F483049
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 840 | 437 | 799 | 243 |
Family's Representative Sequence
| Representative Sequence | 3300009101|Ga0105247_10038942|Ga0105247_100389422 |
| Length | 276 |
| Sequence | MSDTTRRDSSDVAATGAHDEGPMTDHLIVTDEAETRTIKLRRPEKKNAITQAMYLGMSDAIDTAQNNPLVRCIIVTGGSGVFTAGNDLEDFLRAGSAGNDAVRTSAATKFLYSLAHNVKPIIAAVDGVAIGIGTTMLFHCDYVLASTTATFATPFIHLGLVPEGASSLLMPRTMGYQRAFAMLVMGRTMTAADAQIAGFVNTVVAPGHTEVEAHKVARDICRLPAEAVAIGRKLIRTAPDELTRRIDQEAYLFAERMTSEEAIGAFKAFFARKKKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 4 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 5 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 6 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 7 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 8 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 9 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 10 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 11 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 12 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 13 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 14 | 2791355199 | |||
| 15 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 16 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 17 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 18 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 19 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 20 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 21 | 2904699407 | |||
| 22 | 2906610324 | |||
| 23 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 24 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 25 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 26 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 27 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 28 | 2922425934 | |||
| 29 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 30 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 31 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 32 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 33 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 34 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 35 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 36 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 37 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 38 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 45 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 92 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 95 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 96 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 97 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 98 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 101 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 102 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 103 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 106 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 110 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 111 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 112 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 138 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 199 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 200 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 208 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 210 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 212 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 213 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 214 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 216 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 219 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 220 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 221 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 222 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 223 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 225 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 226 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 227 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 230 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 231 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 232 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 233 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 240 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 243 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 245 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 249 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 252 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 253 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 254 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 259 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 260 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 261 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 262 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 263 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 264 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 265 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 341 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 342 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 343 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 344 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 345 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 348 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 349 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 350 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 351 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 352 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 353 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 354 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 355 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 356 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 357 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 358 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 359 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 360 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 361 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 391 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 392 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 393 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 395 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 396 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 397 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 398 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 402 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 405 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 407 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 408 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 409 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 410 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 411 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 412 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 413 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 415 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 416 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 417 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 418 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 419 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 420 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 421 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 422 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 423 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 424 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 425 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 426 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 427 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 429 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 431 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 432 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 433 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 434 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 435 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 436 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 437 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.57 |
| Metatranscriptomes | 0 |
| Isolates | 4.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.93 |
| Nodule | 3.81 |
| Rhizoplane | 6.79 |
| Rhizosphere | 74.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001727 | 3300001979 | Bacteria | 10038 |
| 2 | JGI24739J22299_10042523 | 3300001989 | Bacteria | 1507 |
| 3 | JGI25406J46586_10000018 | 3300003203 | Bacteria | 88860 |
| 4 | JGI25406J46586_10006262 | 3300003203 | Bacteria | 5491 |
| 5 | JGI25153J46596_10027455 | 3300003215 | Bacteria | 1993 |
| 6 | JGI25404J52841_10007849 | 3300003659 | Bacteria | 2265 |
| 7 | JGI25404J52841_10024308 | 3300003659 | Bacteria | 1305 |
| 8 | Ga0070658_10017070 | 3300005327 | Bacteria | 5809 |
| 9 | Ga0070658_10017379 | 3300005327 | Bacteria | 5755 |
| 10 | Ga0070658_10217213 | 3300005327 | Bacteria | 1616 |
| 11 | Ga0070658_10357162 | 3300005327 | Bacteria | 1251 |
| 12 | Ga0070658_10618823 | 3300005327 | Bacteria | 939 |
| 13 | Ga0070683_100067142 | 3300005329 | Bacteria | 3340 |
| 14 | Ga0070670_100368057 | 3300005331 | Bacteria | 1265 |
| 15 | Ga0068869_100037113 | 3300005334 | Bacteria | 3463 |
| 16 | Ga0068869_100293012 | 3300005334 | Bacteria | 1312 |
| 17 | Ga0070680_100037799 | 3300005336 | Bacteria | 3902 |
| 18 | Ga0068868_100070712 | 3300005338 | Bacteria | 2782 |
| 19 | Ga0068868_100103472 | 3300005338 | Bacteria | 2307 |
| 20 | Ga0068868_100588298 | 3300005338 | Bacteria | 985 |
| 21 | Ga0070660_100014841 | 3300005339 | Bacteria | 5623 |
| 22 | Ga0070660_100204725 | 3300005339 | Bacteria | 1601 |
| 23 | Ga0070689_100219851 | 3300005340 | Bacteria | 1558 |
| 24 | Ga0070687_100287400 | 3300005343 | Bacteria | 1038 |
| 25 | Ga0070661_100018037 | 3300005344 | Bacteria | 5014 |
| 26 | Ga0070661_100051288 | 3300005344 | Bacteria | 3019 |
| 27 | Ga0070668_100023719 | 3300005347 | Bacteria | 4643 |
| 28 | Ga0070668_100040432 | 3300005347 | Bacteria | 3568 |
| 29 | Ga0070668_100086528 | 3300005347 | Bacteria | 2464 |
| 30 | Ga0070668_100207763 | 3300005347 | Bacteria | 1609 |
| 31 | Ga0070668_100370502 | 3300005347 | Bacteria | 1216 |
| 32 | Ga0070668_100569766 | 3300005347 | Bacteria | 987 |
| 33 | Ga0070669_100296940 | 3300005353 | Bacteria | 1298 |
| 34 | Ga0070671_100281335 | 3300005355 | Bacteria | 1415 |
| 35 | Ga0070671_100347479 | 3300005355 | Bacteria | 1266 |
| 36 | Ga0070674_100100743 | 3300005356 | Bacteria | 2104 |
| 37 | Ga0070674_100142856 | 3300005356 | Bacteria | 1798 |
| 38 | Ga0070673_100443489 | 3300005364 | Bacteria | 1167 |
| 39 | Ga0070659_100121888 | 3300005366 | Bacteria | 2113 |
| 40 | Ga0070659_100358299 | 3300005366 | Bacteria | 1225 |
| 41 | Ga0070667_100110095 | 3300005367 | Bacteria | 2387 |
| 42 | Ga0070667_100739120 | 3300005367 | Bacteria | 912 |
| 43 | Ga0070709_10251069 | 3300005434 | Bacteria | 1274 |
| 44 | Ga0070709_10397920 | 3300005434 | Bacteria | 1028 |
| 45 | Ga0070714_100087813 | 3300005435 | Bacteria | 2719 |
| 46 | Ga0070714_100245164 | 3300005435 | Bacteria | 1655 |
| 47 | Ga0070713_100002525 | 3300005436 | Bacteria | 11957 |
| 48 | Ga0070713_100085245 | 3300005436 | Bacteria | 2706 |
| 49 | Ga0070710_10032264 | 3300005437 | Bacteria | 2836 |
| 50 | Ga0070711_100004216 | 3300005439 | Bacteria | 8451 |
| 51 | Ga0070711_100019917 | 3300005439 | Bacteria | 4314 |
| 52 | Ga0070700_100303946 | 3300005441 | Bacteria | 1166 |
| 53 | Ga0070708_100108425 | 3300005445 | Bacteria | 2550 |
| 54 | Ga0070663_100003295 | 3300005455 | Bacteria | 9297 |
| 55 | Ga0070663_100024100 | 3300005455 | Bacteria | 4090 |
| 56 | Ga0070663_100031126 | 3300005455 | Bacteria | 3665 |
| 57 | Ga0070663_100301555 | 3300005455 | Bacteria | 1282 |
| 58 | Ga0070663_100345819 | 3300005455 | Bacteria | 1203 |
| 59 | Ga0070678_100450127 | 3300005456 | Bacteria | 1128 |
| 60 | Ga0070662_100060953 | 3300005457 | Bacteria | 2753 |
| 61 | Ga0070662_100065103 | 3300005457 | Bacteria | 2671 |
| 62 | Ga0070662_100276008 | 3300005457 | Bacteria | 1359 |
| 63 | Ga0070681_10016550 | 3300005458 | Bacteria | 7363 |
| 64 | Ga0068867_100017580 | 3300005459 | Bacteria | 5077 |
| 65 | Ga0070685_10064189 | 3300005466 | Bacteria | 2158 |
| 66 | Ga0070706_100170997 | 3300005467 | Bacteria | 2029 |
| 67 | Ga0070698_100216772 | 3300005471 | Bacteria | 1848 |
| 68 | Ga0070698_100549134 | 3300005471 | Bacteria | 1095 |
| 69 | Ga0070679_100448710 | 3300005530 | Bacteria | 1234 |
| 70 | Ga0070684_100025358 | 3300005535 | Bacteria | 4983 |
| 71 | Ga0070684_100182790 | 3300005535 | Bacteria | 1907 |
| 72 | Ga0068853_100014882 | 3300005539 | Bacteria | 6388 |
| 73 | Ga0068853_100058051 | 3300005539 | Bacteria | 3340 |
| 74 | Ga0068853_100069858 | 3300005539 | Bacteria | 3056 |
| 75 | Ga0068853_100089099 | 3300005539 | Bacteria | 2710 |
| 76 | Ga0068853_100136181 | 3300005539 | Bacteria | 2202 |
| 77 | Ga0068853_100164629 | 3300005539 | Bacteria | 2003 |
| 78 | Ga0068853_100626591 | 3300005539 | Bacteria | 1022 |
| 79 | Ga0070672_100269483 | 3300005543 | Bacteria | 1437 |
| 80 | Ga0070665_100027974 | 3300005548 | Bacteria | 5678 |
| 81 | Ga0070665_100112185 | 3300005548 | Bacteria | 2729 |
| 82 | Ga0070665_100173609 | 3300005548 | Bacteria | 2156 |
| 83 | Ga0070665_100196467 | 3300005548 | Bacteria | 2018 |
| 84 | Ga0070665_100257171 | 3300005548 | Bacteria | 1747 |
| 85 | Ga0070665_100259734 | 3300005548 | Bacteria | 1738 |
| 86 | Ga0070665_100279343 | 3300005548 | Bacteria | 1672 |
| 87 | Ga0070665_100373579 | 3300005548 | Bacteria | 1433 |
| 88 | Ga0068855_100012537 | 3300005563 | Bacteria | 10230 |
| 89 | Ga0068855_100054258 | 3300005563 | Bacteria | 4711 |
| 90 | Ga0068855_100179453 | 3300005563 | Bacteria | 2395 |
| 91 | Ga0068855_100215760 | 3300005563 | Bacteria | 2154 |
| 92 | Ga0068855_100439184 | 3300005563 | Bacteria | 1425 |
| 93 | Ga0068855_100574863 | 3300005563 | Bacteria | 1218 |
| 94 | Ga0068855_100857449 | 3300005563 | Bacteria | 962 |
| 95 | Ga0070664_100053456 | 3300005564 | Bacteria | 3424 |
| 96 | Ga0070664_100226606 | 3300005564 | Bacteria | 1674 |
| 97 | Ga0068857_100010486 | 3300005577 | Bacteria | 8054 |
| 98 | Ga0068857_100042553 | 3300005577 | Bacteria | 4031 |
| 99 | Ga0068857_100061831 | 3300005577 | Bacteria | 3327 |
| 100 | Ga0068854_100094867 | 3300005578 | Bacteria | 2226 |
| 101 | Ga0068854_100150890 | 3300005578 | Bacteria | 1792 |
| 102 | Ga0068854_100216648 | 3300005578 | Bacteria | 1513 |
| 103 | Ga0068856_100000505 | 3300005614 | Bacteria | 43297 |
| 104 | Ga0068856_100003444 | 3300005614 | Bacteria | 16003 |
| 105 | Ga0068856_100141898 | 3300005614 | Bacteria | 2410 |
| 106 | Ga0068852_100014578 | 3300005616 | Bacteria | 6057 |
| 107 | Ga0068852_100038624 | 3300005616 | Bacteria | 4014 |
| 108 | Ga0068852_100097767 | 3300005616 | Bacteria | 2642 |
| 109 | Ga0068852_100108144 | 3300005616 | Bacteria | 2524 |
| 110 | Ga0068859_100639053 | 3300005617 | Bacteria | 1156 |
| 111 | Ga0068859_100696730 | 3300005617 | Bacteria | 1106 |
| 112 | Ga0068864_100186578 | 3300005618 | Bacteria | 1899 |
| 113 | Ga0068864_100221833 | 3300005618 | Bacteria | 1745 |
| 114 | Ga0068866_10106928 | 3300005718 | Bacteria | 1554 |
| 115 | Ga0068866_10237679 | 3300005718 | Bacteria | 1108 |
| 116 | Ga0068851_10022662 | 3300005834 | Bacteria | 3063 |
| 117 | Ga0068851_10047145 | 3300005834 | Bacteria | 2181 |
| 118 | Ga0068851_10048287 | 3300005834 | Bacteria | 2157 |
| 119 | Ga0068863_100243328 | 3300005841 | Bacteria | 1736 |
| 120 | Ga0068860_100536596 | 3300005843 | Bacteria | 1171 |
| 121 | Ga0068860_100675583 | 3300005843 | Bacteria | 1042 |
| 122 | Ga0068862_100130594 | 3300005844 | Bacteria | 2221 |
| 123 | Ga0068862_100336754 | 3300005844 | Bacteria | 1396 |
| 124 | Ga0068862_100503870 | 3300005844 | Bacteria | 1149 |
| 125 | Ga0081455_10005785 | 3300005937 | Bacteria | 13478 |
| 126 | Ga0081455_10006447 | 3300005937 | Bacteria | 12574 |
| 127 | Ga0081455_10021510 | 3300005937 | Bacteria | 6051 |
| 128 | Ga0081538_10009846 | 3300005981 | Bacteria | 7908 |
| 129 | Ga0081540_1002041 | 3300005983 | Bacteria | 16838 |
| 130 | Ga0081540_1007700 | 3300005983 | Bacteria | 7634 |
| 131 | Ga0081540_1011669 | 3300005983 | Bacteria | 5856 |
| 132 | Ga0081540_1025347 | 3300005983 | Bacteria | 3415 |
| 133 | Ga0081540_1029018 | 3300005983 | Bacteria | 3092 |
| 134 | Ga0081540_1035571 | 3300005983 | Bacteria | 2669 |
| 135 | Ga0081539_10000003 | 3300005985 | Bacteria | 594833 |
| 136 | Ga0081539_10000199 | 3300005985 | Bacteria | 139305 |
| 137 | Ga0081539_10091602 | 3300005985 | Bacteria | 1570 |
| 138 | Ga0075365_10021053 | 3300006038 | Bacteria | 4059 |
| 139 | Ga0075365_10054204 | 3300006038 | Bacteria | 2658 |
| 140 | Ga0075365_10078490 | 3300006038 | Bacteria | 2232 |
| 141 | Ga0075365_10295831 | 3300006038 | Bacteria | 1139 |
| 142 | Ga0075365_10311402 | 3300006038 | Bacteria | 1108 |
| 143 | Ga0075368_10004358 | 3300006042 | Bacteria | 4788 |
| 144 | Ga0075368_10047370 | 3300006042 | Bacteria | 1701 |
| 145 | Ga0075363_100106380 | 3300006048 | Bacteria | 1556 |
| 146 | Ga0075363_100225433 | 3300006048 | Bacteria | 1075 |
| 147 | Ga0075364_10061329 | 3300006051 | Bacteria | 2467 |
| 148 | Ga0075364_10170166 | 3300006051 | Bacteria | 1473 |
| 149 | Ga0075364_10219239 | 3300006051 | Bacteria | 1291 |
| 150 | Ga0075432_10136169 | 3300006058 | Bacteria | 934 |
| 151 | Ga0070715_10000555 | 3300006163 | Bacteria | 9825 |
| 152 | Ga0070716_100006104 | 3300006173 | Bacteria | 5875 |
| 153 | Ga0070716_100038543 | 3300006173 | Bacteria | 2647 |
| 154 | Ga0075362_10017480 | 3300006177 | Bacteria | 2955 |
| 155 | Ga0075362_10045598 | 3300006177 | Bacteria | 1947 |
| 156 | Ga0075367_10004219 | 3300006178 | Bacteria | 6975 |
| 157 | Ga0075367_10047496 | 3300006178 | Bacteria | 2525 |
| 158 | Ga0075369_10024953 | 3300006186 | Bacteria | 2482 |
| 159 | Ga0075369_10116774 | 3300006186 | Bacteria | 1206 |
| 160 | Ga0075366_10091496 | 3300006195 | Bacteria | 1822 |
| 161 | Ga0097621_100357786 | 3300006237 | Bacteria | 1300 |
| 162 | Ga0075370_10058517 | 3300006353 | Bacteria | 2192 |
| 163 | Ga0075370_10062628 | 3300006353 | Bacteria | 2120 |
| 164 | Ga0075370_10126688 | 3300006353 | Bacteria | 1489 |
| 165 | Ga0075370_10192265 | 3300006353 | Bacteria | 1203 |
| 166 | Ga0075433_10586920 | 3300006852 | Bacteria | 979 |
| 167 | Ga0075434_100592606 | 3300006871 | Bacteria | 1128 |
| 168 | Ga0097620_100639044 | 3300006931 | Bacteria | 1156 |
| 169 | Ga0097620_100696728 | 3300006931 | Bacteria | 1106 |
| 170 | Ga0099825_1034330 | 3300006941 | Bacteria | 1895 |
| 171 | Ga0099824_1022834 | 3300006942 | Bacteria | 4024 |
| 172 | Ga0099822_1000663 | 3300006943 | Bacteria | 34548 |
| 173 | Ga0099795_10005252 | 3300007788 | Bacteria | 3427 |
| 174 | Ga0099795_10019849 | 3300007788 | Bacteria | 2181 |
| 175 | Ga0099795_10046617 | 3300007788 | Bacteria | 1562 |
| 176 | Ga0105240_10000603 | 3300009093 | Bacteria | 66614 |
| 177 | Ga0105240_10027536 | 3300009093 | Bacteria | 7439 |
| 178 | Ga0105240_10129364 | 3300009093 | Bacteria | 3030 |
| 179 | Ga0111539_10027346 | 3300009094 | Bacteria | 6966 |
| 180 | Ga0105245_10075160 | 3300009098 | Bacteria | 3076 |
| 181 | Ga0105247_10038942 | 3300009101 | Bacteria | 2903 |
| 182 | Ga0105247_10077276 | 3300009101 | Bacteria | 2092 |
| 183 | Ga0105247_10256397 | 3300009101 | Bacteria | 1198 |
| 184 | Ga0114129_10664121 | 3300009147 | Bacteria | 1344 |
| 185 | Ga0114129_11312661 | 3300009147 | Bacteria | 896 |
| 186 | Ga0105241_10000075 | 3300009174 | Bacteria | 75421 |
| 187 | Ga0105241_10358381 | 3300009174 | Bacteria | 1268 |
| 188 | Ga0105248_10144570 | 3300009177 | Bacteria | 2683 |
| 189 | Ga0105237_10025971 | 3300009545 | Bacteria | 5988 |
| 190 | Ga0105237_10131327 | 3300009545 | Bacteria | 2499 |
| 191 | Ga0105237_10178285 | 3300009545 | Bacteria | 2125 |
| 192 | Ga0105237_10307093 | 3300009545 | Bacteria | 1589 |
| 193 | Ga0105237_10480624 | 3300009545 | Bacteria | 1248 |
| 194 | Ga0105238_10003279 | 3300009551 | Bacteria | 16156 |
| 195 | Ga0105238_10020719 | 3300009551 | Bacteria | 6696 |
| 196 | Ga0105238_10409590 | 3300009551 | Bacteria | 1350 |
| 197 | Ga0099796_10031490 | 3300010159 | Bacteria | 1730 |
| 198 | Ga0105239_10075790 | 3300010375 | Bacteria | 3699 |
| 199 | Ga0105239_10084018 | 3300010375 | Bacteria | 3506 |
| 200 | Ga0105239_10239306 | 3300010375 | Bacteria | 2037 |
| 201 | Ga0105239_10241825 | 3300010375 | Bacteria | 2026 |
| 202 | Ga0105239_10300514 | 3300010375 | Bacteria | 1807 |
| 203 | Ga0105239_10335478 | 3300010375 | Bacteria | 1706 |
| 204 | Ga0157371_10089823 | 3300013102 | Bacteria | 2176 |
| 205 | Ga0157370_10021342 | 3300013104 | Bacteria | 6453 |
| 206 | Ga0157370_10195664 | 3300013104 | Bacteria | 1876 |
| 207 | Ga0157369_10056614 | 3300013105 | Bacteria | 4231 |
| 208 | Ga0157374_10021557 | 3300013296 | Bacteria | 5735 |
| 209 | Ga0157378_10762669 | 3300013297 | Bacteria | 991 |
| 210 | Ga0163162_10055264 | 3300013306 | Bacteria | 3996 |
| 211 | Ga0163162_10268443 | 3300013306 | Bacteria | 1838 |
| 212 | Ga0163162_10274499 | 3300013306 | Bacteria | 1818 |
| 213 | Ga0157372_11043322 | 3300013307 | Bacteria | 946 |
| 214 | Ga0157375_10077654 | 3300013308 | Bacteria | 3351 |
| 215 | Ga0157375_10107155 | 3300013308 | Bacteria | 2888 |
| 216 | Ga0157375_10417386 | 3300013308 | Bacteria | 1508 |
| 217 | Ga0163163_10047687 | 3300014325 | Bacteria | 4212 |
| 218 | Ga0163163_10314250 | 3300014325 | Bacteria | 1620 |
| 219 | Ga0163163_10416578 | 3300014325 | Bacteria | 1402 |
| 220 | Ga0157380_10323315 | 3300014326 | Bacteria | 1431 |
| 221 | Ga0157377_10239970 | 3300014745 | Bacteria | 1169 |
| 222 | Ga0157376_10135631 | 3300014969 | Bacteria | 2202 |
| 223 | Ga0163161_10255090 | 3300017792 | Bacteria | 1368 |
| 224 | Ga0224570_103551 | 3300022730 | Bacteria | 979 |
| 225 | Ga0209233_1001048 | 3300025261 | Bacteria | 11595 |
| 226 | Ga0209233_1020170 | 3300025261 | Bacteria | 1753 |
| 227 | Ga0209455_1008722 | 3300025272 | Bacteria | 2728 |
| 228 | Ga0209564_1009899 | 3300025295 | Bacteria | 4465 |
| 229 | Ga0209758_1003178 | 3300025297 | Bacteria | 15387 |
| 230 | Ga0209758_1003949 | 3300025297 | Bacteria | 12880 |
| 231 | Ga0209758_1010377 | 3300025297 | Bacteria | 5585 |
| 232 | Ga0207697_10132444 | 3300025315 | Bacteria | 1078 |
| 233 | Ga0207656_10012124 | 3300025321 | Bacteria | 3272 |
| 234 | Ga0207656_10051332 | 3300025321 | Bacteria | 1783 |
| 235 | Ga0207682_10130044 | 3300025893 | Bacteria | 1123 |
| 236 | Ga0207692_10002181 | 3300025898 | Bacteria | 7480 |
| 237 | Ga0207692_10010482 | 3300025898 | Bacteria | 3908 |
| 238 | Ga0207642_10024567 | 3300025899 | Bacteria | 2424 |
| 239 | Ga0207710_10044201 | 3300025900 | Bacteria | 1983 |
| 240 | Ga0207710_10218369 | 3300025900 | Bacteria | 946 |
| 241 | Ga0207688_10093219 | 3300025901 | Bacteria | 1732 |
| 242 | Ga0207647_10011690 | 3300025904 | Bacteria | 6144 |
| 243 | Ga0207647_10129092 | 3300025904 | Bacteria | 1486 |
| 244 | Ga0207685_10085178 | 3300025905 | Bacteria | 1318 |
| 245 | Ga0207699_10039854 | 3300025906 | Bacteria | 2702 |
| 246 | Ga0207699_10262741 | 3300025906 | Bacteria | 1194 |
| 247 | Ga0207645_10193688 | 3300025907 | Bacteria | 1336 |
| 248 | Ga0207643_10084112 | 3300025908 | Bacteria | 1847 |
| 249 | Ga0207705_10093019 | 3300025909 | Bacteria | 2210 |
| 250 | Ga0207705_10170500 | 3300025909 | Bacteria | 1638 |
| 251 | Ga0207705_10332892 | 3300025909 | Bacteria | 1168 |
| 252 | Ga0207705_10394159 | 3300025909 | Bacteria | 1070 |
| 253 | Ga0207705_10494199 | 3300025909 | Bacteria | 950 |
| 254 | Ga0207705_10705146 | 3300025909 | Bacteria | 784 |
| 255 | Ga0207684_10244007 | 3300025910 | Bacteria | 1550 |
| 256 | Ga0207654_10000037 | 3300025911 | Bacteria | 108727 |
| 257 | Ga0207707_10007441 | 3300025912 | Bacteria | 9540 |
| 258 | Ga0207695_10000283 | 3300025913 | Bacteria | 126108 |
| 259 | Ga0207695_10000286 | 3300025913 | Bacteria | 125310 |
| 260 | Ga0207695_10104168 | 3300025913 | Bacteria | 2827 |
| 261 | Ga0207671_10070932 | 3300025914 | Bacteria | 2598 |
| 262 | Ga0207671_10087436 | 3300025914 | Bacteria | 2344 |
| 263 | Ga0207671_10120702 | 3300025914 | Bacteria | 2003 |
| 264 | Ga0207671_10138521 | 3300025914 | Bacteria | 1873 |
| 265 | Ga0207693_10003158 | 3300025915 | Bacteria | 14168 |
| 266 | Ga0207693_10090228 | 3300025915 | Bacteria | 2402 |
| 267 | Ga0207693_10344791 | 3300025915 | Bacteria | 1166 |
| 268 | Ga0207663_10000261 | 3300025916 | Bacteria | 22957 |
| 269 | Ga0207663_10564282 | 3300025916 | Bacteria | 891 |
| 270 | Ga0207660_10009640 | 3300025917 | Bacteria | 6251 |
| 271 | Ga0207660_10510818 | 3300025917 | Bacteria | 975 |
| 272 | Ga0207662_10085072 | 3300025918 | Bacteria | 1936 |
| 273 | Ga0207657_10002700 | 3300025919 | Bacteria | 19128 |
| 274 | Ga0207657_10134362 | 3300025919 | Bacteria | 2025 |
| 275 | Ga0207652_10006338 | 3300025921 | Bacteria | 9558 |
| 276 | Ga0207681_10413685 | 3300025923 | Bacteria | 1091 |
| 277 | Ga0207694_10000120 | 3300025924 | Bacteria | 83624 |
| 278 | Ga0207694_10091488 | 3300025924 | Bacteria | 2401 |
| 279 | Ga0207694_10128279 | 3300025924 | Bacteria | 2031 |
| 280 | Ga0207694_10149516 | 3300025924 | Bacteria | 1881 |
| 281 | Ga0207700_10138800 | 3300025928 | Bacteria | 1994 |
| 282 | Ga0207700_10152357 | 3300025928 | Bacteria | 1912 |
| 283 | Ga0207700_10198737 | 3300025928 | Bacteria | 1688 |
| 284 | Ga0207664_10011105 | 3300025929 | Bacteria | 6381 |
| 285 | Ga0207664_10114239 | 3300025929 | Bacteria | 2249 |
| 286 | Ga0207664_10392364 | 3300025929 | Bacteria | 1233 |
| 287 | Ga0207664_10471245 | 3300025929 | Bacteria | 1122 |
| 288 | Ga0207644_10457323 | 3300025931 | Bacteria | 1049 |
| 289 | Ga0207690_10132261 | 3300025932 | Bacteria | 1827 |
| 290 | Ga0207690_10404702 | 3300025932 | Bacteria | 1089 |
| 291 | Ga0207706_10052332 | 3300025933 | Bacteria | 3605 |
| 292 | Ga0207670_10061941 | 3300025936 | Bacteria | 2555 |
| 293 | Ga0207669_10023409 | 3300025937 | Bacteria | 3299 |
| 294 | Ga0207704_10227247 | 3300025938 | Bacteria | 1385 |
| 295 | Ga0207665_10000280 | 3300025939 | Bacteria | 35528 |
| 296 | Ga0207665_10019565 | 3300025939 | Bacteria | 4452 |
| 297 | Ga0207665_10062181 | 3300025939 | Bacteria | 2532 |
| 298 | Ga0207665_10372546 | 3300025939 | Bacteria | 1082 |
| 299 | Ga0207691_10152893 | 3300025940 | Bacteria | 2028 |
| 300 | Ga0207691_10382503 | 3300025940 | Bacteria | 1201 |
| 301 | Ga0207711_10060989 | 3300025941 | Bacteria | 3251 |
| 302 | Ga0207711_10623100 | 3300025941 | Bacteria | 1007 |
| 303 | Ga0207689_10008118 | 3300025942 | Bacteria | 9157 |
| 304 | Ga0207689_10120814 | 3300025942 | Bacteria | 2155 |
| 305 | Ga0207689_10310222 | 3300025942 | Bacteria | 1308 |
| 306 | Ga0207679_10191197 | 3300025945 | Bacteria | 1702 |
| 307 | Ga0207679_10444490 | 3300025945 | Bacteria | 1149 |
| 308 | Ga0207667_10046316 | 3300025949 | Bacteria | 4604 |
| 309 | Ga0207667_10141047 | 3300025949 | Bacteria | 2481 |
| 310 | Ga0207667_10194168 | 3300025949 | Bacteria | 2083 |
| 311 | Ga0207667_10419859 | 3300025949 | Bacteria | 1361 |
| 312 | Ga0207667_10546150 | 3300025949 | Bacteria | 1172 |
| 313 | Ga0207651_10047369 | 3300025960 | Bacteria | 2898 |
| 314 | Ga0207712_10080055 | 3300025961 | Bacteria | 2375 |
| 315 | Ga0207668_10032604 | 3300025972 | Bacteria | 3444 |
| 316 | Ga0207668_10059080 | 3300025972 | Bacteria | 2684 |
| 317 | Ga0207668_10133716 | 3300025972 | Bacteria | 1897 |
| 318 | Ga0207668_10183739 | 3300025972 | Bacteria | 1651 |
| 319 | Ga0207668_10183980 | 3300025972 | Bacteria | 1650 |
| 320 | Ga0207668_10244197 | 3300025972 | Bacteria | 1454 |
| 321 | Ga0207640_10018694 | 3300025981 | Bacteria | 4078 |
| 322 | Ga0207640_10028018 | 3300025981 | Bacteria | 3438 |
| 323 | Ga0207640_10157315 | 3300025981 | Bacteria | 1677 |
| 324 | Ga0207640_10677966 | 3300025981 | Bacteria | 881 |
| 325 | Ga0207658_10584041 | 3300025986 | Bacteria | 1002 |
| 326 | Ga0207677_10007590 | 3300026023 | Bacteria | 6015 |
| 327 | Ga0207677_10029943 | 3300026023 | Bacteria | 3467 |
| 328 | Ga0207677_10316569 | 3300026023 | Bacteria | 1295 |
| 329 | Ga0207639_10054692 | 3300026041 | Bacteria | 3052 |
| 330 | Ga0207639_10076791 | 3300026041 | Bacteria | 2631 |
| 331 | Ga0207639_10112553 | 3300026041 | Bacteria | 2221 |
| 332 | Ga0207639_10288240 | 3300026041 | Bacteria | 1447 |
| 333 | Ga0207678_10008442 | 3300026067 | Bacteria | 9085 |
| 334 | Ga0207678_10015515 | 3300026067 | Bacteria | 6698 |
| 335 | Ga0207678_10044166 | 3300026067 | Bacteria | 3855 |
| 336 | Ga0207678_10051796 | 3300026067 | Bacteria | 3543 |
| 337 | Ga0207678_10062822 | 3300026067 | Bacteria | 3191 |
| 338 | Ga0207678_10250929 | 3300026067 | Bacteria | 1515 |
| 339 | Ga0207678_10370940 | 3300026067 | Bacteria | 1236 |
| 340 | Ga0207702_10000019 | 3300026078 | Bacteria | 211843 |
| 341 | Ga0207702_10000127 | 3300026078 | Bacteria | 89755 |
| 342 | Ga0207702_10629084 | 3300026078 | Bacteria | 1054 |
| 343 | Ga0207648_10562863 | 3300026089 | Bacteria | 1048 |
| 344 | Ga0207676_10148948 | 3300026095 | Bacteria | 2013 |
| 345 | Ga0207674_10016041 | 3300026116 | Bacteria | 8206 |
| 346 | Ga0207674_10051454 | 3300026116 | Bacteria | 4203 |
| 347 | Ga0207674_10064435 | 3300026116 | Bacteria | 3696 |
| 348 | Ga0207675_100096466 | 3300026118 | Bacteria | 2784 |
| 349 | Ga0207675_100434613 | 3300026118 | Bacteria | 1298 |
| 350 | Ga0207683_10071355 | 3300026121 | Bacteria | 3070 |
| 351 | Ga0207683_10160750 | 3300026121 | Bacteria | 2030 |
| 352 | Ga0207683_10442545 | 3300026121 | Bacteria | 1198 |
| 353 | Ga0207683_10495240 | 3300026121 | Bacteria | 1128 |
| 354 | Ga0207698_10079006 | 3300026142 | Bacteria | 2644 |
| 355 | Ga0207698_10383197 | 3300026142 | Bacteria | 1338 |
| 356 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 357 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 358 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 359 | Ga0209179_1003031 | 3300027512 | Bacteria | 2362 |
| 360 | Ga0209588_1039153 | 3300027671 | Bacteria | 1529 |
| 361 | Ga0209813_10051794 | 3300027866 | Bacteria | 1285 |
| 362 | Ga0207428_10367565 | 3300027907 | Bacteria | 1057 |
| 363 | Ga0268266_10012489 | 3300028379 | Bacteria | 7340 |
| 364 | Ga0268266_10016053 | 3300028379 | Bacteria | 6401 |
| 365 | Ga0268266_10124924 | 3300028379 | Bacteria | 2294 |
| 366 | Ga0268266_10134892 | 3300028379 | Bacteria | 2210 |
| 367 | Ga0268266_10310650 | 3300028379 | Bacteria | 1473 |
| 368 | Ga0268266_10485118 | 3300028379 | Bacteria | 1178 |
| 369 | Ga0268266_10697362 | 3300028379 | Bacteria | 978 |
| 370 | Ga0268265_10073490 | 3300028380 | Bacteria | 2670 |
| 371 | Ga0268265_10101910 | 3300028380 | Bacteria | 2320 |
| 372 | Ga0268265_10237965 | 3300028380 | Bacteria | 1604 |
| 373 | Ga0268264_10164336 | 3300028381 | Bacteria | 2003 |
| 374 | Ga0268264_10220978 | 3300028381 | Bacteria | 1744 |
| 375 | Ga0268264_10310943 | 3300028381 | Bacteria | 1487 |
| 376 | Ga0265337_1018390 | 3300028556 | Bacteria | 2220 |
| 377 | Ga0265326_10013135 | 3300028558 | Bacteria | 2425 |
| 378 | Ga0265319_1007233 | 3300028563 | Bacteria | 5021 |
| 379 | Ga0265334_10013991 | 3300028573 | Bacteria | 3350 |
| 380 | Ga0265318_10008392 | 3300028577 | Bacteria | 4602 |
| 381 | Ga0265323_10003132 | 3300028653 | Bacteria | 7366 |
| 382 | Ga0265322_10037677 | 3300028654 | Bacteria | 1377 |
| 383 | Ga0265336_10008427 | 3300028666 | Bacteria | 3616 |
| 384 | Ga0307515_10346388 | 3300028794 | Bacteria | 1135 |
| 385 | Ga0265338_10000085 | 3300028800 | Bacteria | 175080 |
| 386 | Ga0265324_10002725 | 3300029957 | Bacteria | 8787 |
| 387 | Ga0307512_10169494 | 3300030522 | Bacteria | 1256 |
| 388 | Ga0265325_10188201 | 3300031241 | Bacteria | 958 |
| 389 | Ga0265340_10006832 | 3300031247 | Bacteria | 6242 |
| 390 | Ga0265316_10123104 | 3300031344 | Bacteria | 1958 |
| 391 | Ga0307508_10329432 | 3300031616 | Bacteria | 1119 |
| 392 | Ga0265314_10001137 | 3300031711 | Bacteria | 30830 |
| 393 | Ga0265314_10062403 | 3300031711 | Bacteria | 2533 |
| 394 | Ga0265342_10019909 | 3300031712 | Bacteria | 4316 |
| 395 | Ga0307516_10012892 | 3300031730 | Bacteria | 8969 |
| 396 | Ga0307516_10094494 | 3300031730 | Bacteria | 2814 |
| 397 | Ga0307516_10535447 | 3300031730 | Bacteria | 825 |
| 398 | Ga0307410_10151151 | 3300031852 | Bacteria | 1729 |
| 399 | Ga0307407_10125692 | 3300031903 | Bacteria | 1633 |
| 400 | Ga0307416_100168152 | 3300032002 | Bacteria | 2037 |
| 401 | Ga0307416_101011765 | 3300032002 | Bacteria | 934 |
| 402 | Ga0307411_10066426 | 3300032005 | Bacteria | 2423 |
| 403 | Ga0307415_100041713 | 3300032126 | Bacteria | 3049 |
| 404 | Ga0307510_10021805 | 3300033180 | Bacteria | 7456 |
| 405 | Ga0307510_10117916 | 3300033180 | Bacteria | 2370 |
| 406 | Ga0307510_10147452 | 3300033180 | Bacteria | 1981 |
| 407 | Ga0315911_1000003 | 3300033442 | Bacteria | 502217 |
| 408 | Ga0373958_0015050 | 3300034819 | Bacteria | 1361 |
| 409 | Ga0373934_0064680 | 3300035086 | Bacteria | 1460 |
| 410 | Ga0373940_0034282 | 3300035088 | Bacteria | 1369 |
| 411 | Ga0373944_0112876 | 3300035089 | Bacteria | 930 |
| 412 | Ga0373923_0001291 | 3300035111 | Bacteria | 7073 |
| 413 | Ga0373936_0007502 | 3300035113 | Bacteria | 4102 |
| 414 | Ga0373939_0024329 | 3300035114 | Bacteria | 1686 |
| 415 | Ga0373945_0030875 | 3300035116 | Bacteria | 1890 |
| 416 | Ga0373953_0013574 | 3300035117 | Bacteria | 2912 |
| 417 | Ga0373953_0057691 | 3300035117 | Bacteria | 1581 |
| 418 | Ga0373954_0002129 | 3300035118 | Bacteria | 8219 |
| 419 | Ga0373954_0003928 | 3300035118 | Bacteria | 6359 |
| 420 | Ga0373954_0221369 | 3300035118 | Bacteria | 931 |
| 421 | Ga0373956_0006821 | 3300035119 | Bacteria | 4582 |
| 422 | Ga0373957_0000776 | 3300035120 | Bacteria | 8304 |
| 423 | Ga0373943_0038735 | 3300035170 | Bacteria | 2293 |
| 424 | Ga0373946_0039677 | 3300035171 | Bacteria | 1923 |
| 425 | Ga0373955_0207529 | 3300035172 | Bacteria | 1167 |
| 426 | Ga0373955_0223305 | 3300035172 | Bacteria | 1125 |
| 427 | Ga0373924_0012971 | 3300035410 | Bacteria | 3124 |
| 428 | Ga0373931_0071809 | 3300035691 | Bacteria | 1892 |
| 429 | Ga0373935_0009132 | 3300035692 | Bacteria | 5933 |
| 430 | Ga0373927_0003904 | 3300035695 | Bacteria | 10572 |
| 431 | Ga0373927_0005891 | 3300035695 | Bacteria | 8398 |
| 432 | Ga0373927_0337731 | 3300035695 | Bacteria | 992 |
| 433 | Ga0373933_0036847 | 3300035724 | Bacteria | 2865 |
| 434 | Ga0373933_0125738 | 3300035724 | Bacteria | 1608 |
| 435 | Ga0373933_0373979 | 3300035724 | Bacteria | 927 |
| 436 | Ga0373933_0517703 | 3300035724 | Bacteria | 782 |
| 437 | Ga0373947_0002662 | 3300035725 | Bacteria | 10733 |
| 438 | Ga0373947_0012031 | 3300035725 | Bacteria | 4956 |
| 439 | Ga0373947_0024847 | 3300035725 | Bacteria | 3494 |
| 440 | Ga0373937_0026247 | 3300036401 | Bacteria | 5264 |
| 441 | Ga0373937_0033338 | 3300036401 | Bacteria | 4675 |
| 442 | Ga0373937_0088548 | 3300036401 | Bacteria | 2866 |
| 443 | Ga0373937_0204994 | 3300036401 | Bacteria | 1854 |
| 444 | Ga0373937_0222106 | 3300036401 | Bacteria | 1778 |
| 445 | Ga0373925_0046932 | 3300037068 | Bacteria | 3213 |
| 446 | Ga0373925_0050812 | 3300037068 | Bacteria | 3093 |
| 447 | Ga0373925_0085564 | 3300037068 | Bacteria | 2404 |
| 448 | Ga0373925_0127608 | 3300037068 | Bacteria | 1980 |
| 449 | Ga0395899_0018519 | 3300037312 | Bacteria | 5292 |
| 450 | Ga0395900_0029686 | 3300037418 | Bacteria | 5610 |
| 451 | Ga0395900_0097884 | 3300037418 | Bacteria | 3014 |
| 452 | Ga0395900_0215213 | 3300037418 | Bacteria | 1939 |
| 453 | Ga0395898_0074232 | 3300037466 | Bacteria | 3285 |
| 454 | Ga0395898_0196349 | 3300037466 | Bacteria | 1927 |
| 455 | Ga0395905_0194484 | 3300037471 | Bacteria | 1902 |
| 456 | Ga0395905_0360972 | 3300037471 | Bacteria | 1345 |
| 457 | Ga0395905_0858470 | 3300037471 | Bacteria | 811 |
| 458 | Ga0395901_0004721 | 3300038443 | Bacteria | 13758 |
| 459 | Ga0395901_0350496 | 3300038443 | Bacteria | 1523 |
| 460 | Ga0395901_0369462 | 3300038443 | Bacteria | 1478 |
| 461 | Ga0395901_0526610 | 3300038443 | Bacteria | 1200 |
| 462 | Ga0439465_0018383 | 3300041413 | Bacteria | 2184 |
| 463 | Ga0466966_0021986 | 3300044684 | Bacteria | 4188 |
| 464 | Ga0466964_0082603 | 3300044706 | Bacteria | 1382 |
| 465 | Ga0466959_0122644 | 3300045049 | Bacteria | 1846 |
| 466 | Ga0495592_0006971 | 3300046454 | Bacteria | 8443 |
| 467 | Ga0495592_0028514 | 3300046454 | Bacteria | 4228 |
| 468 | Ga0495592_0075564 | 3300046454 | Bacteria | 2446 |
| 469 | Ga0495603_0004320 | 3300046455 | Bacteria | 8476 |
| 470 | Ga0495603_0011117 | 3300046455 | Bacteria | 5457 |
| 471 | Ga0495603_0031669 | 3300046455 | Bacteria | 3184 |
| 472 | Ga0495603_0071843 | 3300046455 | Bacteria | 2033 |
| 473 | Ga0495603_0364964 | 3300046455 | Bacteria | 828 |
| 474 | Ga0495590_0041600 | 3300046457 | Bacteria | 1602 |
| 475 | Ga0495629_0000439 | 3300046459 | Bacteria | 34692 |
| 476 | Ga0495629_0008693 | 3300046459 | Bacteria | 7475 |
| 477 | Ga0495629_0054073 | 3300046459 | Bacteria | 2808 |
| 478 | Ga0495629_0078244 | 3300046459 | Bacteria | 2309 |
| 479 | Ga0495629_0593104 | 3300046459 | Bacteria | 741 |
| 480 | Ga0495638_0222951 | 3300046460 | Bacteria | 1053 |
| 481 | Ga0495641_0013355 | 3300046461 | Bacteria | 4520 |
| 482 | Ga0495651_0023056 | 3300046462 | Bacteria | 4841 |
| 483 | Ga0495651_0080808 | 3300046462 | Bacteria | 2454 |
| 484 | Ga0495651_0115383 | 3300046462 | Bacteria | 1980 |
| 485 | Ga0495653_0023097 | 3300046463 | Bacteria | 5029 |
| 486 | Ga0495650_0029475 | 3300046471 | Bacteria | 2501 |
| 487 | Ga0495580_0010913 | 3300046472 | Bacteria | 7047 |
| 488 | Ga0495580_0085278 | 3300046472 | Bacteria | 2200 |
| 489 | Ga0495582_0007979 | 3300046473 | Bacteria | 5847 |
| 490 | Ga0495582_0055447 | 3300046473 | Bacteria | 2185 |
| 491 | Ga0495605_0119773 | 3300046474 | Bacteria | 1194 |
| 492 | Ga0495639_0005290 | 3300046475 | Bacteria | 5553 |
| 493 | Ga0495639_0143968 | 3300046475 | Bacteria | 1147 |
| 494 | Ga0495639_0171284 | 3300046475 | Bacteria | 1054 |
| 495 | Ga0495662_0002831 | 3300046476 | Bacteria | 8772 |
| 496 | Ga0495664_0050963 | 3300046477 | Bacteria | 2458 |
| 497 | Ga0495584_0048919 | 3300046491 | Bacteria | 2131 |
| 498 | Ga0495584_0098845 | 3300046491 | Bacteria | 1474 |
| 499 | Ga0495585_0195391 | 3300046492 | Bacteria | 1033 |
| 500 | Ga0495594_0004642 | 3300046499 | Bacteria | 7076 |
| 501 | Ga0495594_0156363 | 3300046499 | Bacteria | 1295 |
| 502 | Ga0495596_0022258 | 3300046500 | Bacteria | 2581 |
| 503 | Ga0495607_0201323 | 3300046501 | Bacteria | 985 |
| 504 | Ga0495606_0002132 | 3300046507 | Bacteria | 23896 |
| 505 | Ga0495606_0307896 | 3300046507 | Bacteria | 856 |
| 506 | Ga0495608_0005431 | 3300046511 | Bacteria | 9112 |
| 507 | Ga0495608_0017029 | 3300046511 | Bacteria | 5028 |
| 508 | Ga0495616_0099681 | 3300046513 | Bacteria | 1364 |
| 509 | Ga0495618_0005075 | 3300046514 | Bacteria | 8041 |
| 510 | Ga0495618_0007998 | 3300046514 | Bacteria | 6401 |
| 511 | Ga0495618_0024391 | 3300046514 | Bacteria | 3745 |
| 512 | Ga0495628_0013324 | 3300046516 | Bacteria | 6918 |
| 513 | Ga0495628_0091840 | 3300046516 | Bacteria | 2349 |
| 514 | Ga0495630_0080229 | 3300046517 | Bacteria | 2461 |
| 515 | Ga0495631_0055557 | 3300046518 | Bacteria | 1725 |
| 516 | Ga0495632_0079237 | 3300046519 | Bacteria | 1568 |
| 517 | Ga0495644_0093169 | 3300046523 | Bacteria | 1138 |
| 518 | Ga0495642_0144998 | 3300046528 | Bacteria | 1026 |
| 519 | Ga0495652_0036615 | 3300046529 | Bacteria | 4263 |
| 520 | Ga0495652_0140961 | 3300046529 | Bacteria | 1896 |
| 521 | Ga0495652_0399026 | 3300046529 | Bacteria | 974 |
| 522 | Ga0495665_0005469 | 3300046531 | Bacteria | 6842 |
| 523 | Ga0495640_0013286 | 3300046533 | Bacteria | 6261 |
| 524 | Ga0495640_0095621 | 3300046533 | Bacteria | 1955 |
| 525 | Ga0495640_0323080 | 3300046533 | Bacteria | 955 |
| 526 | Ga0495586_0025634 | 3300046535 | Bacteria | 3155 |
| 527 | Ga0495587_0032594 | 3300046536 | Bacteria | 3148 |
| 528 | Ga0495587_0065474 | 3300046536 | Bacteria | 2122 |
| 529 | Ga0495609_0100569 | 3300046538 | Bacteria | 1253 |
| 530 | Ga0495597_0070860 | 3300046542 | Bacteria | 1502 |
| 531 | Ga0495597_0091041 | 3300046542 | Bacteria | 1295 |
| 532 | Ga0495645_0016900 | 3300046543 | Bacteria | 5222 |
| 533 | Ga0495645_0092738 | 3300046543 | Bacteria | 2156 |
| 534 | Ga0495622_0040178 | 3300046557 | Bacteria | 2177 |
| 535 | Ga0495667_0005621 | 3300046559 | Bacteria | 8473 |
| 536 | Ga0495667_0022396 | 3300046559 | Bacteria | 4256 |
| 537 | Ga0495667_0042286 | 3300046559 | Bacteria | 3021 |
| 538 | Ga0495656_0106398 | 3300046615 | Bacteria | 1305 |
| 539 | Ga0495656_0152990 | 3300046615 | Bacteria | 1115 |
| 540 | Ga0495668_0275331 | 3300046616 | Bacteria | 922 |
| 541 | Ga0495668_0323232 | 3300046616 | Bacteria | 846 |
| 542 | Ga0495634_0003738 | 3300046642 | Bacteria | 12123 |
| 543 | Ga0495635_0016717 | 3300046663 | Bacteria | 5125 |
| 544 | Ga0495635_0066959 | 3300046663 | Bacteria | 2463 |
| 545 | Ga0495635_0149125 | 3300046663 | Bacteria | 1592 |
| 546 | Ga0495659_0087863 | 3300046664 | Bacteria | 1189 |
| 547 | Ga0495588_0074221 | 3300046674 | Bacteria | 1771 |
| 548 | Ga0495588_0210121 | 3300046674 | Bacteria | 1028 |
| 549 | Ga0495657_0010362 | 3300046675 | Bacteria | 7014 |
| 550 | Ga0495657_0252330 | 3300046675 | Bacteria | 1062 |
| 551 | Ga0495599_0001369 | 3300046678 | Bacteria | 13928 |
| 552 | Ga0495599_0010490 | 3300046678 | Bacteria | 5668 |
| 553 | Ga0495623_0048549 | 3300046679 | Bacteria | 2691 |
| 554 | Ga0495623_0063867 | 3300046679 | Bacteria | 2304 |
| 555 | Ga0495623_0111971 | 3300046679 | Bacteria | 1653 |
| 556 | Ga0495646_0037975 | 3300046680 | Bacteria | 2976 |
| 557 | Ga0495647_0021633 | 3300046681 | Bacteria | 2317 |
| 558 | Ga0495658_0003784 | 3300046683 | Bacteria | 7489 |
| 559 | Ga0495669_0007888 | 3300046684 | Bacteria | 4467 |
| 560 | Ga0495613_0007099 | 3300046689 | Bacteria | 8338 |
| 561 | Ga0495613_0187655 | 3300046689 | Bacteria | 1462 |
| 562 | Ga0495624_0026173 | 3300046690 | Bacteria | 3823 |
| 563 | Ga0495589_0136476 | 3300046794 | Bacteria | 1176 |
| 564 | Ga0495600_0001020 | 3300046809 | Bacteria | 15122 |
| 565 | Ga0495600_0012902 | 3300046809 | Bacteria | 5236 |
| 566 | Ga0495660_0178800 | 3300046810 | Bacteria | 1028 |
| 567 | Ga0495581_0021836 | 3300047315 | Bacteria | 3709 |
| 568 | Ga0495581_0040392 | 3300047315 | Bacteria | 2700 |
| 569 | Ga0495581_0079411 | 3300047315 | Bacteria | 1899 |
| 570 | Ga0495674_0000458 | 3300047319 | Bacteria | 36828 |
| 571 | Ga0495674_0046443 | 3300047319 | Bacteria | 3854 |
| 572 | Ga0495672_0011321 | 3300047320 | Bacteria | 6304 |
| 573 | Ga0495676_0052694 | 3300047321 | Bacteria | 3246 |
| 574 | Ga0495676_0060342 | 3300047321 | Bacteria | 2973 |
| 575 | Ga0495680_0006528 | 3300047322 | Bacteria | 10827 |
| 576 | Ga0495680_0064893 | 3300047322 | Bacteria | 2798 |
| 577 | Ga0495683_0044221 | 3300047323 | Bacteria | 2240 |
| 578 | Ga0495675_0000923 | 3300047444 | Bacteria | 17856 |
| 579 | Ga0495675_0206652 | 3300047444 | Bacteria | 1193 |
| 580 | Ga0495677_0129656 | 3300047445 | Bacteria | 965 |
| 581 | Ga0495673_0048090 | 3300047469 | Bacteria | 1882 |
| 582 | Ga0495684_0000340 | 3300047471 | Bacteria | 37592 |
| 583 | Ga0495684_0008134 | 3300047471 | Bacteria | 8111 |
| 584 | Ga0495684_0028828 | 3300047471 | Bacteria | 4262 |
| 585 | Ga0495686_0152280 | 3300047472 | Bacteria | 1357 |
| 586 | Ga0495686_0164948 | 3300047472 | Bacteria | 1292 |
| 587 | Ga0495593_0000687 | 3300047673 | Bacteria | 19500 |
| 588 | Ga0495593_0006332 | 3300047673 | Bacteria | 6945 |
| 589 | Ga0495602_0137058 | 3300048088 | Bacteria | 1943 |
| 590 | Ga0495602_0185065 | 3300048088 | Bacteria | 1602 |
| 591 | Ga0495602_0433537 | 3300048088 | Bacteria | 931 |
| 592 | Ga0495615_0119467 | 3300048090 | Bacteria | 761 |
| 593 | Ga0496100_0003120 | 3300048903 | Bacteria | 8577 |
| 594 | Ga0496100_0048593 | 3300048903 | Bacteria | 2739 |
| 595 | Ga0496100_0132686 | 3300048903 | Bacteria | 1756 |
| 596 | Ga0496101_0122156 | 3300048904 | Bacteria | 1970 |
| 597 | Ga0496101_0486088 | 3300048904 | Bacteria | 975 |
| 598 | Ga0496102_0002648 | 3300048905 | Bacteria | 15215 |
| 599 | Ga0496102_0136319 | 3300048905 | Bacteria | 2300 |
| 600 | Ga0496103_0017806 | 3300048906 | Bacteria | 4256 |
| 601 | Ga0496104_0007648 | 3300048907 | Bacteria | 9566 |
| 602 | Ga0496104_0105435 | 3300048907 | Bacteria | 2701 |
| 603 | Ga0496104_0335683 | 3300048907 | Bacteria | 1424 |
| 604 | Ga0496105_0042398 | 3300048908 | Bacteria | 3751 |
| 605 | Ga0496105_0147641 | 3300048908 | Bacteria | 1933 |
| 606 | Ga0496105_0231595 | 3300048908 | Bacteria | 1501 |
| 607 | Ga0496106_0015920 | 3300048909 | Bacteria | 5562 |
| 608 | Ga0496106_0122350 | 3300048909 | Bacteria | 2035 |
| 609 | Ga0496106_0155540 | 3300048909 | Bacteria | 1805 |
| 610 | Ga0496106_0259516 | 3300048909 | Bacteria | 1390 |
| 611 | Ga0496106_0346539 | 3300048909 | Bacteria | 1193 |
| 612 | Ga0496106_0349577 | 3300048909 | Bacteria | 1187 |
| 613 | Ga0496107_0004783 | 3300048910 | Bacteria | 9200 |
| 614 | Ga0496107_0004967 | 3300048910 | Bacteria | 9052 |
| 615 | Ga0496107_0230110 | 3300048910 | Bacteria | 1379 |
| 616 | Ga0496108_0000938 | 3300048911 | Bacteria | 22748 |
| 617 | Ga0496108_0016559 | 3300048911 | Bacteria | 6018 |
| 618 | Ga0496108_0653925 | 3300048911 | Bacteria | 913 |
| 619 | Ga0496109_0001723 | 3300048912 | Bacteria | 18237 |
| 620 | Ga0496109_0008707 | 3300048912 | Bacteria | 8639 |
| 621 | Ga0496109_0198825 | 3300048912 | Bacteria | 1884 |
| 622 | Ga0496109_0207737 | 3300048912 | Bacteria | 1841 |
| 623 | Ga0496109_0348248 | 3300048912 | Bacteria | 1399 |
| 624 | Ga0496110_0003174 | 3300048913 | Bacteria | 12507 |
| 625 | Ga0496110_0101921 | 3300048913 | Bacteria | 2574 |
| 626 | Ga0496110_0148931 | 3300048913 | Bacteria | 2118 |
| 627 | Ga0496110_0178575 | 3300048913 | Bacteria | 1927 |
| 628 | Ga0496111_0047665 | 3300048914 | Bacteria | 3086 |
| 629 | Ga0496111_0072809 | 3300048914 | Bacteria | 2501 |
| 630 | Ga0496111_0120465 | 3300048914 | Bacteria | 1938 |
| 631 | Ga0496111_0230872 | 3300048914 | Bacteria | 1374 |
| 632 | Ga0496112_0000014 | 3300048915 | Bacteria | 210932 |
| 633 | Ga0496112_0000590 | 3300048915 | Bacteria | 24921 |
| 634 | Ga0496112_0045788 | 3300048915 | Bacteria | 4288 |
| 635 | Ga0496112_0066467 | 3300048915 | Bacteria | 3557 |
| 636 | Ga0496112_0096875 | 3300048915 | Bacteria | 2920 |
| 637 | Ga0496112_0260750 | 3300048915 | Bacteria | 1682 |
| 638 | Ga0496112_0292386 | 3300048915 | Bacteria | 1575 |
| 639 | Ga0496113_0001909 | 3300048916 | Bacteria | 11903 |
| 640 | Ga0496113_0106631 | 3300048916 | Bacteria | 2176 |
| 641 | Ga0496113_0332810 | 3300048916 | Bacteria | 1218 |
| 642 | Ga0496113_0336513 | 3300048916 | Bacteria | 1210 |
| 643 | Ga0496113_0571363 | 3300048916 | Bacteria | 906 |
| 644 | Ga0496115_0005155 | 3300048918 | Bacteria | 9509 |
| 645 | Ga0496115_0105098 | 3300048918 | Bacteria | 2317 |
| 646 | Ga0496115_0480644 | 3300048918 | Bacteria | 1000 |
| 647 | Ga0496115_0604639 | 3300048918 | Bacteria | 871 |
| 648 | Ga0496116_0001982 | 3300048919 | Bacteria | 22049 |
| 649 | Ga0496117_0021414 | 3300048920 | Bacteria | 5230 |
| 650 | Ga0496118_0039825 | 3300048921 | Bacteria | 3744 |
| 651 | Ga0496118_0105489 | 3300048921 | Bacteria | 1889 |
| 652 | Ga0496119_0167995 | 3300048922 | Bacteria | 1161 |
| 653 | Ga0496119_0224518 | 3300048922 | Bacteria | 959 |
| 654 | Ga0496121_0000379 | 3300048924 | Bacteria | 91131 |
| 655 | Ga0496121_0007216 | 3300048924 | Bacteria | 13458 |
| 656 | Ga0496121_0009899 | 3300048924 | Bacteria | 10855 |
| 657 | Ga0496121_0031316 | 3300048924 | Bacteria | 4861 |
| 658 | Ga0496121_0134182 | 3300048924 | Bacteria | 1847 |
| 659 | Ga0496121_0142705 | 3300048924 | Bacteria | 1774 |
| 660 | Ga0496121_0202708 | 3300048924 | Bacteria | 1413 |
| 661 | Ga0496121_0411611 | 3300048924 | Bacteria | 882 |
| 662 | Ga0496122_0095791 | 3300048925 | Bacteria | 2004 |
| 663 | Ga0496124_0139987 | 3300048927 | Bacteria | 1911 |
| 664 | Ga0496124_0274664 | 3300048927 | Bacteria | 1232 |
| 665 | Ga0496124_0320749 | 3300048927 | Bacteria | 1109 |
| 666 | Ga0496125_0000199 | 3300048928 | Bacteria | 126676 |
| 667 | Ga0496125_0000964 | 3300048928 | Bacteria | 45175 |
| 668 | Ga0496125_0036169 | 3300048928 | Bacteria | 4316 |
| 669 | Ga0496125_0213882 | 3300048928 | Bacteria | 1249 |
| 670 | Ga0496126_0003657 | 3300048929 | Bacteria | 19210 |
| 671 | Ga0496126_0009808 | 3300048929 | Bacteria | 10138 |
| 672 | Ga0496126_0011726 | 3300048929 | Bacteria | 9031 |
| 673 | Ga0496126_0027947 | 3300048929 | Bacteria | 5379 |
| 674 | Ga0496126_0064385 | 3300048929 | Bacteria | 3284 |
| 675 | Ga0496126_0102702 | 3300048929 | Bacteria | 2499 |
| 676 | Ga0496126_0157970 | 3300048929 | Bacteria | 1939 |
| 677 | Ga0496126_0172815 | 3300048929 | Bacteria | 1840 |
| 678 | Ga0495678_084732 | 3300049459 | Bacteria | 1130 |
| 679 | Ga0501031_0000712 | 3300049568 | Bacteria | 19893 |
| 680 | Ga0501031_0007196 | 3300049568 | Bacteria | 7260 |
| 681 | Ga0501032_0001162 | 3300049569 | Bacteria | 21118 |
| 682 | Ga0501032_0012997 | 3300049569 | Bacteria | 5929 |
| 683 | Ga0501032_0205935 | 3300049569 | Bacteria | 1283 |
| 684 | Ga0501032_0317195 | 3300049569 | Bacteria | 1006 |
| 685 | Ga0501033_0000163 | 3300049570 | Bacteria | 63913 |
| 686 | Ga0501033_0003345 | 3300049570 | Bacteria | 13239 |
| 687 | Ga0501033_0017017 | 3300049570 | Bacteria | 5495 |
| 688 | Ga0501033_0028416 | 3300049570 | Bacteria | 4201 |
| 689 | Ga0501033_0178507 | 3300049570 | Bacteria | 1523 |
| 690 | Ga0501034_0000202 | 3300049571 | Bacteria | 112985 |
| 691 | Ga0501034_0703859 | 3300049571 | Bacteria | 908 |
| 692 | Ga0501036_0000021 | 3300049572 | Bacteria | 114136 |
| 693 | Ga0501037_0001561 | 3300049573 | Bacteria | 16713 |
| 694 | Ga0501037_0002687 | 3300049573 | Bacteria | 12835 |
| 695 | Ga0501037_0077304 | 3300049573 | Bacteria | 2415 |
| 696 | Ga0501038_0000226 | 3300049574 | Bacteria | 47831 |
| 697 | Ga0501038_0008947 | 3300049574 | Bacteria | 9185 |
| 698 | Ga0501038_0201201 | 3300049574 | Bacteria | 1598 |
| 699 | Ga0501038_0227075 | 3300049574 | Bacteria | 1487 |
| 700 | Ga0501039_0001542 | 3300049575 | Bacteria | 16931 |
| 701 | Ga0501039_0091639 | 3300049575 | Bacteria | 2369 |
| 702 | Ga0501039_0662939 | 3300049575 | Bacteria | 817 |
| 703 | Ga0501042_0073795 | 3300049578 | Bacteria | 2440 |
| 704 | Ga0501042_0219802 | 3300049578 | Bacteria | 1370 |
| 705 | Ga0501043_0000297 | 3300049579 | Bacteria | 44905 |
| 706 | Ga0501043_0054128 | 3300049579 | Bacteria | 3151 |
| 707 | Ga0501043_0216935 | 3300049579 | Bacteria | 1481 |
| 708 | Ga0501046_0000354 | 3300049580 | Bacteria | 46165 |
| 709 | Ga0501046_0004244 | 3300049580 | Bacteria | 13045 |
| 710 | Ga0501046_0123794 | 3300049580 | Bacteria | 1966 |
| 711 | Ga0501047_0000232 | 3300049581 | Bacteria | 66245 |
| 712 | Ga0501047_0042605 | 3300049581 | Bacteria | 4386 |
| 713 | Ga0501047_0076009 | 3300049581 | Bacteria | 3232 |
| 714 | Ga0501047_0293276 | 3300049581 | Bacteria | 1470 |
| 715 | Ga0501047_0486757 | 3300049581 | Bacteria | 1061 |
| 716 | Ga0501047_0608237 | 3300049581 | Bacteria | 914 |
| 717 | Ga0501048_0000050 | 3300049582 | Bacteria | 57921 |
| 718 | Ga0501048_0148342 | 3300049582 | Bacteria | 1659 |
| 719 | Ga0501067_0001956 | 3300049583 | Bacteria | 11350 |
| 720 | Ga0501068_0005647 | 3300049584 | Bacteria | 6852 |
| 721 | Ga0501069_0013995 | 3300049585 | Bacteria | 4285 |
| 722 | Ga0501070_0012142 | 3300049586 | Bacteria | 7269 |
| 723 | Ga0501070_0252540 | 3300049586 | Bacteria | 1442 |
| 724 | Ga0501071_0071472 | 3300049587 | Bacteria | 2530 |
| 725 | Ga0501072_0002675 | 3300049588 | Bacteria | 13364 |
| 726 | Ga0501073_0000329 | 3300049589 | Bacteria | 31824 |
| 727 | Ga0501073_0099433 | 3300049589 | Bacteria | 2020 |
| 728 | Ga0501074_0000092 | 3300049590 | Bacteria | 43073 |
| 729 | Ga0501076_0262901 | 3300049592 | Bacteria | 1413 |
| 730 | Ga0501079_0026857 | 3300049741 | Bacteria | 4414 |
| 731 | Ga0501079_0812739 | 3300049741 | Bacteria | 736 |
| 732 | Ga0501080_0003432 | 3300049742 | Bacteria | 13983 |
| 733 | Ga0501083_0107217 | 3300049744 | Bacteria | 1838 |
| 734 | Ga0501035_0000120 | 3300049822 | Bacteria | 94532 |
| 735 | Ga0501035_0034371 | 3300049822 | Bacteria | 4606 |
| 736 | Ga0501035_0155462 | 3300049822 | Bacteria | 1982 |
| 737 | Ga0501035_0155631 | 3300049822 | Bacteria | 1981 |
| 738 | Ga0501044_0000179 | 3300049823 | Bacteria | 78633 |
| 739 | Ga0501044_0006711 | 3300049823 | Bacteria | 12684 |
| 740 | Ga0501044_0181637 | 3300049823 | Bacteria | 2070 |
| 741 | Ga0501044_0181763 | 3300049823 | Bacteria | 2069 |
| 742 | Ga0501044_0271612 | 3300049823 | Bacteria | 1631 |
| 743 | Ga0501044_0408919 | 3300049823 | Bacteria | 1268 |
| 744 | Ga0501044_0556973 | 3300049823 | Bacteria | 1043 |
| 745 | Ga0501044_0653889 | 3300049823 | Bacteria | 940 |
| 746 | Ga0501045_0009859 | 3300049824 | Bacteria | 6681 |
| 747 | nmdc:mga03683_34785_c1 | 3300050489 | Bacteria | 1225 |
| 748 | nmdc:mga03683_96169_c1 | 3300050489 | Bacteria | 1297 |
| 749 | nmdc:mga03n38_230662_c1 | 3300050490 | Bacteria | 970 |
| 750 | nmdc:mga03n38_5857_c1 | 3300050490 | Bacteria | 4224 |
| 751 | nmdc:mga03n38_72170_c1 | 3300050490 | Bacteria | 1600 |
| 752 | nmdc:mga00v17_190560_c1 | 3300050491 | Bacteria | 1324 |
| 753 | nmdc:mga00v17_42278_c1 | 3300050491 | Bacteria | 2740 |
| 754 | nmdc:mga0yw44_126007_c1 | 3300050492 | Bacteria | 1654 |
| 755 | nmdc:mga0yw44_295905_c1 | 3300050492 | Bacteria | 1084 |
| 756 | nmdc:mga0k408_444887_c1 | 3300050493 | Bacteria | 770 |
| 757 | nmdc:mga06z11_167171_c1 | 3300050494 | Bacteria | 1261 |
| 758 | nmdc:mga06z11_26303_c1 | 3300050494 | Bacteria | 2768 |
| 759 | nmdc:mga04h51_58700_c1 | 3300050495 | Bacteria | 1313 |
| 760 | nmdc:mga04h51_60168_c1 | 3300050495 | Bacteria | 1300 |
| 761 | nmdc:mga07m45_51114_c1 | 3300050496 | Bacteria | 2330 |
| 762 | nmdc:mga07m45_71267_c1 | 3300050496 | Bacteria | 1977 |
| 763 | nmdc:mga09592_440437_c1 | 3300050508 | Bacteria | 1124 |
| 764 | nmdc:mga08y16_490201_c1 | 3300050511 | Bacteria | 1250 |
| 765 | nmdc:mga0rr50_385367_c1 | 3300050513 | Bacteria | 1182 |
| 766 | nmdc:mga0rr50_654979_c1 | 3300050513 | Bacteria | 896 |
| 767 | nmdc:mga0sz30_5222_c1 | 3300050516 | Bacteria | 4752 |
| 768 | Ga0495601_0028806 | 3300053077 | Bacteria | 3441 |
| 769 | Ga0495612_0072948 | 3300053078 | Bacteria | 1434 |
| 770 | Ga0500635_0000667 | 3300053080 | Bacteria | 8700 |
| 771 | Ga0495619_0006768 | 3300053085 | Bacteria | 7250 |
| 772 | Ga0495619_0064113 | 3300053085 | Bacteria | 2449 |
| 773 | Ga0500583_0022152 | 3300053092 | Bacteria | 2657 |
| 774 | Ga0500651_0162632 | 3300053093 | Bacteria | 1334 |
| 775 | Ga0500566_0018229 | 3300053094 | Bacteria | 4124 |
| 776 | Ga0500566_0145806 | 3300053094 | Bacteria | 1251 |
| 777 | Ga0500641_0027059 | 3300053096 | Bacteria | 2231 |
| 778 | Ga0500554_002502 | 3300053102 | Bacteria | 3626 |
| 779 | Ga0500554_007950 | 3300053102 | Bacteria | 2466 |
| 780 | Ga0500556_0000003 | 3300053104 | Bacteria | 679379 |
| 781 | Ga0500556_0063239 | 3300053104 | Bacteria | 1368 |
| 782 | Ga0500595_000414 | 3300053119 | Bacteria | 27179 |
| 783 | Ga0500618_028139 | 3300053125 | Bacteria | 1333 |
| 784 | Ga0500642_0072461 | 3300053130 | Bacteria | 1570 |
| 785 | Ga0500568_0007066 | 3300053139 | Bacteria | 5548 |
| 786 | Ga0500577_0058518 | 3300053142 | Bacteria | 1474 |
| 787 | Ga0500588_0121232 | 3300053146 | Bacteria | 923 |
| 788 | Ga0500589_044338 | 3300053147 | Bacteria | 2073 |
| 789 | Ga0500590_098273 | 3300053148 | Bacteria | 1410 |
| 790 | Ga0500603_000634 | 3300053150 | Bacteria | 8611 |
| 791 | Ga0500616_0000028 | 3300053153 | Bacteria | 435722 |
| 792 | Ga0500638_006577 | 3300053162 | Bacteria | 4772 |
| 793 | Ga0500637_0001208 | 3300053178 | Bacteria | 10778 |
| 794 | Ga0500567_131420 | 3300053723 | Bacteria | 978 |
| 795 | Ga0500611_023524 | 3300053727 | Bacteria | 1201 |
| 796 | Ga0500645_028254 | 3300053730 | Bacteria | 1698 |
| 797 | Ga0501084_0136077 | 3300054114 | Bacteria | 2068 |
| 798 | Ga0500661_000369 | 3300055283 | Bacteria | 8304 |
| 799 | Ga0501082_0011284 | 3300060353 | Bacteria | 7680 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050489 | nmdc:mga03683_34785_c1 | nmdc:mga03683_34785_c1_19_693 | 203 |
| 2 | 3300050513 | nmdc:mga0rr50_654979_c1 | nmdc:mga0rr50_654979_c1_224_886 | 203 |
| 3 | 3300028577 | Ga0265318_10008392 | Ga0265318_100083925 | 207 |
| 4 | 3300037471 | Ga0395905_0858470 | Ga0395905_0858470_112_786 | 207 |
| 5 | 3300046459 | Ga0495629_0593104 | Ga0495629_0593104_13_687 | 207 |
| 6 | 3300046474 | Ga0495605_0119773 | Ga0495605_0119773_22_693 | 207 |
| 7 | 3300048090 | Ga0495615_0119467 | Ga0495615_0119467_11_685 | 207 |
| 8 | 3300049575 | Ga0501039_0662939 | Ga0501039_0662939_130_801 | 207 |
| 9 | 3300049741 | Ga0501079_0812739 | Ga0501079_0812739_10_681 | 207 |
| 10 | 3300048915 | Ga0496112_0260750 | Ga0496112_0260750_951_1670 | 222 |
| 11 | 3300035118 | Ga0373954_0221369 | Ga0373954_0221369_193_912 | 223 |
| 12 | 3300035724 | Ga0373933_0517703 | Ga0373933_0517703_29_748 | 223 |
| 13 | 3300046616 | Ga0495668_0323232 | Ga0495668_0323232_86_808 | 223 |
| 14 | 3300050493 | nmdc:mga0k408_444887_c1 | nmdc:mga0k408_444887_c1_17_739 | 223 |
| 15 | iso_pu_bacteria | 2904699407 | 2904700548 | 227 |
| 16 | 3300005327 | Ga0070658_10017379 | Ga0070658_100173791 | 231 |
| 17 | 3300005435 | Ga0070714_100087813 | Ga0070714_1000878132 | 231 |
| 18 | 3300005981 | Ga0081538_10009846 | Ga0081538_100098463 | 231 |
| 19 | 3300025929 | Ga0207664_10114239 | Ga0207664_101142392 | 231 |
| 20 | 3300025986 | Ga0207658_10584041 | Ga0207658_105840412 | 231 |
| 21 | 3300046455 | Ga0495603_0364964 | Ga0495603_0364964_68_814 | 231 |
| 22 | 3300046471 | Ga0495650_0029475 | Ga0495650_0029475_1707_2468 | 231 |
| 23 | 3300048907 | Ga0496104_0335683 | Ga0496104_0335683_13_759 | 231 |
| 24 | iso_pu_bacteria | 2643221651 | 2644289336 | 231 |
| 25 | 3300005366 | Ga0070659_100358299 | Ga0070659_1003582992 | 232 |
| 26 | 3300005548 | Ga0070665_100279343 | Ga0070665_1002793432 | 232 |
| 27 | 3300005937 | Ga0081455_10005785 | Ga0081455_100057857 | 232 |
| 28 | 3300005983 | Ga0081540_1011669 | Ga0081540_10116695 | 232 |
| 29 | 3300006177 | Ga0075362_10017480 | Ga0075362_100174802 | 232 |
| 30 | 3300025932 | Ga0207690_10404702 | Ga0207690_104047022 | 232 |
| 31 | 3300032002 | Ga0307416_100168152 | Ga0307416_1001681522 | 232 |
| 32 | 3300037418 | Ga0395900_0029686 | Ga0395900_0029686_4681_5427 | 232 |
| 33 | 3300037466 | Ga0395898_0074232 | Ga0395898_0074232_2312_3058 | 232 |
| 34 | 3300038443 | Ga0395901_0004721 | Ga0395901_0004721_1787_2533 | 232 |
| 35 | 3300003659 | JGI25404J52841_10007849 | JGI25404J52841_100078493 | 233 |
| 36 | 3300005937 | Ga0081455_10006447 | Ga0081455_100064476 | 233 |
| 37 | 3300005983 | Ga0081540_1002041 | Ga0081540_10020415 | 233 |
| 38 | 3300005985 | Ga0081539_10091602 | Ga0081539_100916022 | 233 |
| 39 | 3300009147 | Ga0114129_11312661 | Ga0114129_113126611 | 233 |
| 40 | 3300046529 | Ga0495652_0140961 | Ga0495652_0140961_157_918 | 233 |
| 41 | 3300050513 | nmdc:mga0rr50_385367_c1 | nmdc:mga0rr50_385367_c1_91_903 | 233 |
| 42 | iso_pu_bacteria | 2513237096 | 2513657286 | 233 |
| 43 | iso_pu_bacteria | 2513237104 | 2513722085 | 233 |
| 44 | iso_pu_bacteria | 2513237137 | 2513857757 | 233 |
| 45 | iso_pu_bacteria | 2513237145 | 2513919294 | 233 |
| 46 | iso_pu_bacteria | 2517572143 | 2517891014 | 233 |
| 47 | iso_pu_bacteria | 2524023210 | 2524464984 | 233 |
| 48 | iso_pu_bacteria | 2524023228 | 2524537541 | 233 |
| 49 | iso_pu_bacteria | 2602042107 | 2603860390 | 233 |
| 50 | iso_pu_bacteria | 2667528175 | 2671120069 | 233 |
| 51 | iso_pu_bacteria | 2728368998 | 2728752661 | 233 |
| 52 | iso_pu_bacteria | 2791355197 | 2793066370 | 233 |
| 53 | iso_pu_bacteria | 2885374607 | 2885377335 | 233 |
| 54 | iso_pu_bacteria | 2885383462 | 2885390517 | 233 |
| 55 | iso_pu_bacteria | 2889033259 | 2889037640 | 233 |
| 56 | iso_pu_bacteria | 2904690495 | 2904694460 | 233 |
| 57 | iso_pu_bacteria | 2906610324 | 2906616213 | 233 |
| 58 | iso_pu_bacteria | 2906635258 | 2906636956 | 233 |
| 59 | iso_pu_bacteria | 2906660503 | 2906664450 | 233 |
| 60 | iso_pu_bacteria | 2908756301 | 2908763404 | 233 |
| 61 | iso_pu_bacteria | 2922425934 | 2922431811 | 233 |
| 62 | iso_pu_bacteria | 2935630451 | 2935635347 | 233 |
| 63 | iso_pu_bacteria | 2941507105 | 2941512151 | 233 |
| 64 | iso_pu_bacteria | 2941515067 | 2941519853 | 233 |
| 65 | iso_pu_bacteria | 2941523033 | 2941527860 | 233 |
| 66 | iso_pu_bacteria | 3005474847 | 3005481752 | 233 |
| 67 | iso_pu_bacteria | 8006933436 | 8006939118 | 233 |
| 68 | iso_pu_bacteria | 8006973647 | 8006978775 | 233 |
| 69 | iso_pu_bacteria | 8006984368 | 8006985030 | 233 |
| 70 | iso_pu_bacteria | 8019555841 | 8019559928 | 233 |
| 71 | iso_pu_bacteria | 8019565922 | 8019570031 | 233 |
| 72 | iso_pu_bacteria | 8056681323 | 8056687847 | 233 |
| 73 | iso_pu_bacteria | 8056689827 | 8056690509 | 233 |
| 74 | 3300005455 | Ga0070663_100031126 | Ga0070663_1000311262 | 234 |
| 75 | 3300005563 | Ga0068855_100857449 | Ga0068855_1008574491 | 234 |
| 76 | 3300025909 | Ga0207705_10394159 | Ga0207705_103941591 | 234 |
| 77 | 3300025949 | Ga0207667_10419859 | Ga0207667_104198592 | 234 |
| 78 | 3300026067 | Ga0207678_10044166 | Ga0207678_100441662 | 234 |
| 79 | 3300044684 | Ga0466966_0021986 | Ga0466966_0021986_2779_3540 | 234 |
| 80 | 3300049581 | Ga0501047_0293276 | Ga0501047_0293276_50_811 | 234 |
| 81 | 3300005435 | Ga0070714_100245164 | Ga0070714_1002451642 | 235 |
| 82 | 3300006353 | Ga0075370_10192265 | Ga0075370_101922651 | 235 |
| 83 | 3300006941 | Ga0099825_1034330 | Ga0099825_10343302 | 235 |
| 84 | 3300006942 | Ga0099824_1022834 | Ga0099824_10228343 | 235 |
| 85 | 3300006943 | Ga0099822_1000663 | Ga0099822_100066325 | 235 |
| 86 | 3300025929 | Ga0207664_10471245 | Ga0207664_104712451 | 235 |
| 87 | 3300026089 | Ga0207648_10562863 | Ga0207648_105628631 | 235 |
| 88 | 3300027357 | Ga0209589_1000006 | Ga0209589_1000006128 | 235 |
| 89 | 3300027361 | Ga0209489_100007 | Ga0209489_100007128 | 235 |
| 90 | 3300027363 | Ga0209700_100008 | Ga0209700_100008128 | 235 |
| 91 | 3300035170 | Ga0373943_0038735 | Ga0373943_0038735_412_1167 | 235 |
| 92 | 3300035725 | Ga0373947_0024847 | Ga0373947_0024847_2590_3345 | 235 |
| 93 | 3300037068 | Ga0373925_0046932 | Ga0373925_0046932_78_833 | 235 |
| 94 | 3300037068 | Ga0373925_0127608 | Ga0373925_0127608_121_876 | 235 |
| 95 | 3300046475 | Ga0495639_0143968 | Ga0495639_0143968_80_835 | 235 |
| 96 | 3300047315 | Ga0495581_0040392 | Ga0495581_0040392_518_1273 | 235 |
| 97 | 3300048904 | Ga0496101_0486088 | Ga0496101_0486088_203_958 | 235 |
| 98 | 3300049581 | Ga0501047_0042605 | Ga0501047_0042605_1040_1798 | 235 |
| 99 | 3300049581 | Ga0501047_0608237 | Ga0501047_0608237_38_796 | 235 |
| 100 | 3300049823 | Ga0501044_0271612 | Ga0501044_0271612_537_1295 | 235 |
| 101 | 3300049823 | Ga0501044_0653889 | Ga0501044_0653889_34_792 | 235 |
| 102 | iso_pu_bacteria | 8006926726 | 8006933299 | 235 |
| 103 | 3300005327 | Ga0070658_10217213 | Ga0070658_102172132 | 236 |
| 104 | 3300005327 | Ga0070658_10357162 | Ga0070658_103571622 | 236 |
| 105 | 3300005327 | Ga0070658_10618823 | Ga0070658_106188231 | 236 |
| 106 | 3300005334 | Ga0068869_100293012 | Ga0068869_1002930122 | 236 |
| 107 | 3300005338 | Ga0068868_100070712 | Ga0068868_1000707122 | 236 |
| 108 | 3300005355 | Ga0070671_100281335 | Ga0070671_1002813351 | 236 |
| 109 | 3300005364 | Ga0070673_100443489 | Ga0070673_1004434891 | 236 |
| 110 | 3300005455 | Ga0070663_100024100 | Ga0070663_1000241002 | 236 |
| 111 | 3300005535 | Ga0070684_100182790 | Ga0070684_1001827902 | 236 |
| 112 | 3300005539 | Ga0068853_100136181 | Ga0068853_1001361812 | 236 |
| 113 | 3300005548 | Ga0070665_100259734 | Ga0070665_1002597342 | 236 |
| 114 | 3300005548 | Ga0070665_100373579 | Ga0070665_1003735792 | 236 |
| 115 | 3300005564 | Ga0070664_100226606 | Ga0070664_1002266062 | 236 |
| 116 | 3300005616 | Ga0068852_100038624 | Ga0068852_1000386242 | 236 |
| 117 | 3300005618 | Ga0068864_100186578 | Ga0068864_1001865782 | 236 |
| 118 | 3300005834 | Ga0068851_10022662 | Ga0068851_100226623 | 236 |
| 119 | 3300005983 | Ga0081540_1025347 | Ga0081540_10253472 | 236 |
| 120 | 3300010375 | Ga0105239_10241825 | Ga0105239_102418252 | 236 |
| 121 | 3300013296 | Ga0157374_10021557 | Ga0157374_100215574 | 236 |
| 122 | 3300013306 | Ga0163162_10055264 | Ga0163162_100552642 | 236 |
| 123 | 3300013308 | Ga0157375_10107155 | Ga0157375_101071552 | 236 |
| 124 | 3300014325 | Ga0163163_10047687 | Ga0163163_100476873 | 236 |
| 125 | 3300014969 | Ga0157376_10135631 | Ga0157376_101356312 | 236 |
| 126 | 3300025261 | Ga0209233_1001048 | Ga0209233_10010484 | 236 |
| 127 | 3300025272 | Ga0209455_1008722 | Ga0209455_10087222 | 236 |
| 128 | 3300025321 | Ga0207656_10051332 | Ga0207656_100513322 | 236 |
| 129 | 3300025909 | Ga0207705_10332892 | Ga0207705_103328922 | 236 |
| 130 | 3300025909 | Ga0207705_10705146 | Ga0207705_107051461 | 236 |
| 131 | 3300025931 | Ga0207644_10457323 | Ga0207644_104573231 | 236 |
| 132 | 3300025939 | Ga0207665_10372546 | Ga0207665_103725461 | 236 |
| 133 | 3300025941 | Ga0207711_10623100 | Ga0207711_106231001 | 236 |
| 134 | 3300025942 | Ga0207689_10120814 | Ga0207689_101208142 | 236 |
| 135 | 3300025945 | Ga0207679_10191197 | Ga0207679_101911972 | 236 |
| 136 | 3300026023 | Ga0207677_10007590 | Ga0207677_100075902 | 236 |
| 137 | 3300026041 | Ga0207639_10112553 | Ga0207639_101125532 | 236 |
| 138 | 3300026067 | Ga0207678_10008442 | Ga0207678_100084423 | 236 |
| 139 | 3300028379 | Ga0268266_10310650 | Ga0268266_103106502 | 236 |
| 140 | 3300028379 | Ga0268266_10697362 | Ga0268266_106973621 | 236 |
| 141 | 3300033180 | Ga0307510_10021805 | Ga0307510_100218052 | 236 |
| 142 | 3300037418 | Ga0395900_0215213 | Ga0395900_0215213_875_1636 | 236 |
| 143 | 3300044706 | Ga0466964_0082603 | Ga0466964_0082603_94_897 | 236 |
| 144 | 3300046473 | Ga0495582_0055447 | Ga0495582_0055447_1204_1962 | 236 |
| 145 | 3300047320 | Ga0495672_0011321 | Ga0495672_0011321_5105_5866 | 236 |
| 146 | 3300048903 | Ga0496100_0003120 | Ga0496100_0003120_7543_8304 | 236 |
| 147 | 3300048905 | Ga0496102_0002648 | Ga0496102_0002648_5321_6082 | 236 |
| 148 | 3300048906 | Ga0496103_0017806 | Ga0496103_0017806_1489_2250 | 236 |
| 149 | 3300048907 | Ga0496104_0007648 | Ga0496104_0007648_175_936 | 236 |
| 150 | 3300048908 | Ga0496105_0042398 | Ga0496105_0042398_22_783 | 236 |
| 151 | 3300048910 | Ga0496107_0004967 | Ga0496107_0004967_793_1599 | 236 |
| 152 | 3300048911 | Ga0496108_0016559 | Ga0496108_0016559_2552_3313 | 236 |
| 153 | 3300048912 | Ga0496109_0008707 | Ga0496109_0008707_4836_5597 | 236 |
| 154 | 3300048913 | Ga0496110_0003174 | Ga0496110_0003174_389_1150 | 236 |
| 155 | 3300048914 | Ga0496111_0047665 | Ga0496111_0047665_74_835 | 236 |
| 156 | 3300048916 | Ga0496113_0001909 | Ga0496113_0001909_9102_9863 | 236 |
| 157 | 3300048918 | Ga0496115_0005155 | Ga0496115_0005155_5158_5919 | 236 |
| 158 | 3300048924 | Ga0496121_0009899 | Ga0496121_0009899_3755_4516 | 236 |
| 159 | 3300048924 | Ga0496121_0031316 | Ga0496121_0031316_861_1622 | 236 |
| 160 | 3300049568 | Ga0501031_0007196 | Ga0501031_0007196_2175_2933 | 236 |
| 161 | 3300049569 | Ga0501032_0012997 | Ga0501032_0012997_2435_3193 | 236 |
| 162 | 3300049570 | Ga0501033_0003345 | Ga0501033_0003345_10101_10859 | 236 |
| 163 | 3300049573 | Ga0501037_0002687 | Ga0501037_0002687_2946_3704 | 236 |
| 164 | 3300049574 | Ga0501038_0008947 | Ga0501038_0008947_1141_1899 | 236 |
| 165 | 3300049574 | Ga0501038_0227075 | Ga0501038_0227075_85_843 | 236 |
| 166 | 3300049578 | Ga0501042_0073795 | Ga0501042_0073795_1046_1804 | 236 |
| 167 | 3300049579 | Ga0501043_0054128 | Ga0501043_0054128_212_970 | 236 |
| 168 | 3300049580 | Ga0501046_0004244 | Ga0501046_0004244_2154_2912 | 236 |
| 169 | 3300049581 | Ga0501047_0486757 | Ga0501047_0486757_135_893 | 236 |
| 170 | 3300049582 | Ga0501048_0148342 | Ga0501048_0148342_112_870 | 236 |
| 171 | 3300049589 | Ga0501073_0099433 | Ga0501073_0099433_146_904 | 236 |
| 172 | 3300049822 | Ga0501035_0034371 | Ga0501035_0034371_1566_2324 | 236 |
| 173 | 3300049823 | Ga0501044_0006711 | Ga0501044_0006711_2167_2925 | 236 |
| 174 | 3300053080 | Ga0500635_0000667 | Ga0500635_0000667_461_1219 | 236 |
| 175 | 3300053102 | Ga0500554_007950 | Ga0500554_007950_489_1247 | 236 |
| 176 | 3300053150 | Ga0500603_000634 | Ga0500603_000634_5342_6100 | 236 |
| 177 | 3300053153 | Ga0500616_0000028 | Ga0500616_0000028_225080_225841 | 236 |
| 178 | 3300053178 | Ga0500637_0001208 | Ga0500637_0001208_4755_5513 | 236 |
| 179 | 3300003203 | JGI25406J46586_10000018 | JGI25406J46586_1000001826 | 237 |
| 180 | 3300003203 | JGI25406J46586_10006262 | JGI25406J46586_100062621 | 237 |
| 181 | 3300003215 | JGI25153J46596_10027455 | JGI25153J46596_100274552 | 237 |
| 182 | 3300003659 | JGI25404J52841_10024308 | JGI25404J52841_100243082 | 237 |
| 183 | 3300005327 | Ga0070658_10017070 | Ga0070658_100170702 | 237 |
| 184 | 3300005329 | Ga0070683_100067142 | Ga0070683_1000671422 | 237 |
| 185 | 3300005331 | Ga0070670_100368057 | Ga0070670_1003680572 | 237 |
| 186 | 3300005334 | Ga0068869_100037113 | Ga0068869_1000371132 | 237 |
| 187 | 3300005336 | Ga0070680_100037799 | Ga0070680_1000377991 | 237 |
| 188 | 3300005338 | Ga0068868_100103472 | Ga0068868_1001034722 | 237 |
| 189 | 3300005338 | Ga0068868_100588298 | Ga0068868_1005882981 | 237 |
| 190 | 3300005339 | Ga0070660_100014841 | Ga0070660_1000148413 | 237 |
| 191 | 3300005339 | Ga0070660_100204725 | Ga0070660_1002047252 | 237 |
| 192 | 3300005340 | Ga0070689_100219851 | Ga0070689_1002198511 | 237 |
| 193 | 3300005343 | Ga0070687_100287400 | Ga0070687_1002874001 | 237 |
| 194 | 3300005344 | Ga0070661_100018037 | Ga0070661_1000180373 | 237 |
| 195 | 3300005344 | Ga0070661_100051288 | Ga0070661_1000512882 | 237 |
| 196 | 3300005347 | Ga0070668_100023719 | Ga0070668_1000237195 | 237 |
| 197 | 3300005347 | Ga0070668_100040432 | Ga0070668_1000404322 | 237 |
| 198 | 3300005347 | Ga0070668_100086528 | Ga0070668_1000865282 | 237 |
| 199 | 3300005347 | Ga0070668_100207763 | Ga0070668_1002077632 | 237 |
| 200 | 3300005347 | Ga0070668_100370502 | Ga0070668_1003705021 | 237 |
| 201 | 3300005347 | Ga0070668_100569766 | Ga0070668_1005697661 | 237 |
| 202 | 3300005353 | Ga0070669_100296940 | Ga0070669_1002969402 | 237 |
| 203 | 3300005355 | Ga0070671_100347479 | Ga0070671_1003474791 | 237 |
| 204 | 3300005356 | Ga0070674_100100743 | Ga0070674_1001007432 | 237 |
| 205 | 3300005356 | Ga0070674_100142856 | Ga0070674_1001428562 | 237 |
| 206 | 3300005366 | Ga0070659_100121888 | Ga0070659_1001218882 | 237 |
| 207 | 3300005367 | Ga0070667_100110095 | Ga0070667_1001100951 | 237 |
| 208 | 3300005367 | Ga0070667_100739120 | Ga0070667_1007391201 | 237 |
| 209 | 3300005434 | Ga0070709_10251069 | Ga0070709_102510692 | 237 |
| 210 | 3300005434 | Ga0070709_10397920 | Ga0070709_103979201 | 237 |
| 211 | 3300005436 | Ga0070713_100002525 | Ga0070713_1000025257 | 237 |
| 212 | 3300005436 | Ga0070713_100085245 | Ga0070713_1000852452 | 237 |
| 213 | 3300005437 | Ga0070710_10032264 | Ga0070710_100322643 | 237 |
| 214 | 3300005439 | Ga0070711_100004216 | Ga0070711_1000042166 | 237 |
| 215 | 3300005439 | Ga0070711_100019917 | Ga0070711_1000199174 | 237 |
| 216 | 3300005441 | Ga0070700_100303946 | Ga0070700_1003039461 | 237 |
| 217 | 3300005445 | Ga0070708_100108425 | Ga0070708_1001084252 | 237 |
| 218 | 3300005455 | Ga0070663_100003295 | Ga0070663_1000032953 | 237 |
| 219 | 3300005455 | Ga0070663_100301555 | Ga0070663_1003015552 | 237 |
| 220 | 3300005455 | Ga0070663_100345819 | Ga0070663_1003458191 | 237 |
| 221 | 3300005456 | Ga0070678_100450127 | Ga0070678_1004501271 | 237 |
| 222 | 3300005457 | Ga0070662_100065103 | Ga0070662_1000651032 | 237 |
| 223 | 3300005457 | Ga0070662_100276008 | Ga0070662_1002760081 | 237 |
| 224 | 3300005458 | Ga0070681_10016550 | Ga0070681_100165502 | 237 |
| 225 | 3300005459 | Ga0068867_100017580 | Ga0068867_1000175803 | 237 |
| 226 | 3300005466 | Ga0070685_10064189 | Ga0070685_100641892 | 237 |
| 227 | 3300005467 | Ga0070706_100170997 | Ga0070706_1001709972 | 237 |
| 228 | 3300005471 | Ga0070698_100216772 | Ga0070698_1002167721 | 237 |
| 229 | 3300005471 | Ga0070698_100549134 | Ga0070698_1005491341 | 237 |
| 230 | 3300005530 | Ga0070679_100448710 | Ga0070679_1004487101 | 237 |
| 231 | 3300005535 | Ga0070684_100025358 | Ga0070684_1000253585 | 237 |
| 232 | 3300005539 | Ga0068853_100069858 | Ga0068853_1000698581 | 237 |
| 233 | 3300005539 | Ga0068853_100089099 | Ga0068853_1000890993 | 237 |
| 234 | 3300005539 | Ga0068853_100164629 | Ga0068853_1001646292 | 237 |
| 235 | 3300005539 | Ga0068853_100626591 | Ga0068853_1006265912 | 237 |
| 236 | 3300005543 | Ga0070672_100269483 | Ga0070672_1002694831 | 237 |
| 237 | 3300005548 | Ga0070665_100027974 | Ga0070665_1000279745 | 237 |
| 238 | 3300005548 | Ga0070665_100112185 | Ga0070665_1001121852 | 237 |
| 239 | 3300005548 | Ga0070665_100173609 | Ga0070665_1001736092 | 237 |
| 240 | 3300005548 | Ga0070665_100196467 | Ga0070665_1001964672 | 237 |
| 241 | 3300005548 | Ga0070665_100257171 | Ga0070665_1002571712 | 237 |
| 242 | 3300005563 | Ga0068855_100054258 | Ga0068855_1000542585 | 237 |
| 243 | 3300005563 | Ga0068855_100179453 | Ga0068855_1001794533 | 237 |
| 244 | 3300005563 | Ga0068855_100215760 | Ga0068855_1002157602 | 237 |
| 245 | 3300005563 | Ga0068855_100439184 | Ga0068855_1004391842 | 237 |
| 246 | 3300005563 | Ga0068855_100574863 | Ga0068855_1005748632 | 237 |
| 247 | 3300005564 | Ga0070664_100053456 | Ga0070664_1000534563 | 237 |
| 248 | 3300005577 | Ga0068857_100042553 | Ga0068857_1000425533 | 237 |
| 249 | 3300005578 | Ga0068854_100094867 | Ga0068854_1000948672 | 237 |
| 250 | 3300005578 | Ga0068854_100216648 | Ga0068854_1002166482 | 237 |
| 251 | 3300005614 | Ga0068856_100000505 | Ga0068856_10000050539 | 237 |
| 252 | 3300005614 | Ga0068856_100141898 | Ga0068856_1001418982 | 237 |
| 253 | 3300005616 | Ga0068852_100014578 | Ga0068852_1000145784 | 237 |
| 254 | 3300005616 | Ga0068852_100097767 | Ga0068852_1000977672 | 237 |
| 255 | 3300005616 | Ga0068852_100108144 | Ga0068852_1001081442 | 237 |
| 256 | 3300005617 | Ga0068859_100639053 | Ga0068859_1006390532 | 237 |
| 257 | 3300005618 | Ga0068864_100221833 | Ga0068864_1002218332 | 237 |
| 258 | 3300005718 | Ga0068866_10106928 | Ga0068866_101069282 | 237 |
| 259 | 3300005718 | Ga0068866_10237679 | Ga0068866_102376792 | 237 |
| 260 | 3300005834 | Ga0068851_10048287 | Ga0068851_100482871 | 237 |
| 261 | 3300005841 | Ga0068863_100243328 | Ga0068863_1002433282 | 237 |
| 262 | 3300005843 | Ga0068860_100536596 | Ga0068860_1005365962 | 237 |
| 263 | 3300005843 | Ga0068860_100675583 | Ga0068860_1006755831 | 237 |
| 264 | 3300005844 | Ga0068862_100130594 | Ga0068862_1001305943 | 237 |
| 265 | 3300005844 | Ga0068862_100336754 | Ga0068862_1003367542 | 237 |
| 266 | 3300005844 | Ga0068862_100503870 | Ga0068862_1005038702 | 237 |
| 267 | 3300005937 | Ga0081455_10021510 | Ga0081455_100215105 | 237 |
| 268 | 3300005983 | Ga0081540_1007700 | Ga0081540_10077004 | 237 |
| 269 | 3300005983 | Ga0081540_1029018 | Ga0081540_10290182 | 237 |
| 270 | 3300005983 | Ga0081540_1035571 | Ga0081540_10355712 | 237 |
| 271 | 3300005985 | Ga0081539_10000003 | Ga0081539_10000003373 | 237 |
| 272 | 3300005985 | Ga0081539_10000199 | Ga0081539_1000019997 | 237 |
| 273 | 3300006038 | Ga0075365_10021053 | Ga0075365_100210533 | 237 |
| 274 | 3300006038 | Ga0075365_10054204 | Ga0075365_100542042 | 237 |
| 275 | 3300006038 | Ga0075365_10078490 | Ga0075365_100784902 | 237 |
| 276 | 3300006038 | Ga0075365_10295831 | Ga0075365_102958311 | 237 |
| 277 | 3300006038 | Ga0075365_10311402 | Ga0075365_103114022 | 237 |
| 278 | 3300006042 | Ga0075368_10004358 | Ga0075368_100043583 | 237 |
| 279 | 3300006042 | Ga0075368_10047370 | Ga0075368_100473702 | 237 |
| 280 | 3300006048 | Ga0075363_100106380 | Ga0075363_1001063801 | 237 |
| 281 | 3300006048 | Ga0075363_100225433 | Ga0075363_1002254331 | 237 |
| 282 | 3300006051 | Ga0075364_10061329 | Ga0075364_100613292 | 237 |
| 283 | 3300006051 | Ga0075364_10170166 | Ga0075364_101701662 | 237 |
| 284 | 3300006051 | Ga0075364_10219239 | Ga0075364_102192392 | 237 |
| 285 | 3300006058 | Ga0075432_10136169 | Ga0075432_101361691 | 237 |
| 286 | 3300006163 | Ga0070715_10000555 | Ga0070715_100005556 | 237 |
| 287 | 3300006173 | Ga0070716_100038543 | Ga0070716_1000385433 | 237 |
| 288 | 3300006177 | Ga0075362_10045598 | Ga0075362_100455982 | 237 |
| 289 | 3300006178 | Ga0075367_10004219 | Ga0075367_100042191 | 237 |
| 290 | 3300006178 | Ga0075367_10047496 | Ga0075367_100474963 | 237 |
| 291 | 3300006186 | Ga0075369_10024953 | Ga0075369_100249532 | 237 |
| 292 | 3300006186 | Ga0075369_10116774 | Ga0075369_101167742 | 237 |
| 293 | 3300006195 | Ga0075366_10091496 | Ga0075366_100914962 | 237 |
| 294 | 3300006237 | Ga0097621_100357786 | Ga0097621_1003577861 | 237 |
| 295 | 3300006353 | Ga0075370_10058517 | Ga0075370_100585172 | 237 |
| 296 | 3300006353 | Ga0075370_10062628 | Ga0075370_100626282 | 237 |
| 297 | 3300006353 | Ga0075370_10126688 | Ga0075370_101266881 | 237 |
| 298 | 3300006852 | Ga0075433_10586920 | Ga0075433_105869201 | 237 |
| 299 | 3300006871 | Ga0075434_100592606 | Ga0075434_1005926061 | 237 |
| 300 | 3300006931 | Ga0097620_100639044 | Ga0097620_1006390442 | 237 |
| 301 | 3300007788 | Ga0099795_10019849 | Ga0099795_100198492 | 237 |
| 302 | 3300007788 | Ga0099795_10046617 | Ga0099795_100466172 | 237 |
| 303 | 3300009093 | Ga0105240_10129364 | Ga0105240_101293642 | 237 |
| 304 | 3300009094 | Ga0111539_10027346 | Ga0111539_100273466 | 237 |
| 305 | 3300009098 | Ga0105245_10075160 | Ga0105245_100751602 | 237 |
| 306 | 3300009101 | Ga0105247_10077276 | Ga0105247_100772762 | 237 |
| 307 | 3300009101 | Ga0105247_10256397 | Ga0105247_102563972 | 237 |
| 308 | 3300009147 | Ga0114129_10664121 | Ga0114129_106641211 | 237 |
| 309 | 3300009177 | Ga0105248_10144570 | Ga0105248_101445702 | 237 |
| 310 | 3300009545 | Ga0105237_10025971 | Ga0105237_100259717 | 237 |
| 311 | 3300009545 | Ga0105237_10131327 | Ga0105237_101313272 | 237 |
| 312 | 3300009545 | Ga0105237_10480624 | Ga0105237_104806241 | 237 |
| 313 | 3300009551 | Ga0105238_10003279 | Ga0105238_100032797 | 237 |
| 314 | 3300010159 | Ga0099796_10031490 | Ga0099796_100314901 | 237 |
| 315 | 3300010375 | Ga0105239_10075790 | Ga0105239_100757901 | 237 |
| 316 | 3300010375 | Ga0105239_10335478 | Ga0105239_103354782 | 237 |
| 317 | 3300013102 | Ga0157371_10089823 | Ga0157371_100898232 | 237 |
| 318 | 3300013104 | Ga0157370_10021342 | Ga0157370_100213422 | 237 |
| 319 | 3300013104 | Ga0157370_10195664 | Ga0157370_101956642 | 237 |
| 320 | 3300013105 | Ga0157369_10056614 | Ga0157369_100566142 | 237 |
| 321 | 3300013297 | Ga0157378_10762669 | Ga0157378_107626691 | 237 |
| 322 | 3300013306 | Ga0163162_10268443 | Ga0163162_102684432 | 237 |
| 323 | 3300013306 | Ga0163162_10274499 | Ga0163162_102744993 | 237 |
| 324 | 3300013307 | Ga0157372_11043322 | Ga0157372_110433221 | 237 |
| 325 | 3300013308 | Ga0157375_10077654 | Ga0157375_100776542 | 237 |
| 326 | 3300013308 | Ga0157375_10417386 | Ga0157375_104173861 | 237 |
| 327 | 3300014325 | Ga0163163_10314250 | Ga0163163_103142501 | 237 |
| 328 | 3300014325 | Ga0163163_10416578 | Ga0163163_104165782 | 237 |
| 329 | 3300014326 | Ga0157380_10323315 | Ga0157380_103233151 | 237 |
| 330 | 3300014745 | Ga0157377_10239970 | Ga0157377_102399701 | 237 |
| 331 | 3300017792 | Ga0163161_10255090 | Ga0163161_102550902 | 237 |
| 332 | 3300022730 | Ga0224570_103551 | Ga0224570_1035511 | 237 |
| 333 | 3300025261 | Ga0209233_1020170 | Ga0209233_10201702 | 237 |
| 334 | 3300025295 | Ga0209564_1009899 | Ga0209564_10098992 | 237 |
| 335 | 3300025297 | Ga0209758_1003178 | Ga0209758_100317814 | 237 |
| 336 | 3300025297 | Ga0209758_1010377 | Ga0209758_10103774 | 237 |
| 337 | 3300025315 | Ga0207697_10132444 | Ga0207697_101324442 | 237 |
| 338 | 3300025893 | Ga0207682_10130044 | Ga0207682_101300442 | 237 |
| 339 | 3300025898 | Ga0207692_10002181 | Ga0207692_100021818 | 237 |
| 340 | 3300025898 | Ga0207692_10010482 | Ga0207692_100104823 | 237 |
| 341 | 3300025899 | Ga0207642_10024567 | Ga0207642_100245672 | 237 |
| 342 | 3300025900 | Ga0207710_10218369 | Ga0207710_102183692 | 237 |
| 343 | 3300025901 | Ga0207688_10093219 | Ga0207688_100932192 | 237 |
| 344 | 3300025904 | Ga0207647_10129092 | Ga0207647_101290923 | 237 |
| 345 | 3300025905 | Ga0207685_10085178 | Ga0207685_100851781 | 237 |
| 346 | 3300025906 | Ga0207699_10039854 | Ga0207699_100398541 | 237 |
| 347 | 3300025906 | Ga0207699_10262741 | Ga0207699_102627411 | 237 |
| 348 | 3300025907 | Ga0207645_10193688 | Ga0207645_101936882 | 237 |
| 349 | 3300025908 | Ga0207643_10084112 | Ga0207643_100841121 | 237 |
| 350 | 3300025909 | Ga0207705_10093019 | Ga0207705_100930191 | 237 |
| 351 | 3300025909 | Ga0207705_10170500 | Ga0207705_101705002 | 237 |
| 352 | 3300025909 | Ga0207705_10494199 | Ga0207705_104941991 | 237 |
| 353 | 3300025910 | Ga0207684_10244007 | Ga0207684_102440071 | 237 |
| 354 | 3300025912 | Ga0207707_10007441 | Ga0207707_100074413 | 237 |
| 355 | 3300025913 | Ga0207695_10104168 | Ga0207695_101041682 | 237 |
| 356 | 3300025914 | Ga0207671_10070932 | Ga0207671_100709322 | 237 |
| 357 | 3300025914 | Ga0207671_10087436 | Ga0207671_100874362 | 237 |
| 358 | 3300025914 | Ga0207671_10138521 | Ga0207671_101385211 | 237 |
| 359 | 3300025915 | Ga0207693_10003158 | Ga0207693_100031584 | 237 |
| 360 | 3300025915 | Ga0207693_10344791 | Ga0207693_103447911 | 237 |
| 361 | 3300025916 | Ga0207663_10000261 | Ga0207663_100002612 | 237 |
| 362 | 3300025916 | Ga0207663_10564282 | Ga0207663_105642821 | 237 |
| 363 | 3300025917 | Ga0207660_10009640 | Ga0207660_100096403 | 237 |
| 364 | 3300025917 | Ga0207660_10510818 | Ga0207660_105108181 | 237 |
| 365 | 3300025918 | Ga0207662_10085072 | Ga0207662_100850722 | 237 |
| 366 | 3300025919 | Ga0207657_10002700 | Ga0207657_1000270017 | 237 |
| 367 | 3300025919 | Ga0207657_10134362 | Ga0207657_101343623 | 237 |
| 368 | 3300025921 | Ga0207652_10006338 | Ga0207652_100063387 | 237 |
| 369 | 3300025923 | Ga0207681_10413685 | Ga0207681_104136851 | 237 |
| 370 | 3300025924 | Ga0207694_10128279 | Ga0207694_101282791 | 237 |
| 371 | 3300025928 | Ga0207700_10138800 | Ga0207700_101388001 | 237 |
| 372 | 3300025928 | Ga0207700_10152357 | Ga0207700_101523572 | 237 |
| 373 | 3300025928 | Ga0207700_10198737 | Ga0207700_101987372 | 237 |
| 374 | 3300025929 | Ga0207664_10011105 | Ga0207664_100111054 | 237 |
| 375 | 3300025929 | Ga0207664_10392364 | Ga0207664_103923642 | 237 |
| 376 | 3300025932 | Ga0207690_10132261 | Ga0207690_101322612 | 237 |
| 377 | 3300025936 | Ga0207670_10061941 | Ga0207670_100619412 | 237 |
| 378 | 3300025937 | Ga0207669_10023409 | Ga0207669_100234092 | 237 |
| 379 | 3300025938 | Ga0207704_10227247 | Ga0207704_102272472 | 237 |
| 380 | 3300025939 | Ga0207665_10000280 | Ga0207665_100002805 | 237 |
| 381 | 3300025939 | Ga0207665_10019565 | Ga0207665_100195652 | 237 |
| 382 | 3300025940 | Ga0207691_10152893 | Ga0207691_101528931 | 237 |
| 383 | 3300025940 | Ga0207691_10382503 | Ga0207691_103825032 | 237 |
| 384 | 3300025941 | Ga0207711_10060989 | Ga0207711_100609892 | 237 |
| 385 | 3300025942 | Ga0207689_10008118 | Ga0207689_1000811812 | 237 |
| 386 | 3300025942 | Ga0207689_10310222 | Ga0207689_103102221 | 237 |
| 387 | 3300025945 | Ga0207679_10444490 | Ga0207679_104444901 | 237 |
| 388 | 3300025949 | Ga0207667_10046316 | Ga0207667_100463162 | 237 |
| 389 | 3300025949 | Ga0207667_10194168 | Ga0207667_101941682 | 237 |
| 390 | 3300025949 | Ga0207667_10546150 | Ga0207667_105461501 | 237 |
| 391 | 3300025960 | Ga0207651_10047369 | Ga0207651_100473691 | 237 |
| 392 | 3300025961 | Ga0207712_10080055 | Ga0207712_100800552 | 237 |
| 393 | 3300025972 | Ga0207668_10032604 | Ga0207668_100326042 | 237 |
| 394 | 3300025972 | Ga0207668_10059080 | Ga0207668_100590802 | 237 |
| 395 | 3300025972 | Ga0207668_10133716 | Ga0207668_101337161 | 237 |
| 396 | 3300025972 | Ga0207668_10183739 | Ga0207668_101837392 | 237 |
| 397 | 3300025972 | Ga0207668_10183980 | Ga0207668_101839802 | 237 |
| 398 | 3300025972 | Ga0207668_10244197 | Ga0207668_102441972 | 237 |
| 399 | 3300025981 | Ga0207640_10018694 | Ga0207640_100186942 | 237 |
| 400 | 3300025981 | Ga0207640_10157315 | Ga0207640_101573151 | 237 |
| 401 | 3300026023 | Ga0207677_10029943 | Ga0207677_100299433 | 237 |
| 402 | 3300026023 | Ga0207677_10316569 | Ga0207677_103165691 | 237 |
| 403 | 3300026041 | Ga0207639_10054692 | Ga0207639_100546923 | 237 |
| 404 | 3300026041 | Ga0207639_10076791 | Ga0207639_100767912 | 237 |
| 405 | 3300026041 | Ga0207639_10288240 | Ga0207639_102882402 | 237 |
| 406 | 3300026067 | Ga0207678_10015515 | Ga0207678_100155153 | 237 |
| 407 | 3300026067 | Ga0207678_10051796 | Ga0207678_100517963 | 237 |
| 408 | 3300026067 | Ga0207678_10062822 | Ga0207678_100628222 | 237 |
| 409 | 3300026067 | Ga0207678_10250929 | Ga0207678_102509291 | 237 |
| 410 | 3300026067 | Ga0207678_10370940 | Ga0207678_103709401 | 237 |
| 411 | 3300026078 | Ga0207702_10000127 | Ga0207702_1000012791 | 237 |
| 412 | 3300026078 | Ga0207702_10629084 | Ga0207702_106290841 | 237 |
| 413 | 3300026095 | Ga0207676_10148948 | Ga0207676_101489482 | 237 |
| 414 | 3300026116 | Ga0207674_10051454 | Ga0207674_100514542 | 237 |
| 415 | 3300026118 | Ga0207675_100096466 | Ga0207675_1000964662 | 237 |
| 416 | 3300026118 | Ga0207675_100434613 | Ga0207675_1004346132 | 237 |
| 417 | 3300026121 | Ga0207683_10071355 | Ga0207683_100713553 | 237 |
| 418 | 3300026121 | Ga0207683_10160750 | Ga0207683_101607501 | 237 |
| 419 | 3300026121 | Ga0207683_10442545 | Ga0207683_104425452 | 237 |
| 420 | 3300026121 | Ga0207683_10495240 | Ga0207683_104952401 | 237 |
| 421 | 3300026142 | Ga0207698_10079006 | Ga0207698_100790062 | 237 |
| 422 | 3300026142 | Ga0207698_10383197 | Ga0207698_103831971 | 237 |
| 423 | 3300027512 | Ga0209179_1003031 | Ga0209179_10030312 | 237 |
| 424 | 3300027671 | Ga0209588_1039153 | Ga0209588_10391531 | 237 |
| 425 | 3300027866 | Ga0209813_10051794 | Ga0209813_100517941 | 237 |
| 426 | 3300027907 | Ga0207428_10367565 | Ga0207428_103675651 | 237 |
| 427 | 3300028379 | Ga0268266_10012489 | Ga0268266_100124892 | 237 |
| 428 | 3300028379 | Ga0268266_10016053 | Ga0268266_100160534 | 237 |
| 429 | 3300028379 | Ga0268266_10124924 | Ga0268266_101249242 | 237 |
| 430 | 3300028379 | Ga0268266_10134892 | Ga0268266_101348922 | 237 |
| 431 | 3300028379 | Ga0268266_10485118 | Ga0268266_104851181 | 237 |
| 432 | 3300028380 | Ga0268265_10073490 | Ga0268265_100734902 | 237 |
| 433 | 3300028380 | Ga0268265_10101910 | Ga0268265_101019102 | 237 |
| 434 | 3300028380 | Ga0268265_10237965 | Ga0268265_102379652 | 237 |
| 435 | 3300028381 | Ga0268264_10164336 | Ga0268264_101643362 | 237 |
| 436 | 3300028381 | Ga0268264_10220978 | Ga0268264_102209782 | 237 |
| 437 | 3300028381 | Ga0268264_10310943 | Ga0268264_103109432 | 237 |
| 438 | 3300028556 | Ga0265337_1018390 | Ga0265337_10183901 | 237 |
| 439 | 3300028558 | Ga0265326_10013135 | Ga0265326_100131352 | 237 |
| 440 | 3300028563 | Ga0265319_1007233 | Ga0265319_10072337 | 237 |
| 441 | 3300028573 | Ga0265334_10013991 | Ga0265334_100139912 | 237 |
| 442 | 3300028653 | Ga0265323_10003132 | Ga0265323_100031322 | 237 |
| 443 | 3300028654 | Ga0265322_10037677 | Ga0265322_100376773 | 237 |
| 444 | 3300028666 | Ga0265336_10008427 | Ga0265336_100084274 | 237 |
| 445 | 3300028794 | Ga0307515_10346388 | Ga0307515_103463882 | 237 |
| 446 | 3300028800 | Ga0265338_10000085 | Ga0265338_1000008511 | 237 |
| 447 | 3300029957 | Ga0265324_10002725 | Ga0265324_1000272512 | 237 |
| 448 | 3300030522 | Ga0307512_10169494 | Ga0307512_101694942 | 237 |
| 449 | 3300031241 | Ga0265325_10188201 | Ga0265325_101882012 | 237 |
| 450 | 3300031247 | Ga0265340_10006832 | Ga0265340_100068326 | 237 |
| 451 | 3300031344 | Ga0265316_10123104 | Ga0265316_101231042 | 237 |
| 452 | 3300031616 | Ga0307508_10329432 | Ga0307508_103294322 | 237 |
| 453 | 3300031711 | Ga0265314_10001137 | Ga0265314_1000113719 | 237 |
| 454 | 3300031711 | Ga0265314_10062403 | Ga0265314_100624031 | 237 |
| 455 | 3300031712 | Ga0265342_10019909 | Ga0265342_100199092 | 237 |
| 456 | 3300031730 | Ga0307516_10012892 | Ga0307516_100128922 | 237 |
| 457 | 3300031730 | Ga0307516_10094494 | Ga0307516_100944942 | 237 |
| 458 | 3300031730 | Ga0307516_10535447 | Ga0307516_105354471 | 237 |
| 459 | 3300031852 | Ga0307410_10151151 | Ga0307410_101511512 | 237 |
| 460 | 3300031903 | Ga0307407_10125692 | Ga0307407_101256922 | 237 |
| 461 | 3300032002 | Ga0307416_101011765 | Ga0307416_1010117651 | 237 |
| 462 | 3300032005 | Ga0307411_10066426 | Ga0307411_100664263 | 237 |
| 463 | 3300032126 | Ga0307415_100041713 | Ga0307415_1000417132 | 237 |
| 464 | 3300033180 | Ga0307510_10117916 | Ga0307510_101179162 | 237 |
| 465 | 3300033180 | Ga0307510_10147452 | Ga0307510_101474522 | 237 |
| 466 | 3300033442 | Ga0315911_1000003 | Ga0315911_1000003303 | 237 |
| 467 | 3300034819 | Ga0373958_0015050 | Ga0373958_0015050_316_1077 | 237 |
| 468 | 3300035086 | Ga0373934_0064680 | Ga0373934_0064680_223_984 | 237 |
| 469 | 3300035088 | Ga0373940_0034282 | Ga0373940_0034282_552_1313 | 237 |
| 470 | 3300035089 | Ga0373944_0112876 | Ga0373944_0112876_105_866 | 237 |
| 471 | 3300035111 | Ga0373923_0001291 | Ga0373923_0001291_1207_1968 | 237 |
| 472 | 3300035113 | Ga0373936_0007502 | Ga0373936_0007502_838_1614 | 237 |
| 473 | 3300035114 | Ga0373939_0024329 | Ga0373939_0024329_636_1397 | 237 |
| 474 | 3300035116 | Ga0373945_0030875 | Ga0373945_0030875_799_1575 | 237 |
| 475 | 3300035117 | Ga0373953_0013574 | Ga0373953_0013574_779_1540 | 237 |
| 476 | 3300035117 | Ga0373953_0057691 | Ga0373953_0057691_792_1553 | 237 |
| 477 | 3300035118 | Ga0373954_0002129 | Ga0373954_0002129_1140_1901 | 237 |
| 478 | 3300035118 | Ga0373954_0003928 | Ga0373954_0003928_1080_1841 | 237 |
| 479 | 3300035119 | Ga0373956_0006821 | Ga0373956_0006821_2779_3540 | 237 |
| 480 | 3300035120 | Ga0373957_0000776 | Ga0373957_0000776_5648_6409 | 237 |
| 481 | 3300035172 | Ga0373955_0207529 | Ga0373955_0207529_26_802 | 237 |
| 482 | 3300035172 | Ga0373955_0223305 | Ga0373955_0223305_92_853 | 237 |
| 483 | 3300035410 | Ga0373924_0012971 | Ga0373924_0012971_527_1303 | 237 |
| 484 | 3300035691 | Ga0373931_0071809 | Ga0373931_0071809_1067_1828 | 237 |
| 485 | 3300035692 | Ga0373935_0009132 | Ga0373935_0009132_548_1324 | 237 |
| 486 | 3300035695 | Ga0373927_0005891 | Ga0373927_0005891_1151_1927 | 237 |
| 487 | 3300035695 | Ga0373927_0337731 | Ga0373927_0337731_123_884 | 237 |
| 488 | 3300035724 | Ga0373933_0036847 | Ga0373933_0036847_223_984 | 237 |
| 489 | 3300035724 | Ga0373933_0125738 | Ga0373933_0125738_158_919 | 237 |
| 490 | 3300035724 | Ga0373933_0373979 | Ga0373933_0373979_96_857 | 237 |
| 491 | 3300035725 | Ga0373947_0012031 | Ga0373947_0012031_2888_3664 | 237 |
| 492 | 3300036401 | Ga0373937_0026247 | Ga0373937_0026247_3070_3846 | 237 |
| 493 | 3300036401 | Ga0373937_0033338 | Ga0373937_0033338_3249_4010 | 237 |
| 494 | 3300036401 | Ga0373937_0088548 | Ga0373937_0088548_1608_2369 | 237 |
| 495 | 3300036401 | Ga0373937_0204994 | Ga0373937_0204994_802_1563 | 237 |
| 496 | 3300036401 | Ga0373937_0222106 | Ga0373937_0222106_890_1651 | 237 |
| 497 | 3300037068 | Ga0373925_0050812 | Ga0373925_0050812_1171_1947 | 237 |
| 498 | 3300037068 | Ga0373925_0085564 | Ga0373925_0085564_1044_1805 | 237 |
| 499 | 3300037312 | Ga0395899_0018519 | Ga0395899_0018519_4271_5032 | 237 |
| 500 | 3300037418 | Ga0395900_0097884 | Ga0395900_0097884_1865_2626 | 237 |
| 501 | 3300037466 | Ga0395898_0196349 | Ga0395898_0196349_964_1725 | 237 |
| 502 | 3300037471 | Ga0395905_0194484 | Ga0395905_0194484_698_1459 | 237 |
| 503 | 3300037471 | Ga0395905_0360972 | Ga0395905_0360972_341_1147 | 237 |
| 504 | 3300038443 | Ga0395901_0350496 | Ga0395901_0350496_77_838 | 237 |
| 505 | 3300038443 | Ga0395901_0369462 | Ga0395901_0369462_291_1052 | 237 |
| 506 | 3300038443 | Ga0395901_0526610 | Ga0395901_0526610_51_812 | 237 |
| 507 | 3300041413 | Ga0439465_0018383 | Ga0439465_0018383_911_1717 | 237 |
| 508 | 3300045049 | Ga0466959_0122644 | Ga0466959_0122644_609_1370 | 237 |
| 509 | 3300046454 | Ga0495592_0006971 | Ga0495592_0006971_5608_6369 | 237 |
| 510 | 3300046454 | Ga0495592_0028514 | Ga0495592_0028514_2723_3484 | 237 |
| 511 | 3300046454 | Ga0495592_0075564 | Ga0495592_0075564_415_1191 | 237 |
| 512 | 3300046455 | Ga0495603_0004320 | Ga0495603_0004320_3394_4170 | 237 |
| 513 | 3300046455 | Ga0495603_0011117 | Ga0495603_0011117_3748_4509 | 237 |
| 514 | 3300046455 | Ga0495603_0031669 | Ga0495603_0031669_797_1561 | 237 |
| 515 | 3300046457 | Ga0495590_0041600 | Ga0495590_0041600_464_1225 | 237 |
| 516 | 3300046459 | Ga0495629_0000439 | Ga0495629_0000439_31831_32592 | 237 |
| 517 | 3300046459 | Ga0495629_0008693 | Ga0495629_0008693_3030_3806 | 237 |
| 518 | 3300046459 | Ga0495629_0054073 | Ga0495629_0054073_388_1149 | 237 |
| 519 | 3300046459 | Ga0495629_0078244 | Ga0495629_0078244_760_1581 | 237 |
| 520 | 3300046460 | Ga0495638_0222951 | Ga0495638_0222951_79_840 | 237 |
| 521 | 3300046461 | Ga0495641_0013355 | Ga0495641_0013355_1166_1942 | 237 |
| 522 | 3300046462 | Ga0495651_0023056 | Ga0495651_0023056_1929_2690 | 237 |
| 523 | 3300046462 | Ga0495651_0080808 | Ga0495651_0080808_1461_2222 | 237 |
| 524 | 3300046462 | Ga0495651_0115383 | Ga0495651_0115383_105_866 | 237 |
| 525 | 3300046463 | Ga0495653_0023097 | Ga0495653_0023097_960_1721 | 237 |
| 526 | 3300046472 | Ga0495580_0010913 | Ga0495580_0010913_2159_2935 | 237 |
| 527 | 3300046473 | Ga0495582_0007979 | Ga0495582_0007979_2493_3269 | 237 |
| 528 | 3300046475 | Ga0495639_0005290 | Ga0495639_0005290_3070_3846 | 237 |
| 529 | 3300046475 | Ga0495639_0171284 | Ga0495639_0171284_33_794 | 237 |
| 530 | 3300046476 | Ga0495662_0002831 | Ga0495662_0002831_4472_5248 | 237 |
| 531 | 3300046477 | Ga0495664_0050963 | Ga0495664_0050963_1415_2176 | 237 |
| 532 | 3300046491 | Ga0495584_0048919 | Ga0495584_0048919_127_888 | 237 |
| 533 | 3300046491 | Ga0495584_0098845 | Ga0495584_0098845_360_1181 | 237 |
| 534 | 3300046492 | Ga0495585_0195391 | Ga0495585_0195391_199_960 | 237 |
| 535 | 3300046499 | Ga0495594_0004642 | Ga0495594_0004642_5336_6112 | 237 |
| 536 | 3300046499 | Ga0495594_0156363 | Ga0495594_0156363_353_1114 | 237 |
| 537 | 3300046500 | Ga0495596_0022258 | Ga0495596_0022258_1069_1833 | 237 |
| 538 | 3300046501 | Ga0495607_0201323 | Ga0495607_0201323_168_932 | 237 |
| 539 | 3300046507 | Ga0495606_0002132 | Ga0495606_0002132_3104_3871 | 237 |
| 540 | 3300046511 | Ga0495608_0005431 | Ga0495608_0005431_2457_3218 | 237 |
| 541 | 3300046511 | Ga0495608_0017029 | Ga0495608_0017029_2197_2958 | 237 |
| 542 | 3300046513 | Ga0495616_0099681 | Ga0495616_0099681_109_870 | 237 |
| 543 | 3300046514 | Ga0495618_0005075 | Ga0495618_0005075_6171_6932 | 237 |
| 544 | 3300046514 | Ga0495618_0007998 | Ga0495618_0007998_832_1608 | 237 |
| 545 | 3300046514 | Ga0495618_0024391 | Ga0495618_0024391_2840_3601 | 237 |
| 546 | 3300046516 | Ga0495628_0013324 | Ga0495628_0013324_1629_2390 | 237 |
| 547 | 3300046516 | Ga0495628_0091840 | Ga0495628_0091840_1184_1945 | 237 |
| 548 | 3300046517 | Ga0495630_0080229 | Ga0495630_0080229_739_1515 | 237 |
| 549 | 3300046518 | Ga0495631_0055557 | Ga0495631_0055557_523_1284 | 237 |
| 550 | 3300046519 | Ga0495632_0079237 | Ga0495632_0079237_114_917 | 237 |
| 551 | 3300046523 | Ga0495644_0093169 | Ga0495644_0093169_172_936 | 237 |
| 552 | 3300046528 | Ga0495642_0144998 | Ga0495642_0144998_213_977 | 237 |
| 553 | 3300046529 | Ga0495652_0036615 | Ga0495652_0036615_1970_2731 | 237 |
| 554 | 3300046529 | Ga0495652_0399026 | Ga0495652_0399026_99_860 | 237 |
| 555 | 3300046531 | Ga0495665_0005469 | Ga0495665_0005469_1366_2142 | 237 |
| 556 | 3300046533 | Ga0495640_0013286 | Ga0495640_0013286_2260_3036 | 237 |
| 557 | 3300046533 | Ga0495640_0095621 | Ga0495640_0095621_1011_1772 | 237 |
| 558 | 3300046533 | Ga0495640_0323080 | Ga0495640_0323080_146_907 | 237 |
| 559 | 3300046535 | Ga0495586_0025634 | Ga0495586_0025634_666_1427 | 237 |
| 560 | 3300046536 | Ga0495587_0032594 | Ga0495587_0032594_1982_2743 | 237 |
| 561 | 3300046536 | Ga0495587_0065474 | Ga0495587_0065474_495_1256 | 237 |
| 562 | 3300046538 | Ga0495609_0100569 | Ga0495609_0100569_292_1053 | 237 |
| 563 | 3300046542 | Ga0495597_0070860 | Ga0495597_0070860_110_871 | 237 |
| 564 | 3300046542 | Ga0495597_0091041 | Ga0495597_0091041_436_1203 | 237 |
| 565 | 3300046543 | Ga0495645_0016900 | Ga0495645_0016900_1262_2023 | 237 |
| 566 | 3300046543 | Ga0495645_0092738 | Ga0495645_0092738_928_1689 | 237 |
| 567 | 3300046557 | Ga0495622_0040178 | Ga0495622_0040178_984_1760 | 237 |
| 568 | 3300046559 | Ga0495667_0005621 | Ga0495667_0005621_1728_2489 | 237 |
| 569 | 3300046559 | Ga0495667_0022396 | Ga0495667_0022396_2703_3479 | 237 |
| 570 | 3300046559 | Ga0495667_0042286 | Ga0495667_0042286_264_1025 | 237 |
| 571 | 3300046615 | Ga0495656_0106398 | Ga0495656_0106398_239_1042 | 237 |
| 572 | 3300046615 | Ga0495656_0152990 | Ga0495656_0152990_292_1056 | 237 |
| 573 | 3300046616 | Ga0495668_0275331 | Ga0495668_0275331_147_908 | 237 |
| 574 | 3300046642 | Ga0495634_0003738 | Ga0495634_0003738_3193_3969 | 237 |
| 575 | 3300046663 | Ga0495635_0016717 | Ga0495635_0016717_3091_3867 | 237 |
| 576 | 3300046663 | Ga0495635_0066959 | Ga0495635_0066959_960_1721 | 237 |
| 577 | 3300046663 | Ga0495635_0149125 | Ga0495635_0149125_152_973 | 237 |
| 578 | 3300046664 | Ga0495659_0087863 | Ga0495659_0087863_165_926 | 237 |
| 579 | 3300046674 | Ga0495588_0074221 | Ga0495588_0074221_992_1753 | 237 |
| 580 | 3300046674 | Ga0495588_0210121 | Ga0495588_0210121_245_1009 | 237 |
| 581 | 3300046675 | Ga0495657_0010362 | Ga0495657_0010362_2311_3072 | 237 |
| 582 | 3300046675 | Ga0495657_0252330 | Ga0495657_0252330_114_875 | 237 |
| 583 | 3300046678 | Ga0495599_0001369 | Ga0495599_0001369_2198_2959 | 237 |
| 584 | 3300046678 | Ga0495599_0010490 | Ga0495599_0010490_2376_3137 | 237 |
| 585 | 3300046679 | Ga0495623_0048549 | Ga0495623_0048549_942_1703 | 237 |
| 586 | 3300046679 | Ga0495623_0063867 | Ga0495623_0063867_561_1322 | 237 |
| 587 | 3300046679 | Ga0495623_0111971 | Ga0495623_0111971_195_956 | 237 |
| 588 | 3300046680 | Ga0495646_0037975 | Ga0495646_0037975_960_1721 | 237 |
| 589 | 3300046681 | Ga0495647_0021633 | Ga0495647_0021633_1280_2041 | 237 |
| 590 | 3300046683 | Ga0495658_0003784 | Ga0495658_0003784_3644_4420 | 237 |
| 591 | 3300046684 | Ga0495669_0007888 | Ga0495669_0007888_2773_3534 | 237 |
| 592 | 3300046689 | Ga0495613_0007099 | Ga0495613_0007099_3056_3832 | 237 |
| 593 | 3300046689 | Ga0495613_0187655 | Ga0495613_0187655_90_851 | 237 |
| 594 | 3300046690 | Ga0495624_0026173 | Ga0495624_0026173_145_921 | 237 |
| 595 | 3300046794 | Ga0495589_0136476 | Ga0495589_0136476_50_811 | 237 |
| 596 | 3300046809 | Ga0495600_0001020 | Ga0495600_0001020_8389_9150 | 237 |
| 597 | 3300046809 | Ga0495600_0012902 | Ga0495600_0012902_1451_2212 | 237 |
| 598 | 3300046810 | Ga0495660_0178800 | Ga0495660_0178800_89_850 | 237 |
| 599 | 3300047315 | Ga0495581_0021836 | Ga0495581_0021836_1111_1887 | 237 |
| 600 | 3300047315 | Ga0495581_0079411 | Ga0495581_0079411_234_995 | 237 |
| 601 | 3300047319 | Ga0495674_0000458 | Ga0495674_0000458_3360_4136 | 237 |
| 602 | 3300047319 | Ga0495674_0046443 | Ga0495674_0046443_1329_2090 | 237 |
| 603 | 3300047321 | Ga0495676_0052694 | Ga0495676_0052694_167_928 | 237 |
| 604 | 3300047321 | Ga0495676_0060342 | Ga0495676_0060342_61_837 | 237 |
| 605 | 3300047322 | Ga0495680_0006528 | Ga0495680_0006528_8304_9065 | 237 |
| 606 | 3300047322 | Ga0495680_0064893 | Ga0495680_0064893_198_959 | 237 |
| 607 | 3300047323 | Ga0495683_0044221 | Ga0495683_0044221_126_887 | 237 |
| 608 | 3300047444 | Ga0495675_0000923 | Ga0495675_0000923_14899_15660 | 237 |
| 609 | 3300047444 | Ga0495675_0206652 | Ga0495675_0206652_389_1150 | 237 |
| 610 | 3300047445 | Ga0495677_0129656 | Ga0495677_0129656_74_835 | 237 |
| 611 | 3300047469 | Ga0495673_0048090 | Ga0495673_0048090_230_991 | 237 |
| 612 | 3300047471 | Ga0495684_0000340 | Ga0495684_0000340_31585_32346 | 237 |
| 613 | 3300047471 | Ga0495684_0008134 | Ga0495684_0008134_6391_7152 | 237 |
| 614 | 3300047471 | Ga0495684_0028828 | Ga0495684_0028828_1062_1838 | 237 |
| 615 | 3300047472 | Ga0495686_0152280 | Ga0495686_0152280_281_1042 | 237 |
| 616 | 3300047472 | Ga0495686_0164948 | Ga0495686_0164948_514_1275 | 237 |
| 617 | 3300047673 | Ga0495593_0000687 | Ga0495593_0000687_11644_12405 | 237 |
| 618 | 3300047673 | Ga0495593_0006332 | Ga0495593_0006332_3070_3846 | 237 |
| 619 | 3300048088 | Ga0495602_0137058 | Ga0495602_0137058_834_1595 | 237 |
| 620 | 3300048088 | Ga0495602_0185065 | Ga0495602_0185065_694_1455 | 237 |
| 621 | 3300048088 | Ga0495602_0433537 | Ga0495602_0433537_13_774 | 237 |
| 622 | 3300048903 | Ga0496100_0048593 | Ga0496100_0048593_506_1267 | 237 |
| 623 | 3300048903 | Ga0496100_0132686 | Ga0496100_0132686_278_1042 | 237 |
| 624 | 3300048904 | Ga0496101_0122156 | Ga0496101_0122156_798_1613 | 237 |
| 625 | 3300048905 | Ga0496102_0136319 | Ga0496102_0136319_784_1548 | 237 |
| 626 | 3300048907 | Ga0496104_0105435 | Ga0496104_0105435_1214_1975 | 237 |
| 627 | 3300048908 | Ga0496105_0147641 | Ga0496105_0147641_1062_1823 | 237 |
| 628 | 3300048908 | Ga0496105_0231595 | Ga0496105_0231595_630_1391 | 237 |
| 629 | 3300048909 | Ga0496106_0015920 | Ga0496106_0015920_1999_2760 | 237 |
| 630 | 3300048909 | Ga0496106_0122350 | Ga0496106_0122350_1025_1804 | 237 |
| 631 | 3300048909 | Ga0496106_0155540 | Ga0496106_0155540_97_858 | 237 |
| 632 | 3300048909 | Ga0496106_0259516 | Ga0496106_0259516_439_1203 | 237 |
| 633 | 3300048909 | Ga0496106_0346539 | Ga0496106_0346539_281_1042 | 237 |
| 634 | 3300048909 | Ga0496106_0349577 | Ga0496106_0349577_370_1134 | 237 |
| 635 | 3300048910 | Ga0496107_0004783 | Ga0496107_0004783_1104_1865 | 237 |
| 636 | 3300048910 | Ga0496107_0230110 | Ga0496107_0230110_138_899 | 237 |
| 637 | 3300048911 | Ga0496108_0000938 | Ga0496108_0000938_6250_7011 | 237 |
| 638 | 3300048911 | Ga0496108_0653925 | Ga0496108_0653925_89_850 | 237 |
| 639 | 3300048912 | Ga0496109_0001723 | Ga0496109_0001723_13984_14745 | 237 |
| 640 | 3300048912 | Ga0496109_0198825 | Ga0496109_0198825_1018_1779 | 237 |
| 641 | 3300048912 | Ga0496109_0207737 | Ga0496109_0207737_830_1591 | 237 |
| 642 | 3300048912 | Ga0496109_0348248 | Ga0496109_0348248_456_1220 | 237 |
| 643 | 3300048913 | Ga0496110_0101921 | Ga0496110_0101921_604_1413 | 237 |
| 644 | 3300048913 | Ga0496110_0148931 | Ga0496110_0148931_247_1008 | 237 |
| 645 | 3300048913 | Ga0496110_0178575 | Ga0496110_0178575_285_1046 | 237 |
| 646 | 3300048914 | Ga0496111_0072809 | Ga0496111_0072809_446_1207 | 237 |
| 647 | 3300048914 | Ga0496111_0120465 | Ga0496111_0120465_143_907 | 237 |
| 648 | 3300048914 | Ga0496111_0230872 | Ga0496111_0230872_583_1344 | 237 |
| 649 | 3300048915 | Ga0496112_0000014 | Ga0496112_0000014_65_832 | 237 |
| 650 | 3300048915 | Ga0496112_0000590 | Ga0496112_0000590_50_817 | 237 |
| 651 | 3300048915 | Ga0496112_0045788 | Ga0496112_0045788_2571_3332 | 237 |
| 652 | 3300048915 | Ga0496112_0066467 | Ga0496112_0066467_978_1793 | 237 |
| 653 | 3300048915 | Ga0496112_0096875 | Ga0496112_0096875_315_1076 | 237 |
| 654 | 3300048915 | Ga0496112_0292386 | Ga0496112_0292386_513_1322 | 237 |
| 655 | 3300048916 | Ga0496113_0106631 | Ga0496113_0106631_422_1183 | 237 |
| 656 | 3300048916 | Ga0496113_0332810 | Ga0496113_0332810_49_810 | 237 |
| 657 | 3300048916 | Ga0496113_0336513 | Ga0496113_0336513_23_784 | 237 |
| 658 | 3300048916 | Ga0496113_0571363 | Ga0496113_0571363_59_868 | 237 |
| 659 | 3300048918 | Ga0496115_0105098 | Ga0496115_0105098_1329_2090 | 237 |
| 660 | 3300048918 | Ga0496115_0480644 | Ga0496115_0480644_49_810 | 237 |
| 661 | 3300048918 | Ga0496115_0604639 | Ga0496115_0604639_57_818 | 237 |
| 662 | 3300048919 | Ga0496116_0001982 | Ga0496116_0001982_14894_15673 | 237 |
| 663 | 3300048920 | Ga0496117_0021414 | Ga0496117_0021414_3723_4502 | 237 |
| 664 | 3300048921 | Ga0496118_0039825 | Ga0496118_0039825_1694_2473 | 237 |
| 665 | 3300048922 | Ga0496119_0167995 | Ga0496119_0167995_238_999 | 237 |
| 666 | 3300048922 | Ga0496119_0224518 | Ga0496119_0224518_123_884 | 237 |
| 667 | 3300048924 | Ga0496121_0000379 | Ga0496121_0000379_90263_91024 | 237 |
| 668 | 3300048924 | Ga0496121_0134182 | Ga0496121_0134182_764_1534 | 237 |
| 669 | 3300048924 | Ga0496121_0142705 | Ga0496121_0142705_981_1745 | 237 |
| 670 | 3300048924 | Ga0496121_0411611 | Ga0496121_0411611_97_861 | 237 |
| 671 | 3300048925 | Ga0496122_0095791 | Ga0496122_0095791_382_1146 | 237 |
| 672 | 3300048927 | Ga0496124_0139987 | Ga0496124_0139987_696_1475 | 237 |
| 673 | 3300048927 | Ga0496124_0274664 | Ga0496124_0274664_69_833 | 237 |
| 674 | 3300048927 | Ga0496124_0320749 | Ga0496124_0320749_70_840 | 237 |
| 675 | 3300048928 | Ga0496125_0000199 | Ga0496125_0000199_105825_106586 | 237 |
| 676 | 3300048928 | Ga0496125_0000964 | Ga0496125_0000964_11184_11945 | 237 |
| 677 | 3300048928 | Ga0496125_0036169 | Ga0496125_0036169_3182_3961 | 237 |
| 678 | 3300048928 | Ga0496125_0213882 | Ga0496125_0213882_54_815 | 237 |
| 679 | 3300048929 | Ga0496126_0009808 | Ga0496126_0009808_5283_6047 | 237 |
| 680 | 3300048929 | Ga0496126_0011726 | Ga0496126_0011726_8248_9009 | 237 |
| 681 | 3300048929 | Ga0496126_0027947 | Ga0496126_0027947_3087_3848 | 237 |
| 682 | 3300048929 | Ga0496126_0064385 | Ga0496126_0064385_1890_2651 | 237 |
| 683 | 3300048929 | Ga0496126_0102702 | Ga0496126_0102702_1336_2115 | 237 |
| 684 | 3300048929 | Ga0496126_0157970 | Ga0496126_0157970_1148_1909 | 237 |
| 685 | 3300048929 | Ga0496126_0172815 | Ga0496126_0172815_41_802 | 237 |
| 686 | 3300049459 | Ga0495678_084732 | Ga0495678_084732_341_1105 | 237 |
| 687 | 3300049568 | Ga0501031_0000712 | Ga0501031_0000712_9755_10558 | 237 |
| 688 | 3300049569 | Ga0501032_0001162 | Ga0501032_0001162_13633_14436 | 237 |
| 689 | 3300049569 | Ga0501032_0205935 | Ga0501032_0205935_321_1082 | 237 |
| 690 | 3300049569 | Ga0501032_0317195 | Ga0501032_0317195_90_851 | 237 |
| 691 | 3300049570 | Ga0501033_0000163 | Ga0501033_0000163_38017_38820 | 237 |
| 692 | 3300049570 | Ga0501033_0017017 | Ga0501033_0017017_4140_4901 | 237 |
| 693 | 3300049570 | Ga0501033_0028416 | Ga0501033_0028416_694_1455 | 237 |
| 694 | 3300049570 | Ga0501033_0178507 | Ga0501033_0178507_381_1142 | 237 |
| 695 | 3300049571 | Ga0501034_0000202 | Ga0501034_0000202_16170_16973 | 237 |
| 696 | 3300049571 | Ga0501034_0703859 | Ga0501034_0703859_58_819 | 237 |
| 697 | 3300049572 | Ga0501036_0000021 | Ga0501036_0000021_16239_17042 | 237 |
| 698 | 3300049573 | Ga0501037_0001561 | Ga0501037_0001561_5001_5804 | 237 |
| 699 | 3300049573 | Ga0501037_0077304 | Ga0501037_0077304_530_1291 | 237 |
| 700 | 3300049574 | Ga0501038_0000226 | Ga0501038_0000226_12531_13334 | 237 |
| 701 | 3300049574 | Ga0501038_0201201 | Ga0501038_0201201_420_1181 | 237 |
| 702 | 3300049575 | Ga0501039_0001542 | Ga0501039_0001542_15107_15910 | 237 |
| 703 | 3300049575 | Ga0501039_0091639 | Ga0501039_0091639_288_1058 | 237 |
| 704 | 3300049578 | Ga0501042_0219802 | Ga0501042_0219802_200_961 | 237 |
| 705 | 3300049579 | Ga0501043_0000297 | Ga0501043_0000297_5432_6235 | 237 |
| 706 | 3300049579 | Ga0501043_0216935 | Ga0501043_0216935_50_811 | 237 |
| 707 | 3300049580 | Ga0501046_0000354 | Ga0501046_0000354_17452_18255 | 237 |
| 708 | 3300049580 | Ga0501046_0123794 | Ga0501046_0123794_1101_1862 | 237 |
| 709 | 3300049581 | Ga0501047_0000232 | Ga0501047_0000232_15960_16763 | 237 |
| 710 | 3300049581 | Ga0501047_0076009 | Ga0501047_0076009_2221_2982 | 237 |
| 711 | 3300049582 | Ga0501048_0000050 | Ga0501048_0000050_16884_17687 | 237 |
| 712 | 3300049583 | Ga0501067_0001956 | Ga0501067_0001956_2642_3445 | 237 |
| 713 | 3300049584 | Ga0501068_0005647 | Ga0501068_0005647_2183_2986 | 237 |
| 714 | 3300049585 | Ga0501069_0013995 | Ga0501069_0013995_3391_4194 | 237 |
| 715 | 3300049586 | Ga0501070_0012142 | Ga0501070_0012142_49_810 | 237 |
| 716 | 3300049586 | Ga0501070_0252540 | Ga0501070_0252540_629_1390 | 237 |
| 717 | 3300049587 | Ga0501071_0071472 | Ga0501071_0071472_741_1547 | 237 |
| 718 | 3300049588 | Ga0501072_0002675 | Ga0501072_0002675_9643_10446 | 237 |
| 719 | 3300049589 | Ga0501073_0000329 | Ga0501073_0000329_26189_26992 | 237 |
| 720 | 3300049590 | Ga0501074_0000092 | Ga0501074_0000092_16412_17215 | 237 |
| 721 | 3300049592 | Ga0501076_0262901 | Ga0501076_0262901_434_1237 | 237 |
| 722 | 3300049741 | Ga0501079_0026857 | Ga0501079_0026857_2201_3004 | 237 |
| 723 | 3300049742 | Ga0501080_0003432 | Ga0501080_0003432_11340_12143 | 237 |
| 724 | 3300049744 | Ga0501083_0107217 | Ga0501083_0107217_338_1141 | 237 |
| 725 | 3300049822 | Ga0501035_0000120 | Ga0501035_0000120_52927_53730 | 237 |
| 726 | 3300049822 | Ga0501035_0155462 | Ga0501035_0155462_526_1287 | 237 |
| 727 | 3300049822 | Ga0501035_0155631 | Ga0501035_0155631_878_1639 | 237 |
| 728 | 3300049823 | Ga0501044_0000179 | Ga0501044_0000179_73964_74767 | 237 |
| 729 | 3300049823 | Ga0501044_0181637 | Ga0501044_0181637_86_847 | 237 |
| 730 | 3300049823 | Ga0501044_0181763 | Ga0501044_0181763_474_1235 | 237 |
| 731 | 3300049823 | Ga0501044_0408919 | Ga0501044_0408919_89_850 | 237 |
| 732 | 3300049823 | Ga0501044_0556973 | Ga0501044_0556973_179_982 | 237 |
| 733 | 3300049824 | Ga0501045_0009859 | Ga0501045_0009859_972_1775 | 237 |
| 734 | 3300050489 | nmdc:mga03683_96169_c1 | nmdc:mga03683_96169_c1_474_1235 | 237 |
| 735 | 3300050490 | nmdc:mga03n38_230662_c1 | nmdc:mga03n38_230662_c1_154_918 | 237 |
| 736 | 3300050490 | nmdc:mga03n38_5857_c1 | nmdc:mga03n38_5857_c1_433_1197 | 237 |
| 737 | 3300050490 | nmdc:mga03n38_72170_c1 | nmdc:mga03n38_72170_c1_230_991 | 237 |
| 738 | 3300050491 | nmdc:mga00v17_190560_c1 | nmdc:mga00v17_190560_c1_338_1102 | 237 |
| 739 | 3300050491 | nmdc:mga00v17_42278_c1 | nmdc:mga00v17_42278_c1_1125_1904 | 237 |
| 740 | 3300050492 | nmdc:mga0yw44_126007_c1 | nmdc:mga0yw44_126007_c1_797_1558 | 237 |
| 741 | 3300050492 | nmdc:mga0yw44_295905_c1 | nmdc:mga0yw44_295905_c1_28_792 | 237 |
| 742 | 3300050494 | nmdc:mga06z11_167171_c1 | nmdc:mga06z11_167171_c1_323_1087 | 237 |
| 743 | 3300050494 | nmdc:mga06z11_26303_c1 | nmdc:mga06z11_26303_c1_586_1392 | 237 |
| 744 | 3300050495 | nmdc:mga04h51_58700_c1 | nmdc:mga04h51_58700_c1_343_1107 | 237 |
| 745 | 3300050495 | nmdc:mga04h51_60168_c1 | nmdc:mga04h51_60168_c1_229_993 | 237 |
| 746 | 3300050496 | nmdc:mga07m45_51114_c1 | nmdc:mga07m45_51114_c1_691_1470 | 237 |
| 747 | 3300050496 | nmdc:mga07m45_71267_c1 | nmdc:mga07m45_71267_c1_115_876 | 237 |
| 748 | 3300050508 | nmdc:mga09592_440437_c1 | nmdc:mga09592_440437_c1_111_875 | 237 |
| 749 | 3300050511 | nmdc:mga08y16_490201_c1 | nmdc:mga08y16_490201_c1_33_854 | 237 |
| 750 | 3300050516 | nmdc:mga0sz30_5222_c1 | nmdc:mga0sz30_5222_c1_2767_3546 | 237 |
| 751 | 3300053077 | Ga0495601_0028806 | Ga0495601_0028806_149_910 | 237 |
| 752 | 3300053078 | Ga0495612_0072948 | Ga0495612_0072948_548_1309 | 237 |
| 753 | 3300053085 | Ga0495619_0006768 | Ga0495619_0006768_3156_3917 | 237 |
| 754 | 3300053085 | Ga0495619_0064113 | Ga0495619_0064113_780_1541 | 237 |
| 755 | 3300053092 | Ga0500583_0022152 | Ga0500583_0022152_1610_2374 | 237 |
| 756 | 3300053093 | Ga0500651_0162632 | Ga0500651_0162632_182_988 | 237 |
| 757 | 3300053094 | Ga0500566_0018229 | Ga0500566_0018229_856_1617 | 237 |
| 758 | 3300053094 | Ga0500566_0145806 | Ga0500566_0145806_304_1065 | 237 |
| 759 | 3300053096 | Ga0500641_0027059 | Ga0500641_0027059_394_1200 | 237 |
| 760 | 3300053102 | Ga0500554_002502 | Ga0500554_002502_2058_2819 | 237 |
| 761 | 3300053104 | Ga0500556_0000003 | Ga0500556_0000003_57319_58083 | 237 |
| 762 | 3300053104 | Ga0500556_0063239 | Ga0500556_0063239_576_1340 | 237 |
| 763 | 3300053119 | Ga0500595_000414 | Ga0500595_000414_20731_21492 | 237 |
| 764 | 3300053125 | Ga0500618_028139 | Ga0500618_028139_359_1123 | 237 |
| 765 | 3300053130 | Ga0500642_0072461 | Ga0500642_0072461_92_853 | 237 |
| 766 | 3300053139 | Ga0500568_0007066 | Ga0500568_0007066_1046_1807 | 237 |
| 767 | 3300053142 | Ga0500577_0058518 | Ga0500577_0058518_336_1100 | 237 |
| 768 | 3300053146 | Ga0500588_0121232 | Ga0500588_0121232_28_789 | 237 |
| 769 | 3300053147 | Ga0500589_044338 | Ga0500589_044338_41_805 | 237 |
| 770 | 3300053148 | Ga0500590_098273 | Ga0500590_098273_51_857 | 237 |
| 771 | 3300053162 | Ga0500638_006577 | Ga0500638_006577_1963_2724 | 237 |
| 772 | 3300053723 | Ga0500567_131420 | Ga0500567_131420_49_813 | 237 |
| 773 | 3300053727 | Ga0500611_023524 | Ga0500611_023524_329_1093 | 237 |
| 774 | 3300053730 | Ga0500645_028254 | Ga0500645_028254_757_1521 | 237 |
| 775 | 3300054114 | Ga0501084_0136077 | Ga0501084_0136077_985_1788 | 237 |
| 776 | 3300055283 | Ga0500661_000369 | Ga0500661_000369_5391_6152 | 237 |
| 777 | 3300060353 | Ga0501082_0011284 | Ga0501082_0011284_5513_6316 | 237 |
| 778 | iso_pu_bacteria | 2513237098 | 2513678794 | 237 |
| 779 | iso_pu_bacteria | 2791355199 | 2793080685 | 237 |
| 780 | iso_pu_bacteria | 2903748898 | 2903749653 | 237 |
| 781 | iso_pu_bacteria | 2903768456 | 2903773693 | 237 |
| 782 | iso_pu_bacteria | 2908739725 | 2908741281 | 237 |
| 783 | iso_pu_bacteria | 2922361189 | 2922361599 | 237 |
| 784 | 3300001979 | JGI24740J21852_10001727 | JGI24740J21852_100017279 | 238 |
| 785 | 3300001989 | JGI24739J22299_10042523 | JGI24739J22299_100425231 | 238 |
| 786 | 3300005457 | Ga0070662_100060953 | Ga0070662_1000609532 | 238 |
| 787 | 3300005539 | Ga0068853_100014882 | Ga0068853_1000148822 | 238 |
| 788 | 3300005539 | Ga0068853_100058051 | Ga0068853_1000580513 | 238 |
| 789 | 3300005563 | Ga0068855_100012537 | Ga0068855_1000125372 | 238 |
| 790 | 3300005577 | Ga0068857_100010486 | Ga0068857_1000104866 | 238 |
| 791 | 3300005577 | Ga0068857_100061831 | Ga0068857_1000618312 | 238 |
| 792 | 3300005578 | Ga0068854_100150890 | Ga0068854_1001508902 | 238 |
| 793 | 3300005614 | Ga0068856_100003444 | Ga0068856_10000344411 | 238 |
| 794 | 3300005617 | Ga0068859_100696730 | Ga0068859_1006967302 | 238 |
| 795 | 3300005834 | Ga0068851_10047145 | Ga0068851_100471452 | 238 |
| 796 | 3300006173 | Ga0070716_100006104 | Ga0070716_1000061042 | 238 |
| 797 | 3300006931 | Ga0097620_100696728 | Ga0097620_1006967282 | 238 |
| 798 | 3300007788 | Ga0099795_10005252 | Ga0099795_100052522 | 238 |
| 799 | 3300009093 | Ga0105240_10000603 | Ga0105240_100006036 | 238 |
| 800 | 3300009093 | Ga0105240_10027536 | Ga0105240_100275366 | 238 |
| 801 | 3300009101 | Ga0105247_10038942 | Ga0105247_100389422 | 238 |
| 802 | 3300009174 | Ga0105241_10000075 | Ga0105241_1000007558 | 238 |
| 803 | 3300009174 | Ga0105241_10358381 | Ga0105241_103583811 | 238 |
| 804 | 3300009545 | Ga0105237_10178285 | Ga0105237_101782852 | 238 |
| 805 | 3300009545 | Ga0105237_10307093 | Ga0105237_103070932 | 238 |
| 806 | 3300009551 | Ga0105238_10020719 | Ga0105238_100207192 | 238 |
| 807 | 3300009551 | Ga0105238_10409590 | Ga0105238_104095902 | 238 |
| 808 | 3300010375 | Ga0105239_10084018 | Ga0105239_100840182 | 238 |
| 809 | 3300010375 | Ga0105239_10239306 | Ga0105239_102393061 | 238 |
| 810 | 3300010375 | Ga0105239_10300514 | Ga0105239_103005142 | 238 |
| 811 | 3300025297 | Ga0209758_1003949 | Ga0209758_100394913 | 238 |
| 812 | 3300025321 | Ga0207656_10012124 | Ga0207656_100121243 | 238 |
| 813 | 3300025900 | Ga0207710_10044201 | Ga0207710_100442012 | 238 |
| 814 | 3300025904 | Ga0207647_10011690 | Ga0207647_100116904 | 238 |
| 815 | 3300025911 | Ga0207654_10000037 | Ga0207654_100000373 | 238 |
| 816 | 3300025913 | Ga0207695_10000283 | Ga0207695_100002836 | 238 |
| 817 | 3300025913 | Ga0207695_10000286 | Ga0207695_1000028669 | 238 |
| 818 | 3300025914 | Ga0207671_10120702 | Ga0207671_101207022 | 238 |
| 819 | 3300025915 | Ga0207693_10090228 | Ga0207693_100902282 | 238 |
| 820 | 3300025924 | Ga0207694_10000120 | Ga0207694_1000012013 | 238 |
| 821 | 3300025924 | Ga0207694_10091488 | Ga0207694_100914882 | 238 |
| 822 | 3300025924 | Ga0207694_10149516 | Ga0207694_101495162 | 238 |
| 823 | 3300025933 | Ga0207706_10052332 | Ga0207706_100523322 | 238 |
| 824 | 3300025939 | Ga0207665_10062181 | Ga0207665_100621813 | 238 |
| 825 | 3300025949 | Ga0207667_10141047 | Ga0207667_101410472 | 238 |
| 826 | 3300025981 | Ga0207640_10028018 | Ga0207640_100280183 | 238 |
| 827 | 3300025981 | Ga0207640_10677966 | Ga0207640_106779661 | 238 |
| 828 | 3300026078 | Ga0207702_10000019 | Ga0207702_10000019105 | 238 |
| 829 | 3300026116 | Ga0207674_10016041 | Ga0207674_100160416 | 238 |
| 830 | 3300026116 | Ga0207674_10064435 | Ga0207674_100644353 | 238 |
| 831 | 3300035171 | Ga0373946_0039677 | Ga0373946_0039677_860_1624 | 238 |
| 832 | 3300035695 | Ga0373927_0003904 | Ga0373927_0003904_5598_6362 | 238 |
| 833 | 3300035725 | Ga0373947_0002662 | Ga0373947_0002662_1340_2104 | 238 |
| 834 | 3300046455 | Ga0495603_0071843 | Ga0495603_0071843_676_1440 | 238 |
| 835 | 3300046472 | Ga0495580_0085278 | Ga0495580_0085278_1188_1952 | 238 |
| 836 | 3300046507 | Ga0495606_0307896 | Ga0495606_0307896_17_781 | 238 |
| 837 | 3300048921 | Ga0496118_0105489 | Ga0496118_0105489_25_789 | 238 |
| 838 | 3300048924 | Ga0496121_0007216 | Ga0496121_0007216_9548_10312 | 238 |
| 839 | 3300048924 | Ga0496121_0202708 | Ga0496121_0202708_97_879 | 238 |
| 840 | 3300048929 | Ga0496126_0003657 | Ga0496126_0003657_4352_5167 | 238 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5o34-assembly1.cif.gz_C | thne from s.clavuligerus | 0.8431 | 6 | 202 |
| 3qmj-assembly1.cif.gz_A | crystal structure of enoyl-coa hydratase echa8_6 from mycobacterium marinum | 0.8365 | 4 | 213 |
| 3qmj-assembly1.cif.gz_A | crystal structure of enoyl-coa hydratase echa8_6 from mycobacterium marinum | 0.8182 | 4 | 213 |
| 4elx-assembly1.cif.gz_F | structure of apo e.coli. 1,4-dihydroxy-2- naphthoyl coa synthases with cl | 0.8169 | 4 | 202 |
| 3fdu-assembly2.cif.gz_D | crystal structure of a putative enoyl-coa hydratase/isomerase from acinetobacter baumannii | 0.8069 | 1 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3rsiC01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.9345 | 4 | 56 | 3.30.300.220 |
| 4nekC01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8627 | 2 | 201 | 3.90.226.10 |
| 4f47A01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8626 | 4 | 201 | 3.90.226.10 |
| 1dciC01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8613 | 1 | 198 | 3.90.226.10 |
| 4nekC01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8584 | 2 | 201 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1J5P3J2-F1-model_v4 | 2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) | 0.9104 | 1 | 151 |
GO:0004165
GO:0004300 GO:0005777 |
| AF-A0A131Y2F7-F1-model_v4 | Putative enoyl-coa hydratase/isomerase | 0.8575 | 3 | 193 |
GO:0000062
GO:0004165 GO:0005777 |
| AF-A0A2E2U0C1-F1-model_v4 | deleted | 0.8449 | 1 | 202 |
|
| AF-A0A538LM92-F1-model_v4 | Enoyl-CoA hydratase/isomerase family protein | 0.8445 | 4 | 198 |
GO:0006635
GO:0016836 GO:0016853 |
| AF-A0A257KJZ7-F1-model_v4 | Enoyl-CoA hydratase | 0.8413 | 1 | 192 |
GO:0004165
GO:0005777 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar