | Ga0105237_10000571 | 3300009545 | Bacteria | 51560 |
| 194 | Ga0105237_10011644 | 3300009545 | Bacteria | 9306 |
| 195 | Ga0105237_10022754 | 3300009545 | Bacteria | 6431 |
| 196 | Ga0105237_10147533 | 3300009545 | Bacteria | 2347 |
| 197 | Ga0105237_10288041 | 3300009545 | Bacteria | 1645 |
| 198 | Ga0105238_10000224 | 3300009551 | Bacteria | 62846 |
| 199 | Ga0105238_10002702 | 3300009551 | Bacteria | 17642 |
| 200 | Ga0105238_10021104 | 3300009551 | Bacteria | 6637 |
| 201 | Ga0105238_10023762 | 3300009551 | Bacteria | 6248 |
| 202 | Ga0105238_10085161 | 3300009551 | Bacteria | 3150 |
| 203 | Ga0105238_10138963 | 3300009551 | Bacteria | 2407 |
| 204 | Ga0105238_10189516 | 3300009551 | Bacteria | 2033 |
| 205 | Ga0105028_102892 | 3300009993 | Bacteria | 1801 |
| 206 | Ga0105239_10000023 | 3300010375 | Bacteria | 257478 |
| 207 | Ga0105239_10021526 | 3300010375 | Bacteria | 7109 |
| 208 | Ga0105239_10046151 | 3300010375 | Bacteria | 4774 |
| 209 | Ga0105239_10075734 | 3300010375 | Bacteria | 3700 |
| 210 | Ga0105239_10179719 | 3300010375 | Bacteria | 2367 |
| 211 | Ga0157373_10002185 | 3300013100 | Bacteria | 14812 |
| 212 | Ga0157371_10002405 | 3300013102 | Bacteria | 17908 |
| 213 | Ga0157371_10007880 | 3300013102 | Bacteria | 8552 |
| 214 | Ga0157371_10014358 | 3300013102 | Bacteria | 5980 |
| 215 | Ga0157371_10119685 | 3300013102 | Bacteria | 1872 |
| 216 | Ga0157370_10000044 | 3300013104 | Bacteria | 131302 |
| 217 | Ga0157370_10008181 | 3300013104 | Bacteria | 11306 |
| 218 | Ga0157370_10022676 | 3300013104 | Bacteria | 6248 |
| 219 | Ga0157370_10033352 | 3300013104 | Bacteria | 5021 |
| 220 | Ga0157370_10085340 | 3300013104 | Bacteria | 2966 |
| 221 | Ga0157369_10000057 | 3300013105 | Bacteria | 157096 |
| 222 | Ga0157369_10004095 | 3300013105 | Bacteria | 17268 |
| 223 | Ga0157369_10005110 | 3300013105 | Bacteria | 15361 |
| 224 | Ga0157369_10127294 | 3300013105 | Bacteria | 2699 |
| 225 | Ga0157374_10033453 | 3300013296 | Bacteria | 4691 |
| 226 | Ga0163162_10000007 | 3300013306 | Bacteria | 368084 |
| 227 | Ga0163162_10000284 | 3300013306 | Bacteria | 46182 |
| 228 | Ga0163162_10019407 | 3300013306 | Bacteria | 6667 |
| 229 | Ga0163162_10029630 | 3300013306 | Bacteria | 5418 |
| 230 | Ga0157372_10004509 | 3300013307 | Bacteria | 14858 |
| 231 | Ga0157372_10019325 | 3300013307 | Bacteria | 7338 |
| 232 | Ga0157372_10027128 | 3300013307 | Bacteria | 6234 |
| 233 | Ga0157372_10051334 | 3300013307 | Bacteria | 4589 |
| 234 | Ga0157372_10062104 | 3300013307 | Bacteria | 4185 |
| 235 | Ga0157375_10000206 | 3300013308 | Bacteria | 54667 |
| 236 | Ga0157375_10003760 | 3300013308 | Bacteria | 13161 |
| 237 | Ga0157375_10049967 | 3300013308 | Bacteria | 4101 |
| 238 | Ga0157375_10072201 | 3300013308 | Bacteria | 3467 |
| 239 | Ga0163163_10000537 | 3300014325 | Bacteria | 33554 |
| 240 | Ga0163163_10130566 | 3300014325 | Bacteria | 2552 |
| 241 | Ga0182008_10001914 | 3300014497 | Bacteria | 13466 |
| 242 | Ga0182008_10003037 | 3300014497 | Bacteria | 10300 |
| 243 | Ga0182008_10010938 | 3300014497 | Bacteria | 4841 |
| 244 | Ga0182008_10032370 | 3300014497 | Bacteria | 2628 |
| 245 | Ga0182008_10042068 | 3300014497 | Bacteria | 2277 |
| 246 | Ga0157376_10000427 | 3300014969 | Bacteria | 27265 |
| 247 | Ga0157376_10005743 | 3300014969 | Bacteria | 8691 |
| 248 | Ga0182006_1000077 | 3300015261 | Bacteria | 127377 |
| 249 | Ga0182006_1000427 | 3300015261 | Bacteria | 33649 |
| 250 | Ga0182006_1008610 | 3300015261 | Bacteria | 4622 |
| 251 | Ga0182006_1015992 | 3300015261 | Bacteria | 3206 |
| 252 | Ga0182006_1037923 | 3300015261 | Bacteria | 1908 |
| 253 | Ga0182006_1041468 | 3300015261 | Bacteria | 1807 |
| 254 | Ga0182007_10000556 | 3300015262 | Bacteria | 22049 |
| 255 | Ga0182007_10006254 | 3300015262 | Bacteria | 5123 |
| 256 | Ga0182007_10006322 | 3300015262 | Bacteria | 5095 |
| 257 | Ga0182005_1000060 | 3300015265 | Bacteria | 98664 |
| 258 | Ga0182005_1000463 | 3300015265 | Bacteria | 21182 |
| 259 | Ga0182005_1022260 | 3300015265 | Bacteria | 1737 |
| 260 | Ga0183369_1007 | 3300015685 | Bacteria | 414878 |
| 261 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 262 | Ga0183361_10614 | 3300016635 | Bacteria | 1616 |
| 263 | Ga0163161_10004924 | 3300017792 | Bacteria | 9293 |
| 264 | Ga0163161_10083110 | 3300017792 | Bacteria | 2360 |
| 265 | Ga0163161_10085650 | 3300017792 | Bacteria | 2325 |
| 266 | Ga0206356_11480241 | 3300020070 | Bacteria | 2578 |
| 267 | Ga0206354_10669824 | 3300020081 | Bacteria | 1466 |
| 268 | Ga0206353_10435035 | 3300020082 | Bacteria | 2343 |
| 269 | Ga0209760_100363 | 3300025207 | Bacteria | 12318 |
| 270 | Ga0209784_100011 | 3300025224 | Bacteria | 546770 |
| 271 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 272 | Ga0209674_100140 | 3300025226 | Bacteria | 109152 |
| 273 | Ga0209674_100627 | 3300025226 | Bacteria | 13044 |
| 274 | Ga0209674_100990 | 3300025226 | Bacteria | 8760 |
| 275 | Ga0209672_100005 | 3300025228 | Bacteria | 1069303 |
| 276 | Ga0209672_100016 | 3300025228 | Bacteria | 522604 |
| 277 | Ga0209672_100341 | 3300025228 | Bacteria | 30044 |
| 278 | Ga0209563_100023 | 3300025230 | Bacteria | 636844 |
| 279 | Ga0207427_100026 | 3300025231 | Bacteria | 412764 |
| 280 | Ga0207427_100057 | 3300025231 | Bacteria | 198202 |
| 281 | Ga0207427_100253 | 3300025231 | Bacteria | 42374 |
| 282 | Ga0207427_100265 | 3300025231 | Bacteria | 40397 |
| 283 | Ga0207427_104288 | 3300025231 | Bacteria | 2473 |
| 284 | Ga0209437_100020 | 3300025233 | Bacteria | 656374 |
| 285 | Ga0209437_100184 | 3300025233 | Bacteria | 128650 |
| 286 | Ga0209437_100202 | 3300025233 | Bacteria | 118709 |
| 287 | Ga0209437_100359 | 3300025233 | Bacteria | 50926 |
| 288 | Ga0209437_100422 | 3300025233 | Bacteria | 37894 |
| 289 | Ga0209437_101541 | 3300025233 | Bacteria | 5402 |
| 290 | Ga0209258_100006 | 3300025242 | Bacteria | 1069303 |
| 291 | Ga0209258_100012 | 3300025242 | Bacteria | 825544 |
| 292 | Ga0209258_100027 | 3300025242 | Bacteria | 518449 |
| 293 | Ga0209258_100064 | 3300025242 | Bacteria | 293837 |
| 294 | Ga0209258_100139 | 3300025242 | Bacteria | 167268 |
| 295 | Ga0209258_106463 | 3300025242 | Bacteria | 1835 |
| 296 | Ga0207425_1000097 | 3300025245 | Bacteria | 84719 |
| 297 | Ga0209646_1000322 | 3300025246 | Bacteria | 36810 |
| 298 | Ga0209646_1000820 | 3300025246 | Bacteria | 10498 |
| 299 | Ga0209646_1002983 | 3300025246 | Bacteria | 3502 |
| 300 | Ga0209026_1000018 | 3300025250 | Bacteria | 381351 |
| 301 | Ga0209026_1000077 | 3300025250 | Bacteria | 200561 |
| 302 | Ga0209026_1000098 | 3300025250 | Bacteria | 161845 |
| 303 | Ga0209026_1000117 | 3300025250 | Bacteria | 131918 |
| 304 | Ga0209026_1000451 | 3300025250 | Bacteria | 32750 |
| 305 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 306 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 307 | Ga0209148_1000012 | 3300025254 | Bacteria | 1069303 |
| 308 | Ga0209148_1000014 | 3300025254 | Bacteria | 925277 |
| 309 | Ga0209148_1000073 | 3300025254 | Bacteria | 320851 |
| 310 | Ga0209148_1000173 | 3300025254 | Bacteria | 130560 |
| 311 | Ga0209148_1001681 | 3300025254 | Bacteria | 9906 |
| 312 | Ga0209759_1000134 | 3300025256 | Bacteria | 126221 |
| 313 | Ga0209759_1000550 | 3300025256 | Bacteria | 38618 |
| 314 | Ga0209759_1001310 | 3300025256 | Bacteria | 14662 |
| 315 | Ga0209759_1002234 | 3300025256 | Bacteria | 8827 |
| 316 | Ga0209129_1000189 | 3300025258 | Bacteria | 84712 |
| 317 | Ga0209129_1001261 | 3300025258 | Bacteria | 14508 |
| 318 | Ga0209129_1002319 | 3300025258 | Bacteria | 9439 |
| 319 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 320 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 321 | Ga0209233_1000063 | 3300025261 | Bacteria | 395810 |
| 322 | Ga0209233_1000147 | 3300025261 | Bacteria | 186517 |
| 323 | Ga0209233_1008375 | 3300025261 | Bacteria | 3205 |
| 324 | Ga0209565_1000063 | 3300025263 | Bacteria | 183711 |
| 325 | Ga0209455_1000008 | 3300025272 | Bacteria | 1069303 |
| 326 | Ga0209455_1000014 | 3300025272 | Bacteria | 806601 |
| 327 | Ga0209455_1000018 | 3300025272 | Bacteria | 718034 |
| 328 | Ga0209455_1000019 | 3300025272 | Bacteria | 705658 |
| 329 | Ga0209455_1001025 | 3300025272 | Bacteria | 13911 |
| 330 | Ga0209673_1000065 | 3300025273 | Bacteria | 252799 |
| 331 | Ga0209130_1006433 | 3300025284 | Bacteria | 3818 |
| 332 | Ga0209130_1006566 | 3300025284 | Bacteria | 3757 |
| 333 | Ga0209675_1000011 | 3300025291 | Bacteria | 520597 |
| 334 | Ga0209675_1007735 | 3300025291 | Bacteria | 4061 |
| 335 | Ga0209676_1000011 | 3300025292 | Bacteria | 860463 |
| 336 | Ga0209676_1000034 | 3300025292 | Bacteria | 460125 |
| 337 | Ga0209676_1000068 | 3300025292 | Bacteria | 314068 |
| 338 | Ga0209676_1000728 | 3300025292 | Bacteria | 45109 |
| 339 | Ga0209676_1000981 | 3300025292 | Bacteria | 34140 |
| 340 | Ga0209676_1002601 | 3300025292 | Bacteria | 12379 |
| 341 | Ga0209676_1005433 | 3300025292 | Bacteria | 6660 |
| 342 | Ga0209025_1000054 | 3300025294 | Bacteria | 317002 |
| 343 | Ga0209025_1004511 | 3300025294 | Bacteria | 12025 |
| 344 | Ga0209025_1036260 | 3300025294 | Bacteria | 2212 |
| 345 | Ga0209564_1000433 | 3300025295 | Bacteria | 72594 |
| 346 | Ga0209758_1000062 | 3300025297 | Bacteria | 317002 |
| 347 | Ga0209758_1000644 | 3300025297 | Bacteria | 53122 |
| 348 | Ga0209758_1029512 | 3300025297 | Bacteria | 2291 |
| 349 | Ga0209050_1000239 | 3300025298 | Bacteria | 119530 |
| 350 | Ga0209050_1000599 | 3300025298 | Bacteria | 57405 |
| 351 | Ga0209050_1002692 | 3300025298 | Bacteria | 14452 |
| 352 | Ga0209256_1002093 | 3300025299 | Bacteria | 17461 |
| 353 | Ga0209256_1003080 | 3300025299 | Bacteria | 12238 |
| 354 | Ga0209256_1003541 | 3300025299 | Bacteria | 10843 |
| 355 | Ga0209256_1005136 | 3300025299 | Bacteria | 7741 |
| 356 | Ga0209256_1008903 | 3300025299 | Bacteria | 4529 |
| 357 | Ga0209051_1002354 | 3300025303 | Bacteria | 13679 |
| 358 | Ga0209051_1004118 | 3300025303 | Bacteria | 9106 |
| 359 | Ga0209051_1024719 | 3300025303 | Bacteria | 2462 |
| 360 | Ga0209257_1000014 | 3300025304 | Bacteria | 946850 |
| 361 | Ga0209257_1000263 | 3300025304 | Bacteria | 120530 |
| 362 | Ga0209257_1000283 | 3300025304 | Bacteria | 113507 |
| 363 | Ga0209257_1000645 | 3300025304 | Bacteria | 55704 |
| 364 | Ga0209257_1001034 | 3300025304 | Bacteria | 37233 |
| 365 | Ga0209257_1001651 | 3300025304 | Bacteria | 25402 |
| 366 | Ga0209257_1002860 | 3300025304 | Bacteria | 16121 |
| 367 | Ga0209257_1003306 | 3300025304 | Bacteria | 14041 |
| 368 | Ga0209257_1004492 | 3300025304 | Bacteria | 10753 |
| 369 | Ga0207656_10000302 | 3300025321 | Bacteria | 17096 |
| 370 | Ga0207656_10014809 | 3300025321 | Bacteria | 3012 |
| 371 | Ga0207692_10048626 | 3300025898 | Bacteria | 2136 |
| 372 | Ga0207710_10003190 | 3300025900 | Bacteria | 7337 |
| 373 | Ga0207680_10000002 | 3300025903 | Bacteria | 1018646 |
| 374 | Ga0207680_10002436 | 3300025903 | Bacteria | 8677 |
| 375 | Ga0207647_10000078 | 3300025904 | Bacteria | 73787 |
| 376 | Ga0207647_10001332 | 3300025904 | Bacteria | 18967 |
| 377 | Ga0207647_10006827 | 3300025904 | Bacteria | 8274 |
| 378 | Ga0207647_10009507 | 3300025904 | Bacteria | 6904 |
| 379 | Ga0207654_10008492 | 3300025911 | Bacteria | 5196 |
| 380 | Ga0207707_10029048 | 3300025912 | Bacteria | 4832 |
| 381 | Ga0207707_10151511 | 3300025912 | Bacteria | 2027 |
| 382 | Ga0207695_10000033 | 3300025913 | Bacteria | 507477 |
| 383 | Ga0207695_10000581 | 3300025913 | Bacteria | 74447 |
| 384 | Ga0207695_10001880 | 3300025913 | Bacteria | 32856 |
| 385 | Ga0207695_10002256 | 3300025913 | Bacteria | 28860 |
| 386 | Ga0207695_10002259 | 3300025913 | Bacteria | 28854 |
| 387 | Ga0207695_10009427 | 3300025913 | Bacteria | 12076 |
| 388 | Ga0207695_10012614 | 3300025913 | Bacteria | 10127 |
| 389 | Ga0207695_10019726 | 3300025913 | Bacteria | 7752 |
| 390 | Ga0207695_10031732 | 3300025913 | Bacteria | 5789 |
| 391 | Ga0207695_10063506 | 3300025913 | Bacteria | 3806 |
| 392 | Ga0207671_10000038 | 3300025914 | Bacteria | 227066 |
| 393 | Ga0207671_10001015 | 3300025914 | Bacteria | 34337 |
| 394 | Ga0207671_10014832 | 3300025914 | Bacteria | 6137 |
| 395 | Ga0207671_10022208 | 3300025914 | Bacteria | 4801 |
| 396 | Ga0207671_10092144 | 3300025914 | Bacteria | 2285 |
| 397 | Ga0207649_10129956 | 3300025920 | Bacteria | 1709 |
| 398 | Ga0207652_10150608 | 3300025921 | Bacteria | 2083 |
| 399 | Ga0207681_10001068 | 3300025923 | Bacteria | 17781 |
| 400 | Ga0207681_10046782 | 3300025923 | Bacteria | 2911 |
| 401 | Ga0207694_10000210 | 3300025924 | Bacteria | 56867 |
| 402 | Ga0207694_10000487 | 3300025924 | Bacteria | 35975 |
| 403 | Ga0207694_10001035 | 3300025924 | Bacteria | 24204 |
| 404 | Ga0207694_10004749 | 3300025924 | Bacteria | 10562 |
| 405 | Ga0207694_10059753 | 3300025924 | Bacteria | 2966 |
| 406 | Ga0207694_10061178 | 3300025924 | Bacteria | 2930 |
| 407 | Ga0207694_10118772 | 3300025924 | Bacteria | 2110 |
| 408 | Ga0207650_10000003 | 3300025925 | Bacteria | 1123235 |
| 409 | Ga0207650_10006416 | 3300025925 | Bacteria | 8015 |
| 410 | Ga0207650_10067663 | 3300025925 | Bacteria | 2680 |
| 411 | Ga0207700_10013029 | 3300025928 | Bacteria | 5392 |
| 412 | Ga0207664_10000026 | 3300025929 | Bacteria | 194571 |
| 413 | Ga0207664_10038881 | 3300025929 | Bacteria | 3691 |
| 414 | Ga0207644_10000027 | 3300025931 | Bacteria | 143706 |
| 415 | Ga0207690_10002055 | 3300025932 | Bacteria | 12330 |
| 416 | Ga0207690_10018134 | 3300025932 | Bacteria | 4313 |
| 417 | Ga0207706_10019337 | 3300025933 | Bacteria | 6126 |
| 418 | Ga0207706_10067935 | 3300025933 | Bacteria | 3137 |
| 419 | Ga0207709_10004205 | 3300025935 | Bacteria | 8353 |
| 420 | Ga0207670_10001950 | 3300025936 | Bacteria | 10813 |
| 421 | Ga0207670_10083399 | 3300025936 | Bacteria | 2242 |
| 422 | Ga0207704_10011804 | 3300025938 | Bacteria | 4316 |
| 423 | Ga0207704_10025598 | 3300025938 | Bacteria | 3222 |
| 424 | Ga0207704_10048528 | 3300025938 | Bacteria | 2546 |
| 425 | Ga0207691_10047647 | 3300025940 | Bacteria | 3932 |
| 426 | Ga0207661_10179395 | 3300025944 | Bacteria | 1849 |
| 427 | Ga0207667_10000693 | 3300025949 | Bacteria | 43651 |
| 428 | Ga0207667_10007470 | 3300025949 | Bacteria | 13134 |
| 429 | Ga0207667_10008397 | 3300025949 | Bacteria | 12273 |
| 430 | Ga0207651_10031925 | 3300025960 | Bacteria | 3374 |
| 431 | Ga0207712_10000288 | 3300025961 | Bacteria | 47902 |
| 432 | Ga0207668_10018829 | 3300025972 | Bacteria | 4353 |
| 433 | Ga0207668_10059861 | 3300025972 | Bacteria | 2671 |
| 434 | Ga0207640_10004830 | 3300025981 | Bacteria | 7317 |
| 435 | Ga0207640_10007281 | 3300025981 | Bacteria | 6104 |
| 436 | Ga0207640_10020869 | 3300025981 | Bacteria | 3894 |
| 437 | Ga0207640_10094207 | 3300025981 | Bacteria | 2082 |
| 438 | Ga0207658_10000004 | 3300025986 | Bacteria | 569357 |
| 439 | Ga0207658_10012049 | 3300025986 | Bacteria | 5899 |
| 440 | Ga0207658_10027507 | 3300025986 | Bacteria | 3996 |
| 441 | Ga0207658_10063939 | 3300025986 | Bacteria | 2759 |
| 442 | Ga0207703_10001120 | 3300026035 | Bacteria | 25309 |
| 443 | Ga0207703_10076430 | 3300026035 | Bacteria | 2778 |
| 444 | Ga0207639_10005157 | 3300026041 | Bacteria | 8808 |
| 445 | Ga0207678_10008203 | 3300026067 | Bacteria | 9208 |
| 446 | Ga0207678_10014285 | 3300026067 | Bacteria | 6981 |
| 447 | Ga0207678_10106775 | 3300026067 | Bacteria | 2388 |
| 448 | Ga0207678_10215025 | 3300026067 | Bacteria | 1645 |
| 449 | Ga0207702_10000108 | 3300026078 | Bacteria | 95976 |
| 450 | Ga0207702_10000312 | 3300026078 | Bacteria | 55514 |
| 451 | Ga0207641_10019264 | 3300026088 | Bacteria | 5599 |
| 452 | Ga0207641_10035200 | 3300026088 | Bacteria | 4170 |
| 453 | Ga0207641_10165082 | 3300026088 | Bacteria | 2016 |
| 454 | Ga0207641_10179904 | 3300026088 | Bacteria | 1936 |
| 455 | Ga0207676_10000003 | 3300026095 | Bacteria | 1123235 |
| 456 | Ga0207674_10002019 | 3300026116 | Bacteria | 25743 |
| 457 | Ga0207674_10039426 | 3300026116 | Bacteria | 4896 |
| 458 | Ga0207675_100147765 | 3300026118 | Bacteria | 2236 |
| 459 | Ga0207683_10013683 | 3300026121 | Bacteria | 6918 |
| 460 | Ga0207683_10022504 | 3300026121 | Bacteria | 5409 |
| 461 | Ga0207683_10037910 | 3300026121 | Bacteria | 4198 |
| 462 | Ga0207683_10064767 | 3300026121 | Bacteria | 3222 |
| 463 | Ga0207683_10081681 | 3300026121 | Bacteria | 2869 |
| 464 | Ga0207698_10018844 | 3300026142 | Bacteria | 4713 |
| 465 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 466 | Ga0209371_1000139 | 3300027312 | Bacteria | 120350 |
| 467 | Ga0207428_10003984 | 3300027907 | Bacteria | 14174 |
| 468 | Ga0207428_10116357 | 3300027907 | Bacteria | 2053 |
| 469 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 470 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 471 | Ga0268266_10002297 | 3300028379 | Bacteria | 20736 |
| 472 | Ga0268264_10000016 | 3300028381 | Bacteria | 502537 |
| 473 | Ga0268264_10001303 | 3300028381 | Bacteria | 23523 |
| 474 | Ga0268264_10062361 | 3300028381 | Bacteria | 3130 |
| 475 | Ga0268264_10131959 | 3300028381 | Bacteria | 2216 |
| 476 | Ga0265334_10028783 | 3300028573 | Bacteria | 2229 |
| 477 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 478 | Ga0268256_1000109 | 3300030500 | Bacteria | 120350 |
| 479 | Ga0316177_1014219 | 3300030731 | Bacteria | 6930 |
| 480 | Ga0316178_1139308 | 3300030735 | Bacteria | 2031 |
| 481 | Ga0316183_1078638 | 3300030742 | Bacteria | 5614 |
| 482 | Ga0265327_10001419 | 3300031251 | Bacteria | 30507 |
| 483 | Ga0265313_10022433 | 3300031595 | Bacteria | 3424 |
| 484 | Ga0307508_10010230 | 3300031616 | Bacteria | 8582 |
| 485 | Ga0316575_10004695 | 3300031665 | Bacteria | 4815 |
| 486 | Ga0265314_10093203 | 3300031711 | Bacteria | 1956 |
| 487 | Ga0316576_10005271 | 3300031727 | Bacteria | 7874 |
| 488 | Ga0316576_10037332 | 3300031727 | Bacteria | 3477 |
| 489 | Ga0307405_10051474 | 3300031731 | Bacteria | 2556 |
| 490 | Ga0307412_10000203 | 3300031911 | Bacteria | 40488 |
| 491 | Ga0307412_10001756 | 3300031911 | Bacteria | 11982 |
| 492 | Ga0307414_10021507 | 3300032004 | Bacteria | 4049 |
| 493 | Ga0307414_10076107 | 3300032004 | Bacteria | 2438 |
| 494 | Ga0307414_10088213 | 3300032004 | Bacteria | 2295 |
| 495 | Ga0307510_10011777 | 3300033180 | Bacteria | 10376 |
| 496 | Ga0373944_0003053 | 3300035089 | Bacteria | 4305 |
| 497 | Ga0373957_0030344 | 3300035120 | Bacteria | 1981 |
| 498 | Ga0373955_0059394 | 3300035172 | Bacteria | 2106 |
| 499 | Ga0373927_0076523 | 3300035695 | Bacteria | 2167 |
| 500 | Ga0373937_0035551 | 3300036401 | Bacteria | 4535 |
| 501 | Ga0373937_0137035 | 3300036401 | Bacteria | 2289 |
| 502 | Ga0316584_0046555 | 3300036712 | Bacteria | 3240 |
| 503 | Ga0373925_0103237 | 3300037068 | Bacteria | 2194 |
| 504 | Ga0395899_0000089 | 3300037312 | Bacteria | 156851 |
| 505 | Ga0395900_0000029 | 3300037418 | Bacteria | 281061 |
| 506 | Ga0395900_0011616 | 3300037418 | Bacteria | 9011 |
| 507 | Ga0395900_0239257 | 3300037418 | Bacteria | 1822 |
| 508 | Ga0395898_0000018 | 3300037466 | Bacteria | 418600 |
| 509 | Ga0395898_0000049 | 3300037466 | Bacteria | 284792 |
| 510 | Ga0395898_0001843 | 3300037466 | Bacteria | 27253 |
| 511 | Ga0395898_0092449 | 3300037466 | Bacteria | 2909 |
| 512 | Ga0395905_0000934 | 3300037471 | Bacteria | 37728 |
| 513 | Ga0395905_0001196 | 3300037471 | Bacteria | 32448 |
| 514 | Ga0395901_0000773 | 3300038443 | Bacteria | 35853 |
| 515 | Ga0395901_0008539 | 3300038443 | Bacteria | 10349 |
| 516 | Ga0395901_0035111 | 3300038443 | Bacteria | 5181 |
| 517 | Ga0395901_0049611 | 3300038443 | Bacteria | 4361 |
| 518 | Ga0395901_0049898 | 3300038443 | Bacteria | 4348 |
| 519 | Ga0395901_0124752 | 3300038443 | Bacteria | 2705 |
| 520 | Ga0237819_00917 | 3300038705 | Bacteria | 9091 |
| 521 | Ga0439436_0000006 | 3300041404 | Bacteria | 123245 |
| 522 | Ga0439465_0000040 | 3300041413 | Bacteria | 26319 |
| 523 | Ga0439465_0000833 | 3300041413 | Bacteria | 9715 |
| 524 | Ga0451793_0073484 | 3300041452 | Bacteria | 3479 |
| 525 | Ga0451797_0870357 | 3300041453 | Bacteria | 2604 |
| 526 | Ga0451806_099755 | 3300041462 | Bacteria | 3948 |
| 527 | Ga0451807_0145775 | 3300041486 | Bacteria | 4026 |
| 528 | Ga0451807_1713052 | 3300041486 | Bacteria | 1790 |
| 529 | Ga0451837_1686608 | 3300041494 | Bacteria | 2514 |
| 530 | Ga0439445_0009603 | 3300042004 | Bacteria | 2282 |
| 531 | Ga0439449_0000134 | 3300042007 | Bacteria | 25113 |
| 532 | Ga0450908_000855 | 3300042184 | Bacteria | 5872 |
| 533 | Ga0439440_0006951 | 3300042993 | Bacteria | 2290 |
| 534 | Ga0466969_0006363 | 3300044656 | Bacteria | 6282 |
| 535 | Ga0466969_0007873 | 3300044656 | Bacteria | 5658 |
| 536 | Ga0466969_0023913 | 3300044656 | Bacteria | 3144 |
| 537 | Ga0466969_0026182 | 3300044656 | Bacteria | 2992 |
| 538 | Ga0466982_0000003 | 3300044672 | Bacteria | 417243 |
| 539 | Ga0466982_0000231 | 3300044672 | Bacteria | 14748 |
| 540 | Ga0466965_0028634 | 3300044683 | Bacteria | 2707 |
| 541 | Ga0466966_0001912 | 3300044684 | Bacteria | 13504 |
| 542 | Ga0466966_0005127 | 3300044684 | Bacteria | 8610 |
| 543 | Ga0466966_0006879 | 3300044684 | Bacteria | 7533 |
| 544 | Ga0466966_0047309 | 3300044684 | Bacteria | 2743 |
| 545 | Ga0466961_0001342 | 3300044693 | Bacteria | 15159 |
| 546 | Ga0466961_0007688 | 3300044693 | Bacteria | 6862 |
| 547 | Ga0466961_0017725 | 3300044693 | Bacteria | 4575 |
| 548 | Ga0466961_0036413 | 3300044693 | Bacteria | 3158 |
| 549 | Ga0466961_0043622 | 3300044693 | Bacteria | 2871 |
| 550 | Ga0453684_0002590 | 3300044712 | Bacteria | 43282 |
| 551 | Ga0466971_0003646 | 3300044719 | Bacteria | 6585 |
| 552 | Ga0466970_0053070 | 3300044765 | Bacteria | 2165 |
| 553 | Ga0466970_0076834 | 3300044765 | Bacteria | 1799 |
| 554 | Ga0466957_0009996 | 3300044842 | Bacteria | 5429 |
| 555 | Ga0466957_0132197 | 3300044842 | Bacteria | 1600 |
| 556 | Ga0466959_0000346 | 3300045049 | Bacteria | 27374 |
| 557 | Ga0466959_0001514 | 3300045049 | Bacteria | 14264 |
| 558 | Ga0466959_0089200 | 3300045049 | Bacteria | 2215 |
| 559 | Ga0451576_0000840 | 3300045051 | Bacteria | 59794 |
| 560 | Ga0466958_0002540 | 3300045836 | Bacteria | 9203 |
| 561 | Ga0466958_0122088 | 3300045836 | Bacteria | 1631 |
| 562 | Ga0466967_0085422 | 3300045976 | Bacteria | 2857 |
| 563 | Ga0495617_000107 | 3300046452 | Bacteria | 60888 |
| 564 | Ga0495617_000337 | 3300046452 | Bacteria | 25904 |
| 565 | Ga0495629_0047720 | 3300046459 | Bacteria | 3004 |
| 566 | Ga0495638_0000268 | 3300046460 | Bacteria | 70252 |
| 567 | Ga0495638_0000430 | 3300046460 | Bacteria | 50741 |
| 568 | Ga0495638_0002222 | 3300046460 | Bacteria | 16136 |
| 569 | Ga0495638_0003275 | 3300046460 | Bacteria | 12775 |
| 570 | Ga0495638_0039200 | 3300046460 | Bacteria | 3008 |
| 571 | Ga0495650_0000444 | 3300046471 | Bacteria | 66241 |
| 572 | Ga0495650_0000980 | 3300046471 | Bacteria | 32575 |
| 573 | Ga0495650_0001591 | 3300046471 | Bacteria | 21278 |
| 574 | Ga0495580_0018580 | 3300046472 | Bacteria | 5174 |
| 575 | Ga0495582_0014227 | 3300046473 | Bacteria | 4377 |
| 576 | Ga0495584_0005843 | 3300046491 | Bacteria | 6483 |
| 577 | Ga0495585_0000028 | 3300046492 | Bacteria | 146662 |
| 578 | Ga0495585_0000927 | 3300046492 | Bacteria | 24791 |
| 579 | Ga0495594_0050003 | 3300046499 | Bacteria | 2299 |
| 580 | Ga0495607_0000438 | 3300046501 | Bacteria | 42080 |
| 581 | Ga0495607_0002438 | 3300046501 | Bacteria | 15147 |
| 582 | Ga0495607_0025777 | 3300046501 | Bacteria | 3654 |
| 583 | Ga0495606_0000216 | 3300046507 | Bacteria | 102891 |
| 584 | Ga0495606_0000872 | 3300046507 | Bacteria | 45088 |
| 585 | Ga0495606_0000934 | 3300046507 | Bacteria | 43034 |
| 586 | Ga0495606_0012571 | 3300046507 | Bacteria | 6776 |
| 587 | Ga0495606_0033187 | 3300046507 | Bacteria | 3564 |
| 588 | Ga0495606_0038546 | 3300046507 | Bacteria | 3232 |
| 589 | Ga0495610_0003255 | 3300046512 | Bacteria | 12817 |
| 590 | Ga0495610_0006433 | 3300046512 | Bacteria | 8089 |
| 591 | Ga0495610_0021328 | 3300046512 | Bacteria | 3565 |
| 592 | Ga0495616_0000098 | 3300046513 | Bacteria | 74007 |
| 593 | Ga0495620_0001664 | 3300046515 | Bacteria | 13134 |
| 594 | Ga0495631_0001265 | 3300046518 | Bacteria | 15613 |
| 595 | Ga0495631_0004267 | 3300046518 | Bacteria | 7643 |
| 596 | Ga0495631_0006251 | 3300046518 | Bacteria | 6170 |
| 597 | Ga0495632_0000032 | 3300046519 | Bacteria | 164561 |
| 598 | Ga0495632_0063007 | 3300046519 | Bacteria | 1796 |
| 599 | Ga0495643_0002752 | 3300046522 | Bacteria | 13485 |
| 600 | Ga0495648_0002326 | 3300046524 | Bacteria | 17687 |
| 601 | Ga0495663_0000499 | 3300046525 | Bacteria | 14134 |
| 602 | Ga0495663_0011170 | 3300046525 | Bacteria | 2499 |
| 603 | Ga0495622_0022919 | 3300046557 | Bacteria | 2910 |
| 604 | Ga0495633_0004706 | 3300046558 | Bacteria | 8578 |
| 605 | Ga0495668_0021466 | 3300046616 | Bacteria | 3702 |
| 606 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 607 | Ga0495611_0000092 | 3300046648 | Bacteria | 62897 |
| 608 | Ga0495625_0000037 | 3300046660 | Bacteria | 219383 |
| 609 | Ga0495625_0016209 | 3300046660 | Bacteria | 5871 |
| 610 | Ga0495625_0024483 | 3300046660 | Bacteria | 4593 |
| 611 | Ga0495625_0064918 | 3300046660 | Bacteria | 2574 |
| 612 | Ga0495661_0019881 | 3300046665 | Bacteria | 4393 |
| 613 | Ga0495623_0096454 | 3300046679 | Bacteria | 1807 |
| 614 | Ga0495658_0007277 | 3300046683 | Bacteria | 5470 |
| 615 | Ga0495670_0002216 | 3300046691 | Bacteria | 9601 |
| 616 | Ga0495670_0002434 | 3300046691 | Bacteria | 9190 |
| 617 | Ga0495670_0012753 | 3300046691 | Bacteria | 4133 |
| 618 | Ga0495671_0003326 | 3300046692 | Bacteria | 9929 |
| 619 | Ga0495649_0001808 | 3300046694 | Bacteria | 15722 |
| 620 | Ga0495589_0000523 | 3300046794 | Bacteria | 26993 |
| 621 | Ga0495660_0000076 | 3300046810 | Bacteria | 105580 |
| 622 | Ga0495660_0000567 | 3300046810 | Bacteria | 29946 |
| 623 | Ga0495672_0000105 | 3300047320 | Bacteria | 133882 |
| 624 | Ga0495680_0109638 | 3300047322 | Bacteria | 2047 |
| 625 | Ga0495683_0001013 | 3300047323 | Bacteria | 19575 |
| 626 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 627 | Ga0495673_0000010 | 3300047469 | Bacteria | 709599 |
| 628 | Ga0495673_0000087 | 3300047469 | Bacteria | 190669 |
| 629 | Ga0495673_0001346 | 3300047469 | Bacteria | 19925 |
| 630 | Ga0495686_0000123 | 3300047472 | Bacteria | 159841 |
| 631 | Ga0495686_0000792 | 3300047472 | Bacteria | 41248 |
| 632 | Ga0495686_0017669 | 3300047472 | Bacteria | 4800 |
| 633 | Ga0495686_0057699 | 3300047472 | Bacteria | 2422 |
| 634 | Ga0496100_0010984 | 3300048903 | Bacteria | 5139 |
| 635 | Ga0496101_0003218 | 3300048904 | Bacteria | 10127 |
| 636 | Ga0496101_0065594 | 3300048904 | Bacteria | 2647 |
| 637 | Ga0496102_0140045 | 3300048905 | Bacteria | 2268 |
| 638 | Ga0496104_0000017 | 3300048907 | Bacteria | 325877 |
| 639 | Ga0496105_0000009 | 3300048908 | Bacteria | 325734 |
| 640 | Ga0496105_0064090 | 3300048908 | Bacteria | 3032 |
| 641 | Ga0496106_0000563 | 3300048909 | Bacteria | 26445 |
| 642 | Ga0496114_0003989 | 3300048917 | Bacteria | 11398 |
| 643 | Ga0496115_0000530 | 3300048918 | Bacteria | 29698 |
| 644 | Ga0496115_0000924 | 3300048918 | Bacteria | 21293 |
| 645 | Ga0496115_0029951 | 3300048918 | Bacteria | 4279 |
| 646 | Ga0496115_0043831 | 3300048918 | Bacteria | 3568 |
| 647 | Ga0496116_0005311 | 3300048919 | Bacteria | 12006 |
| 648 | Ga0496117_0001191 | 3300048920 | Bacteria | 39121 |
| 649 | Ga0496117_0002104 | 3300048920 | Bacteria | 26184 |
| 650 | Ga0496117_0011556 | 3300048920 | Bacteria | 7899 |
| 651 | Ga0496117_0019026 | 3300048920 | Bacteria | 5658 |
| 652 | Ga0496117_0041533 | 3300048920 | Bacteria | 3368 |
| 653 | Ga0496117_0062217 | 3300048920 | Bacteria | 2559 |
| 654 | Ga0496118_0000858 | 3300048921 | Bacteria | 48244 |
| 655 | Ga0496118_0004478 | 3300048921 | Bacteria | 16549 |
| 656 | Ga0496118_0005348 | 3300048921 | Bacteria | 14620 |
| 657 | Ga0496118_0006565 | 3300048921 | Bacteria | 12718 |
| 658 | Ga0496118_0012820 | 3300048921 | Bacteria | 8002 |
| 659 | Ga0496118_0014740 | 3300048921 | Bacteria | 7298 |
| 660 | Ga0496118_0032826 | 3300048921 | Bacteria | 4268 |
| 661 | Ga0496118_0036831 | 3300048921 | Bacteria | 3948 |
| 662 | Ga0496118_0068986 | 3300048921 | Bacteria | 2563 |
| 663 | Ga0496119_0000070 | 3300048922 | Bacteria | 154395 |
| 664 | Ga0496119_0001416 | 3300048922 | Bacteria | 29034 |
| 665 | Ga0496119_0002285 | 3300048922 | Bacteria | 21233 |
| 666 | Ga0496119_0069083 | 3300048922 | Bacteria | 2077 |
| 667 | Ga0496120_0000181 | 3300048923 | Bacteria | 107114 |
| 668 | Ga0496120_0000676 | 3300048923 | Bacteria | 50058 |
| 669 | Ga0496120_0000696 | 3300048923 | Bacteria | 49219 |
| 670 | Ga0496120_0005912 | 3300048923 | Bacteria | 9539 |
| 671 | Ga0496121_0000541 | 3300048924 | Bacteria | 71839 |
| 672 | Ga0496121_0001673 | 3300048924 | Bacteria | 36526 |
| 673 | Ga0496121_0002576 | 3300048924 | Bacteria | 27425 |
| 674 | Ga0496121_0007321 | 3300048924 | Bacteria | 13347 |
| 675 | Ga0496121_0008621 | 3300048924 | Bacteria | 11935 |
| 676 | Ga0496121_0016007 | 3300048924 | Bacteria | 7776 |
| 677 | Ga0496121_0043851 | 3300048924 | Bacteria | 3867 |
| 678 | Ga0496121_0049290 | 3300048924 | Bacteria | 3572 |
| 679 | Ga0496121_0068591 | 3300048924 | Bacteria | 2868 |
| 680 | Ga0496121_0129210 | 3300048924 | Bacteria | 1894 |
| 681 | Ga0496121_0155012 | 3300048924 | Bacteria | 1681 |
| 682 | Ga0496122_0000372 | 3300048925 | Bacteria | 96314 |
| 683 | Ga0496122_0000901 | 3300048925 | Bacteria | 54955 |
| 684 | Ga0496122_0055190 | 3300048925 | Bacteria | 2975 |
| 685 | Ga0496122_0055374 | 3300048925 | Bacteria | 2968 |
| 686 | Ga0496122_0066848 | 3300048925 | Bacteria | 2593 |
| 687 | Ga0496122_0099280 | 3300048925 | Bacteria | 1953 |
| 688 | Ga0496123_0000694 | 3300048926 | Bacteria | 55393 |
| 689 | Ga0496123_0000727 | 3300048926 | Bacteria | 53518 |
| 690 | Ga0496123_0003232 | 3300048926 | Bacteria | 18540 |
| 691 | Ga0496123_0004944 | 3300048926 | Bacteria | 13665 |
| 692 | Ga0496123_0012754 | 3300048926 | Bacteria | 7127 |
| 693 | Ga0496123_0020644 | 3300048926 | Bacteria | 5147 |
| 694 | Ga0496123_0022327 | 3300048926 | Bacteria | 4881 |
| 695 | Ga0496123_0083673 | 3300048926 | Bacteria | 1928 |
| 696 | Ga0496124_0000009 | 3300048927 | Bacteria | 734820 |
| 697 | Ga0496124_0001061 | 3300048927 | Bacteria | 43394 |
| 698 | Ga0496124_0004084 | 3300048927 | Bacteria | 17267 |
| 699 | Ga0496124_0005367 | 3300048927 | Bacteria | 14474 |
| 700 | Ga0496124_0012178 | 3300048927 | Bacteria | 8513 |
| 701 | Ga0496124_0013838 | 3300048927 | Bacteria | 7846 |
| 702 | Ga0496124_0013858 | 3300048927 | Bacteria | 7841 |
| 703 | Ga0496124_0025735 | 3300048927 | Bacteria | 5321 |
| 704 | Ga0496124_0095133 | 3300048927 | Bacteria | 2421 |
| 705 | Ga0496125_0000348 | 3300048928 | Bacteria | 87672 |
| 706 | Ga0496125_0002711 | 3300048928 | Bacteria | 22502 |
| 707 | Ga0496125_0004432 | 3300048928 | Bacteria | 16200 |
| 708 | Ga0496125_0006197 | 3300048928 | Bacteria | 13028 |
| 709 | Ga0496125_0010457 | 3300048928 | Bacteria | 9384 |
| 710 | Ga0496125_0016678 | 3300048928 | Bacteria | 7041 |
| 711 | Ga0496125_0075496 | 3300048928 | Bacteria | 2608 |
| 712 | Ga0496126_0001731 | 3300048929 | Bacteria | 32382 |
| 713 | Ga0496126_0004409 | 3300048929 | Bacteria | 16857 |
| 714 | Ga0496126_0042023 | 3300048929 | Bacteria | 4225 |
| 715 | Ga0496126_0053772 | 3300048929 | Bacteria | 3651 |
| 716 | Ga0496126_0059566 | 3300048929 | Bacteria | 3438 |
| 717 | Ga0495678_000028 | 3300049459 | Bacteria | 220080 |
| 718 | Ga0495678_024415 | 3300049459 | Bacteria | 2611 |
| 719 | Ga0495682_0015236 | 3300049460 | Bacteria | 2913 |
| 720 | Ga0495682_0038251 | 3300049460 | Bacteria | 1763 |
| 721 | Ga0501031_0011773 | 3300049568 | Bacteria | 5707 |
| 722 | Ga0501031_0019155 | 3300049568 | Bacteria | 4456 |
| 723 | Ga0501031_0052541 | 3300049568 | Bacteria | 2655 |
| 724 | Ga0501032_0034432 | 3300049569 | Bacteria | 3468 |
| 725 | Ga0501032_0125391 | 3300049569 | Bacteria | 1696 |
| 726 | Ga0501033_0000539 | 3300049570 | Bacteria | 35280 |
| 727 | Ga0501033_0045414 | 3300049570 | Bacteria | 3269 |
| 728 | Ga0501033_0072967 | 3300049570 | Bacteria | 2520 |
| 729 | Ga0501034_0000083 | 3300049571 | Bacteria | 169656 |
| 730 | Ga0501034_0000091 | 3300049571 | Bacteria | 164456 |
| 731 | Ga0501034_0000592 | 3300049571 | Bacteria | 57290 |
| 732 | Ga0501034_0001599 | 3300049571 | Bacteria | 29470 |
| 733 | Ga0501034_0039909 | 3300049571 | Bacteria | 4754 |
| 734 | Ga0501034_0079414 | 3300049571 | Bacteria | 3284 |
| 735 | Ga0501034_0098838 | 3300049571 | Bacteria | 2913 |
| 736 | Ga0501037_0029032 | 3300049573 | Bacteria | 4085 |
| 737 | Ga0501037_0030806 | 3300049573 | Bacteria | 3962 |
| 738 | Ga0501037_0085388 | 3300049573 | Bacteria | 2285 |
| 739 | Ga0501038_0082482 | 3300049574 | Bacteria | 2707 |
| 740 | Ga0501043_0035321 | 3300049579 | Bacteria | 3931 |
| 741 | Ga0501043_0042000 | 3300049579 | Bacteria | 3592 |
| 742 | Ga0501043_0055361 | 3300049579 | Bacteria | 3116 |
| 743 | Ga0501046_0010507 | 3300049580 | Bacteria | 7941 |
| 744 | Ga0501046_0098181 | 3300049580 | Bacteria | 2249 |
| 745 | Ga0501047_0045273 | 3300049581 | Bacteria | 4254 |
| 746 | Ga0501047_0071692 | 3300049581 | Bacteria | 3334 |
| 747 | Ga0501047_0076534 | 3300049581 | Bacteria | 3220 |
| 748 | Ga0501047_0199733 | 3300049581 | Bacteria | 1861 |
| 749 | Ga0501048_0046805 | 3300049582 | Bacteria | 3088 |
| 750 | Ga0501048_0091233 | 3300049582 | Bacteria | 2149 |
| 751 | Ga0501069_0010771 | 3300049585 | Bacteria | 4848 |
| 752 | Ga0501070_0058089 | 3300049586 | Bacteria | 3207 |
| 753 | Ga0501080_0217497 | 3300049742 | Bacteria | 1749 |
| 754 | Ga0501083_0096064 | 3300049744 | Bacteria | 1955 |
| 755 | Ga0501035_0000974 | 3300049822 | Bacteria | 30264 |
| 756 | Ga0501035_0051319 | 3300049822 | Bacteria | 3693 |
| 757 | Ga0501035_0066072 | 3300049822 | Bacteria | 3210 |
| 758 | Ga0501035_0094360 | 3300049822 | Bacteria | 2631 |
| 759 | Ga0501044_0003619 | 3300049823 | Bacteria | 17388 |
| 760 | Ga0501044_0046734 | 3300049823 | Bacteria | 4480 |
| 761 | Ga0501044_0068438 | 3300049823 | Bacteria | 3616 |
| 762 | Ga0501044_0151092 | 3300049823 | Bacteria | 2304 |
| 763 | Ga0501044_0275834 | 3300049823 | Bacteria | 1616 |
| 764 | nmdc:mga08y16_12136_c1 | 3300050511 | Bacteria | 9054 |
| 765 | Ga0500643_000152 | 3300053087 | Bacteria | 69800 |
| 766 | Ga0500643_000460 | 3300053087 | Bacteria | 30091 |
| 767 | Ga0500644_0002761 | 3300053088 | Bacteria | 4382 |
| 768 | Ga0500651_0000033 | 3300053093 | Bacteria | 108567 |
| 769 | Ga0500555_000409 | 3300053103 | Bacteria | 17896 |
| 770 | Ga0500634_0000098 | 3300053161 | Bacteria | 34065 |
| 771 | Ga0501084_0214821 | 3300054114 | Bacteria | 1623 |
| 772 | Ga0466962_0015399 | 3300061719 | Bacteria | 3686 |
| 773 | Ga0466962_0022655 | 3300061719 | Bacteria | 3019 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003794 | Ga0055531_10015137 | Ga0055531_100151373 | 394 |
| 2 | 3300009094 | Ga0111539_10001027 | Ga0111539_1000102725 | 394 |
| 3 | 3300037418 | Ga0395900_0239257 | Ga0395900_0239257_60_1268 | 396 |
| 4 | 3300027907 | Ga0207428_10003984 | Ga0207428_100039849 | 405 |
| 5 | 3300048922 | Ga0496119_0069083 | Ga0496119_0069083_195_1424 | 409 |
| 6 | 3300049744 | Ga0501083_0096064 | Ga0501083_0096064_31_1287 | 415 |
| 7 | 3300025321 | Ga0207656_10014809 | Ga0207656_100148091 | 427 |
| 8 | 3300005331 | Ga0070670_100000002 | Ga0070670_100000002209 | 433 |
| 9 | 3300005353 | Ga0070669_100007740 | Ga0070669_1000077404 | 433 |
| 10 | 3300005355 | Ga0070671_100000023 | Ga0070671_10000002373 | 433 |
| 11 | 3300005365 | Ga0070688_100064916 | Ga0070688_1000649161 | 433 |
| 12 | 3300005367 | Ga0070667_100000018 | Ga0070667_100000018208 | 433 |
| 13 | 3300005466 | Ga0070685_10000011 | Ga0070685_10000011102 | 433 |
| 14 | 3300005548 | Ga0070665_100005073 | Ga0070665_1000050732 | 433 |
| 15 | 3300005617 | Ga0068859_100105981 | Ga0068859_1001059812 | 433 |
| 16 | 3300005618 | Ga0068864_100000003 | Ga0068864_100000003211 | 433 |
| 17 | 3300005843 | Ga0068860_100022725 | Ga0068860_1000227254 | 433 |
| 18 | 3300005844 | Ga0068862_100005757 | Ga0068862_1000057572 | 433 |
| 19 | 3300006931 | Ga0097620_100105989 | Ga0097620_1001059892 | 433 |
| 20 | 3300009101 | Ga0105247_10004696 | Ga0105247_100046962 | 433 |
| 21 | 3300009177 | Ga0105248_10096502 | Ga0105248_100965023 | 433 |
| 22 | 3300014325 | Ga0163163_10000537 | Ga0163163_1000053713 | 433 |
| 23 | 3300025923 | Ga0207681_10001068 | Ga0207681_100010682 | 433 |
| 24 | 3300025925 | Ga0207650_10000003 | Ga0207650_10000003761 | 433 |
| 25 | 3300025931 | Ga0207644_10000027 | Ga0207644_1000002791 | 433 |
| 26 | 3300025986 | Ga0207658_10000004 | Ga0207658_10000004208 | 433 |
| 27 | 3300026088 | Ga0207641_10019264 | Ga0207641_100192642 | 433 |
| 28 | 3300026095 | Ga0207676_10000003 | Ga0207676_10000003334 | 433 |
| 29 | 3300028379 | Ga0268266_10002297 | Ga0268266_1000229714 | 433 |
| 30 | 3300028381 | Ga0268264_10000016 | Ga0268264_10000016258 | 433 |
| 31 | 3300005354 | Ga0070675_100014764 | Ga0070675_1000147645 | 434 |
| 32 | 3300035695 | Ga0373927_0076523 | Ga0373927_0076523_66_1463 | 434 |
| 33 | 3300037068 | Ga0373925_0103237 | Ga0373925_0103237_185_1582 | 434 |
| 34 | 3300031727 | Ga0316576_10037332 | Ga0316576_100373321 | 437 |
| 35 | 3300036712 | Ga0316584_0046555 | Ga0316584_0046555_837_2240 | 437 |
| 36 | 3300031727 | Ga0316576_10005271 | Ga0316576_100052712 | 438 |
| 37 | 3300005331 | Ga0070670_100080904 | Ga0070670_1000809042 | 440 |
| 38 | 3300025925 | Ga0207650_10067663 | Ga0207650_100676632 | 440 |
| 39 | 3300031595 | Ga0265313_10022433 | Ga0265313_100224332 | 440 |
| 40 | 3300054114 | Ga0501084_0214821 | Ga0501084_0214821_145_1563 | 440 |
| 41 | 3300005616 | Ga0068852_100066737 | Ga0068852_1000667372 | 445 |
| 42 | 3300026035 | Ga0207703_10076430 | Ga0207703_100764302 | 445 |
| 43 | 3300026142 | Ga0207698_10018844 | Ga0207698_100188443 | 445 |
| 44 | 3300013308 | Ga0157375_10003760 | Ga0157375_100037604 | 448 |
| 45 | 3300049570 | Ga0501033_0045414 | Ga0501033_0045414_680_2065 | 448 |
| 46 | 3300005327 | Ga0070658_10000825 | Ga0070658_100008257 | 449 |
| 47 | 3300005335 | Ga0070666_10000018 | Ga0070666_1000001862 | 449 |
| 48 | 3300005344 | Ga0070661_100022106 | Ga0070661_1000221063 | 449 |
| 49 | 3300005367 | Ga0070667_100101624 | Ga0070667_1001016242 | 449 |
| 50 | 3300009551 | Ga0105238_10000224 | Ga0105238_1000022429 | 449 |
| 51 | 3300013306 | Ga0163162_10000284 | Ga0163162_100002846 | 449 |
| 52 | 3300025903 | Ga0207680_10000002 | Ga0207680_10000002448 | 449 |
| 53 | 3300025920 | Ga0207649_10129956 | Ga0207649_101299561 | 449 |
| 54 | 3300025924 | Ga0207694_10000210 | Ga0207694_1000021043 | 449 |
| 55 | 3300025972 | Ga0207668_10059861 | Ga0207668_100598612 | 449 |
| 56 | 3300025986 | Ga0207658_10027507 | Ga0207658_100275074 | 449 |
| 57 | 3300028379 | Ga0268266_10000004 | Ga0268266_10000004445 | 449 |
| 58 | 3300033180 | Ga0307510_10011777 | Ga0307510_100117774 | 449 |
| 59 | 3300046471 | Ga0495650_0000980 | Ga0495650_0000980_12633_14015 | 449 |
| 60 | 3300046660 | Ga0495625_0016209 | Ga0495625_0016209_3119_4501 | 449 |
| 61 | 3300048924 | Ga0496121_0068591 | Ga0496121_0068591_599_2071 | 449 |
| 62 | 3300048929 | Ga0496126_0042023 | Ga0496126_0042023_394_1866 | 449 |
| 63 | 3300006051 | Ga0075364_10000075 | Ga0075364_1000007524 | 450 |
| 64 | 3300005262 | Ga0065165_1000186 | Ga0065165_100018667 | 451 |
| 65 | 3300006186 | Ga0075369_10022777 | Ga0075369_100227772 | 451 |
| 66 | 3300009174 | Ga0105241_10181519 | Ga0105241_101815192 | 451 |
| 67 | 3300025258 | Ga0209129_1002319 | Ga0209129_10023198 | 451 |
| 68 | 3300025297 | Ga0209758_1029512 | Ga0209758_10295122 | 451 |
| 69 | 3300031711 | Ga0265314_10093203 | Ga0265314_100932032 | 451 |
| 70 | 3300049571 | Ga0501034_0000592 | Ga0501034_0000592_36261_37631 | 451 |
| 71 | 3300013102 | Ga0157371_10119685 | Ga0157371_101196852 | 452 |
| 72 | 3300025261 | Ga0209233_1008375 | Ga0209233_10083753 | 452 |
| 73 | 3300053088 | Ga0500644_0002761 | Ga0500644_0002761_1441_2826 | 453 |
| 74 | 3300025936 | Ga0207670_10083399 | Ga0207670_100833992 | 455 |
| 75 | 3300031616 | Ga0307508_10010230 | Ga0307508_100102306 | 455 |
| 76 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_274884_276266 | 455 |
| 77 | 3300046660 | Ga0495625_0000037 | Ga0495625_0000037_15738_17120 | 455 |
| 78 | iso_pu_bacteria | 2593339238 | 2595448294 | 455 |
| 79 | 3300025944 | Ga0207661_10179395 | Ga0207661_101793952 | 456 |
| 80 | iso_pu_bacteria | 2593339239 | 2595451589 | 456 |
| 81 | iso_pu_bacteria | 2718218334 | 2721028363 | 456 |
| 82 | iso_pu_bacteria | 2734482264 | 2735836056 | 456 |
| 83 | iso_pu_bacteria | 2738543009 | 2739227767 | 456 |
| 84 | iso_pu_bacteria | 2739367700 | 2739730103 | 456 |
| 85 | iso_pu_bacteria | 2818991440 | 2819563415 | 456 |
| 86 | iso_pu_bacteria | 2842918807 | 2842921591 | 456 |
| 87 | iso_pu_bacteria | 2884338543 | 2884339849 | 456 |
| 88 | iso_pu_bacteria | 2884411467 | 2884414294 | 456 |
| 89 | iso_pu_bacteria | 2904463128 | 2904464277 | 456 |
| 90 | iso_pu_bacteria | 2919085039 | 2919088491 | 456 |
| 91 | iso_pu_bacteria | 2919404418 | 2919404669 | 456 |
| 92 | iso_pu_bacteria | 2928963466 | 2928965648 | 456 |
| 93 | iso_pu_bacteria | 2941471342 | 2941472455 | 456 |
| 94 | iso_pu_bacteria | 2953994433 | 2953997605 | 456 |
| 95 | 3300005466 | Ga0070685_10000308 | Ga0070685_1000030817 | 457 |
| 96 | 3300005548 | Ga0070665_100061775 | Ga0070665_1000617752 | 457 |
| 97 | 3300009093 | Ga0105240_10001717 | Ga0105240_1000171733 | 457 |
| 98 | 3300009093 | Ga0105240_10014038 | Ga0105240_1001403810 | 457 |
| 99 | 3300009174 | Ga0105241_10036548 | Ga0105241_100365483 | 457 |
| 100 | 3300009545 | Ga0105237_10011644 | Ga0105237_100116445 | 457 |
| 101 | 3300009551 | Ga0105238_10002702 | Ga0105238_100027025 | 457 |
| 102 | 3300010375 | Ga0105239_10179719 | Ga0105239_101797193 | 457 |
| 103 | 3300025913 | Ga0207695_10000033 | Ga0207695_10000033191 | 457 |
| 104 | 3300025913 | Ga0207695_10063506 | Ga0207695_100635063 | 457 |
| 105 | 3300025914 | Ga0207671_10014832 | Ga0207671_100148325 | 457 |
| 106 | 3300025924 | Ga0207694_10000487 | Ga0207694_100004875 | 457 |
| 107 | 3300037471 | Ga0395905_0000934 | Ga0395905_0000934_20878_22284 | 457 |
| 108 | 3300037471 | Ga0395905_0001196 | Ga0395905_0001196_17280_18686 | 457 |
| 109 | iso_pu_bacteria | 2842914999 | 2842915248 | 457 |
| 110 | iso_pu_bacteria | 2894414249 | 2894417675 | 457 |
| 111 | iso_pu_bacteria | 2919513703 | 2919517206 | 457 |
| 112 | iso_pu_bacteria | 2919675420 | 2919677057 | 457 |
| 113 | 3300005456 | Ga0070678_100135470 | Ga0070678_1001354702 | 458 |
| 114 | 3300026118 | Ga0207675_100147765 | Ga0207675_1001477652 | 458 |
| 115 | 3300026121 | Ga0207683_10081681 | Ga0207683_100816812 | 458 |
| 116 | iso_pu_bacteria | 2537561836 | 2538832126 | 458 |
| 117 | iso_pu_bacteria | 2547132130 | 2547502953 | 458 |
| 118 | iso_pu_bacteria | 2576861471 | 2578458509 | 458 |
| 119 | iso_pu_bacteria | 2643221562 | 2643829616 | 458 |
| 120 | iso_pu_bacteria | 2643221577 | 2643896909 | 458 |
| 121 | iso_pu_bacteria | 2643221579 | 2643907996 | 458 |
| 122 | iso_pu_bacteria | 2643221581 | 2643915801 | 458 |
| 123 | iso_pu_bacteria | 2643221685 | 2644479115 | 458 |
| 124 | iso_pu_bacteria | 2687453130 | 2687584149 | 458 |
| 125 | iso_pu_bacteria | 2747842428 | 2747949477 | 458 |
| 126 | iso_pu_bacteria | 2747842501 | 2748019767 | 458 |
| 127 | iso_pu_bacteria | 2765235840 | 2765578881 | 458 |
| 128 | iso_pu_bacteria | 2816332141 | 2816516951 | 458 |
| 129 | iso_pu_bacteria | 2818991457 | 2819659675 | 458 |
| 130 | iso_pu_bacteria | 2842391507 | 2842393066 | 458 |
| 131 | iso_pu_bacteria | 2842757796 | 2842760210 | 458 |
| 132 | iso_pu_bacteria | 2842780639 | 2842780907 | 458 |
| 133 | iso_pu_bacteria | 2852649853 | 2852650927 | 458 |
| 134 | iso_pu_bacteria | 2852684882 | 2852685522 | 458 |
| 135 | iso_pu_bacteria | 2857442823 | 2857443771 | 458 |
| 136 | iso_pu_bacteria | 2874220319 | 2874221527 | 458 |
| 137 | iso_pu_bacteria | 2895395659 | 2895397555 | 458 |
| 138 | iso_pu_bacteria | 2895498888 | 2895500767 | 458 |
| 139 | iso_pu_bacteria | 2895511927 | 2895516363 | 458 |
| 140 | iso_pu_bacteria | 2895522137 | 2895523718 | 458 |
| 141 | iso_pu_bacteria | 2895525241 | 2895526701 | 458 |
| 142 | iso_pu_bacteria | 2919089067 | 2919089806 | 458 |
| 143 | iso_pu_bacteria | 2919130084 | 2919131677 | 458 |
| 144 | iso_pu_bacteria | 2919134579 | 2919137743 | 458 |
| 145 | iso_pu_bacteria | 2923516293 | 2923518646 | 458 |
| 146 | iso_pu_bacteria | 2928496128 | 2928500244 | 458 |
| 147 | iso_pu_bacteria | 2929195423 | 2929197953 | 458 |
| 148 | iso_pu_bacteria | 2931380184 | 2931380849 | 458 |
| 149 | iso_pu_bacteria | 2937610967 | 2937612344 | 458 |
| 150 | iso_pu_bacteria | 2939589442 | 2939591368 | 458 |
| 151 | iso_pu_bacteria | 2939611941 | 2939612650 | 458 |
| 152 | iso_pu_bacteria | 2939622612 | 2939623155 | 458 |
| 153 | iso_pu_bacteria | 2939626828 | 2939630913 | 458 |
| 154 | iso_pu_bacteria | 2941475908 | 2941478224 | 458 |
| 155 | iso_pu_bacteria | 2961047084 | 2961048294 | 458 |
| 156 | iso_pu_bacteria | 2961064222 | 2961065292 | 458 |
| 157 | iso_pu_bacteria | 2974307012 | 2974309069 | 458 |
| 158 | iso_pu_bacteria | 2977247770 | 2977249787 | 458 |
| 159 | iso_pu_bacteria | 2984514374 | 2984515724 | 458 |
| 160 | iso_pu_bacteria | 2987605356 | 2987606341 | 458 |
| 161 | iso_pu_bacteria | 8002869464 | 8002871863 | 458 |
| 162 | iso_pu_bacteria | 8021622325 | 8021624263 | 458 |
| 163 | iso_pu_bacteria | 8021626552 | 8021626606 | 458 |
| 164 | iso_pu_bacteria | 8021648035 | 8021649098 | 458 |
| 165 | 3300002737 | JGI25162J39368_1003087 | JGI25162J39368_10030873 | 459 |
| 166 | 3300005937 | Ga0081455_10052948 | Ga0081455_100529482 | 459 |
| 167 | 3300009094 | Ga0111539_10016831 | Ga0111539_100168317 | 459 |
| 168 | 3300025233 | Ga0209437_101541 | Ga0209437_1015413 | 459 |
| 169 | 3300025254 | Ga0209148_1001681 | Ga0209148_10016813 | 459 |
| 170 | 3300027907 | Ga0207428_10116357 | Ga0207428_101163572 | 459 |
| 171 | 3300028573 | Ga0265334_10028783 | Ga0265334_100287831 | 459 |
| 172 | 3300036401 | Ga0373937_0137035 | Ga0373937_0137035_595_2016 | 459 |
| 173 | 3300044672 | Ga0466982_0000231 | Ga0466982_0000231_8603_9982 | 459 |
| 174 | 3300049581 | Ga0501047_0199733 | Ga0501047_0199733_123_1526 | 459 |
| 175 | 3300049822 | Ga0501035_0000974 | Ga0501035_0000974_1312_2730 | 459 |
| 176 | 3300050511 | nmdc:mga08y16_12136_c1 | nmdc:mga08y16_12136_c1_3444_4871 | 459 |
| 177 | 3300001979 | JGI24740J21852_10002000 | JGI24740J21852_100020007 | 460 |
| 178 | 3300001989 | JGI24739J22299_10005709 | JGI24739J22299_100057093 | 460 |
| 179 | 3300001990 | JGI24737J22298_10013097 | JGI24737J22298_100130972 | 460 |
| 180 | 3300002067 | JGI24735J21928_10033230 | JGI24735J21928_100332301 | 460 |
| 181 | 3300002067 | JGI24735J21928_10033252 | JGI24735J21928_100332521 | 460 |
| 182 | 3300002075 | JGI24738J21930_10000181 | JGI24738J21930_100001812 | 460 |
| 183 | 3300002737 | JGI25162J39368_1000294 | JGI25162J39368_10002949 | 460 |
| 184 | 3300002737 | JGI25162J39368_1000397 | JGI25162J39368_100039710 | 460 |
| 185 | 3300002737 | JGI25162J39368_1002269 | JGI25162J39368_10022694 | 460 |
| 186 | 3300002741 | JGI25157J39369_1000559 | JGI25157J39369_100055914 | 460 |
| 187 | 3300002771 | JGI25163J39215_1001719 | JGI25163J39215_10017192 | 460 |
| 188 | 3300002772 | JGI25164J39214_1000203 | JGI25164J39214_100020326 | 460 |
| 189 | 3300003214 | JGI25165J46597_1000352 | JGI25165J46597_100035226 | 460 |
| 190 | 3300003215 | JGI25153J46596_10016875 | JGI25153J46596_100168752 | 460 |
| 191 | 3300003578 | Ga0006562J51391_1035570 | Ga0006562J51391_10355702 | 460 |
| 192 | 3300003751 | Ga0055538_1000713 | Ga0055538_10007135 | 460 |
| 193 | 3300003756 | Ga0055533_1000285 | Ga0055533_100028517 | 460 |
| 194 | 3300003761 | Ga0055535_1000074 | Ga0055535_100007491 | 460 |
| 195 | 3300003761 | Ga0055535_1000293 | Ga0055535_100029326 | 460 |
| 196 | 3300003762 | Ga0055542_1000357 | Ga0055542_10003574 | 460 |
| 197 | 3300003762 | Ga0055542_1000368 | Ga0055542_100036826 | 460 |
| 198 | 3300003763 | Ga0055529_1000121 | Ga0055529_100012192 | 460 |
| 199 | 3300003763 | Ga0055529_1000349 | Ga0055529_100034926 | 460 |
| 200 | 3300005262 | Ga0065165_1006259 | Ga0065165_10062595 | 460 |
| 201 | 3300005340 | Ga0070689_100001806 | Ga0070689_1000018061 | 460 |
| 202 | 3300005364 | Ga0070673_100043087 | Ga0070673_1000430873 | 460 |
| 203 | 3300005367 | Ga0070667_100092097 | Ga0070667_1000920972 | 460 |
| 204 | 3300005563 | Ga0068855_100021479 | Ga0068855_1000214796 | 460 |
| 205 | 3300005563 | Ga0068855_100044098 | Ga0068855_1000440983 | 460 |
| 206 | 3300005578 | Ga0068854_100002904 | Ga0068854_10000290410 | 460 |
| 207 | 3300005578 | Ga0068854_100020234 | Ga0068854_1000202342 | 460 |
| 208 | 3300005617 | Ga0068859_100063405 | Ga0068859_1000634052 | 460 |
| 209 | 3300005617 | Ga0068859_100074657 | Ga0068859_1000746572 | 460 |
| 210 | 3300005841 | Ga0068863_100024746 | Ga0068863_1000247466 | 460 |
| 211 | 3300005841 | Ga0068863_100032819 | Ga0068863_1000328195 | 460 |
| 212 | 3300005841 | Ga0068863_100073638 | Ga0068863_1000736383 | 460 |
| 213 | 3300006358 | Ga0068871_100150842 | Ga0068871_1001508422 | 460 |
| 214 | 3300006881 | Ga0068865_100009059 | Ga0068865_1000090592 | 460 |
| 215 | 3300006931 | Ga0097620_100063405 | Ga0097620_1000634052 | 460 |
| 216 | 3300006931 | Ga0097620_100074654 | Ga0097620_1000746542 | 460 |
| 217 | 3300009093 | Ga0105240_10002685 | Ga0105240_100026857 | 460 |
| 218 | 3300009093 | Ga0105240_10026393 | Ga0105240_100263936 | 460 |
| 219 | 3300009093 | Ga0105240_10064962 | Ga0105240_100649624 | 460 |
| 220 | 3300009093 | Ga0105240_10256873 | Ga0105240_102568732 | 460 |
| 221 | 3300009101 | Ga0105247_10003540 | Ga0105247_100035404 | 460 |
| 222 | 3300009545 | Ga0105237_10000543 | Ga0105237_1000054337 | 460 |
| 223 | 3300009545 | Ga0105237_10288041 | Ga0105237_102880411 | 460 |
| 224 | 3300009551 | Ga0105238_10189516 | Ga0105238_101895162 | 460 |
| 225 | 3300010375 | Ga0105239_10000023 | Ga0105239_10000023146 | 460 |
| 226 | 3300010375 | Ga0105239_10046151 | Ga0105239_100461512 | 460 |
| 227 | 3300010375 | Ga0105239_10075734 | Ga0105239_100757343 | 460 |
| 228 | 3300013104 | Ga0157370_10000044 | Ga0157370_1000004412 | 460 |
| 229 | 3300013105 | Ga0157369_10004095 | Ga0157369_100040957 | 460 |
| 230 | 3300013296 | Ga0157374_10033453 | Ga0157374_100334533 | 460 |
| 231 | 3300013306 | Ga0163162_10019407 | Ga0163162_100194072 | 460 |
| 232 | 3300013306 | Ga0163162_10029630 | Ga0163162_100296305 | 460 |
| 233 | 3300013307 | Ga0157372_10019325 | Ga0157372_100193252 | 460 |
| 234 | 3300013308 | Ga0157375_10049967 | Ga0157375_100499672 | 460 |
| 235 | 3300013308 | Ga0157375_10072201 | Ga0157375_100722011 | 460 |
| 236 | 3300014325 | Ga0163163_10130566 | Ga0163163_101305662 | 460 |
| 237 | 3300014497 | Ga0182008_10003037 | Ga0182008_100030379 | 460 |
| 238 | 3300014969 | Ga0157376_10000427 | Ga0157376_1000042725 | 460 |
| 239 | 3300015261 | Ga0182006_1000077 | Ga0182006_100007798 | 460 |
| 240 | 3300015261 | Ga0182006_1000427 | Ga0182006_10004279 | 460 |
| 241 | 3300015262 | Ga0182007_10006322 | Ga0182007_100063223 | 460 |
| 242 | 3300015265 | Ga0182005_1000060 | Ga0182005_100006084 | 460 |
| 243 | 3300015265 | Ga0182005_1022260 | Ga0182005_10222602 | 460 |
| 244 | 3300015687 | Ga0183368_1003 | Ga0183368_1003567 | 460 |
| 245 | 3300017792 | Ga0163161_10083110 | Ga0163161_100831102 | 460 |
| 246 | 3300025207 | Ga0209760_100363 | Ga0209760_1003632 | 460 |
| 247 | 3300025224 | Ga0209784_100011 | Ga0209784_100011138 | 460 |
| 248 | 3300025226 | Ga0209674_100012 | Ga0209674_100012311 | 460 |
| 249 | 3300025231 | Ga0207427_100026 | Ga0207427_10002626 | 460 |
| 250 | 3300025231 | Ga0207427_104288 | Ga0207427_1042882 | 460 |
| 251 | 3300025233 | Ga0209437_100202 | Ga0209437_10020286 | 460 |
| 252 | 3300025233 | Ga0209437_100359 | Ga0209437_10035926 | 460 |
| 253 | 3300025242 | Ga0209258_100027 | Ga0209258_100027409 | 460 |
| 254 | 3300025242 | Ga0209258_106463 | Ga0209258_1064631 | 460 |
| 255 | 3300025246 | Ga0209646_1000322 | Ga0209646_100032221 | 460 |
| 256 | 3300025246 | Ga0209646_1002983 | Ga0209646_10029832 | 460 |
| 257 | 3300025250 | Ga0209026_1000018 | Ga0209026_1000018303 | 460 |
| 258 | 3300025254 | Ga0209148_1000001 | Ga0209148_10000011147 | 460 |
| 259 | 3300025254 | Ga0209148_1000005 | Ga0209148_10000051142 | 460 |
| 260 | 3300025256 | Ga0209759_1000550 | Ga0209759_100055021 | 460 |
| 261 | 3300025258 | Ga0209129_1001261 | Ga0209129_100126119 | 460 |
| 262 | 3300025261 | Ga0209233_1000002 | Ga0209233_10000021083 | 460 |
| 263 | 3300025272 | Ga0209455_1000019 | Ga0209455_1000019476 | 460 |
| 264 | 3300025297 | Ga0209758_1000644 | Ga0209758_100064424 | 460 |
| 265 | 3300025299 | Ga0209256_1008903 | Ga0209256_10089032 | 460 |
| 266 | 3300025303 | Ga0209051_1004118 | Ga0209051_10041187 | 460 |
| 267 | 3300025900 | Ga0207710_10003190 | Ga0207710_100031904 | 460 |
| 268 | 3300025904 | Ga0207647_10000078 | Ga0207647_1000007851 | 460 |
| 269 | 3300025904 | Ga0207647_10009507 | Ga0207647_100095076 | 460 |
| 270 | 3300025913 | Ga0207695_10001880 | Ga0207695_1000188020 | 460 |
| 271 | 3300025913 | Ga0207695_10009427 | Ga0207695_100094273 | 460 |
| 272 | 3300025913 | Ga0207695_10019726 | Ga0207695_100197266 | 460 |
| 273 | 3300025913 | Ga0207695_10031732 | Ga0207695_100317324 | 460 |
| 274 | 3300025914 | Ga0207671_10000038 | Ga0207671_1000003857 | 460 |
| 275 | 3300025924 | Ga0207694_10118772 | Ga0207694_101187721 | 460 |
| 276 | 3300025936 | Ga0207670_10001950 | Ga0207670_100019501 | 460 |
| 277 | 3300025938 | Ga0207704_10011804 | Ga0207704_100118044 | 460 |
| 278 | 3300025940 | Ga0207691_10047647 | Ga0207691_100476472 | 460 |
| 279 | 3300025949 | Ga0207667_10000693 | Ga0207667_1000069312 | 460 |
| 280 | 3300025949 | Ga0207667_10008397 | Ga0207667_100083977 | 460 |
| 281 | 3300025960 | Ga0207651_10031925 | Ga0207651_100319252 | 460 |
| 282 | 3300025981 | Ga0207640_10004830 | Ga0207640_100048302 | 460 |
| 283 | 3300025981 | Ga0207640_10020869 | Ga0207640_100208691 | 460 |
| 284 | 3300026067 | Ga0207678_10106775 | Ga0207678_101067752 | 460 |
| 285 | 3300026067 | Ga0207678_10215025 | Ga0207678_102150251 | 460 |
| 286 | 3300026088 | Ga0207641_10035200 | Ga0207641_100352004 | 460 |
| 287 | 3300026088 | Ga0207641_10165082 | Ga0207641_101650822 | 460 |
| 288 | 3300026088 | Ga0207641_10179904 | Ga0207641_101799041 | 460 |
| 289 | 3300026116 | Ga0207674_10002019 | Ga0207674_1000201919 | 460 |
| 290 | 3300026121 | Ga0207683_10013683 | Ga0207683_100136836 | 460 |
| 291 | 3300026121 | Ga0207683_10022504 | Ga0207683_100225046 | 460 |
| 292 | 3300028381 | Ga0268264_10131959 | Ga0268264_101319591 | 460 |
| 293 | 3300031731 | Ga0307405_10051474 | Ga0307405_100514741 | 460 |
| 294 | 3300031911 | Ga0307412_10000203 | Ga0307412_1000020325 | 460 |
| 295 | 3300041404 | Ga0439436_0000006 | Ga0439436_0000006_54618_56000 | 460 |
| 296 | 3300041413 | Ga0439465_0000833 | Ga0439465_0000833_8196_9578 | 460 |
| 297 | 3300041453 | Ga0451797_0870357 | Ga0451797_0870357_371_1846 | 460 |
| 298 | 3300041486 | Ga0451807_0145775 | Ga0451807_0145775_542_2017 | 460 |
| 299 | 3300041494 | Ga0451837_1686608 | Ga0451837_1686608_953_2443 | 460 |
| 300 | 3300042184 | Ga0450908_000855 | Ga0450908_000855_834_2216 | 460 |
| 301 | 3300044656 | Ga0466969_0023913 | Ga0466969_0023913_1436_2899 | 460 |
| 302 | 3300044672 | Ga0466982_0000003 | Ga0466982_0000003_149638_151041 | 460 |
| 303 | 3300044684 | Ga0466966_0001912 | Ga0466966_0001912_1538_2941 | 460 |
| 304 | 3300044684 | Ga0466966_0047309 | Ga0466966_0047309_1024_2487 | 460 |
| 305 | 3300044719 | Ga0466971_0003646 | Ga0466971_0003646_614_2017 | 460 |
| 306 | 3300046452 | Ga0495617_000107 | Ga0495617_000107_10531_11913 | 460 |
| 307 | 3300046452 | Ga0495617_000337 | Ga0495617_000337_5225_6607 | 460 |
| 308 | 3300046460 | Ga0495638_0000430 | Ga0495638_0000430_23859_25241 | 460 |
| 309 | 3300046460 | Ga0495638_0002222 | Ga0495638_0002222_13223_14605 | 460 |
| 310 | 3300046460 | Ga0495638_0039200 | Ga0495638_0039200_16_1467 | 460 |
| 311 | 3300046471 | Ga0495650_0000444 | Ga0495650_0000444_38717_40099 | 460 |
| 312 | 3300046471 | Ga0495650_0001591 | Ga0495650_0001591_1171_2622 | 460 |
| 313 | 3300046491 | Ga0495584_0005843 | Ga0495584_0005843_2987_4438 | 460 |
| 314 | 3300046492 | Ga0495585_0000028 | Ga0495585_0000028_14077_15459 | 460 |
| 315 | 3300046492 | Ga0495585_0000927 | Ga0495585_0000927_131_1582 | 460 |
| 316 | 3300046501 | Ga0495607_0000438 | Ga0495607_0000438_6954_8336 | 460 |
| 317 | 3300046501 | Ga0495607_0002438 | Ga0495607_0002438_5590_6972 | 460 |
| 318 | 3300046501 | Ga0495607_0025777 | Ga0495607_0025777_2168_3550 | 460 |
| 319 | 3300046507 | Ga0495606_0000216 | Ga0495606_0000216_20134_21597 | 460 |
| 320 | 3300046507 | Ga0495606_0000872 | Ga0495606_0000872_31028_32479 | 460 |
| 321 | 3300046507 | Ga0495606_0000934 | Ga0495606_0000934_7688_9070 | 460 |
| 322 | 3300046507 | Ga0495606_0033187 | Ga0495606_0033187_1168_2550 | 460 |
| 323 | 3300046507 | Ga0495606_0038546 | Ga0495606_0038546_1751_3202 | 460 |
| 324 | 3300046512 | Ga0495610_0006433 | Ga0495610_0006433_469_1851 | 460 |
| 325 | 3300046512 | Ga0495610_0021328 | Ga0495610_0021328_1143_2594 | 460 |
| 326 | 3300046513 | Ga0495616_0000098 | Ga0495616_0000098_36170_37621 | 460 |
| 327 | 3300046515 | Ga0495620_0001664 | Ga0495620_0001664_1179_2561 | 460 |
| 328 | 3300046518 | Ga0495631_0001265 | Ga0495631_0001265_1648_3099 | 460 |
| 329 | 3300046518 | Ga0495631_0004267 | Ga0495631_0004267_6124_7506 | 460 |
| 330 | 3300046519 | Ga0495632_0000032 | Ga0495632_0000032_2664_4046 | 460 |
| 331 | 3300046519 | Ga0495632_0063007 | Ga0495632_0063007_171_1553 | 460 |
| 332 | 3300046524 | Ga0495648_0002326 | Ga0495648_0002326_7205_8587 | 460 |
| 333 | 3300046557 | Ga0495622_0022919 | Ga0495622_0022919_436_1818 | 460 |
| 334 | 3300046616 | Ga0495668_0021466 | Ga0495668_0021466_516_1898 | 460 |
| 335 | 3300046648 | Ga0495611_0000092 | Ga0495611_0000092_33694_35145 | 460 |
| 336 | 3300046660 | Ga0495625_0064918 | Ga0495625_0064918_1075_2457 | 460 |
| 337 | 3300046665 | Ga0495661_0019881 | Ga0495661_0019881_1946_3328 | 460 |
| 338 | 3300046691 | Ga0495670_0002216 | Ga0495670_0002216_6971_8353 | 460 |
| 339 | 3300046691 | Ga0495670_0002434 | Ga0495670_0002434_425_1876 | 460 |
| 340 | 3300046691 | Ga0495670_0012753 | Ga0495670_0012753_2136_3518 | 460 |
| 341 | 3300046692 | Ga0495671_0003326 | Ga0495671_0003326_5852_7234 | 460 |
| 342 | 3300046694 | Ga0495649_0001808 | Ga0495649_0001808_10385_11848 | 460 |
| 343 | 3300046794 | Ga0495589_0000523 | Ga0495589_0000523_25449_26831 | 460 |
| 344 | 3300046810 | Ga0495660_0000076 | Ga0495660_0000076_94759_96141 | 460 |
| 345 | 3300046810 | Ga0495660_0000567 | Ga0495660_0000567_13075_14457 | 460 |
| 346 | 3300047323 | Ga0495683_0001013 | Ga0495683_0001013_202_1653 | 460 |
| 347 | 3300047446 | Ga0495679_000001 | Ga0495679_000001_1314087_1315469 | 460 |
| 348 | 3300047469 | Ga0495673_0000010 | Ga0495673_0000010_501671_503122 | 460 |
| 349 | 3300047469 | Ga0495673_0000087 | Ga0495673_0000087_63867_65249 | 460 |
| 350 | 3300047469 | Ga0495673_0001346 | Ga0495673_0001346_12168_13550 | 460 |
| 351 | 3300047472 | Ga0495686_0000123 | Ga0495686_0000123_84379_85761 | 460 |
| 352 | 3300047472 | Ga0495686_0000792 | Ga0495686_0000792_5731_7182 | 460 |
| 353 | 3300047472 | Ga0495686_0017669 | Ga0495686_0017669_580_1962 | 460 |
| 354 | 3300047472 | Ga0495686_0057699 | Ga0495686_0057699_76_1527 | 460 |
| 355 | 3300048903 | Ga0496100_0010984 | Ga0496100_0010984_701_2101 | 460 |
| 356 | 3300048904 | Ga0496101_0003218 | Ga0496101_0003218_7530_8912 | 460 |
| 357 | 3300048904 | Ga0496101_0065594 | Ga0496101_0065594_670_2070 | 460 |
| 358 | 3300048905 | Ga0496102_0140045 | Ga0496102_0140045_91_1473 | 460 |
| 359 | 3300048908 | Ga0496105_0064090 | Ga0496105_0064090_560_1960 | 460 |
| 360 | 3300048909 | Ga0496106_0000563 | Ga0496106_0000563_23723_25105 | 460 |
| 361 | 3300048917 | Ga0496114_0003989 | Ga0496114_0003989_6849_8279 | 460 |
| 362 | 3300048918 | Ga0496115_0000530 | Ga0496115_0000530_905_2287 | 460 |
| 363 | 3300048918 | Ga0496115_0000924 | Ga0496115_0000924_19637_21100 | 460 |
| 364 | 3300048918 | Ga0496115_0029951 | Ga0496115_0029951_1539_2921 | 460 |
| 365 | 3300048918 | Ga0496115_0043831 | Ga0496115_0043831_1204_2604 | 460 |
| 366 | 3300048920 | Ga0496117_0041533 | Ga0496117_0041533_238_1638 | 460 |
| 367 | 3300048920 | Ga0496117_0062217 | Ga0496117_0062217_361_1743 | 460 |
| 368 | 3300048921 | Ga0496118_0005348 | Ga0496118_0005348_1623_3005 | 460 |
| 369 | 3300048921 | Ga0496118_0014740 | Ga0496118_0014740_1683_3083 | 460 |
| 370 | 3300048921 | Ga0496118_0036831 | Ga0496118_0036831_1128_2528 | 460 |
| 371 | 3300048922 | Ga0496119_0000070 | Ga0496119_0000070_44975_46375 | 460 |
| 372 | 3300048923 | Ga0496120_0000696 | Ga0496120_0000696_43449_44849 | 460 |
| 373 | 3300048924 | Ga0496121_0000541 | Ga0496121_0000541_69353_70735 | 460 |
| 374 | 3300048924 | Ga0496121_0001673 | Ga0496121_0001673_26943_28325 | 460 |
| 375 | 3300048924 | Ga0496121_0002576 | Ga0496121_0002576_2968_4368 | 460 |
| 376 | 3300048924 | Ga0496121_0007321 | Ga0496121_0007321_4069_5520 | 460 |
| 377 | 3300048924 | Ga0496121_0016007 | Ga0496121_0016007_5732_7228 | 460 |
| 378 | 3300048924 | Ga0496121_0155012 | Ga0496121_0155012_246_1628 | 460 |
| 379 | 3300048925 | Ga0496122_0055374 | Ga0496122_0055374_1560_2942 | 460 |
| 380 | 3300048926 | Ga0496123_0003232 | Ga0496123_0003232_14940_16379 | 460 |
| 381 | 3300048927 | Ga0496124_0013838 | Ga0496124_0013838_5391_6830 | 460 |
| 382 | 3300048927 | Ga0496124_0013858 | Ga0496124_0013858_1017_2456 | 460 |
| 383 | 3300048928 | Ga0496125_0000348 | Ga0496125_0000348_43328_44824 | 460 |
| 384 | 3300048928 | Ga0496125_0075496 | Ga0496125_0075496_1108_2490 | 460 |
| 385 | 3300048929 | Ga0496126_0001731 | Ga0496126_0001731_29832_31232 | 460 |
| 386 | 3300048929 | Ga0496126_0059566 | Ga0496126_0059566_636_2099 | 460 |
| 387 | 3300049459 | Ga0495678_000028 | Ga0495678_000028_41881_43263 | 460 |
| 388 | 3300049459 | Ga0495678_024415 | Ga0495678_024415_898_2280 | 460 |
| 389 | 3300049460 | Ga0495682_0015236 | Ga0495682_0015236_1257_2639 | 460 |
| 390 | 3300049460 | Ga0495682_0038251 | Ga0495682_0038251_267_1649 | 460 |
| 391 | 3300049585 | Ga0501069_0010771 | Ga0501069_0010771_2817_4199 | 460 |
| 392 | 3300053087 | Ga0500643_000152 | Ga0500643_000152_33334_34716 | 460 |
| 393 | 3300053087 | Ga0500643_000460 | Ga0500643_000460_3529_4953 | 460 |
| 394 | 3300053103 | Ga0500555_000409 | Ga0500555_000409_11574_12956 | 460 |
| 395 | 3300061719 | Ga0466962_0015399 | Ga0466962_0015399_32_1435 | 460 |
| 396 | iso_pu_bacteria | 8003014200 | 8003016197 | 460 |
| 397 | 3300002705 | JGI25156J39149_1000554 | JGI25156J39149_10005544 | 461 |
| 398 | 3300002737 | JGI25162J39368_1001712 | JGI25162J39368_10017128 | 461 |
| 399 | 3300002738 | JGI25154J39366_1003210 | JGI25154J39366_10032102 | 461 |
| 400 | 3300002741 | JGI25157J39369_1000571 | JGI25157J39369_10005714 | 461 |
| 401 | 3300002741 | JGI25157J39369_1002314 | JGI25157J39369_10023142 | 461 |
| 402 | 3300002772 | JGI25164J39214_1000138 | JGI25164J39214_100013819 | 461 |
| 403 | 3300003214 | JGI25165J46597_1000234 | JGI25165J46597_100023449 | 461 |
| 404 | 3300003752 | Ga0055539_1002855 | Ga0055539_10028552 | 461 |
| 405 | 3300003756 | Ga0055533_1004809 | Ga0055533_10048092 | 461 |
| 406 | 3300003759 | Ga0055525_1000178 | Ga0055525_10001783 | 461 |
| 407 | 3300003760 | Ga0055527_1000031 | Ga0055527_1000031145 | 461 |
| 408 | 3300003760 | Ga0055527_1000054 | Ga0055527_10000547 | 461 |
| 409 | 3300003760 | Ga0055527_1000803 | Ga0055527_10008035 | 461 |
| 410 | 3300003761 | Ga0055535_1000203 | Ga0055535_10002035 | 461 |
| 411 | 3300003761 | Ga0055535_1000725 | Ga0055535_100072519 | 461 |
| 412 | 3300003761 | Ga0055535_1000828 | Ga0055535_100082813 | 461 |
| 413 | 3300003761 | Ga0055535_1001977 | Ga0055535_10019774 | 461 |
| 414 | 3300003761 | Ga0055535_1002324 | Ga0055535_10023245 | 461 |
| 415 | 3300003762 | Ga0055542_1000083 | Ga0055542_1000083103 | 461 |
| 416 | 3300003762 | Ga0055542_1000100 | Ga0055542_100010098 | 461 |
| 417 | 3300003762 | Ga0055542_1000621 | Ga0055542_10006215 | 461 |
| 418 | 3300003762 | Ga0055542_1000748 | Ga0055542_100074819 | 461 |
| 419 | 3300003763 | Ga0055529_1000073 | Ga0055529_10000735 | 461 |
| 420 | 3300003763 | Ga0055529_1000288 | Ga0055529_100028855 | 461 |
| 421 | 3300003763 | Ga0055529_1000567 | Ga0055529_100056719 | 461 |
| 422 | 3300003763 | Ga0055529_1001548 | Ga0055529_10015484 | 461 |
| 423 | 3300005335 | Ga0070666_10001323 | Ga0070666_100013239 | 461 |
| 424 | 3300005355 | Ga0070671_100106387 | Ga0070671_1001063872 | 461 |
| 425 | 3300005367 | Ga0070667_100047135 | Ga0070667_1000471352 | 461 |
| 426 | 3300005367 | Ga0070667_100067867 | Ga0070667_1000678672 | 461 |
| 427 | 3300005455 | Ga0070663_100001649 | Ga0070663_1000016493 | 461 |
| 428 | 3300005457 | Ga0070662_100020438 | Ga0070662_1000204383 | 461 |
| 429 | 3300005458 | Ga0070681_10057495 | Ga0070681_100574951 | 461 |
| 430 | 3300005458 | Ga0070681_10146756 | Ga0070681_101467562 | 461 |
| 431 | 3300005530 | Ga0070679_100125175 | Ga0070679_1001251751 | 461 |
| 432 | 3300005539 | Ga0068853_100142629 | Ga0068853_1001426292 | 461 |
| 433 | 3300005547 | Ga0070693_100007027 | Ga0070693_1000070277 | 461 |
| 434 | 3300005548 | Ga0070665_100000786 | Ga0070665_10000078612 | 461 |
| 435 | 3300005563 | Ga0068855_100150693 | Ga0068855_1001506932 | 461 |
| 436 | 3300005578 | Ga0068854_100003674 | Ga0068854_1000036748 | 461 |
| 437 | 3300005578 | Ga0068854_100050615 | Ga0068854_1000506152 | 461 |
| 438 | 3300005614 | Ga0068856_100000012 | Ga0068856_10000001232 | 461 |
| 439 | 3300005614 | Ga0068856_100001305 | Ga0068856_1000013052 | 461 |
| 440 | 3300005842 | Ga0068858_100000799 | Ga0068858_10000079914 | 461 |
| 441 | 3300005843 | Ga0068860_100018698 | Ga0068860_1000186984 | 461 |
| 442 | 3300006051 | Ga0075364_10043609 | Ga0075364_100436092 | 461 |
| 443 | 3300006881 | Ga0068865_100025111 | Ga0068865_1000251112 | 461 |
| 444 | 3300009093 | Ga0105240_10002894 | Ga0105240_100028943 | 461 |
| 445 | 3300009093 | Ga0105240_10159723 | Ga0105240_101597232 | 461 |
| 446 | 3300009093 | Ga0105240_10311171 | Ga0105240_103111711 | 461 |
| 447 | 3300009174 | Ga0105241_10002687 | Ga0105241_100026879 | 461 |
| 448 | 3300009176 | Ga0105242_10007059 | Ga0105242_100070598 | 461 |
| 449 | 3300009545 | Ga0105237_10000571 | Ga0105237_1000057142 | 461 |
| 450 | 3300009545 | Ga0105237_10022754 | Ga0105237_100227541 | 461 |
| 451 | 3300009551 | Ga0105238_10021104 | Ga0105238_100211044 | 461 |
| 452 | 3300009551 | Ga0105238_10085161 | Ga0105238_100851612 | 461 |
| 453 | 3300010375 | Ga0105239_10021526 | Ga0105239_100215262 | 461 |
| 454 | 3300013105 | Ga0157369_10000057 | Ga0157369_1000005767 | 461 |
| 455 | 3300013105 | Ga0157369_10005110 | Ga0157369_100051102 | 461 |
| 456 | 3300013306 | Ga0163162_10000007 | Ga0163162_10000007113 | 461 |
| 457 | 3300013307 | Ga0157372_10027128 | Ga0157372_100271286 | 461 |
| 458 | 3300013307 | Ga0157372_10062104 | Ga0157372_100621043 | 461 |
| 459 | 3300013308 | Ga0157375_10000206 | Ga0157375_1000020640 | 461 |
| 460 | 3300014969 | Ga0157376_10005743 | Ga0157376_100057436 | 461 |
| 461 | 3300020070 | Ga0206356_11480241 | Ga0206356_114802411 | 461 |
| 462 | 3300020081 | Ga0206354_10669824 | Ga0206354_106698241 | 461 |
| 463 | 3300020082 | Ga0206353_10435035 | Ga0206353_104350352 | 461 |
| 464 | 3300025226 | Ga0209674_100140 | Ga0209674_10014012 | 461 |
| 465 | 3300025226 | Ga0209674_100990 | Ga0209674_1009902 | 461 |
| 466 | 3300025228 | Ga0209672_100005 | Ga0209672_100005511 | 461 |
| 467 | 3300025228 | Ga0209672_100016 | Ga0209672_100016171 | 461 |
| 468 | 3300025228 | Ga0209672_100341 | Ga0209672_10034119 | 461 |
| 469 | 3300025230 | Ga0209563_100023 | Ga0209563_100023167 | 461 |
| 470 | 3300025231 | Ga0207427_100057 | Ga0207427_10005720 | 461 |
| 471 | 3300025233 | Ga0209437_100184 | Ga0209437_10018420 | 461 |
| 472 | 3300025242 | Ga0209258_100006 | Ga0209258_100006511 | 461 |
| 473 | 3300025242 | Ga0209258_100012 | Ga0209258_100012312 | 461 |
| 474 | 3300025242 | Ga0209258_100064 | Ga0209258_10006464 | 461 |
| 475 | 3300025242 | Ga0209258_100139 | Ga0209258_10013948 | 461 |
| 476 | 3300025246 | Ga0209646_1000820 | Ga0209646_10008204 | 461 |
| 477 | 3300025250 | Ga0209026_1000077 | Ga0209026_1000077126 | 461 |
| 478 | 3300025250 | Ga0209026_1000117 | Ga0209026_100011797 | 461 |
| 479 | 3300025250 | Ga0209026_1000451 | Ga0209026_10004518 | 461 |
| 480 | 3300025254 | Ga0209148_1000012 | Ga0209148_1000012511 | 461 |
| 481 | 3300025254 | Ga0209148_1000014 | Ga0209148_1000014343 | 461 |
| 482 | 3300025254 | Ga0209148_1000073 | Ga0209148_1000073246 | 461 |
| 483 | 3300025254 | Ga0209148_1000173 | Ga0209148_100017362 | 461 |
| 484 | 3300025256 | Ga0209759_1000134 | Ga0209759_100013419 | 461 |
| 485 | 3300025256 | Ga0209759_1001310 | Ga0209759_100131011 | 461 |
| 486 | 3300025256 | Ga0209759_1002234 | Ga0209759_10022345 | 461 |
| 487 | 3300025261 | Ga0209233_1000063 | Ga0209233_1000063131 | 461 |
| 488 | 3300025272 | Ga0209455_1000008 | Ga0209455_1000008511 | 461 |
| 489 | 3300025272 | Ga0209455_1000014 | Ga0209455_1000014231 | 461 |
| 490 | 3300025272 | Ga0209455_1000018 | Ga0209455_1000018483 | 461 |
| 491 | 3300025272 | Ga0209455_1001025 | Ga0209455_10010257 | 461 |
| 492 | 3300025321 | Ga0207656_10000302 | Ga0207656_1000030210 | 461 |
| 493 | 3300025903 | Ga0207680_10002436 | Ga0207680_100024368 | 461 |
| 494 | 3300025904 | Ga0207647_10001332 | Ga0207647_1000133214 | 461 |
| 495 | 3300025911 | Ga0207654_10008492 | Ga0207654_100084922 | 461 |
| 496 | 3300025912 | Ga0207707_10151511 | Ga0207707_101515112 | 461 |
| 497 | 3300025913 | Ga0207695_10000581 | Ga0207695_100005818 | 461 |
| 498 | 3300025913 | Ga0207695_10002256 | Ga0207695_1000225613 | 461 |
| 499 | 3300025913 | Ga0207695_10002259 | Ga0207695_1000225913 | 461 |
| 500 | 3300025913 | Ga0207695_10012614 | Ga0207695_100126143 | 461 |
| 501 | 3300025914 | Ga0207671_10001015 | Ga0207671_100010158 | 461 |
| 502 | 3300025914 | Ga0207671_10022208 | Ga0207671_100222083 | 461 |
| 503 | 3300025921 | Ga0207652_10150608 | Ga0207652_101506081 | 461 |
| 504 | 3300025924 | Ga0207694_10001035 | Ga0207694_100010352 | 461 |
| 505 | 3300025924 | Ga0207694_10004749 | Ga0207694_100047497 | 461 |
| 506 | 3300025933 | Ga0207706_10019337 | Ga0207706_100193373 | 461 |
| 507 | 3300025938 | Ga0207704_10025598 | Ga0207704_100255982 | 461 |
| 508 | 3300025938 | Ga0207704_10048528 | Ga0207704_100485282 | 461 |
| 509 | 3300025961 | Ga0207712_10000288 | Ga0207712_1000028831 | 461 |
| 510 | 3300025981 | Ga0207640_10007281 | Ga0207640_100072813 | 461 |
| 511 | 3300025981 | Ga0207640_10094207 | Ga0207640_100942071 | 461 |
| 512 | 3300025986 | Ga0207658_10012049 | Ga0207658_100120495 | 461 |
| 513 | 3300025986 | Ga0207658_10063939 | Ga0207658_100639392 | 461 |
| 514 | 3300026035 | Ga0207703_10001120 | Ga0207703_1000112015 | 461 |
| 515 | 3300026067 | Ga0207678_10008203 | Ga0207678_100082032 | 461 |
| 516 | 3300026067 | Ga0207678_10014285 | Ga0207678_100142854 | 461 |
| 517 | 3300026078 | Ga0207702_10000108 | Ga0207702_1000010869 | 461 |
| 518 | 3300026078 | Ga0207702_10000312 | Ga0207702_1000031248 | 461 |
| 519 | 3300026116 | Ga0207674_10039426 | Ga0207674_100394263 | 461 |
| 520 | 3300026121 | Ga0207683_10064767 | Ga0207683_100647673 | 461 |
| 521 | 3300028379 | Ga0268266_10000006 | Ga0268266_10000006123 | 461 |
| 522 | 3300028381 | Ga0268264_10001303 | Ga0268264_1000130321 | 461 |
| 523 | 3300028381 | Ga0268264_10062361 | Ga0268264_100623612 | 461 |
| 524 | 3300030731 | Ga0316177_1014219 | Ga0316177_10142195 | 461 |
| 525 | 3300030735 | Ga0316178_1139308 | Ga0316178_11393082 | 461 |
| 526 | 3300031251 | Ga0265327_10001419 | Ga0265327_1000141917 | 461 |
| 527 | 3300031665 | Ga0316575_10004695 | Ga0316575_100046956 | 461 |
| 528 | 3300035089 | Ga0373944_0003053 | Ga0373944_0003053_2492_3877 | 461 |
| 529 | 3300035120 | Ga0373957_0030344 | Ga0373957_0030344_161_1546 | 461 |
| 530 | 3300035172 | Ga0373955_0059394 | Ga0373955_0059394_27_1412 | 461 |
| 531 | 3300036401 | Ga0373937_0035551 | Ga0373937_0035551_1804_3189 | 461 |
| 532 | 3300037312 | Ga0395899_0000089 | Ga0395899_0000089_49373_50758 | 461 |
| 533 | 3300037418 | Ga0395900_0000029 | Ga0395900_0000029_277184_278569 | 461 |
| 534 | 3300037418 | Ga0395900_0011616 | Ga0395900_0011616_6339_7724 | 461 |
| 535 | 3300037466 | Ga0395898_0000018 | Ga0395898_0000018_160619_162004 | 461 |
| 536 | 3300037466 | Ga0395898_0000049 | Ga0395898_0000049_49734_51119 | 461 |
| 537 | 3300037466 | Ga0395898_0001843 | Ga0395898_0001843_2994_4379 | 461 |
| 538 | 3300037466 | Ga0395898_0092449 | Ga0395898_0092449_1164_2549 | 461 |
| 539 | 3300038443 | Ga0395901_0008539 | Ga0395901_0008539_5723_7108 | 461 |
| 540 | 3300038443 | Ga0395901_0035111 | Ga0395901_0035111_1374_2759 | 461 |
| 541 | 3300038443 | Ga0395901_0049611 | Ga0395901_0049611_1642_3027 | 461 |
| 542 | 3300038443 | Ga0395901_0049898 | Ga0395901_0049898_2174_3559 | 461 |
| 543 | 3300038443 | Ga0395901_0124752 | Ga0395901_0124752_156_1541 | 461 |
| 544 | 3300041452 | Ga0451793_0073484 | Ga0451793_0073484_867_2252 | 461 |
| 545 | 3300044656 | Ga0466969_0006363 | Ga0466969_0006363_1362_2747 | 461 |
| 546 | 3300044656 | Ga0466969_0007873 | Ga0466969_0007873_1401_2786 | 461 |
| 547 | 3300044656 | Ga0466969_0026182 | Ga0466969_0026182_246_1631 | 461 |
| 548 | 3300044683 | Ga0466965_0028634 | Ga0466965_0028634_1125_2621 | 461 |
| 549 | 3300044684 | Ga0466966_0005127 | Ga0466966_0005127_5983_7368 | 461 |
| 550 | 3300044684 | Ga0466966_0006879 | Ga0466966_0006879_1365_2750 | 461 |
| 551 | 3300044693 | Ga0466961_0001342 | Ga0466961_0001342_12697_14082 | 461 |
| 552 | 3300044693 | Ga0466961_0007688 | Ga0466961_0007688_3327_4712 | 461 |
| 553 | 3300044693 | Ga0466961_0017725 | Ga0466961_0017725_2423_3808 | 461 |
| 554 | 3300044693 | Ga0466961_0036413 | Ga0466961_0036413_198_1694 | 461 |
| 555 | 3300044693 | Ga0466961_0043622 | Ga0466961_0043622_91_1476 | 461 |
| 556 | 3300044712 | Ga0453684_0002590 | Ga0453684_0002590_17069_18454 | 461 |
| 557 | 3300044765 | Ga0466970_0053070 | Ga0466970_0053070_445_1830 | 461 |
| 558 | 3300044765 | Ga0466970_0076834 | Ga0466970_0076834_15_1400 | 461 |
| 559 | 3300044842 | Ga0466957_0009996 | Ga0466957_0009996_3363_4748 | 461 |
| 560 | 3300044842 | Ga0466957_0132197 | Ga0466957_0132197_108_1493 | 461 |
| 561 | 3300045049 | Ga0466959_0000346 | Ga0466959_0000346_18127_19512 | 461 |
| 562 | 3300045049 | Ga0466959_0001514 | Ga0466959_0001514_3546_4931 | 461 |
| 563 | 3300045049 | Ga0466959_0089200 | Ga0466959_0089200_415_1911 | 461 |
| 564 | 3300045051 | Ga0451576_0000840 | Ga0451576_0000840_24829_26214 | 461 |
| 565 | 3300045836 | Ga0466958_0002540 | Ga0466958_0002540_346_1842 | 461 |
| 566 | 3300045836 | Ga0466958_0122088 | Ga0466958_0122088_198_1583 | 461 |
| 567 | 3300045976 | Ga0466967_0085422 | Ga0466967_0085422_1429_2814 | 461 |
| 568 | 3300046459 | Ga0495629_0047720 | Ga0495629_0047720_1515_2900 | 461 |
| 569 | 3300046460 | Ga0495638_0000268 | Ga0495638_0000268_49575_50960 | 461 |
| 570 | 3300046472 | Ga0495580_0018580 | Ga0495580_0018580_2720_4105 | 461 |
| 571 | 3300046473 | Ga0495582_0014227 | Ga0495582_0014227_1805_3190 | 461 |
| 572 | 3300046499 | Ga0495594_0050003 | Ga0495594_0050003_623_2008 | 461 |
| 573 | 3300046679 | Ga0495623_0096454 | Ga0495623_0096454_149_1534 | 461 |
| 574 | 3300046683 | Ga0495658_0007277 | Ga0495658_0007277_3212_4597 | 461 |
| 575 | 3300047322 | Ga0495680_0109638 | Ga0495680_0109638_184_1569 | 461 |
| 576 | 3300048907 | Ga0496104_0000017 | Ga0496104_0000017_236868_238253 | 461 |
| 577 | 3300048908 | Ga0496105_0000009 | Ga0496105_0000009_37754_39139 | 461 |
| 578 | 3300048923 | Ga0496120_0005912 | Ga0496120_0005912_2408_3811 | 461 |
| 579 | 3300048924 | Ga0496121_0049290 | Ga0496121_0049290_1987_3390 | 461 |
| 580 | 3300048927 | Ga0496124_0005367 | Ga0496124_0005367_7899_9308 | 461 |
| 581 | 3300048929 | Ga0496126_0053772 | Ga0496126_0053772_755_2158 | 461 |
| 582 | 3300049568 | Ga0501031_0019155 | Ga0501031_0019155_33_1586 | 461 |
| 583 | 3300049568 | Ga0501031_0052541 | Ga0501031_0052541_457_1845 | 461 |
| 584 | 3300049569 | Ga0501032_0125391 | Ga0501032_0125391_115_1503 | 461 |
| 585 | 3300049570 | Ga0501033_0000539 | Ga0501033_0000539_13175_14563 | 461 |
| 586 | 3300049571 | Ga0501034_0039909 | Ga0501034_0039909_2202_3587 | 461 |
| 587 | 3300049573 | Ga0501037_0029032 | Ga0501037_0029032_1655_3043 | 461 |
| 588 | 3300049573 | Ga0501037_0085388 | Ga0501037_0085388_385_1770 | 461 |
| 589 | 3300049574 | Ga0501038_0082482 | Ga0501038_0082482_1197_2585 | 461 |
| 590 | 3300049579 | Ga0501043_0035321 | Ga0501043_0035321_1391_2779 | 461 |
| 591 | 3300049579 | Ga0501043_0042000 | Ga0501043_0042000_646_2034 | 461 |
| 592 | 3300049579 | Ga0501043_0055361 | Ga0501043_0055361_1446_2831 | 461 |
| 593 | 3300049580 | Ga0501046_0098181 | Ga0501046_0098181_827_2215 | 461 |
| 594 | 3300049581 | Ga0501047_0045273 | Ga0501047_0045273_2802_4187 | 461 |
| 595 | 3300049581 | Ga0501047_0071692 | Ga0501047_0071692_1089_2477 | 461 |
| 596 | 3300049581 | Ga0501047_0076534 | Ga0501047_0076534_1531_2916 | 461 |
| 597 | 3300049582 | Ga0501048_0091233 | Ga0501048_0091233_538_1926 | 461 |
| 598 | 3300049586 | Ga0501070_0058089 | Ga0501070_0058089_1559_2944 | 461 |
| 599 | 3300049742 | Ga0501080_0217497 | Ga0501080_0217497_131_1519 | 461 |
| 600 | 3300049822 | Ga0501035_0051319 | Ga0501035_0051319_1849_3237 | 461 |
| 601 | 3300049822 | Ga0501035_0066072 | Ga0501035_0066072_409_1797 | 461 |
| 602 | 3300049822 | Ga0501035_0094360 | Ga0501035_0094360_966_2354 | 461 |
| 603 | 3300049823 | Ga0501044_0003619 | Ga0501044_0003619_2415_3803 | 461 |
| 604 | 3300049823 | Ga0501044_0046734 | Ga0501044_0046734_1379_2764 | 461 |
| 605 | 3300049823 | Ga0501044_0068438 | Ga0501044_0068438_1166_2554 | 461 |
| 606 | 3300053161 | Ga0500634_0000098 | Ga0500634_0000098_623_2008 | 461 |
| 607 | 3300061719 | Ga0466962_0022655 | Ga0466962_0022655_1325_2821 | 461 |
| 608 | 2162886007 | SwRhRL2b_contig_36842 | SwRhRL2b_0101.00008590 | 462 |
| 609 | 3300002737 | JGI25162J39368_1001995 | JGI25162J39368_10019955 | 462 |
| 610 | 3300002737 | JGI25162J39368_1002829 | JGI25162J39368_10028292 | 462 |
| 611 | 3300002737 | JGI25162J39368_1003446 | JGI25162J39368_10034466 | 462 |
| 612 | 3300002772 | JGI25164J39214_1000669 | JGI25164J39214_100066911 | 462 |
| 613 | 3300002772 | JGI25164J39214_1001921 | JGI25164J39214_10019215 | 462 |
| 614 | 3300002773 | JGI25152J39213_1000118 | JGI25152J39213_100011837 | 462 |
| 615 | 3300002774 | JGI25150J39212_1001719 | JGI25150J39212_10017192 | 462 |
| 616 | 3300003187 | JGI25151J46595_10000315 | JGI25151J46595_1000031537 | 462 |
| 617 | 3300003214 | JGI25165J46597_1001324 | JGI25165J46597_100132411 | 462 |
| 618 | 3300003214 | JGI25165J46597_1003755 | JGI25165J46597_10037552 | 462 |
| 619 | 3300003215 | JGI25153J46596_10000167 | JGI25153J46596_1000016737 | 462 |
| 620 | 3300003320 | rootH2_10085211 | rootH2_100852112 | 462 |
| 621 | 3300003771 | Ga0055526_1002395 | Ga0055526_10023951 | 462 |
| 622 | 3300003771 | Ga0055526_1011059 | Ga0055526_10110593 | 462 |
| 623 | 3300003773 | Ga0055537_1000091 | Ga0055537_100009148 | 462 |
| 624 | 3300003775 | Ga0055524_1005686 | Ga0055524_10056865 | 462 |
| 625 | 3300003775 | Ga0055524_1005776 | Ga0055524_10057762 | 462 |
| 626 | 3300003781 | Ga0055536_1000812 | Ga0055536_100081217 | 462 |
| 627 | 3300003781 | Ga0055536_1000925 | Ga0055536_10009254 | 462 |
| 628 | 3300003781 | Ga0055536_1003611 | Ga0055536_10036112 | 462 |
| 629 | 3300003781 | Ga0055536_1007843 | Ga0055536_10078434 | 462 |
| 630 | 3300003781 | Ga0055536_1019931 | Ga0055536_10199312 | 462 |
| 631 | 3300003784 | Ga0055534_1000043 | Ga0055534_100004349 | 462 |
| 632 | 3300003790 | Ga0055528_1000087 | Ga0055528_100008714 | 462 |
| 633 | 3300003791 | Ga0055530_10000673 | Ga0055530_1000067317 | 462 |
| 634 | 3300003791 | Ga0055530_10000796 | Ga0055530_100007965 | 462 |
| 635 | 3300003791 | Ga0055530_10001562 | Ga0055530_1000156213 | 462 |
| 636 | 3300003794 | Ga0055531_10001450 | Ga0055531_1000145017 | 462 |
| 637 | 3300003794 | Ga0055531_10004122 | Ga0055531_100041229 | 462 |
| 638 | 3300003794 | Ga0055531_10007659 | Ga0055531_100076596 | 462 |
| 639 | 3300003794 | Ga0055531_10009101 | Ga0055531_100091012 | 462 |
| 640 | 3300003794 | Ga0055531_10018662 | Ga0055531_100186622 | 462 |
| 641 | 3300003794 | Ga0055531_10018842 | Ga0055531_100188421 | 462 |
| 642 | 3300003856 | Ga0058692_1000031 | Ga0058692_1000031114 | 462 |
| 643 | 3300003856 | Ga0058692_1000060 | Ga0058692_100006038 | 462 |
| 644 | 3300005289 | Ga0065704_10070367 | Ga0065704_100703671 | 462 |
| 645 | 3300005289 | Ga0065704_10070531 | Ga0065704_100705316 | 462 |
| 646 | 3300005336 | Ga0070680_100080045 | Ga0070680_1000800452 | 462 |
| 647 | 3300005337 | Ga0070682_100012019 | Ga0070682_1000120193 | 462 |
| 648 | 3300005337 | Ga0070682_100081928 | Ga0070682_1000819281 | 462 |
| 649 | 3300005347 | Ga0070668_100061553 | Ga0070668_1000615532 | 462 |
| 650 | 3300005366 | Ga0070659_100010161 | Ga0070659_1000101612 | 462 |
| 651 | 3300005366 | Ga0070659_100089902 | Ga0070659_1000899022 | 462 |
| 652 | 3300005435 | Ga0070714_100000030 | Ga0070714_1000000308 | 462 |
| 653 | 3300005435 | Ga0070714_100056774 | Ga0070714_1000567743 | 462 |
| 654 | 3300005436 | Ga0070713_100001194 | Ga0070713_10000119410 | 462 |
| 655 | 3300005437 | Ga0070710_10061947 | Ga0070710_100619472 | 462 |
| 656 | 3300005458 | Ga0070681_10042687 | Ga0070681_100426871 | 462 |
| 657 | 3300005458 | Ga0070681_10089537 | Ga0070681_100895371 | 462 |
| 658 | 3300005458 | Ga0070681_10211295 | Ga0070681_102112951 | 462 |
| 659 | 3300005539 | Ga0068853_100011536 | Ga0068853_1000115366 | 462 |
| 660 | 3300005546 | Ga0070696_100006077 | Ga0070696_1000060776 | 462 |
| 661 | 3300005546 | Ga0070696_100012566 | Ga0070696_1000125662 | 462 |
| 662 | 3300005547 | Ga0070693_100005935 | Ga0070693_1000059353 | 462 |
| 663 | 3300005548 | Ga0070665_100293396 | Ga0070665_1002933961 | 462 |
| 664 | 3300009011 | Ga0105251_10000684 | Ga0105251_100006843 | 462 |
| 665 | 3300009011 | Ga0105251_10011627 | Ga0105251_100116272 | 462 |
| 666 | 3300009545 | Ga0105237_10147533 | Ga0105237_101475332 | 462 |
| 667 | 3300009551 | Ga0105238_10023762 | Ga0105238_100237624 | 462 |
| 668 | 3300009551 | Ga0105238_10138963 | Ga0105238_101389632 | 462 |
| 669 | 3300009993 | Ga0105028_102892 | Ga0105028_1028921 | 462 |
| 670 | 3300013100 | Ga0157373_10002185 | Ga0157373_100021856 | 462 |
| 671 | 3300013102 | Ga0157371_10002405 | Ga0157371_1000240516 | 462 |
| 672 | 3300013102 | Ga0157371_10007880 | Ga0157371_100078803 | 462 |
| 673 | 3300013102 | Ga0157371_10014358 | Ga0157371_100143584 | 462 |
| 674 | 3300013104 | Ga0157370_10008181 | Ga0157370_100081813 | 462 |
| 675 | 3300013104 | Ga0157370_10022676 | Ga0157370_100226766 | 462 |
| 676 | 3300013104 | Ga0157370_10033352 | Ga0157370_100333522 | 462 |
| 677 | 3300013104 | Ga0157370_10085340 | Ga0157370_100853402 | 462 |
| 678 | 3300013105 | Ga0157369_10127294 | Ga0157369_101272942 | 462 |
| 679 | 3300013307 | Ga0157372_10004509 | Ga0157372_1000450910 | 462 |
| 680 | 3300013307 | Ga0157372_10051334 | Ga0157372_100513342 | 462 |
| 681 | 3300014497 | Ga0182008_10001914 | Ga0182008_1000191410 | 462 |
| 682 | 3300014497 | Ga0182008_10010938 | Ga0182008_100109383 | 462 |
| 683 | 3300014497 | Ga0182008_10032370 | Ga0182008_100323702 | 462 |
| 684 | 3300014497 | Ga0182008_10042068 | Ga0182008_100420682 | 462 |
| 685 | 3300015261 | Ga0182006_1008610 | Ga0182006_10086103 | 462 |
| 686 | 3300015261 | Ga0182006_1015992 | Ga0182006_10159923 | 462 |
| 687 | 3300015261 | Ga0182006_1037923 | Ga0182006_10379232 | 462 |
| 688 | 3300015261 | Ga0182006_1041468 | Ga0182006_10414682 | 462 |
| 689 | 3300015262 | Ga0182007_10000556 | Ga0182007_1000055624 | 462 |
| 690 | 3300015262 | Ga0182007_10006254 | Ga0182007_100062542 | 462 |
| 691 | 3300015265 | Ga0182005_1000463 | Ga0182005_100046322 | 462 |
| 692 | 3300015685 | Ga0183369_1007 | Ga0183369_100726 | 462 |
| 693 | 3300016635 | Ga0183361_10614 | Ga0183361_106141 | 462 |
| 694 | 3300017792 | Ga0163161_10004924 | Ga0163161_100049247 | 462 |
| 695 | 3300017792 | Ga0163161_10085650 | Ga0163161_100856501 | 462 |
| 696 | 3300025226 | Ga0209674_100627 | Ga0209674_1006275 | 462 |
| 697 | 3300025231 | Ga0207427_100253 | Ga0207427_10025328 | 462 |
| 698 | 3300025231 | Ga0207427_100265 | Ga0207427_10026526 | 462 |
| 699 | 3300025233 | Ga0209437_100020 | Ga0209437_100020542 | 462 |
| 700 | 3300025233 | Ga0209437_100422 | Ga0209437_10042229 | 462 |
| 701 | 3300025245 | Ga0207425_1000097 | Ga0207425_100009752 | 462 |
| 702 | 3300025250 | Ga0209026_1000098 | Ga0209026_100009890 | 462 |
| 703 | 3300025258 | Ga0209129_1000189 | Ga0209129_100018952 | 462 |
| 704 | 3300025261 | Ga0209233_1000020 | Ga0209233_100002084 | 462 |
| 705 | 3300025261 | Ga0209233_1000147 | Ga0209233_1000147182 | 462 |
| 706 | 3300025263 | Ga0209565_1000063 | Ga0209565_100006339 | 462 |
| 707 | 3300025273 | Ga0209673_1000065 | Ga0209673_1000065100 | 462 |
| 708 | 3300025284 | Ga0209130_1006433 | Ga0209130_10064332 | 462 |
| 709 | 3300025284 | Ga0209130_1006566 | Ga0209130_10065661 | 462 |
| 710 | 3300025291 | Ga0209675_1000011 | Ga0209675_1000011243 | 462 |
| 711 | 3300025291 | Ga0209675_1007735 | Ga0209675_10077353 | 462 |
| 712 | 3300025292 | Ga0209676_1000011 | Ga0209676_1000011602 | 462 |
| 713 | 3300025292 | Ga0209676_1000034 | Ga0209676_1000034449 | 462 |
| 714 | 3300025292 | Ga0209676_1000068 | Ga0209676_1000068166 | 462 |
| 715 | 3300025292 | Ga0209676_1000728 | Ga0209676_100072830 | 462 |
| 716 | 3300025292 | Ga0209676_1000981 | Ga0209676_100098117 | 462 |
| 717 | 3300025292 | Ga0209676_1002601 | Ga0209676_10026013 | 462 |
| 718 | 3300025292 | Ga0209676_1005433 | Ga0209676_10054332 | 462 |
| 719 | 3300025294 | Ga0209025_1000054 | Ga0209025_100005452 | 462 |
| 720 | 3300025294 | Ga0209025_1004511 | Ga0209025_10045116 | 462 |
| 721 | 3300025294 | Ga0209025_1036260 | Ga0209025_10362602 | 462 |
| 722 | 3300025295 | Ga0209564_1000433 | Ga0209564_100043326 | 462 |
| 723 | 3300025297 | Ga0209758_1000062 | Ga0209758_100006252 | 462 |
| 724 | 3300025298 | Ga0209050_1000239 | Ga0209050_100023969 | 462 |
| 725 | 3300025298 | Ga0209050_1000599 | Ga0209050_100059917 | 462 |
| 726 | 3300025298 | Ga0209050_1002692 | Ga0209050_10026925 | 462 |
| 727 | 3300025299 | Ga0209256_1002093 | Ga0209256_100209314 | 462 |
| 728 | 3300025299 | Ga0209256_1003080 | Ga0209256_10030806 | 462 |
| 729 | 3300025299 | Ga0209256_1003541 | Ga0209256_10035417 | 462 |
| 730 | 3300025299 | Ga0209256_1005136 | Ga0209256_10051361 | 462 |
| 731 | 3300025303 | Ga0209051_1002354 | Ga0209051_100235413 | 462 |
| 732 | 3300025303 | Ga0209051_1024719 | Ga0209051_10247192 | 462 |
| 733 | 3300025304 | Ga0209257_1000014 | Ga0209257_1000014661 | 462 |
| 734 | 3300025304 | Ga0209257_1000263 | Ga0209257_100026349 | 462 |
| 735 | 3300025304 | Ga0209257_1000283 | Ga0209257_10002839 | 462 |
| 736 | 3300025304 | Ga0209257_1000645 | Ga0209257_100064514 | 462 |
| 737 | 3300025304 | Ga0209257_1001034 | Ga0209257_100103417 | 462 |
| 738 | 3300025304 | Ga0209257_1001651 | Ga0209257_100165120 | 462 |
| 739 | 3300025304 | Ga0209257_1002860 | Ga0209257_100286011 | 462 |
| 740 | 3300025304 | Ga0209257_1003306 | Ga0209257_10033062 | 462 |
| 741 | 3300025304 | Ga0209257_1004492 | Ga0209257_10044926 | 462 |
| 742 | 3300025898 | Ga0207692_10048626 | Ga0207692_100486262 | 462 |
| 743 | 3300025904 | Ga0207647_10006827 | Ga0207647_100068276 | 462 |
| 744 | 3300025912 | Ga0207707_10029048 | Ga0207707_100290485 | 462 |
| 745 | 3300025914 | Ga0207671_10092144 | Ga0207671_100921442 | 462 |
| 746 | 3300025923 | Ga0207681_10046782 | Ga0207681_100467822 | 462 |
| 747 | 3300025924 | Ga0207694_10059753 | Ga0207694_100597532 | 462 |
| 748 | 3300025924 | Ga0207694_10061178 | Ga0207694_100611781 | 462 |
| 749 | 3300025925 | Ga0207650_10006416 | Ga0207650_100064163 | 462 |
| 750 | 3300025928 | Ga0207700_10013029 | Ga0207700_100130296 | 462 |
| 751 | 3300025929 | Ga0207664_10000026 | Ga0207664_10000026146 | 462 |
| 752 | 3300025929 | Ga0207664_10038881 | Ga0207664_100388814 | 462 |
| 753 | 3300025932 | Ga0207690_10002055 | Ga0207690_100020554 | 462 |
| 754 | 3300025932 | Ga0207690_10018134 | Ga0207690_100181343 | 462 |
| 755 | 3300025933 | Ga0207706_10067935 | Ga0207706_100679353 | 462 |
| 756 | 3300025935 | Ga0207709_10004205 | Ga0207709_100042054 | 462 |
| 757 | 3300025949 | Ga0207667_10007470 | Ga0207667_1000747011 | 462 |
| 758 | 3300025972 | Ga0207668_10018829 | Ga0207668_100188292 | 462 |
| 759 | 3300026041 | Ga0207639_10005157 | Ga0207639_100051577 | 462 |
| 760 | 3300026121 | Ga0207683_10037910 | Ga0207683_100379104 | 462 |
| 761 | 3300027312 | Ga0209371_1000004 | Ga0209371_100000464 | 462 |
| 762 | 3300027312 | Ga0209371_1000139 | Ga0209371_100013938 | 462 |
| 763 | 3300030500 | Ga0268256_1000005 | Ga0268256_1000005981 | 462 |
| 764 | 3300030500 | Ga0268256_1000109 | Ga0268256_100010964 | 462 |
| 765 | 3300030742 | Ga0316183_1078638 | Ga0316183_10786383 | 462 |
| 766 | 3300031911 | Ga0307412_10001756 | Ga0307412_1000175611 | 462 |
| 767 | 3300032004 | Ga0307414_10021507 | Ga0307414_100215072 | 462 |
| 768 | 3300032004 | Ga0307414_10076107 | Ga0307414_100761073 | 462 |
| 769 | 3300032004 | Ga0307414_10088213 | Ga0307414_100882133 | 462 |
| 770 | 3300038443 | Ga0395901_0000773 | Ga0395901_0000773_19204_20613 | 462 |
| 771 | 3300038705 | Ga0237819_00917 | Ga0237819_00917_3502_5046 | 462 |
| 772 | 3300041413 | Ga0439465_0000040 | Ga0439465_0000040_11543_12934 | 462 |
| 773 | 3300041462 | Ga0451806_099755 | Ga0451806_099755_352_1740 | 462 |
| 774 | 3300041486 | Ga0451807_1713052 | Ga0451807_1713052_195_1583 | 462 |
| 775 | 3300042004 | Ga0439445_0009603 | Ga0439445_0009603_152_1543 | 462 |
| 776 | 3300042007 | Ga0439449_0000134 | Ga0439449_0000134_7998_9389 | 462 |
| 777 | 3300042993 | Ga0439440_0006951 | Ga0439440_0006951_539_1927 | 462 |
| 778 | 3300046460 | Ga0495638_0003275 | Ga0495638_0003275_11018_12406 | 462 |
| 779 | 3300046507 | Ga0495606_0012571 | Ga0495606_0012571_4783_6171 | 462 |
| 780 | 3300046512 | Ga0495610_0003255 | Ga0495610_0003255_10879_12267 | 462 |
| 781 | 3300046518 | Ga0495631_0006251 | Ga0495631_0006251_489_1877 | 462 |
| 782 | 3300046522 | Ga0495643_0002752 | Ga0495643_0002752_1216_2604 | 462 |
| 783 | 3300046525 | Ga0495663_0000499 | Ga0495663_0000499_5267_6655 | 462 |
| 784 | 3300046525 | Ga0495663_0011170 | Ga0495663_0011170_108_1496 | 462 |
| 785 | 3300046558 | Ga0495633_0004706 | Ga0495633_0004706_4219_5607 | 462 |
| 786 | 3300046660 | Ga0495625_0024483 | Ga0495625_0024483_2618_4006 | 462 |
| 787 | 3300047320 | Ga0495672_0000105 | Ga0495672_0000105_118220_119608 | 462 |
| 788 | 3300048919 | Ga0496116_0005311 | Ga0496116_0005311_246_1634 | 462 |
| 789 | 3300048920 | Ga0496117_0001191 | Ga0496117_0001191_23063_24484 | 462 |
| 790 | 3300048920 | Ga0496117_0002104 | Ga0496117_0002104_20338_21726 | 462 |
| 791 | 3300048920 | Ga0496117_0011556 | Ga0496117_0011556_1182_2570 | 462 |
| 792 | 3300048920 | Ga0496117_0019026 | Ga0496117_0019026_920_2308 | 462 |
| 793 | 3300048921 | Ga0496118_0000858 | Ga0496118_0000858_22338_23726 | 462 |
| 794 | 3300048921 | Ga0496118_0004478 | Ga0496118_0004478_4060_5448 | 462 |
| 795 | 3300048921 | Ga0496118_0006565 | Ga0496118_0006565_1134_2522 | 462 |
| 796 | 3300048921 | Ga0496118_0012820 | Ga0496118_0012820_5379_6767 | 462 |
| 797 | 3300048921 | Ga0496118_0032826 | Ga0496118_0032826_2681_4102 | 462 |
| 798 | 3300048921 | Ga0496118_0068986 | Ga0496118_0068986_228_1616 | 462 |
| 799 | 3300048922 | Ga0496119_0001416 | Ga0496119_0001416_10720_12108 | 462 |
| 800 | 3300048922 | Ga0496119_0002285 | Ga0496119_0002285_5181_6602 | 462 |
| 801 | 3300048923 | Ga0496120_0000181 | Ga0496120_0000181_90462_91850 | 462 |
| 802 | 3300048923 | Ga0496120_0000676 | Ga0496120_0000676_14658_16079 | 462 |
| 803 | 3300048924 | Ga0496121_0008621 | Ga0496121_0008621_198_1586 | 462 |
| 804 | 3300048924 | Ga0496121_0043851 | Ga0496121_0043851_1956_3344 | 462 |
| 805 | 3300048924 | Ga0496121_0129210 | Ga0496121_0129210_17_1405 | 462 |
| 806 | 3300048925 | Ga0496122_0000372 | Ga0496122_0000372_84210_85598 | 462 |
| 807 | 3300048925 | Ga0496122_0000901 | Ga0496122_0000901_37215_38636 | 462 |
| 808 | 3300048925 | Ga0496122_0055190 | Ga0496122_0055190_1150_2538 | 462 |
| 809 | 3300048925 | Ga0496122_0066848 | Ga0496122_0066848_225_1613 | 462 |
| 810 | 3300048925 | Ga0496122_0099280 | Ga0496122_0099280_389_1795 | 462 |
| 811 | 3300048926 | Ga0496123_0000694 | Ga0496123_0000694_10704_12092 | 462 |
| 812 | 3300048926 | Ga0496123_0000727 | Ga0496123_0000727_37481_38902 | 462 |
| 813 | 3300048926 | Ga0496123_0004944 | Ga0496123_0004944_11522_13048 | 462 |
| 814 | 3300048926 | Ga0496123_0012754 | Ga0496123_0012754_1182_2588 | 462 |
| 815 | 3300048926 | Ga0496123_0020644 | Ga0496123_0020644_708_2096 | 462 |
| 816 | 3300048926 | Ga0496123_0022327 | Ga0496123_0022327_486_1874 | 462 |
| 817 | 3300048926 | Ga0496123_0083673 | Ga0496123_0083673_169_1557 | 462 |
| 818 | 3300048927 | Ga0496124_0000009 | Ga0496124_0000009_421179_422567 | 462 |
| 819 | 3300048927 | Ga0496124_0001061 | Ga0496124_0001061_27354_28775 | 462 |
| 820 | 3300048927 | Ga0496124_0004084 | Ga0496124_0004084_1176_2564 | 462 |
| 821 | 3300048927 | Ga0496124_0012178 | Ga0496124_0012178_6652_8040 | 462 |
| 822 | 3300048927 | Ga0496124_0025735 | Ga0496124_0025735_327_1715 | 462 |
| 823 | 3300048927 | Ga0496124_0095133 | Ga0496124_0095133_702_2090 | 462 |
| 824 | 3300048928 | Ga0496125_0002711 | Ga0496125_0002711_3119_4507 | 462 |
| 825 | 3300048928 | Ga0496125_0004432 | Ga0496125_0004432_13596_14984 | 462 |
| 826 | 3300048928 | Ga0496125_0006197 | Ga0496125_0006197_305_1693 | 462 |
| 827 | 3300048928 | Ga0496125_0010457 | Ga0496125_0010457_7769_9157 | 462 |
| 828 | 3300048928 | Ga0496125_0016678 | Ga0496125_0016678_4756_6144 | 462 |
| 829 | 3300048929 | Ga0496126_0004409 | Ga0496126_0004409_15275_16663 | 462 |
| 830 | 3300049568 | Ga0501031_0011773 | Ga0501031_0011773_2479_3867 | 462 |
| 831 | 3300049569 | Ga0501032_0034432 | Ga0501032_0034432_657_2048 | 462 |
| 832 | 3300049570 | Ga0501033_0072967 | Ga0501033_0072967_220_1608 | 462 |
| 833 | 3300049571 | Ga0501034_0000083 | Ga0501034_0000083_45822_47210 | 462 |
| 834 | 3300049571 | Ga0501034_0000091 | Ga0501034_0000091_42662_44056 | 462 |
| 835 | 3300049571 | Ga0501034_0001599 | Ga0501034_0001599_1259_2647 | 462 |
| 836 | 3300049571 | Ga0501034_0079414 | Ga0501034_0079414_1576_2967 | 462 |
| 837 | 3300049571 | Ga0501034_0098838 | Ga0501034_0098838_1099_2490 | 462 |
| 838 | 3300049573 | Ga0501037_0030806 | Ga0501037_0030806_1097_2488 | 462 |
| 839 | 3300049580 | Ga0501046_0010507 | Ga0501046_0010507_5137_6528 | 462 |
| 840 | 3300049582 | Ga0501048_0046805 | Ga0501048_0046805_1427_2836 | 462 |
| 841 | 3300049823 | Ga0501044_0151092 | Ga0501044_0151092_514_1932 | 462 |
| 842 | 3300049823 | Ga0501044_0275834 | Ga0501044_0275834_24_1415 | 462 |
| 843 | 3300053093 | Ga0500651_0000033 | Ga0500651_0000033_90426_91817 | 462 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3pm9-assembly1.cif.gz_A | crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution | 0.9275 | 1 | 460 |
| 7qh2-assembly1.cif.gz_F | cryo-em structure of ldh-etfab complex from acetobacterium woodii | 0.9225 | 6 | 459 |
| 3pm9-assembly1.cif.gz_A | crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution | 0.9217 | 1 | 460 |
| 7qh2-assembly1.cif.gz_F | cryo-em structure of ldh-etfab complex from acetobacterium woodii | 0.9035 | 6 | 459 |
| 6lpq-assembly1.cif.gz_A | crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) | 0.8997 | 1 | 462 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7K4A7_386_505_3.30.70.2190 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9607 | 218 | 330 | 3.30.70.2190 |
| af_Q55E52_251_370_3.30.70.2190 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9602 | 219 | 330 | 3.30.70.2190 |
| 3pm9F02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9591 | 94 | 215 | 3.30.465.10 |
| af_P46681_278_399_3.30.70.2190 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.959 | 216 | 331 | 3.30.70.2190 |
| af_Q9C1X2_273_393_3.30.70.2190 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9586 | 216 | 331 | 3.30.70.2190 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N1XLV5-F1-model_v4 | deleted | 0.9836 | 1 | 332 |
|
| AF-A0A4S0JYZ6-F1-model_v4 | FAD-binding oxidoreductase | 0.9823 | 78 | 213 |
GO:0022904
GO:0071949 |
| AF-A0A848QDE5-F1-model_v4 | deleted | 0.9768 | 71 | 304 |
|
| AF-A0A4S0JYZ6-F1-model_v4 | FAD-binding oxidoreductase | 0.9752 | 78 | 213 |
GO:0022904
GO:0071949 |
| AF-A0A848QDE5-F1-model_v4 | deleted | 0.9686 | 71 | 304 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar