F483049

General Info

Members Datasets Scaffolds Average Seq Length
840 437 799 243

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10038942|Ga0105247_100389422
Length 276
Sequence MSDTTRRDSSDVAATGAHDEGPMTDHLIVTDEAETRTIKLRRPEKKNAITQAMYLGMSDAIDTAQNNPLVRCIIVTGGSGVFTAGNDLEDFLRAGSAGNDAVRTSAATKFLYSLAHNVKPIIAAVDGVAIGIGTTMLFHCDYVLASTTATFATPFIHLGLVPEGASSLLMPRTMGYQRAFAMLVMGRTMTAADAQIAGFVNTVVAPGHTEVEAHKVARDICRLPAEAVAIGRKLIRTAPDELTRRIDQEAYLFAERMTSEEAIGAFKAFFARKKKK

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
7 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
8 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
9 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
10 2643221651 Afipia sp. Root123D2 Isolate Unclassified
11 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
12 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
13 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
14 2791355199
15 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
16 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
17 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
18 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
19 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
20 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
21 2904699407
22 2906610324
23 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
24 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
25 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
26 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
27 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
28 2922425934
29 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
30 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
31 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
32 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
33 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
34 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
35 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
36 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
38 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
47 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
95 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
98 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
99 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
110 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
111 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
112 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
198 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
199 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
200 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
203 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
208 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
209 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
210 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
211 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
212 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
213 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
214 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
215 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
216 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
217 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
218 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
221 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
222 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
223 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
224 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
225 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
226 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
232 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
233 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
234 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
235 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
236 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
237 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
240 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
241 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
242 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
243 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
244 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
245 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
246 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
247 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
248 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
249 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
250 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
252 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
253 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
254 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
261 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
262 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
263 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
264 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
265 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
266 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
267 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
268 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
269 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
270 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
274 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
275 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
276 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
277 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
278 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
279 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
280 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
281 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
282 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
283 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
284 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
285 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
286 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
287 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
288 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
289 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
290 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
291 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
292 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
293 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
294 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
295 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
296 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
297 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
298 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
299 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
300 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
301 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
302 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
303 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
304 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
305 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
306 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
307 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
308 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
309 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
310 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
311 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
312 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
313 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
314 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
315 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
320 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
321 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
322 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
323 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
324 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
325 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
326 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
327 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
328 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
329 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
330 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
331 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
332 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
333 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
334 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
335 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
336 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
352 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
353 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
354 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
355 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
356 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
357 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
358 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
359 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
360 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
361 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
362 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
376 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
377 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
378 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
379 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
380 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
381 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
382 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
383 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
384 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
385 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
386 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
387 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
390 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
391 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
392 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
393 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
394 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
395 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
396 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
397 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
398 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
399 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
400 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
401 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
402 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
403 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
404 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
405 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
406 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
407 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
408 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
409 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
410 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
411 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
412 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
413 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
414 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
415 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
416 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
417 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
418 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
419 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
420 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
421 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
422 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
423 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
424 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
425 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
426 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
427 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
428 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
429 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
430 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
431 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
432 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
433 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
434 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
435 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
436 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
437 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.57
Metatranscriptomes 0
Isolates 4.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.93
Nodule 3.81
Rhizoplane 6.79
Rhizosphere 74.17
Stem 0
Stem Tuber 0
Unclassified 6.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001727 3300001979 Bacteria 10038
2 JGI24739J22299_10042523 3300001989 Bacteria 1507
3 JGI25406J46586_10000018 3300003203 Bacteria 88860
4 JGI25406J46586_10006262 3300003203 Bacteria 5491
5 JGI25153J46596_10027455 3300003215 Bacteria 1993
6 JGI25404J52841_10007849 3300003659 Bacteria 2265
7 JGI25404J52841_10024308 3300003659 Bacteria 1305
8 Ga0070658_10017070 3300005327 Bacteria 5809
9 Ga0070658_10017379 3300005327 Bacteria 5755
10 Ga0070658_10217213 3300005327 Bacteria 1616
11 Ga0070658_10357162 3300005327 Bacteria 1251
12 Ga0070658_10618823 3300005327 Bacteria 939
13 Ga0070683_100067142 3300005329 Bacteria 3340
14 Ga0070670_100368057 3300005331 Bacteria 1265
15 Ga0068869_100037113 3300005334 Bacteria 3463
16 Ga0068869_100293012 3300005334 Bacteria 1312
17 Ga0070680_100037799 3300005336 Bacteria 3902
18 Ga0068868_100070712 3300005338 Bacteria 2782
19 Ga0068868_100103472 3300005338 Bacteria 2307
20 Ga0068868_100588298 3300005338 Bacteria 985
21 Ga0070660_100014841 3300005339 Bacteria 5623
22 Ga0070660_100204725 3300005339 Bacteria 1601
23 Ga0070689_100219851 3300005340 Bacteria 1558
24 Ga0070687_100287400 3300005343 Bacteria 1038
25 Ga0070661_100018037 3300005344 Bacteria 5014
26 Ga0070661_100051288 3300005344 Bacteria 3019
27 Ga0070668_100023719 3300005347 Bacteria 4643
28 Ga0070668_100040432 3300005347 Bacteria 3568
29 Ga0070668_100086528 3300005347 Bacteria 2464
30 Ga0070668_100207763 3300005347 Bacteria 1609
31 Ga0070668_100370502 3300005347 Bacteria 1216
32 Ga0070668_100569766 3300005347 Bacteria 987
33 Ga0070669_100296940 3300005353 Bacteria 1298
34 Ga0070671_100281335 3300005355 Bacteria 1415
35 Ga0070671_100347479 3300005355 Bacteria 1266
36 Ga0070674_100100743 3300005356 Bacteria 2104
37 Ga0070674_100142856 3300005356 Bacteria 1798
38 Ga0070673_100443489 3300005364 Bacteria 1167
39 Ga0070659_100121888 3300005366 Bacteria 2113
40 Ga0070659_100358299 3300005366 Bacteria 1225
41 Ga0070667_100110095 3300005367 Bacteria 2387
42 Ga0070667_100739120 3300005367 Bacteria 912
43 Ga0070709_10251069 3300005434 Bacteria 1274
44 Ga0070709_10397920 3300005434 Bacteria 1028
45 Ga0070714_100087813 3300005435 Bacteria 2719
46 Ga0070714_100245164 3300005435 Bacteria 1655
47 Ga0070713_100002525 3300005436 Bacteria 11957
48 Ga0070713_100085245 3300005436 Bacteria 2706
49 Ga0070710_10032264 3300005437 Bacteria 2836
50 Ga0070711_100004216 3300005439 Bacteria 8451
51 Ga0070711_100019917 3300005439 Bacteria 4314
52 Ga0070700_100303946 3300005441 Bacteria 1166
53 Ga0070708_100108425 3300005445 Bacteria 2550
54 Ga0070663_100003295 3300005455 Bacteria 9297
55 Ga0070663_100024100 3300005455 Bacteria 4090
56 Ga0070663_100031126 3300005455 Bacteria 3665
57 Ga0070663_100301555 3300005455 Bacteria 1282
58 Ga0070663_100345819 3300005455 Bacteria 1203
59 Ga0070678_100450127 3300005456 Bacteria 1128
60 Ga0070662_100060953 3300005457 Bacteria 2753
61 Ga0070662_100065103 3300005457 Bacteria 2671
62 Ga0070662_100276008 3300005457 Bacteria 1359
63 Ga0070681_10016550 3300005458 Bacteria 7363
64 Ga0068867_100017580 3300005459 Bacteria 5077
65 Ga0070685_10064189 3300005466 Bacteria 2158
66 Ga0070706_100170997 3300005467 Bacteria 2029
67 Ga0070698_100216772 3300005471 Bacteria 1848
68 Ga0070698_100549134 3300005471 Bacteria 1095
69 Ga0070679_100448710 3300005530 Bacteria 1234
70 Ga0070684_100025358 3300005535 Bacteria 4983
71 Ga0070684_100182790 3300005535 Bacteria 1907
72 Ga0068853_100014882 3300005539 Bacteria 6388
73 Ga0068853_100058051 3300005539 Bacteria 3340
74 Ga0068853_100069858 3300005539 Bacteria 3056
75 Ga0068853_100089099 3300005539 Bacteria 2710
76 Ga0068853_100136181 3300005539 Bacteria 2202
77 Ga0068853_100164629 3300005539 Bacteria 2003
78 Ga0068853_100626591 3300005539 Bacteria 1022
79 Ga0070672_100269483 3300005543 Bacteria 1437
80 Ga0070665_100027974 3300005548 Bacteria 5678
81 Ga0070665_100112185 3300005548 Bacteria 2729
82 Ga0070665_100173609 3300005548 Bacteria 2156
83 Ga0070665_100196467 3300005548 Bacteria 2018
84 Ga0070665_100257171 3300005548 Bacteria 1747
85 Ga0070665_100259734 3300005548 Bacteria 1738
86 Ga0070665_100279343 3300005548 Bacteria 1672
87 Ga0070665_100373579 3300005548 Bacteria 1433
88 Ga0068855_100012537 3300005563 Bacteria 10230
89 Ga0068855_100054258 3300005563 Bacteria 4711
90 Ga0068855_100179453 3300005563 Bacteria 2395
91 Ga0068855_100215760 3300005563 Bacteria 2154
92 Ga0068855_100439184 3300005563 Bacteria 1425
93 Ga0068855_100574863 3300005563 Bacteria 1218
94 Ga0068855_100857449 3300005563 Bacteria 962
95 Ga0070664_100053456 3300005564 Bacteria 3424
96 Ga0070664_100226606 3300005564 Bacteria 1674
97 Ga0068857_100010486 3300005577 Bacteria 8054
98 Ga0068857_100042553 3300005577 Bacteria 4031
99 Ga0068857_100061831 3300005577 Bacteria 3327
100 Ga0068854_100094867 3300005578 Bacteria 2226
101 Ga0068854_100150890 3300005578 Bacteria 1792
102 Ga0068854_100216648 3300005578 Bacteria 1513
103 Ga0068856_100000505 3300005614 Bacteria 43297
104 Ga0068856_100003444 3300005614 Bacteria 16003
105 Ga0068856_100141898 3300005614 Bacteria 2410
106 Ga0068852_100014578 3300005616 Bacteria 6057
107 Ga0068852_100038624 3300005616 Bacteria 4014
108 Ga0068852_100097767 3300005616 Bacteria 2642
109 Ga0068852_100108144 3300005616 Bacteria 2524
110 Ga0068859_100639053 3300005617 Bacteria 1156
111 Ga0068859_100696730 3300005617 Bacteria 1106
112 Ga0068864_100186578 3300005618 Bacteria 1899
113 Ga0068864_100221833 3300005618 Bacteria 1745
114 Ga0068866_10106928 3300005718 Bacteria 1554
115 Ga0068866_10237679 3300005718 Bacteria 1108
116 Ga0068851_10022662 3300005834 Bacteria 3063
117 Ga0068851_10047145 3300005834 Bacteria 2181
118 Ga0068851_10048287 3300005834 Bacteria 2157
119 Ga0068863_100243328 3300005841 Bacteria 1736
120 Ga0068860_100536596 3300005843 Bacteria 1171
121 Ga0068860_100675583 3300005843 Bacteria 1042
122 Ga0068862_100130594 3300005844 Bacteria 2221
123 Ga0068862_100336754 3300005844 Bacteria 1396
124 Ga0068862_100503870 3300005844 Bacteria 1149
125 Ga0081455_10005785 3300005937 Bacteria 13478
126 Ga0081455_10006447 3300005937 Bacteria 12574
127 Ga0081455_10021510 3300005937 Bacteria 6051
128 Ga0081538_10009846 3300005981 Bacteria 7908
129 Ga0081540_1002041 3300005983 Bacteria 16838
130 Ga0081540_1007700 3300005983 Bacteria 7634
131 Ga0081540_1011669 3300005983 Bacteria 5856
132 Ga0081540_1025347 3300005983 Bacteria 3415
133 Ga0081540_1029018 3300005983 Bacteria 3092
134 Ga0081540_1035571 3300005983 Bacteria 2669
135 Ga0081539_10000003 3300005985 Bacteria 594833
136 Ga0081539_10000199 3300005985 Bacteria 139305
137 Ga0081539_10091602 3300005985 Bacteria 1570
138 Ga0075365_10021053 3300006038 Bacteria 4059
139 Ga0075365_10054204 3300006038 Bacteria 2658
140 Ga0075365_10078490 3300006038 Bacteria 2232
141 Ga0075365_10295831 3300006038 Bacteria 1139
142 Ga0075365_10311402 3300006038 Bacteria 1108
143 Ga0075368_10004358 3300006042 Bacteria 4788
144 Ga0075368_10047370 3300006042 Bacteria 1701
145 Ga0075363_100106380 3300006048 Bacteria 1556
146 Ga0075363_100225433 3300006048 Bacteria 1075
147 Ga0075364_10061329 3300006051 Bacteria 2467
148 Ga0075364_10170166 3300006051 Bacteria 1473
149 Ga0075364_10219239 3300006051 Bacteria 1291
150 Ga0075432_10136169 3300006058 Bacteria 934
151 Ga0070715_10000555 3300006163 Bacteria 9825
152 Ga0070716_100006104 3300006173 Bacteria 5875
153 Ga0070716_100038543 3300006173 Bacteria 2647
154 Ga0075362_10017480 3300006177 Bacteria 2955
155 Ga0075362_10045598 3300006177 Bacteria 1947
156 Ga0075367_10004219 3300006178 Bacteria 6975
157 Ga0075367_10047496 3300006178 Bacteria 2525
158 Ga0075369_10024953 3300006186 Bacteria 2482
159 Ga0075369_10116774 3300006186 Bacteria 1206
160 Ga0075366_10091496 3300006195 Bacteria 1822
161 Ga0097621_100357786 3300006237 Bacteria 1300
162 Ga0075370_10058517 3300006353 Bacteria 2192
163 Ga0075370_10062628 3300006353 Bacteria 2120
164 Ga0075370_10126688 3300006353 Bacteria 1489
165 Ga0075370_10192265 3300006353 Bacteria 1203
166 Ga0075433_10586920 3300006852 Bacteria 979
167 Ga0075434_100592606 3300006871 Bacteria 1128
168 Ga0097620_100639044 3300006931 Bacteria 1156
169 Ga0097620_100696728 3300006931 Bacteria 1106
170 Ga0099825_1034330 3300006941 Bacteria 1895
171 Ga0099824_1022834 3300006942 Bacteria 4024
172 Ga0099822_1000663 3300006943 Bacteria 34548
173 Ga0099795_10005252 3300007788 Bacteria 3427
174 Ga0099795_10019849 3300007788 Bacteria 2181
175 Ga0099795_10046617 3300007788 Bacteria 1562
176 Ga0105240_10000603 3300009093 Bacteria 66614
177 Ga0105240_10027536 3300009093 Bacteria 7439
178 Ga0105240_10129364 3300009093 Bacteria 3030
179 Ga0111539_10027346 3300009094 Bacteria 6966
180 Ga0105245_10075160 3300009098 Bacteria 3076
181 Ga0105247_10038942 3300009101 Bacteria 2903
182 Ga0105247_10077276 3300009101 Bacteria 2092
183 Ga0105247_10256397 3300009101 Bacteria 1198
184 Ga0114129_10664121 3300009147 Bacteria 1344
185 Ga0114129_11312661 3300009147 Bacteria 896
186 Ga0105241_10000075 3300009174 Bacteria 75421
187 Ga0105241_10358381 3300009174 Bacteria 1268
188 Ga0105248_10144570 3300009177 Bacteria 2683
189 Ga0105237_10025971 3300009545 Bacteria 5988
190 Ga0105237_10131327 3300009545 Bacteria 2499
191 Ga0105237_10178285 3300009545 Bacteria 2125
192 Ga0105237_10307093 3300009545 Bacteria 1589
193 Ga0105237_10480624 3300009545 Bacteria 1248
194 Ga0105238_10003279 3300009551 Bacteria 16156
195 Ga0105238_10020719 3300009551 Bacteria 6696
196 Ga0105238_10409590 3300009551 Bacteria 1350
197 Ga0099796_10031490 3300010159 Bacteria 1730
198 Ga0105239_10075790 3300010375 Bacteria 3699
199 Ga0105239_10084018 3300010375 Bacteria 3506
200 Ga0105239_10239306 3300010375 Bacteria 2037
201 Ga0105239_10241825 3300010375 Bacteria 2026
202 Ga0105239_10300514 3300010375 Bacteria 1807
203 Ga0105239_10335478 3300010375 Bacteria 1706
204 Ga0157371_10089823 3300013102 Bacteria 2176
205 Ga0157370_10021342 3300013104 Bacteria 6453
206 Ga0157370_10195664 3300013104 Bacteria 1876
207 Ga0157369_10056614 3300013105 Bacteria 4231
208 Ga0157374_10021557 3300013296 Bacteria 5735
209 Ga0157378_10762669 3300013297 Bacteria 991
210 Ga0163162_10055264 3300013306 Bacteria 3996
211 Ga0163162_10268443 3300013306 Bacteria 1838
212 Ga0163162_10274499 3300013306 Bacteria 1818
213 Ga0157372_11043322 3300013307 Bacteria 946
214 Ga0157375_10077654 3300013308 Bacteria 3351
215 Ga0157375_10107155 3300013308 Bacteria 2888
216 Ga0157375_10417386 3300013308 Bacteria 1508
217 Ga0163163_10047687 3300014325 Bacteria 4212
218 Ga0163163_10314250 3300014325 Bacteria 1620
219 Ga0163163_10416578 3300014325 Bacteria 1402
220 Ga0157380_10323315 3300014326 Bacteria 1431
221 Ga0157377_10239970 3300014745 Bacteria 1169
222 Ga0157376_10135631 3300014969 Bacteria 2202
223 Ga0163161_10255090 3300017792 Bacteria 1368
224 Ga0224570_103551 3300022730 Bacteria 979
225 Ga0209233_1001048 3300025261 Bacteria 11595
226 Ga0209233_1020170 3300025261 Bacteria 1753
227 Ga0209455_1008722 3300025272 Bacteria 2728
228 Ga0209564_1009899 3300025295 Bacteria 4465
229 Ga0209758_1003178 3300025297 Bacteria 15387
230 Ga0209758_1003949 3300025297 Bacteria 12880
231 Ga0209758_1010377 3300025297 Bacteria 5585
232 Ga0207697_10132444 3300025315 Bacteria 1078
233 Ga0207656_10012124 3300025321 Bacteria 3272
234 Ga0207656_10051332 3300025321 Bacteria 1783
235 Ga0207682_10130044 3300025893 Bacteria 1123
236 Ga0207692_10002181 3300025898 Bacteria 7480
237 Ga0207692_10010482 3300025898 Bacteria 3908
238 Ga0207642_10024567 3300025899 Bacteria 2424
239 Ga0207710_10044201 3300025900 Bacteria 1983
240 Ga0207710_10218369 3300025900 Bacteria 946
241 Ga0207688_10093219 3300025901 Bacteria 1732
242 Ga0207647_10011690 3300025904 Bacteria 6144
243 Ga0207647_10129092 3300025904 Bacteria 1486
244 Ga0207685_10085178 3300025905 Bacteria 1318
245 Ga0207699_10039854 3300025906 Bacteria 2702
246 Ga0207699_10262741 3300025906 Bacteria 1194
247 Ga0207645_10193688 3300025907 Bacteria 1336
248 Ga0207643_10084112 3300025908 Bacteria 1847
249 Ga0207705_10093019 3300025909 Bacteria 2210
250 Ga0207705_10170500 3300025909 Bacteria 1638
251 Ga0207705_10332892 3300025909 Bacteria 1168
252 Ga0207705_10394159 3300025909 Bacteria 1070
253 Ga0207705_10494199 3300025909 Bacteria 950
254 Ga0207705_10705146 3300025909 Bacteria 784
255 Ga0207684_10244007 3300025910 Bacteria 1550
256 Ga0207654_10000037 3300025911 Bacteria 108727
257 Ga0207707_10007441 3300025912 Bacteria 9540
258 Ga0207695_10000283 3300025913 Bacteria 126108
259 Ga0207695_10000286 3300025913 Bacteria 125310
260 Ga0207695_10104168 3300025913 Bacteria 2827
261 Ga0207671_10070932 3300025914 Bacteria 2598
262 Ga0207671_10087436 3300025914 Bacteria 2344
263 Ga0207671_10120702 3300025914 Bacteria 2003
264 Ga0207671_10138521 3300025914 Bacteria 1873
265 Ga0207693_10003158 3300025915 Bacteria 14168
266 Ga0207693_10090228 3300025915 Bacteria 2402
267 Ga0207693_10344791 3300025915 Bacteria 1166
268 Ga0207663_10000261 3300025916 Bacteria 22957
269 Ga0207663_10564282 3300025916 Bacteria 891
270 Ga0207660_10009640 3300025917 Bacteria 6251
271 Ga0207660_10510818 3300025917 Bacteria 975
272 Ga0207662_10085072 3300025918 Bacteria 1936
273 Ga0207657_10002700 3300025919 Bacteria 19128
274 Ga0207657_10134362 3300025919 Bacteria 2025
275 Ga0207652_10006338 3300025921 Bacteria 9558
276 Ga0207681_10413685 3300025923 Bacteria 1091
277 Ga0207694_10000120 3300025924 Bacteria 83624
278 Ga0207694_10091488 3300025924 Bacteria 2401
279 Ga0207694_10128279 3300025924 Bacteria 2031
280 Ga0207694_10149516 3300025924 Bacteria 1881
281 Ga0207700_10138800 3300025928 Bacteria 1994
282 Ga0207700_10152357 3300025928 Bacteria 1912
283 Ga0207700_10198737 3300025928 Bacteria 1688
284 Ga0207664_10011105 3300025929 Bacteria 6381
285 Ga0207664_10114239 3300025929 Bacteria 2249
286 Ga0207664_10392364 3300025929 Bacteria 1233
287 Ga0207664_10471245 3300025929 Bacteria 1122
288 Ga0207644_10457323 3300025931 Bacteria 1049
289 Ga0207690_10132261 3300025932 Bacteria 1827
290 Ga0207690_10404702 3300025932 Bacteria 1089
291 Ga0207706_10052332 3300025933 Bacteria 3605
292 Ga0207670_10061941 3300025936 Bacteria 2555
293 Ga0207669_10023409 3300025937 Bacteria 3299
294 Ga0207704_10227247 3300025938 Bacteria 1385
295 Ga0207665_10000280 3300025939 Bacteria 35528
296 Ga0207665_10019565 3300025939 Bacteria 4452
297 Ga0207665_10062181 3300025939 Bacteria 2532
298 Ga0207665_10372546 3300025939 Bacteria 1082
299 Ga0207691_10152893 3300025940 Bacteria 2028
300 Ga0207691_10382503 3300025940 Bacteria 1201
301 Ga0207711_10060989 3300025941 Bacteria 3251
302 Ga0207711_10623100 3300025941 Bacteria 1007
303 Ga0207689_10008118 3300025942 Bacteria 9157
304 Ga0207689_10120814 3300025942 Bacteria 2155
305 Ga0207689_10310222 3300025942 Bacteria 1308
306 Ga0207679_10191197 3300025945 Bacteria 1702
307 Ga0207679_10444490 3300025945 Bacteria 1149
308 Ga0207667_10046316 3300025949 Bacteria 4604
309 Ga0207667_10141047 3300025949 Bacteria 2481
310 Ga0207667_10194168 3300025949 Bacteria 2083
311 Ga0207667_10419859 3300025949 Bacteria 1361
312 Ga0207667_10546150 3300025949 Bacteria 1172
313 Ga0207651_10047369 3300025960 Bacteria 2898
314 Ga0207712_10080055 3300025961 Bacteria 2375
315 Ga0207668_10032604 3300025972 Bacteria 3444
316 Ga0207668_10059080 3300025972 Bacteria 2684
317 Ga0207668_10133716 3300025972 Bacteria 1897
318 Ga0207668_10183739 3300025972 Bacteria 1651
319 Ga0207668_10183980 3300025972 Bacteria 1650
320 Ga0207668_10244197 3300025972 Bacteria 1454
321 Ga0207640_10018694 3300025981 Bacteria 4078
322 Ga0207640_10028018 3300025981 Bacteria 3438
323 Ga0207640_10157315 3300025981 Bacteria 1677
324 Ga0207640_10677966 3300025981 Bacteria 881
325 Ga0207658_10584041 3300025986 Bacteria 1002
326 Ga0207677_10007590 3300026023 Bacteria 6015
327 Ga0207677_10029943 3300026023 Bacteria 3467
328 Ga0207677_10316569 3300026023 Bacteria 1295
329 Ga0207639_10054692 3300026041 Bacteria 3052
330 Ga0207639_10076791 3300026041 Bacteria 2631
331 Ga0207639_10112553 3300026041 Bacteria 2221
332 Ga0207639_10288240 3300026041 Bacteria 1447
333 Ga0207678_10008442 3300026067 Bacteria 9085
334 Ga0207678_10015515 3300026067 Bacteria 6698
335 Ga0207678_10044166 3300026067 Bacteria 3855
336 Ga0207678_10051796 3300026067 Bacteria 3543
337 Ga0207678_10062822 3300026067 Bacteria 3191
338 Ga0207678_10250929 3300026067 Bacteria 1515
339 Ga0207678_10370940 3300026067 Bacteria 1236
340 Ga0207702_10000019 3300026078 Bacteria 211843
341 Ga0207702_10000127 3300026078 Bacteria 89755
342 Ga0207702_10629084 3300026078 Bacteria 1054
343 Ga0207648_10562863 3300026089 Bacteria 1048
344 Ga0207676_10148948 3300026095 Bacteria 2013
345 Ga0207674_10016041 3300026116 Bacteria 8206
346 Ga0207674_10051454 3300026116 Bacteria 4203
347 Ga0207674_10064435 3300026116 Bacteria 3696
348 Ga0207675_100096466 3300026118 Bacteria 2784
349 Ga0207675_100434613 3300026118 Bacteria 1298
350 Ga0207683_10071355 3300026121 Bacteria 3070
351 Ga0207683_10160750 3300026121 Bacteria 2030
352 Ga0207683_10442545 3300026121 Bacteria 1198
353 Ga0207683_10495240 3300026121 Bacteria 1128
354 Ga0207698_10079006 3300026142 Bacteria 2644
355 Ga0207698_10383197 3300026142 Bacteria 1338
356 Ga0209589_1000006 3300027357 Bacteria 436292
357 Ga0209489_100007 3300027361 Bacteria 436292
358 Ga0209700_100008 3300027363 Bacteria 436292
359 Ga0209179_1003031 3300027512 Bacteria 2362
360 Ga0209588_1039153 3300027671 Bacteria 1529
361 Ga0209813_10051794 3300027866 Bacteria 1285
362 Ga0207428_10367565 3300027907 Bacteria 1057
363 Ga0268266_10012489 3300028379 Bacteria 7340
364 Ga0268266_10016053 3300028379 Bacteria 6401
365 Ga0268266_10124924 3300028379 Bacteria 2294
366 Ga0268266_10134892 3300028379 Bacteria 2210
367 Ga0268266_10310650 3300028379 Bacteria 1473
368 Ga0268266_10485118 3300028379 Bacteria 1178
369 Ga0268266_10697362 3300028379 Bacteria 978
370 Ga0268265_10073490 3300028380 Bacteria 2670
371 Ga0268265_10101910 3300028380 Bacteria 2320
372 Ga0268265_10237965 3300028380 Bacteria 1604
373 Ga0268264_10164336 3300028381 Bacteria 2003
374 Ga0268264_10220978 3300028381 Bacteria 1744
375 Ga0268264_10310943 3300028381 Bacteria 1487
376 Ga0265337_1018390 3300028556 Bacteria 2220
377 Ga0265326_10013135 3300028558 Bacteria 2425
378 Ga0265319_1007233 3300028563 Bacteria 5021
379 Ga0265334_10013991 3300028573 Bacteria 3350
380 Ga0265318_10008392 3300028577 Bacteria 4602
381 Ga0265323_10003132 3300028653 Bacteria 7366
382 Ga0265322_10037677 3300028654 Bacteria 1377
383 Ga0265336_10008427 3300028666 Bacteria 3616
384 Ga0307515_10346388 3300028794 Bacteria 1135
385 Ga0265338_10000085 3300028800 Bacteria 175080
386 Ga0265324_10002725 3300029957 Bacteria 8787
387 Ga0307512_10169494 3300030522 Bacteria 1256
388 Ga0265325_10188201 3300031241 Bacteria 958
389 Ga0265340_10006832 3300031247 Bacteria 6242
390 Ga0265316_10123104 3300031344 Bacteria 1958
391 Ga0307508_10329432 3300031616 Bacteria 1119
392 Ga0265314_10001137 3300031711 Bacteria 30830
393 Ga0265314_10062403 3300031711 Bacteria 2533
394 Ga0265342_10019909 3300031712 Bacteria 4316
395 Ga0307516_10012892 3300031730 Bacteria 8969
396 Ga0307516_10094494 3300031730 Bacteria 2814
397 Ga0307516_10535447 3300031730 Bacteria 825
398 Ga0307410_10151151 3300031852 Bacteria 1729
399 Ga0307407_10125692 3300031903 Bacteria 1633
400 Ga0307416_100168152 3300032002 Bacteria 2037
401 Ga0307416_101011765 3300032002 Bacteria 934
402 Ga0307411_10066426 3300032005 Bacteria 2423
403 Ga0307415_100041713 3300032126 Bacteria 3049
404 Ga0307510_10021805 3300033180 Bacteria 7456
405 Ga0307510_10117916 3300033180 Bacteria 2370
406 Ga0307510_10147452 3300033180 Bacteria 1981
407 Ga0315911_1000003 3300033442 Bacteria 502217
408 Ga0373958_0015050 3300034819 Bacteria 1361
409 Ga0373934_0064680 3300035086 Bacteria 1460
410 Ga0373940_0034282 3300035088 Bacteria 1369
411 Ga0373944_0112876 3300035089 Bacteria 930
412 Ga0373923_0001291 3300035111 Bacteria 7073
413 Ga0373936_0007502 3300035113 Bacteria 4102
414 Ga0373939_0024329 3300035114 Bacteria 1686
415 Ga0373945_0030875 3300035116 Bacteria 1890
416 Ga0373953_0013574 3300035117 Bacteria 2912
417 Ga0373953_0057691 3300035117 Bacteria 1581
418 Ga0373954_0002129 3300035118 Bacteria 8219
419 Ga0373954_0003928 3300035118 Bacteria 6359
420 Ga0373954_0221369 3300035118 Bacteria 931
421 Ga0373956_0006821 3300035119 Bacteria 4582
422 Ga0373957_0000776 3300035120 Bacteria 8304
423 Ga0373943_0038735 3300035170 Bacteria 2293
424 Ga0373946_0039677 3300035171 Bacteria 1923
425 Ga0373955_0207529 3300035172 Bacteria 1167
426 Ga0373955_0223305 3300035172 Bacteria 1125
427 Ga0373924_0012971 3300035410 Bacteria 3124
428 Ga0373931_0071809 3300035691 Bacteria 1892
429 Ga0373935_0009132 3300035692 Bacteria 5933
430 Ga0373927_0003904 3300035695 Bacteria 10572
431 Ga0373927_0005891 3300035695 Bacteria 8398
432 Ga0373927_0337731 3300035695 Bacteria 992
433 Ga0373933_0036847 3300035724 Bacteria 2865
434 Ga0373933_0125738 3300035724 Bacteria 1608
435 Ga0373933_0373979 3300035724 Bacteria 927
436 Ga0373933_0517703 3300035724 Bacteria 782
437 Ga0373947_0002662 3300035725 Bacteria 10733
438 Ga0373947_0012031 3300035725 Bacteria 4956
439 Ga0373947_0024847 3300035725 Bacteria 3494
440 Ga0373937_0026247 3300036401 Bacteria 5264
441 Ga0373937_0033338 3300036401 Bacteria 4675
442 Ga0373937_0088548 3300036401 Bacteria 2866
443 Ga0373937_0204994 3300036401 Bacteria 1854
444 Ga0373937_0222106 3300036401 Bacteria 1778
445 Ga0373925_0046932 3300037068 Bacteria 3213
446 Ga0373925_0050812 3300037068 Bacteria 3093
447 Ga0373925_0085564 3300037068 Bacteria 2404
448 Ga0373925_0127608 3300037068 Bacteria 1980
449 Ga0395899_0018519 3300037312 Bacteria 5292
450 Ga0395900_0029686 3300037418 Bacteria 5610
451 Ga0395900_0097884 3300037418 Bacteria 3014
452 Ga0395900_0215213 3300037418 Bacteria 1939
453 Ga0395898_0074232 3300037466 Bacteria 3285
454 Ga0395898_0196349 3300037466 Bacteria 1927
455 Ga0395905_0194484 3300037471 Bacteria 1902
456 Ga0395905_0360972 3300037471 Bacteria 1345
457 Ga0395905_0858470 3300037471 Bacteria 811
458 Ga0395901_0004721 3300038443 Bacteria 13758
459 Ga0395901_0350496 3300038443 Bacteria 1523
460 Ga0395901_0369462 3300038443 Bacteria 1478
461 Ga0395901_0526610 3300038443 Bacteria 1200
462 Ga0439465_0018383 3300041413 Bacteria 2184
463 Ga0466966_0021986 3300044684 Bacteria 4188
464 Ga0466964_0082603 3300044706 Bacteria 1382
465 Ga0466959_0122644 3300045049 Bacteria 1846
466 Ga0495592_0006971 3300046454 Bacteria 8443
467 Ga0495592_0028514 3300046454 Bacteria 4228
468 Ga0495592_0075564 3300046454 Bacteria 2446
469 Ga0495603_0004320 3300046455 Bacteria 8476
470 Ga0495603_0011117 3300046455 Bacteria 5457
471 Ga0495603_0031669 3300046455 Bacteria 3184
472 Ga0495603_0071843 3300046455 Bacteria 2033
473 Ga0495603_0364964 3300046455 Bacteria 828
474 Ga0495590_0041600 3300046457 Bacteria 1602
475 Ga0495629_0000439 3300046459 Bacteria 34692
476 Ga0495629_0008693 3300046459 Bacteria 7475
477 Ga0495629_0054073 3300046459 Bacteria 2808
478 Ga0495629_0078244 3300046459 Bacteria 2309
479 Ga0495629_0593104 3300046459 Bacteria 741
480 Ga0495638_0222951 3300046460 Bacteria 1053
481 Ga0495641_0013355 3300046461 Bacteria 4520
482 Ga0495651_0023056 3300046462 Bacteria 4841
483 Ga0495651_0080808 3300046462 Bacteria 2454
484 Ga0495651_0115383 3300046462 Bacteria 1980
485 Ga0495653_0023097 3300046463 Bacteria 5029
486 Ga0495650_0029475 3300046471 Bacteria 2501
487 Ga0495580_0010913 3300046472 Bacteria 7047
488 Ga0495580_0085278 3300046472 Bacteria 2200
489 Ga0495582_0007979 3300046473 Bacteria 5847
490 Ga0495582_0055447 3300046473 Bacteria 2185
491 Ga0495605_0119773 3300046474 Bacteria 1194
492 Ga0495639_0005290 3300046475 Bacteria 5553
493 Ga0495639_0143968 3300046475 Bacteria 1147
494 Ga0495639_0171284 3300046475 Bacteria 1054
495 Ga0495662_0002831 3300046476 Bacteria 8772
496 Ga0495664_0050963 3300046477 Bacteria 2458
497 Ga0495584_0048919 3300046491 Bacteria 2131
498 Ga0495584_0098845 3300046491 Bacteria 1474
499 Ga0495585_0195391 3300046492 Bacteria 1033
500 Ga0495594_0004642 3300046499 Bacteria 7076
501 Ga0495594_0156363 3300046499 Bacteria 1295
502 Ga0495596_0022258 3300046500 Bacteria 2581
503 Ga0495607_0201323 3300046501 Bacteria 985
504 Ga0495606_0002132 3300046507 Bacteria 23896
505 Ga0495606_0307896 3300046507 Bacteria 856
506 Ga0495608_0005431 3300046511 Bacteria 9112
507 Ga0495608_0017029 3300046511 Bacteria 5028
508 Ga0495616_0099681 3300046513 Bacteria 1364
509 Ga0495618_0005075 3300046514 Bacteria 8041
510 Ga0495618_0007998 3300046514 Bacteria 6401
511 Ga0495618_0024391 3300046514 Bacteria 3745
512 Ga0495628_0013324 3300046516 Bacteria 6918
513 Ga0495628_0091840 3300046516 Bacteria 2349
514 Ga0495630_0080229 3300046517 Bacteria 2461
515 Ga0495631_0055557 3300046518 Bacteria 1725
516 Ga0495632_0079237 3300046519 Bacteria 1568
517 Ga0495644_0093169 3300046523 Bacteria 1138
518 Ga0495642_0144998 3300046528 Bacteria 1026
519 Ga0495652_0036615 3300046529 Bacteria 4263
520 Ga0495652_0140961 3300046529 Bacteria 1896
521 Ga0495652_0399026 3300046529 Bacteria 974
522 Ga0495665_0005469 3300046531 Bacteria 6842
523 Ga0495640_0013286 3300046533 Bacteria 6261
524 Ga0495640_0095621 3300046533 Bacteria 1955
525 Ga0495640_0323080 3300046533 Bacteria 955
526 Ga0495586_0025634 3300046535 Bacteria 3155
527 Ga0495587_0032594 3300046536 Bacteria 3148
528 Ga0495587_0065474 3300046536 Bacteria 2122
529 Ga0495609_0100569 3300046538 Bacteria 1253
530 Ga0495597_0070860 3300046542 Bacteria 1502
531 Ga0495597_0091041 3300046542 Bacteria 1295
532 Ga0495645_0016900 3300046543 Bacteria 5222
533 Ga0495645_0092738 3300046543 Bacteria 2156
534 Ga0495622_0040178 3300046557 Bacteria 2177
535 Ga0495667_0005621 3300046559 Bacteria 8473
536 Ga0495667_0022396 3300046559 Bacteria 4256
537 Ga0495667_0042286 3300046559 Bacteria 3021
538 Ga0495656_0106398 3300046615 Bacteria 1305
539 Ga0495656_0152990 3300046615 Bacteria 1115
540 Ga0495668_0275331 3300046616 Bacteria 922
541 Ga0495668_0323232 3300046616 Bacteria 846
542 Ga0495634_0003738 3300046642 Bacteria 12123
543 Ga0495635_0016717 3300046663 Bacteria 5125
544 Ga0495635_0066959 3300046663 Bacteria 2463
545 Ga0495635_0149125 3300046663 Bacteria 1592
546 Ga0495659_0087863 3300046664 Bacteria 1189
547 Ga0495588_0074221 3300046674 Bacteria 1771
548 Ga0495588_0210121 3300046674 Bacteria 1028
549 Ga0495657_0010362 3300046675 Bacteria 7014
550 Ga0495657_0252330 3300046675 Bacteria 1062
551 Ga0495599_0001369 3300046678 Bacteria 13928
552 Ga0495599_0010490 3300046678 Bacteria 5668
553 Ga0495623_0048549 3300046679 Bacteria 2691
554 Ga0495623_0063867 3300046679 Bacteria 2304
555 Ga0495623_0111971 3300046679 Bacteria 1653
556 Ga0495646_0037975 3300046680 Bacteria 2976
557 Ga0495647_0021633 3300046681 Bacteria 2317
558 Ga0495658_0003784 3300046683 Bacteria 7489
559 Ga0495669_0007888 3300046684 Bacteria 4467
560 Ga0495613_0007099 3300046689 Bacteria 8338
561 Ga0495613_0187655 3300046689 Bacteria 1462
562 Ga0495624_0026173 3300046690 Bacteria 3823
563 Ga0495589_0136476 3300046794 Bacteria 1176
564 Ga0495600_0001020 3300046809 Bacteria 15122
565 Ga0495600_0012902 3300046809 Bacteria 5236
566 Ga0495660_0178800 3300046810 Bacteria 1028
567 Ga0495581_0021836 3300047315 Bacteria 3709
568 Ga0495581_0040392 3300047315 Bacteria 2700
569 Ga0495581_0079411 3300047315 Bacteria 1899
570 Ga0495674_0000458 3300047319 Bacteria 36828
571 Ga0495674_0046443 3300047319 Bacteria 3854
572 Ga0495672_0011321 3300047320 Bacteria 6304
573 Ga0495676_0052694 3300047321 Bacteria 3246
574 Ga0495676_0060342 3300047321 Bacteria 2973
575 Ga0495680_0006528 3300047322 Bacteria 10827
576 Ga0495680_0064893 3300047322 Bacteria 2798
577 Ga0495683_0044221 3300047323 Bacteria 2240
578 Ga0495675_0000923 3300047444 Bacteria 17856
579 Ga0495675_0206652 3300047444 Bacteria 1193
580 Ga0495677_0129656 3300047445 Bacteria 965
581 Ga0495673_0048090 3300047469 Bacteria 1882
582 Ga0495684_0000340 3300047471 Bacteria 37592
583 Ga0495684_0008134 3300047471 Bacteria 8111
584 Ga0495684_0028828 3300047471 Bacteria 4262
585 Ga0495686_0152280 3300047472 Bacteria 1357
586 Ga0495686_0164948 3300047472 Bacteria 1292
587 Ga0495593_0000687 3300047673 Bacteria 19500
588 Ga0495593_0006332 3300047673 Bacteria 6945
589 Ga0495602_0137058 3300048088 Bacteria 1943
590 Ga0495602_0185065 3300048088 Bacteria 1602
591 Ga0495602_0433537 3300048088 Bacteria 931
592 Ga0495615_0119467 3300048090 Bacteria 761
593 Ga0496100_0003120 3300048903 Bacteria 8577
594 Ga0496100_0048593 3300048903 Bacteria 2739
595 Ga0496100_0132686 3300048903 Bacteria 1756
596 Ga0496101_0122156 3300048904 Bacteria 1970
597 Ga0496101_0486088 3300048904 Bacteria 975
598 Ga0496102_0002648 3300048905 Bacteria 15215
599 Ga0496102_0136319 3300048905 Bacteria 2300
600 Ga0496103_0017806 3300048906 Bacteria 4256
601 Ga0496104_0007648 3300048907 Bacteria 9566
602 Ga0496104_0105435 3300048907 Bacteria 2701
603 Ga0496104_0335683 3300048907 Bacteria 1424
604 Ga0496105_0042398 3300048908 Bacteria 3751
605 Ga0496105_0147641 3300048908 Bacteria 1933
606 Ga0496105_0231595 3300048908 Bacteria 1501
607 Ga0496106_0015920 3300048909 Bacteria 5562
608 Ga0496106_0122350 3300048909 Bacteria 2035
609 Ga0496106_0155540 3300048909 Bacteria 1805
610 Ga0496106_0259516 3300048909 Bacteria 1390
611 Ga0496106_0346539 3300048909 Bacteria 1193
612 Ga0496106_0349577 3300048909 Bacteria 1187
613 Ga0496107_0004783 3300048910 Bacteria 9200
614 Ga0496107_0004967 3300048910 Bacteria 9052
615 Ga0496107_0230110 3300048910 Bacteria 1379
616 Ga0496108_0000938 3300048911 Bacteria 22748
617 Ga0496108_0016559 3300048911 Bacteria 6018
618 Ga0496108_0653925 3300048911 Bacteria 913
619 Ga0496109_0001723 3300048912 Bacteria 18237
620 Ga0496109_0008707 3300048912 Bacteria 8639
621 Ga0496109_0198825 3300048912 Bacteria 1884
622 Ga0496109_0207737 3300048912 Bacteria 1841
623 Ga0496109_0348248 3300048912 Bacteria 1399
624 Ga0496110_0003174 3300048913 Bacteria 12507
625 Ga0496110_0101921 3300048913 Bacteria 2574
626 Ga0496110_0148931 3300048913 Bacteria 2118
627 Ga0496110_0178575 3300048913 Bacteria 1927
628 Ga0496111_0047665 3300048914 Bacteria 3086
629 Ga0496111_0072809 3300048914 Bacteria 2501
630 Ga0496111_0120465 3300048914 Bacteria 1938
631 Ga0496111_0230872 3300048914 Bacteria 1374
632 Ga0496112_0000014 3300048915 Bacteria 210932
633 Ga0496112_0000590 3300048915 Bacteria 24921
634 Ga0496112_0045788 3300048915 Bacteria 4288
635 Ga0496112_0066467 3300048915 Bacteria 3557
636 Ga0496112_0096875 3300048915 Bacteria 2920
637 Ga0496112_0260750 3300048915 Bacteria 1682
638 Ga0496112_0292386 3300048915 Bacteria 1575
639 Ga0496113_0001909 3300048916 Bacteria 11903
640 Ga0496113_0106631 3300048916 Bacteria 2176
641 Ga0496113_0332810 3300048916 Bacteria 1218
642 Ga0496113_0336513 3300048916 Bacteria 1210
643 Ga0496113_0571363 3300048916 Bacteria 906
644 Ga0496115_0005155 3300048918 Bacteria 9509
645 Ga0496115_0105098 3300048918 Bacteria 2317
646 Ga0496115_0480644 3300048918 Bacteria 1000
647 Ga0496115_0604639 3300048918 Bacteria 871
648 Ga0496116_0001982 3300048919 Bacteria 22049
649 Ga0496117_0021414 3300048920 Bacteria 5230
650 Ga0496118_0039825 3300048921 Bacteria 3744
651 Ga0496118_0105489 3300048921 Bacteria 1889
652 Ga0496119_0167995 3300048922 Bacteria 1161
653 Ga0496119_0224518 3300048922 Bacteria 959
654 Ga0496121_0000379 3300048924 Bacteria 91131
655 Ga0496121_0007216 3300048924 Bacteria 13458
656 Ga0496121_0009899 3300048924 Bacteria 10855
657 Ga0496121_0031316 3300048924 Bacteria 4861
658 Ga0496121_0134182 3300048924 Bacteria 1847
659 Ga0496121_0142705 3300048924 Bacteria 1774
660 Ga0496121_0202708 3300048924 Bacteria 1413
661 Ga0496121_0411611 3300048924 Bacteria 882
662 Ga0496122_0095791 3300048925 Bacteria 2004
663 Ga0496124_0139987 3300048927 Bacteria 1911
664 Ga0496124_0274664 3300048927 Bacteria 1232
665 Ga0496124_0320749 3300048927 Bacteria 1109
666 Ga0496125_0000199 3300048928 Bacteria 126676
667 Ga0496125_0000964 3300048928 Bacteria 45175
668 Ga0496125_0036169 3300048928 Bacteria 4316
669 Ga0496125_0213882 3300048928 Bacteria 1249
670 Ga0496126_0003657 3300048929 Bacteria 19210
671 Ga0496126_0009808 3300048929 Bacteria 10138
672 Ga0496126_0011726 3300048929 Bacteria 9031
673 Ga0496126_0027947 3300048929 Bacteria 5379
674 Ga0496126_0064385 3300048929 Bacteria 3284
675 Ga0496126_0102702 3300048929 Bacteria 2499
676 Ga0496126_0157970 3300048929 Bacteria 1939
677 Ga0496126_0172815 3300048929 Bacteria 1840
678 Ga0495678_084732 3300049459 Bacteria 1130
679 Ga0501031_0000712 3300049568 Bacteria 19893
680 Ga0501031_0007196 3300049568 Bacteria 7260
681 Ga0501032_0001162 3300049569 Bacteria 21118
682 Ga0501032_0012997 3300049569 Bacteria 5929
683 Ga0501032_0205935 3300049569 Bacteria 1283
684 Ga0501032_0317195 3300049569 Bacteria 1006
685 Ga0501033_0000163 3300049570 Bacteria 63913
686 Ga0501033_0003345 3300049570 Bacteria 13239
687 Ga0501033_0017017 3300049570 Bacteria 5495
688 Ga0501033_0028416 3300049570 Bacteria 4201
689 Ga0501033_0178507 3300049570 Bacteria 1523
690 Ga0501034_0000202 3300049571 Bacteria 112985
691 Ga0501034_0703859 3300049571 Bacteria 908
692 Ga0501036_0000021 3300049572 Bacteria 114136
693 Ga0501037_0001561 3300049573 Bacteria 16713
694 Ga0501037_0002687 3300049573 Bacteria 12835
695 Ga0501037_0077304 3300049573 Bacteria 2415
696 Ga0501038_0000226 3300049574 Bacteria 47831
697 Ga0501038_0008947 3300049574 Bacteria 9185
698 Ga0501038_0201201 3300049574 Bacteria 1598
699 Ga0501038_0227075 3300049574 Bacteria 1487
700 Ga0501039_0001542 3300049575 Bacteria 16931
701 Ga0501039_0091639 3300049575 Bacteria 2369
702 Ga0501039_0662939 3300049575 Bacteria 817
703 Ga0501042_0073795 3300049578 Bacteria 2440
704 Ga0501042_0219802 3300049578 Bacteria 1370
705 Ga0501043_0000297 3300049579 Bacteria 44905
706 Ga0501043_0054128 3300049579 Bacteria 3151
707 Ga0501043_0216935 3300049579 Bacteria 1481
708 Ga0501046_0000354 3300049580 Bacteria 46165
709 Ga0501046_0004244 3300049580 Bacteria 13045
710 Ga0501046_0123794 3300049580 Bacteria 1966
711 Ga0501047_0000232 3300049581 Bacteria 66245
712 Ga0501047_0042605 3300049581 Bacteria 4386
713 Ga0501047_0076009 3300049581 Bacteria 3232
714 Ga0501047_0293276 3300049581 Bacteria 1470
715 Ga0501047_0486757 3300049581 Bacteria 1061
716 Ga0501047_0608237 3300049581 Bacteria 914
717 Ga0501048_0000050 3300049582 Bacteria 57921
718 Ga0501048_0148342 3300049582 Bacteria 1659
719 Ga0501067_0001956 3300049583 Bacteria 11350
720 Ga0501068_0005647 3300049584 Bacteria 6852
721 Ga0501069_0013995 3300049585 Bacteria 4285
722 Ga0501070_0012142 3300049586 Bacteria 7269
723 Ga0501070_0252540 3300049586 Bacteria 1442
724 Ga0501071_0071472 3300049587 Bacteria 2530
725 Ga0501072_0002675 3300049588 Bacteria 13364
726 Ga0501073_0000329 3300049589 Bacteria 31824
727 Ga0501073_0099433 3300049589 Bacteria 2020
728 Ga0501074_0000092 3300049590 Bacteria 43073
729 Ga0501076_0262901 3300049592 Bacteria 1413
730 Ga0501079_0026857 3300049741 Bacteria 4414
731 Ga0501079_0812739 3300049741 Bacteria 736
732 Ga0501080_0003432 3300049742 Bacteria 13983
733 Ga0501083_0107217 3300049744 Bacteria 1838
734 Ga0501035_0000120 3300049822 Bacteria 94532
735 Ga0501035_0034371 3300049822 Bacteria 4606
736 Ga0501035_0155462 3300049822 Bacteria 1982
737 Ga0501035_0155631 3300049822 Bacteria 1981
738 Ga0501044_0000179 3300049823 Bacteria 78633
739 Ga0501044_0006711 3300049823 Bacteria 12684
740 Ga0501044_0181637 3300049823 Bacteria 2070
741 Ga0501044_0181763 3300049823 Bacteria 2069
742 Ga0501044_0271612 3300049823 Bacteria 1631
743 Ga0501044_0408919 3300049823 Bacteria 1268
744 Ga0501044_0556973 3300049823 Bacteria 1043
745 Ga0501044_0653889 3300049823 Bacteria 940
746 Ga0501045_0009859 3300049824 Bacteria 6681
747 nmdc:mga03683_34785_c1 3300050489 Bacteria 1225
748 nmdc:mga03683_96169_c1 3300050489 Bacteria 1297
749 nmdc:mga03n38_230662_c1 3300050490 Bacteria 970
750 nmdc:mga03n38_5857_c1 3300050490 Bacteria 4224
751 nmdc:mga03n38_72170_c1 3300050490 Bacteria 1600
752 nmdc:mga00v17_190560_c1 3300050491 Bacteria 1324
753 nmdc:mga00v17_42278_c1 3300050491 Bacteria 2740
754 nmdc:mga0yw44_126007_c1 3300050492 Bacteria 1654
755 nmdc:mga0yw44_295905_c1 3300050492 Bacteria 1084
756 nmdc:mga0k408_444887_c1 3300050493 Bacteria 770
757 nmdc:mga06z11_167171_c1 3300050494 Bacteria 1261
758 nmdc:mga06z11_26303_c1 3300050494 Bacteria 2768
759 nmdc:mga04h51_58700_c1 3300050495 Bacteria 1313
760 nmdc:mga04h51_60168_c1 3300050495 Bacteria 1300
761 nmdc:mga07m45_51114_c1 3300050496 Bacteria 2330
762 nmdc:mga07m45_71267_c1 3300050496 Bacteria 1977
763 nmdc:mga09592_440437_c1 3300050508 Bacteria 1124
764 nmdc:mga08y16_490201_c1 3300050511 Bacteria 1250
765 nmdc:mga0rr50_385367_c1 3300050513 Bacteria 1182
766 nmdc:mga0rr50_654979_c1 3300050513 Bacteria 896
767 nmdc:mga0sz30_5222_c1 3300050516 Bacteria 4752
768 Ga0495601_0028806 3300053077 Bacteria 3441
769 Ga0495612_0072948 3300053078 Bacteria 1434
770 Ga0500635_0000667 3300053080 Bacteria 8700
771 Ga0495619_0006768 3300053085 Bacteria 7250
772 Ga0495619_0064113 3300053085 Bacteria 2449
773 Ga0500583_0022152 3300053092 Bacteria 2657
774 Ga0500651_0162632 3300053093 Bacteria 1334
775 Ga0500566_0018229 3300053094 Bacteria 4124
776 Ga0500566_0145806 3300053094 Bacteria 1251
777 Ga0500641_0027059 3300053096 Bacteria 2231
778 Ga0500554_002502 3300053102 Bacteria 3626
779 Ga0500554_007950 3300053102 Bacteria 2466
780 Ga0500556_0000003 3300053104 Bacteria 679379
781 Ga0500556_0063239 3300053104 Bacteria 1368
782 Ga0500595_000414 3300053119 Bacteria 27179
783 Ga0500618_028139 3300053125 Bacteria 1333
784 Ga0500642_0072461 3300053130 Bacteria 1570
785 Ga0500568_0007066 3300053139 Bacteria 5548
786 Ga0500577_0058518 3300053142 Bacteria 1474
787 Ga0500588_0121232 3300053146 Bacteria 923
788 Ga0500589_044338 3300053147 Bacteria 2073
789 Ga0500590_098273 3300053148 Bacteria 1410
790 Ga0500603_000634 3300053150 Bacteria 8611
791 Ga0500616_0000028 3300053153 Bacteria 435722
792 Ga0500638_006577 3300053162 Bacteria 4772
793 Ga0500637_0001208 3300053178 Bacteria 10778
794 Ga0500567_131420 3300053723 Bacteria 978
795 Ga0500611_023524 3300053727 Bacteria 1201
796 Ga0500645_028254 3300053730 Bacteria 1698
797 Ga0501084_0136077 3300054114 Bacteria 2068
798 Ga0500661_000369 3300055283 Bacteria 8304
799 Ga0501082_0011284 3300060353 Bacteria 7680

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050489 nmdc:mga03683_34785_c1 nmdc:mga03683_34785_c1_19_693 203
2 3300050513 nmdc:mga0rr50_654979_c1 nmdc:mga0rr50_654979_c1_224_886 203
3 3300028577 Ga0265318_10008392 Ga0265318_100083925 207
4 3300037471 Ga0395905_0858470 Ga0395905_0858470_112_786 207
5 3300046459 Ga0495629_0593104 Ga0495629_0593104_13_687 207
6 3300046474 Ga0495605_0119773 Ga0495605_0119773_22_693 207
7 3300048090 Ga0495615_0119467 Ga0495615_0119467_11_685 207
8 3300049575 Ga0501039_0662939 Ga0501039_0662939_130_801 207
9 3300049741 Ga0501079_0812739 Ga0501079_0812739_10_681 207
10 3300048915 Ga0496112_0260750 Ga0496112_0260750_951_1670 222
11 3300035118 Ga0373954_0221369 Ga0373954_0221369_193_912 223
12 3300035724 Ga0373933_0517703 Ga0373933_0517703_29_748 223
13 3300046616 Ga0495668_0323232 Ga0495668_0323232_86_808 223
14 3300050493 nmdc:mga0k408_444887_c1 nmdc:mga0k408_444887_c1_17_739 223
15 iso_pu_bacteria 2904699407 2904700548 227
16 3300005327 Ga0070658_10017379 Ga0070658_100173791 231
17 3300005435 Ga0070714_100087813 Ga0070714_1000878132 231
18 3300005981 Ga0081538_10009846 Ga0081538_100098463 231
19 3300025929 Ga0207664_10114239 Ga0207664_101142392 231
20 3300025986 Ga0207658_10584041 Ga0207658_105840412 231
21 3300046455 Ga0495603_0364964 Ga0495603_0364964_68_814 231
22 3300046471 Ga0495650_0029475 Ga0495650_0029475_1707_2468 231
23 3300048907 Ga0496104_0335683 Ga0496104_0335683_13_759 231
24 iso_pu_bacteria 2643221651 2644289336 231
25 3300005366 Ga0070659_100358299 Ga0070659_1003582992 232
26 3300005548 Ga0070665_100279343 Ga0070665_1002793432 232
27 3300005937 Ga0081455_10005785 Ga0081455_100057857 232
28 3300005983 Ga0081540_1011669 Ga0081540_10116695 232
29 3300006177 Ga0075362_10017480 Ga0075362_100174802 232
30 3300025932 Ga0207690_10404702 Ga0207690_104047022 232
31 3300032002 Ga0307416_100168152 Ga0307416_1001681522 232
32 3300037418 Ga0395900_0029686 Ga0395900_0029686_4681_5427 232
33 3300037466 Ga0395898_0074232 Ga0395898_0074232_2312_3058 232
34 3300038443 Ga0395901_0004721 Ga0395901_0004721_1787_2533 232
35 3300003659 JGI25404J52841_10007849 JGI25404J52841_100078493 233
36 3300005937 Ga0081455_10006447 Ga0081455_100064476 233
37 3300005983 Ga0081540_1002041 Ga0081540_10020415 233
38 3300005985 Ga0081539_10091602 Ga0081539_100916022 233
39 3300009147 Ga0114129_11312661 Ga0114129_113126611 233
40 3300046529 Ga0495652_0140961 Ga0495652_0140961_157_918 233
41 3300050513 nmdc:mga0rr50_385367_c1 nmdc:mga0rr50_385367_c1_91_903 233
42 iso_pu_bacteria 2513237096 2513657286 233
43 iso_pu_bacteria 2513237104 2513722085 233
44 iso_pu_bacteria 2513237137 2513857757 233
45 iso_pu_bacteria 2513237145 2513919294 233
46 iso_pu_bacteria 2517572143 2517891014 233
47 iso_pu_bacteria 2524023210 2524464984 233
48 iso_pu_bacteria 2524023228 2524537541 233
49 iso_pu_bacteria 2602042107 2603860390 233
50 iso_pu_bacteria 2667528175 2671120069 233
51 iso_pu_bacteria 2728368998 2728752661 233
52 iso_pu_bacteria 2791355197 2793066370 233
53 iso_pu_bacteria 2885374607 2885377335 233
54 iso_pu_bacteria 2885383462 2885390517 233
55 iso_pu_bacteria 2889033259 2889037640 233
56 iso_pu_bacteria 2904690495 2904694460 233
57 iso_pu_bacteria 2906610324 2906616213 233
58 iso_pu_bacteria 2906635258 2906636956 233
59 iso_pu_bacteria 2906660503 2906664450 233
60 iso_pu_bacteria 2908756301 2908763404 233
61 iso_pu_bacteria 2922425934 2922431811 233
62 iso_pu_bacteria 2935630451 2935635347 233
63 iso_pu_bacteria 2941507105 2941512151 233
64 iso_pu_bacteria 2941515067 2941519853 233
65 iso_pu_bacteria 2941523033 2941527860 233
66 iso_pu_bacteria 3005474847 3005481752 233
67 iso_pu_bacteria 8006933436 8006939118 233
68 iso_pu_bacteria 8006973647 8006978775 233
69 iso_pu_bacteria 8006984368 8006985030 233
70 iso_pu_bacteria 8019555841 8019559928 233
71 iso_pu_bacteria 8019565922 8019570031 233
72 iso_pu_bacteria 8056681323 8056687847 233
73 iso_pu_bacteria 8056689827 8056690509 233
74 3300005455 Ga0070663_100031126 Ga0070663_1000311262 234
75 3300005563 Ga0068855_100857449 Ga0068855_1008574491 234
76 3300025909 Ga0207705_10394159 Ga0207705_103941591 234
77 3300025949 Ga0207667_10419859 Ga0207667_104198592 234
78 3300026067 Ga0207678_10044166 Ga0207678_100441662 234
79 3300044684 Ga0466966_0021986 Ga0466966_0021986_2779_3540 234
80 3300049581 Ga0501047_0293276 Ga0501047_0293276_50_811 234
81 3300005435 Ga0070714_100245164 Ga0070714_1002451642 235
82 3300006353 Ga0075370_10192265 Ga0075370_101922651 235
83 3300006941 Ga0099825_1034330 Ga0099825_10343302 235
84 3300006942 Ga0099824_1022834 Ga0099824_10228343 235
85 3300006943 Ga0099822_1000663 Ga0099822_100066325 235
86 3300025929 Ga0207664_10471245 Ga0207664_104712451 235
87 3300026089 Ga0207648_10562863 Ga0207648_105628631 235
88 3300027357 Ga0209589_1000006 Ga0209589_1000006128 235
89 3300027361 Ga0209489_100007 Ga0209489_100007128 235
90 3300027363 Ga0209700_100008 Ga0209700_100008128 235
91 3300035170 Ga0373943_0038735 Ga0373943_0038735_412_1167 235
92 3300035725 Ga0373947_0024847 Ga0373947_0024847_2590_3345 235
93 3300037068 Ga0373925_0046932 Ga0373925_0046932_78_833 235
94 3300037068 Ga0373925_0127608 Ga0373925_0127608_121_876 235
95 3300046475 Ga0495639_0143968 Ga0495639_0143968_80_835 235
96 3300047315 Ga0495581_0040392 Ga0495581_0040392_518_1273 235
97 3300048904 Ga0496101_0486088 Ga0496101_0486088_203_958 235
98 3300049581 Ga0501047_0042605 Ga0501047_0042605_1040_1798 235
99 3300049581 Ga0501047_0608237 Ga0501047_0608237_38_796 235
100 3300049823 Ga0501044_0271612 Ga0501044_0271612_537_1295 235
101 3300049823 Ga0501044_0653889 Ga0501044_0653889_34_792 235
102 iso_pu_bacteria 8006926726 8006933299 235
103 3300005327 Ga0070658_10217213 Ga0070658_102172132 236
104 3300005327 Ga0070658_10357162 Ga0070658_103571622 236
105 3300005327 Ga0070658_10618823 Ga0070658_106188231 236
106 3300005334 Ga0068869_100293012 Ga0068869_1002930122 236
107 3300005338 Ga0068868_100070712 Ga0068868_1000707122 236
108 3300005355 Ga0070671_100281335 Ga0070671_1002813351 236
109 3300005364 Ga0070673_100443489 Ga0070673_1004434891 236
110 3300005455 Ga0070663_100024100 Ga0070663_1000241002 236
111 3300005535 Ga0070684_100182790 Ga0070684_1001827902 236
112 3300005539 Ga0068853_100136181 Ga0068853_1001361812 236
113 3300005548 Ga0070665_100259734 Ga0070665_1002597342 236
114 3300005548 Ga0070665_100373579 Ga0070665_1003735792 236
115 3300005564 Ga0070664_100226606 Ga0070664_1002266062 236
116 3300005616 Ga0068852_100038624 Ga0068852_1000386242 236
117 3300005618 Ga0068864_100186578 Ga0068864_1001865782 236
118 3300005834 Ga0068851_10022662 Ga0068851_100226623 236
119 3300005983 Ga0081540_1025347 Ga0081540_10253472 236
120 3300010375 Ga0105239_10241825 Ga0105239_102418252 236
121 3300013296 Ga0157374_10021557 Ga0157374_100215574 236
122 3300013306 Ga0163162_10055264 Ga0163162_100552642 236
123 3300013308 Ga0157375_10107155 Ga0157375_101071552 236
124 3300014325 Ga0163163_10047687 Ga0163163_100476873 236
125 3300014969 Ga0157376_10135631 Ga0157376_101356312 236
126 3300025261 Ga0209233_1001048 Ga0209233_10010484 236
127 3300025272 Ga0209455_1008722 Ga0209455_10087222 236
128 3300025321 Ga0207656_10051332 Ga0207656_100513322 236
129 3300025909 Ga0207705_10332892 Ga0207705_103328922 236
130 3300025909 Ga0207705_10705146 Ga0207705_107051461 236
131 3300025931 Ga0207644_10457323 Ga0207644_104573231 236
132 3300025939 Ga0207665_10372546 Ga0207665_103725461 236
133 3300025941 Ga0207711_10623100 Ga0207711_106231001 236
134 3300025942 Ga0207689_10120814 Ga0207689_101208142 236
135 3300025945 Ga0207679_10191197 Ga0207679_101911972 236
136 3300026023 Ga0207677_10007590 Ga0207677_100075902 236
137 3300026041 Ga0207639_10112553 Ga0207639_101125532 236
138 3300026067 Ga0207678_10008442 Ga0207678_100084423 236
139 3300028379 Ga0268266_10310650 Ga0268266_103106502 236
140 3300028379 Ga0268266_10697362 Ga0268266_106973621 236
141 3300033180 Ga0307510_10021805 Ga0307510_100218052 236
142 3300037418 Ga0395900_0215213 Ga0395900_0215213_875_1636 236
143 3300044706 Ga0466964_0082603 Ga0466964_0082603_94_897 236
144 3300046473 Ga0495582_0055447 Ga0495582_0055447_1204_1962 236
145 3300047320 Ga0495672_0011321 Ga0495672_0011321_5105_5866 236
146 3300048903 Ga0496100_0003120 Ga0496100_0003120_7543_8304 236
147 3300048905 Ga0496102_0002648 Ga0496102_0002648_5321_6082 236
148 3300048906 Ga0496103_0017806 Ga0496103_0017806_1489_2250 236
149 3300048907 Ga0496104_0007648 Ga0496104_0007648_175_936 236
150 3300048908 Ga0496105_0042398 Ga0496105_0042398_22_783 236
151 3300048910 Ga0496107_0004967 Ga0496107_0004967_793_1599 236
152 3300048911 Ga0496108_0016559 Ga0496108_0016559_2552_3313 236
153 3300048912 Ga0496109_0008707 Ga0496109_0008707_4836_5597 236
154 3300048913 Ga0496110_0003174 Ga0496110_0003174_389_1150 236
155 3300048914 Ga0496111_0047665 Ga0496111_0047665_74_835 236
156 3300048916 Ga0496113_0001909 Ga0496113_0001909_9102_9863 236
157 3300048918 Ga0496115_0005155 Ga0496115_0005155_5158_5919 236
158 3300048924 Ga0496121_0009899 Ga0496121_0009899_3755_4516 236
159 3300048924 Ga0496121_0031316 Ga0496121_0031316_861_1622 236
160 3300049568 Ga0501031_0007196 Ga0501031_0007196_2175_2933 236
161 3300049569 Ga0501032_0012997 Ga0501032_0012997_2435_3193 236
162 3300049570 Ga0501033_0003345 Ga0501033_0003345_10101_10859 236
163 3300049573 Ga0501037_0002687 Ga0501037_0002687_2946_3704 236
164 3300049574 Ga0501038_0008947 Ga0501038_0008947_1141_1899 236
165 3300049574 Ga0501038_0227075 Ga0501038_0227075_85_843 236
166 3300049578 Ga0501042_0073795 Ga0501042_0073795_1046_1804 236
167 3300049579 Ga0501043_0054128 Ga0501043_0054128_212_970 236
168 3300049580 Ga0501046_0004244 Ga0501046_0004244_2154_2912 236
169 3300049581 Ga0501047_0486757 Ga0501047_0486757_135_893 236
170 3300049582 Ga0501048_0148342 Ga0501048_0148342_112_870 236
171 3300049589 Ga0501073_0099433 Ga0501073_0099433_146_904 236
172 3300049822 Ga0501035_0034371 Ga0501035_0034371_1566_2324 236
173 3300049823 Ga0501044_0006711 Ga0501044_0006711_2167_2925 236
174 3300053080 Ga0500635_0000667 Ga0500635_0000667_461_1219 236
175 3300053102 Ga0500554_007950 Ga0500554_007950_489_1247 236
176 3300053150 Ga0500603_000634 Ga0500603_000634_5342_6100 236
177 3300053153 Ga0500616_0000028 Ga0500616_0000028_225080_225841 236
178 3300053178 Ga0500637_0001208 Ga0500637_0001208_4755_5513 236
179 3300003203 JGI25406J46586_10000018 JGI25406J46586_1000001826 237
180 3300003203 JGI25406J46586_10006262 JGI25406J46586_100062621 237
181 3300003215 JGI25153J46596_10027455 JGI25153J46596_100274552 237
182 3300003659 JGI25404J52841_10024308 JGI25404J52841_100243082 237
183 3300005327 Ga0070658_10017070 Ga0070658_100170702 237
184 3300005329 Ga0070683_100067142 Ga0070683_1000671422 237
185 3300005331 Ga0070670_100368057 Ga0070670_1003680572 237
186 3300005334 Ga0068869_100037113 Ga0068869_1000371132 237
187 3300005336 Ga0070680_100037799 Ga0070680_1000377991 237
188 3300005338 Ga0068868_100103472 Ga0068868_1001034722 237
189 3300005338 Ga0068868_100588298 Ga0068868_1005882981 237
190 3300005339 Ga0070660_100014841 Ga0070660_1000148413 237
191 3300005339 Ga0070660_100204725 Ga0070660_1002047252 237
192 3300005340 Ga0070689_100219851 Ga0070689_1002198511 237
193 3300005343 Ga0070687_100287400 Ga0070687_1002874001 237
194 3300005344 Ga0070661_100018037 Ga0070661_1000180373 237
195 3300005344 Ga0070661_100051288 Ga0070661_1000512882 237
196 3300005347 Ga0070668_100023719 Ga0070668_1000237195 237
197 3300005347 Ga0070668_100040432 Ga0070668_1000404322 237
198 3300005347 Ga0070668_100086528 Ga0070668_1000865282 237
199 3300005347 Ga0070668_100207763 Ga0070668_1002077632 237
200 3300005347 Ga0070668_100370502 Ga0070668_1003705021 237
201 3300005347 Ga0070668_100569766 Ga0070668_1005697661 237
202 3300005353 Ga0070669_100296940 Ga0070669_1002969402 237
203 3300005355 Ga0070671_100347479 Ga0070671_1003474791 237
204 3300005356 Ga0070674_100100743 Ga0070674_1001007432 237
205 3300005356 Ga0070674_100142856 Ga0070674_1001428562 237
206 3300005366 Ga0070659_100121888 Ga0070659_1001218882 237
207 3300005367 Ga0070667_100110095 Ga0070667_1001100951 237
208 3300005367 Ga0070667_100739120 Ga0070667_1007391201 237
209 3300005434 Ga0070709_10251069 Ga0070709_102510692 237
210 3300005434 Ga0070709_10397920 Ga0070709_103979201 237
211 3300005436 Ga0070713_100002525 Ga0070713_1000025257 237
212 3300005436 Ga0070713_100085245 Ga0070713_1000852452 237
213 3300005437 Ga0070710_10032264 Ga0070710_100322643 237
214 3300005439 Ga0070711_100004216 Ga0070711_1000042166 237
215 3300005439 Ga0070711_100019917 Ga0070711_1000199174 237
216 3300005441 Ga0070700_100303946 Ga0070700_1003039461 237
217 3300005445 Ga0070708_100108425 Ga0070708_1001084252 237
218 3300005455 Ga0070663_100003295 Ga0070663_1000032953 237
219 3300005455 Ga0070663_100301555 Ga0070663_1003015552 237
220 3300005455 Ga0070663_100345819 Ga0070663_1003458191 237
221 3300005456 Ga0070678_100450127 Ga0070678_1004501271 237
222 3300005457 Ga0070662_100065103 Ga0070662_1000651032 237
223 3300005457 Ga0070662_100276008 Ga0070662_1002760081 237
224 3300005458 Ga0070681_10016550 Ga0070681_100165502 237
225 3300005459 Ga0068867_100017580 Ga0068867_1000175803 237
226 3300005466 Ga0070685_10064189 Ga0070685_100641892 237
227 3300005467 Ga0070706_100170997 Ga0070706_1001709972 237
228 3300005471 Ga0070698_100216772 Ga0070698_1002167721 237
229 3300005471 Ga0070698_100549134 Ga0070698_1005491341 237
230 3300005530 Ga0070679_100448710 Ga0070679_1004487101 237
231 3300005535 Ga0070684_100025358 Ga0070684_1000253585 237
232 3300005539 Ga0068853_100069858 Ga0068853_1000698581 237
233 3300005539 Ga0068853_100089099 Ga0068853_1000890993 237
234 3300005539 Ga0068853_100164629 Ga0068853_1001646292 237
235 3300005539 Ga0068853_100626591 Ga0068853_1006265912 237
236 3300005543 Ga0070672_100269483 Ga0070672_1002694831 237
237 3300005548 Ga0070665_100027974 Ga0070665_1000279745 237
238 3300005548 Ga0070665_100112185 Ga0070665_1001121852 237
239 3300005548 Ga0070665_100173609 Ga0070665_1001736092 237
240 3300005548 Ga0070665_100196467 Ga0070665_1001964672 237
241 3300005548 Ga0070665_100257171 Ga0070665_1002571712 237
242 3300005563 Ga0068855_100054258 Ga0068855_1000542585 237
243 3300005563 Ga0068855_100179453 Ga0068855_1001794533 237
244 3300005563 Ga0068855_100215760 Ga0068855_1002157602 237
245 3300005563 Ga0068855_100439184 Ga0068855_1004391842 237
246 3300005563 Ga0068855_100574863 Ga0068855_1005748632 237
247 3300005564 Ga0070664_100053456 Ga0070664_1000534563 237
248 3300005577 Ga0068857_100042553 Ga0068857_1000425533 237
249 3300005578 Ga0068854_100094867 Ga0068854_1000948672 237
250 3300005578 Ga0068854_100216648 Ga0068854_1002166482 237
251 3300005614 Ga0068856_100000505 Ga0068856_10000050539 237
252 3300005614 Ga0068856_100141898 Ga0068856_1001418982 237
253 3300005616 Ga0068852_100014578 Ga0068852_1000145784 237
254 3300005616 Ga0068852_100097767 Ga0068852_1000977672 237
255 3300005616 Ga0068852_100108144 Ga0068852_1001081442 237
256 3300005617 Ga0068859_100639053 Ga0068859_1006390532 237
257 3300005618 Ga0068864_100221833 Ga0068864_1002218332 237
258 3300005718 Ga0068866_10106928 Ga0068866_101069282 237
259 3300005718 Ga0068866_10237679 Ga0068866_102376792 237
260 3300005834 Ga0068851_10048287 Ga0068851_100482871 237
261 3300005841 Ga0068863_100243328 Ga0068863_1002433282 237
262 3300005843 Ga0068860_100536596 Ga0068860_1005365962 237
263 3300005843 Ga0068860_100675583 Ga0068860_1006755831 237
264 3300005844 Ga0068862_100130594 Ga0068862_1001305943 237
265 3300005844 Ga0068862_100336754 Ga0068862_1003367542 237
266 3300005844 Ga0068862_100503870 Ga0068862_1005038702 237
267 3300005937 Ga0081455_10021510 Ga0081455_100215105 237
268 3300005983 Ga0081540_1007700 Ga0081540_10077004 237
269 3300005983 Ga0081540_1029018 Ga0081540_10290182 237
270 3300005983 Ga0081540_1035571 Ga0081540_10355712 237
271 3300005985 Ga0081539_10000003 Ga0081539_10000003373 237
272 3300005985 Ga0081539_10000199 Ga0081539_1000019997 237
273 3300006038 Ga0075365_10021053 Ga0075365_100210533 237
274 3300006038 Ga0075365_10054204 Ga0075365_100542042 237
275 3300006038 Ga0075365_10078490 Ga0075365_100784902 237
276 3300006038 Ga0075365_10295831 Ga0075365_102958311 237
277 3300006038 Ga0075365_10311402 Ga0075365_103114022 237
278 3300006042 Ga0075368_10004358 Ga0075368_100043583 237
279 3300006042 Ga0075368_10047370 Ga0075368_100473702 237
280 3300006048 Ga0075363_100106380 Ga0075363_1001063801 237
281 3300006048 Ga0075363_100225433 Ga0075363_1002254331 237
282 3300006051 Ga0075364_10061329 Ga0075364_100613292 237
283 3300006051 Ga0075364_10170166 Ga0075364_101701662 237
284 3300006051 Ga0075364_10219239 Ga0075364_102192392 237
285 3300006058 Ga0075432_10136169 Ga0075432_101361691 237
286 3300006163 Ga0070715_10000555 Ga0070715_100005556 237
287 3300006173 Ga0070716_100038543 Ga0070716_1000385433 237
288 3300006177 Ga0075362_10045598 Ga0075362_100455982 237
289 3300006178 Ga0075367_10004219 Ga0075367_100042191 237
290 3300006178 Ga0075367_10047496 Ga0075367_100474963 237
291 3300006186 Ga0075369_10024953 Ga0075369_100249532 237
292 3300006186 Ga0075369_10116774 Ga0075369_101167742 237
293 3300006195 Ga0075366_10091496 Ga0075366_100914962 237
294 3300006237 Ga0097621_100357786 Ga0097621_1003577861 237
295 3300006353 Ga0075370_10058517 Ga0075370_100585172 237
296 3300006353 Ga0075370_10062628 Ga0075370_100626282 237
297 3300006353 Ga0075370_10126688 Ga0075370_101266881 237
298 3300006852 Ga0075433_10586920 Ga0075433_105869201 237
299 3300006871 Ga0075434_100592606 Ga0075434_1005926061 237
300 3300006931 Ga0097620_100639044 Ga0097620_1006390442 237
301 3300007788 Ga0099795_10019849 Ga0099795_100198492 237
302 3300007788 Ga0099795_10046617 Ga0099795_100466172 237
303 3300009093 Ga0105240_10129364 Ga0105240_101293642 237
304 3300009094 Ga0111539_10027346 Ga0111539_100273466 237
305 3300009098 Ga0105245_10075160 Ga0105245_100751602 237
306 3300009101 Ga0105247_10077276 Ga0105247_100772762 237
307 3300009101 Ga0105247_10256397 Ga0105247_102563972 237
308 3300009147 Ga0114129_10664121 Ga0114129_106641211 237
309 3300009177 Ga0105248_10144570 Ga0105248_101445702 237
310 3300009545 Ga0105237_10025971 Ga0105237_100259717 237
311 3300009545 Ga0105237_10131327 Ga0105237_101313272 237
312 3300009545 Ga0105237_10480624 Ga0105237_104806241 237
313 3300009551 Ga0105238_10003279 Ga0105238_100032797 237
314 3300010159 Ga0099796_10031490 Ga0099796_100314901 237
315 3300010375 Ga0105239_10075790 Ga0105239_100757901 237
316 3300010375 Ga0105239_10335478 Ga0105239_103354782 237
317 3300013102 Ga0157371_10089823 Ga0157371_100898232 237
318 3300013104 Ga0157370_10021342 Ga0157370_100213422 237
319 3300013104 Ga0157370_10195664 Ga0157370_101956642 237
320 3300013105 Ga0157369_10056614 Ga0157369_100566142 237
321 3300013297 Ga0157378_10762669 Ga0157378_107626691 237
322 3300013306 Ga0163162_10268443 Ga0163162_102684432 237
323 3300013306 Ga0163162_10274499 Ga0163162_102744993 237
324 3300013307 Ga0157372_11043322 Ga0157372_110433221 237
325 3300013308 Ga0157375_10077654 Ga0157375_100776542 237
326 3300013308 Ga0157375_10417386 Ga0157375_104173861 237
327 3300014325 Ga0163163_10314250 Ga0163163_103142501 237
328 3300014325 Ga0163163_10416578 Ga0163163_104165782 237
329 3300014326 Ga0157380_10323315 Ga0157380_103233151 237
330 3300014745 Ga0157377_10239970 Ga0157377_102399701 237
331 3300017792 Ga0163161_10255090 Ga0163161_102550902 237
332 3300022730 Ga0224570_103551 Ga0224570_1035511 237
333 3300025261 Ga0209233_1020170 Ga0209233_10201702 237
334 3300025295 Ga0209564_1009899 Ga0209564_10098992 237
335 3300025297 Ga0209758_1003178 Ga0209758_100317814 237
336 3300025297 Ga0209758_1010377 Ga0209758_10103774 237
337 3300025315 Ga0207697_10132444 Ga0207697_101324442 237
338 3300025893 Ga0207682_10130044 Ga0207682_101300442 237
339 3300025898 Ga0207692_10002181 Ga0207692_100021818 237
340 3300025898 Ga0207692_10010482 Ga0207692_100104823 237
341 3300025899 Ga0207642_10024567 Ga0207642_100245672 237
342 3300025900 Ga0207710_10218369 Ga0207710_102183692 237
343 3300025901 Ga0207688_10093219 Ga0207688_100932192 237
344 3300025904 Ga0207647_10129092 Ga0207647_101290923 237
345 3300025905 Ga0207685_10085178 Ga0207685_100851781 237
346 3300025906 Ga0207699_10039854 Ga0207699_100398541 237
347 3300025906 Ga0207699_10262741 Ga0207699_102627411 237
348 3300025907 Ga0207645_10193688 Ga0207645_101936882 237
349 3300025908 Ga0207643_10084112 Ga0207643_100841121 237
350 3300025909 Ga0207705_10093019 Ga0207705_100930191 237
351 3300025909 Ga0207705_10170500 Ga0207705_101705002 237
352 3300025909 Ga0207705_10494199 Ga0207705_104941991 237
353 3300025910 Ga0207684_10244007 Ga0207684_102440071 237
354 3300025912 Ga0207707_10007441 Ga0207707_100074413 237
355 3300025913 Ga0207695_10104168 Ga0207695_101041682 237
356 3300025914 Ga0207671_10070932 Ga0207671_100709322 237
357 3300025914 Ga0207671_10087436 Ga0207671_100874362 237
358 3300025914 Ga0207671_10138521 Ga0207671_101385211 237
359 3300025915 Ga0207693_10003158 Ga0207693_100031584 237
360 3300025915 Ga0207693_10344791 Ga0207693_103447911 237
361 3300025916 Ga0207663_10000261 Ga0207663_100002612 237
362 3300025916 Ga0207663_10564282 Ga0207663_105642821 237
363 3300025917 Ga0207660_10009640 Ga0207660_100096403 237
364 3300025917 Ga0207660_10510818 Ga0207660_105108181 237
365 3300025918 Ga0207662_10085072 Ga0207662_100850722 237
366 3300025919 Ga0207657_10002700 Ga0207657_1000270017 237
367 3300025919 Ga0207657_10134362 Ga0207657_101343623 237
368 3300025921 Ga0207652_10006338 Ga0207652_100063387 237
369 3300025923 Ga0207681_10413685 Ga0207681_104136851 237
370 3300025924 Ga0207694_10128279 Ga0207694_101282791 237
371 3300025928 Ga0207700_10138800 Ga0207700_101388001 237
372 3300025928 Ga0207700_10152357 Ga0207700_101523572 237
373 3300025928 Ga0207700_10198737 Ga0207700_101987372 237
374 3300025929 Ga0207664_10011105 Ga0207664_100111054 237
375 3300025929 Ga0207664_10392364 Ga0207664_103923642 237
376 3300025932 Ga0207690_10132261 Ga0207690_101322612 237
377 3300025936 Ga0207670_10061941 Ga0207670_100619412 237
378 3300025937 Ga0207669_10023409 Ga0207669_100234092 237
379 3300025938 Ga0207704_10227247 Ga0207704_102272472 237
380 3300025939 Ga0207665_10000280 Ga0207665_100002805 237
381 3300025939 Ga0207665_10019565 Ga0207665_100195652 237
382 3300025940 Ga0207691_10152893 Ga0207691_101528931 237
383 3300025940 Ga0207691_10382503 Ga0207691_103825032 237
384 3300025941 Ga0207711_10060989 Ga0207711_100609892 237
385 3300025942 Ga0207689_10008118 Ga0207689_1000811812 237
386 3300025942 Ga0207689_10310222 Ga0207689_103102221 237
387 3300025945 Ga0207679_10444490 Ga0207679_104444901 237
388 3300025949 Ga0207667_10046316 Ga0207667_100463162 237
389 3300025949 Ga0207667_10194168 Ga0207667_101941682 237
390 3300025949 Ga0207667_10546150 Ga0207667_105461501 237
391 3300025960 Ga0207651_10047369 Ga0207651_100473691 237
392 3300025961 Ga0207712_10080055 Ga0207712_100800552 237
393 3300025972 Ga0207668_10032604 Ga0207668_100326042 237
394 3300025972 Ga0207668_10059080 Ga0207668_100590802 237
395 3300025972 Ga0207668_10133716 Ga0207668_101337161 237
396 3300025972 Ga0207668_10183739 Ga0207668_101837392 237
397 3300025972 Ga0207668_10183980 Ga0207668_101839802 237
398 3300025972 Ga0207668_10244197 Ga0207668_102441972 237
399 3300025981 Ga0207640_10018694 Ga0207640_100186942 237
400 3300025981 Ga0207640_10157315 Ga0207640_101573151 237
401 3300026023 Ga0207677_10029943 Ga0207677_100299433 237
402 3300026023 Ga0207677_10316569 Ga0207677_103165691 237
403 3300026041 Ga0207639_10054692 Ga0207639_100546923 237
404 3300026041 Ga0207639_10076791 Ga0207639_100767912 237
405 3300026041 Ga0207639_10288240 Ga0207639_102882402 237
406 3300026067 Ga0207678_10015515 Ga0207678_100155153 237
407 3300026067 Ga0207678_10051796 Ga0207678_100517963 237
408 3300026067 Ga0207678_10062822 Ga0207678_100628222 237
409 3300026067 Ga0207678_10250929 Ga0207678_102509291 237
410 3300026067 Ga0207678_10370940 Ga0207678_103709401 237
411 3300026078 Ga0207702_10000127 Ga0207702_1000012791 237
412 3300026078 Ga0207702_10629084 Ga0207702_106290841 237
413 3300026095 Ga0207676_10148948 Ga0207676_101489482 237
414 3300026116 Ga0207674_10051454 Ga0207674_100514542 237
415 3300026118 Ga0207675_100096466 Ga0207675_1000964662 237
416 3300026118 Ga0207675_100434613 Ga0207675_1004346132 237
417 3300026121 Ga0207683_10071355 Ga0207683_100713553 237
418 3300026121 Ga0207683_10160750 Ga0207683_101607501 237
419 3300026121 Ga0207683_10442545 Ga0207683_104425452 237
420 3300026121 Ga0207683_10495240 Ga0207683_104952401 237
421 3300026142 Ga0207698_10079006 Ga0207698_100790062 237
422 3300026142 Ga0207698_10383197 Ga0207698_103831971 237
423 3300027512 Ga0209179_1003031 Ga0209179_10030312 237
424 3300027671 Ga0209588_1039153 Ga0209588_10391531 237
425 3300027866 Ga0209813_10051794 Ga0209813_100517941 237
426 3300027907 Ga0207428_10367565 Ga0207428_103675651 237
427 3300028379 Ga0268266_10012489 Ga0268266_100124892 237
428 3300028379 Ga0268266_10016053 Ga0268266_100160534 237
429 3300028379 Ga0268266_10124924 Ga0268266_101249242 237
430 3300028379 Ga0268266_10134892 Ga0268266_101348922 237
431 3300028379 Ga0268266_10485118 Ga0268266_104851181 237
432 3300028380 Ga0268265_10073490 Ga0268265_100734902 237
433 3300028380 Ga0268265_10101910 Ga0268265_101019102 237
434 3300028380 Ga0268265_10237965 Ga0268265_102379652 237
435 3300028381 Ga0268264_10164336 Ga0268264_101643362 237
436 3300028381 Ga0268264_10220978 Ga0268264_102209782 237
437 3300028381 Ga0268264_10310943 Ga0268264_103109432 237
438 3300028556 Ga0265337_1018390 Ga0265337_10183901 237
439 3300028558 Ga0265326_10013135 Ga0265326_100131352 237
440 3300028563 Ga0265319_1007233 Ga0265319_10072337 237
441 3300028573 Ga0265334_10013991 Ga0265334_100139912 237
442 3300028653 Ga0265323_10003132 Ga0265323_100031322 237
443 3300028654 Ga0265322_10037677 Ga0265322_100376773 237
444 3300028666 Ga0265336_10008427 Ga0265336_100084274 237
445 3300028794 Ga0307515_10346388 Ga0307515_103463882 237
446 3300028800 Ga0265338_10000085 Ga0265338_1000008511 237
447 3300029957 Ga0265324_10002725 Ga0265324_1000272512 237
448 3300030522 Ga0307512_10169494 Ga0307512_101694942 237
449 3300031241 Ga0265325_10188201 Ga0265325_101882012 237
450 3300031247 Ga0265340_10006832 Ga0265340_100068326 237
451 3300031344 Ga0265316_10123104 Ga0265316_101231042 237
452 3300031616 Ga0307508_10329432 Ga0307508_103294322 237
453 3300031711 Ga0265314_10001137 Ga0265314_1000113719 237
454 3300031711 Ga0265314_10062403 Ga0265314_100624031 237
455 3300031712 Ga0265342_10019909 Ga0265342_100199092 237
456 3300031730 Ga0307516_10012892 Ga0307516_100128922 237
457 3300031730 Ga0307516_10094494 Ga0307516_100944942 237
458 3300031730 Ga0307516_10535447 Ga0307516_105354471 237
459 3300031852 Ga0307410_10151151 Ga0307410_101511512 237
460 3300031903 Ga0307407_10125692 Ga0307407_101256922 237
461 3300032002 Ga0307416_101011765 Ga0307416_1010117651 237
462 3300032005 Ga0307411_10066426 Ga0307411_100664263 237
463 3300032126 Ga0307415_100041713 Ga0307415_1000417132 237
464 3300033180 Ga0307510_10117916 Ga0307510_101179162 237
465 3300033180 Ga0307510_10147452 Ga0307510_101474522 237
466 3300033442 Ga0315911_1000003 Ga0315911_1000003303 237
467 3300034819 Ga0373958_0015050 Ga0373958_0015050_316_1077 237
468 3300035086 Ga0373934_0064680 Ga0373934_0064680_223_984 237
469 3300035088 Ga0373940_0034282 Ga0373940_0034282_552_1313 237
470 3300035089 Ga0373944_0112876 Ga0373944_0112876_105_866 237
471 3300035111 Ga0373923_0001291 Ga0373923_0001291_1207_1968 237
472 3300035113 Ga0373936_0007502 Ga0373936_0007502_838_1614 237
473 3300035114 Ga0373939_0024329 Ga0373939_0024329_636_1397 237
474 3300035116 Ga0373945_0030875 Ga0373945_0030875_799_1575 237
475 3300035117 Ga0373953_0013574 Ga0373953_0013574_779_1540 237
476 3300035117 Ga0373953_0057691 Ga0373953_0057691_792_1553 237
477 3300035118 Ga0373954_0002129 Ga0373954_0002129_1140_1901 237
478 3300035118 Ga0373954_0003928 Ga0373954_0003928_1080_1841 237
479 3300035119 Ga0373956_0006821 Ga0373956_0006821_2779_3540 237
480 3300035120 Ga0373957_0000776 Ga0373957_0000776_5648_6409 237
481 3300035172 Ga0373955_0207529 Ga0373955_0207529_26_802 237
482 3300035172 Ga0373955_0223305 Ga0373955_0223305_92_853 237
483 3300035410 Ga0373924_0012971 Ga0373924_0012971_527_1303 237
484 3300035691 Ga0373931_0071809 Ga0373931_0071809_1067_1828 237
485 3300035692 Ga0373935_0009132 Ga0373935_0009132_548_1324 237
486 3300035695 Ga0373927_0005891 Ga0373927_0005891_1151_1927 237
487 3300035695 Ga0373927_0337731 Ga0373927_0337731_123_884 237
488 3300035724 Ga0373933_0036847 Ga0373933_0036847_223_984 237
489 3300035724 Ga0373933_0125738 Ga0373933_0125738_158_919 237
490 3300035724 Ga0373933_0373979 Ga0373933_0373979_96_857 237
491 3300035725 Ga0373947_0012031 Ga0373947_0012031_2888_3664 237
492 3300036401 Ga0373937_0026247 Ga0373937_0026247_3070_3846 237
493 3300036401 Ga0373937_0033338 Ga0373937_0033338_3249_4010 237
494 3300036401 Ga0373937_0088548 Ga0373937_0088548_1608_2369 237
495 3300036401 Ga0373937_0204994 Ga0373937_0204994_802_1563 237
496 3300036401 Ga0373937_0222106 Ga0373937_0222106_890_1651 237
497 3300037068 Ga0373925_0050812 Ga0373925_0050812_1171_1947 237
498 3300037068 Ga0373925_0085564 Ga0373925_0085564_1044_1805 237
499 3300037312 Ga0395899_0018519 Ga0395899_0018519_4271_5032 237
500 3300037418 Ga0395900_0097884 Ga0395900_0097884_1865_2626 237
501 3300037466 Ga0395898_0196349 Ga0395898_0196349_964_1725 237
502 3300037471 Ga0395905_0194484 Ga0395905_0194484_698_1459 237
503 3300037471 Ga0395905_0360972 Ga0395905_0360972_341_1147 237
504 3300038443 Ga0395901_0350496 Ga0395901_0350496_77_838 237
505 3300038443 Ga0395901_0369462 Ga0395901_0369462_291_1052 237
506 3300038443 Ga0395901_0526610 Ga0395901_0526610_51_812 237
507 3300041413 Ga0439465_0018383 Ga0439465_0018383_911_1717 237
508 3300045049 Ga0466959_0122644 Ga0466959_0122644_609_1370 237
509 3300046454 Ga0495592_0006971 Ga0495592_0006971_5608_6369 237
510 3300046454 Ga0495592_0028514 Ga0495592_0028514_2723_3484 237
511 3300046454 Ga0495592_0075564 Ga0495592_0075564_415_1191 237
512 3300046455 Ga0495603_0004320 Ga0495603_0004320_3394_4170 237
513 3300046455 Ga0495603_0011117 Ga0495603_0011117_3748_4509 237
514 3300046455 Ga0495603_0031669 Ga0495603_0031669_797_1561 237
515 3300046457 Ga0495590_0041600 Ga0495590_0041600_464_1225 237
516 3300046459 Ga0495629_0000439 Ga0495629_0000439_31831_32592 237
517 3300046459 Ga0495629_0008693 Ga0495629_0008693_3030_3806 237
518 3300046459 Ga0495629_0054073 Ga0495629_0054073_388_1149 237
519 3300046459 Ga0495629_0078244 Ga0495629_0078244_760_1581 237
520 3300046460 Ga0495638_0222951 Ga0495638_0222951_79_840 237
521 3300046461 Ga0495641_0013355 Ga0495641_0013355_1166_1942 237
522 3300046462 Ga0495651_0023056 Ga0495651_0023056_1929_2690 237
523 3300046462 Ga0495651_0080808 Ga0495651_0080808_1461_2222 237
524 3300046462 Ga0495651_0115383 Ga0495651_0115383_105_866 237
525 3300046463 Ga0495653_0023097 Ga0495653_0023097_960_1721 237
526 3300046472 Ga0495580_0010913 Ga0495580_0010913_2159_2935 237
527 3300046473 Ga0495582_0007979 Ga0495582_0007979_2493_3269 237
528 3300046475 Ga0495639_0005290 Ga0495639_0005290_3070_3846 237
529 3300046475 Ga0495639_0171284 Ga0495639_0171284_33_794 237
530 3300046476 Ga0495662_0002831 Ga0495662_0002831_4472_5248 237
531 3300046477 Ga0495664_0050963 Ga0495664_0050963_1415_2176 237
532 3300046491 Ga0495584_0048919 Ga0495584_0048919_127_888 237
533 3300046491 Ga0495584_0098845 Ga0495584_0098845_360_1181 237
534 3300046492 Ga0495585_0195391 Ga0495585_0195391_199_960 237
535 3300046499 Ga0495594_0004642 Ga0495594_0004642_5336_6112 237
536 3300046499 Ga0495594_0156363 Ga0495594_0156363_353_1114 237
537 3300046500 Ga0495596_0022258 Ga0495596_0022258_1069_1833 237
538 3300046501 Ga0495607_0201323 Ga0495607_0201323_168_932 237
539 3300046507 Ga0495606_0002132 Ga0495606_0002132_3104_3871 237
540 3300046511 Ga0495608_0005431 Ga0495608_0005431_2457_3218 237
541 3300046511 Ga0495608_0017029 Ga0495608_0017029_2197_2958 237
542 3300046513 Ga0495616_0099681 Ga0495616_0099681_109_870 237
543 3300046514 Ga0495618_0005075 Ga0495618_0005075_6171_6932 237
544 3300046514 Ga0495618_0007998 Ga0495618_0007998_832_1608 237
545 3300046514 Ga0495618_0024391 Ga0495618_0024391_2840_3601 237
546 3300046516 Ga0495628_0013324 Ga0495628_0013324_1629_2390 237
547 3300046516 Ga0495628_0091840 Ga0495628_0091840_1184_1945 237
548 3300046517 Ga0495630_0080229 Ga0495630_0080229_739_1515 237
549 3300046518 Ga0495631_0055557 Ga0495631_0055557_523_1284 237
550 3300046519 Ga0495632_0079237 Ga0495632_0079237_114_917 237
551 3300046523 Ga0495644_0093169 Ga0495644_0093169_172_936 237
552 3300046528 Ga0495642_0144998 Ga0495642_0144998_213_977 237
553 3300046529 Ga0495652_0036615 Ga0495652_0036615_1970_2731 237
554 3300046529 Ga0495652_0399026 Ga0495652_0399026_99_860 237
555 3300046531 Ga0495665_0005469 Ga0495665_0005469_1366_2142 237
556 3300046533 Ga0495640_0013286 Ga0495640_0013286_2260_3036 237
557 3300046533 Ga0495640_0095621 Ga0495640_0095621_1011_1772 237
558 3300046533 Ga0495640_0323080 Ga0495640_0323080_146_907 237
559 3300046535 Ga0495586_0025634 Ga0495586_0025634_666_1427 237
560 3300046536 Ga0495587_0032594 Ga0495587_0032594_1982_2743 237
561 3300046536 Ga0495587_0065474 Ga0495587_0065474_495_1256 237
562 3300046538 Ga0495609_0100569 Ga0495609_0100569_292_1053 237
563 3300046542 Ga0495597_0070860 Ga0495597_0070860_110_871 237
564 3300046542 Ga0495597_0091041 Ga0495597_0091041_436_1203 237
565 3300046543 Ga0495645_0016900 Ga0495645_0016900_1262_2023 237
566 3300046543 Ga0495645_0092738 Ga0495645_0092738_928_1689 237
567 3300046557 Ga0495622_0040178 Ga0495622_0040178_984_1760 237
568 3300046559 Ga0495667_0005621 Ga0495667_0005621_1728_2489 237
569 3300046559 Ga0495667_0022396 Ga0495667_0022396_2703_3479 237
570 3300046559 Ga0495667_0042286 Ga0495667_0042286_264_1025 237
571 3300046615 Ga0495656_0106398 Ga0495656_0106398_239_1042 237
572 3300046615 Ga0495656_0152990 Ga0495656_0152990_292_1056 237
573 3300046616 Ga0495668_0275331 Ga0495668_0275331_147_908 237
574 3300046642 Ga0495634_0003738 Ga0495634_0003738_3193_3969 237
575 3300046663 Ga0495635_0016717 Ga0495635_0016717_3091_3867 237
576 3300046663 Ga0495635_0066959 Ga0495635_0066959_960_1721 237
577 3300046663 Ga0495635_0149125 Ga0495635_0149125_152_973 237
578 3300046664 Ga0495659_0087863 Ga0495659_0087863_165_926 237
579 3300046674 Ga0495588_0074221 Ga0495588_0074221_992_1753 237
580 3300046674 Ga0495588_0210121 Ga0495588_0210121_245_1009 237
581 3300046675 Ga0495657_0010362 Ga0495657_0010362_2311_3072 237
582 3300046675 Ga0495657_0252330 Ga0495657_0252330_114_875 237
583 3300046678 Ga0495599_0001369 Ga0495599_0001369_2198_2959 237
584 3300046678 Ga0495599_0010490 Ga0495599_0010490_2376_3137 237
585 3300046679 Ga0495623_0048549 Ga0495623_0048549_942_1703 237
586 3300046679 Ga0495623_0063867 Ga0495623_0063867_561_1322 237
587 3300046679 Ga0495623_0111971 Ga0495623_0111971_195_956 237
588 3300046680 Ga0495646_0037975 Ga0495646_0037975_960_1721 237
589 3300046681 Ga0495647_0021633 Ga0495647_0021633_1280_2041 237
590 3300046683 Ga0495658_0003784 Ga0495658_0003784_3644_4420 237
591 3300046684 Ga0495669_0007888 Ga0495669_0007888_2773_3534 237
592 3300046689 Ga0495613_0007099 Ga0495613_0007099_3056_3832 237
593 3300046689 Ga0495613_0187655 Ga0495613_0187655_90_851 237
594 3300046690 Ga0495624_0026173 Ga0495624_0026173_145_921 237
595 3300046794 Ga0495589_0136476 Ga0495589_0136476_50_811 237
596 3300046809 Ga0495600_0001020 Ga0495600_0001020_8389_9150 237
597 3300046809 Ga0495600_0012902 Ga0495600_0012902_1451_2212 237
598 3300046810 Ga0495660_0178800 Ga0495660_0178800_89_850 237
599 3300047315 Ga0495581_0021836 Ga0495581_0021836_1111_1887 237
600 3300047315 Ga0495581_0079411 Ga0495581_0079411_234_995 237
601 3300047319 Ga0495674_0000458 Ga0495674_0000458_3360_4136 237
602 3300047319 Ga0495674_0046443 Ga0495674_0046443_1329_2090 237
603 3300047321 Ga0495676_0052694 Ga0495676_0052694_167_928 237
604 3300047321 Ga0495676_0060342 Ga0495676_0060342_61_837 237
605 3300047322 Ga0495680_0006528 Ga0495680_0006528_8304_9065 237
606 3300047322 Ga0495680_0064893 Ga0495680_0064893_198_959 237
607 3300047323 Ga0495683_0044221 Ga0495683_0044221_126_887 237
608 3300047444 Ga0495675_0000923 Ga0495675_0000923_14899_15660 237
609 3300047444 Ga0495675_0206652 Ga0495675_0206652_389_1150 237
610 3300047445 Ga0495677_0129656 Ga0495677_0129656_74_835 237
611 3300047469 Ga0495673_0048090 Ga0495673_0048090_230_991 237
612 3300047471 Ga0495684_0000340 Ga0495684_0000340_31585_32346 237
613 3300047471 Ga0495684_0008134 Ga0495684_0008134_6391_7152 237
614 3300047471 Ga0495684_0028828 Ga0495684_0028828_1062_1838 237
615 3300047472 Ga0495686_0152280 Ga0495686_0152280_281_1042 237
616 3300047472 Ga0495686_0164948 Ga0495686_0164948_514_1275 237
617 3300047673 Ga0495593_0000687 Ga0495593_0000687_11644_12405 237
618 3300047673 Ga0495593_0006332 Ga0495593_0006332_3070_3846 237
619 3300048088 Ga0495602_0137058 Ga0495602_0137058_834_1595 237
620 3300048088 Ga0495602_0185065 Ga0495602_0185065_694_1455 237
621 3300048088 Ga0495602_0433537 Ga0495602_0433537_13_774 237
622 3300048903 Ga0496100_0048593 Ga0496100_0048593_506_1267 237
623 3300048903 Ga0496100_0132686 Ga0496100_0132686_278_1042 237
624 3300048904 Ga0496101_0122156 Ga0496101_0122156_798_1613 237
625 3300048905 Ga0496102_0136319 Ga0496102_0136319_784_1548 237
626 3300048907 Ga0496104_0105435 Ga0496104_0105435_1214_1975 237
627 3300048908 Ga0496105_0147641 Ga0496105_0147641_1062_1823 237
628 3300048908 Ga0496105_0231595 Ga0496105_0231595_630_1391 237
629 3300048909 Ga0496106_0015920 Ga0496106_0015920_1999_2760 237
630 3300048909 Ga0496106_0122350 Ga0496106_0122350_1025_1804 237
631 3300048909 Ga0496106_0155540 Ga0496106_0155540_97_858 237
632 3300048909 Ga0496106_0259516 Ga0496106_0259516_439_1203 237
633 3300048909 Ga0496106_0346539 Ga0496106_0346539_281_1042 237
634 3300048909 Ga0496106_0349577 Ga0496106_0349577_370_1134 237
635 3300048910 Ga0496107_0004783 Ga0496107_0004783_1104_1865 237
636 3300048910 Ga0496107_0230110 Ga0496107_0230110_138_899 237
637 3300048911 Ga0496108_0000938 Ga0496108_0000938_6250_7011 237
638 3300048911 Ga0496108_0653925 Ga0496108_0653925_89_850 237
639 3300048912 Ga0496109_0001723 Ga0496109_0001723_13984_14745 237
640 3300048912 Ga0496109_0198825 Ga0496109_0198825_1018_1779 237
641 3300048912 Ga0496109_0207737 Ga0496109_0207737_830_1591 237
642 3300048912 Ga0496109_0348248 Ga0496109_0348248_456_1220 237
643 3300048913 Ga0496110_0101921 Ga0496110_0101921_604_1413 237
644 3300048913 Ga0496110_0148931 Ga0496110_0148931_247_1008 237
645 3300048913 Ga0496110_0178575 Ga0496110_0178575_285_1046 237
646 3300048914 Ga0496111_0072809 Ga0496111_0072809_446_1207 237
647 3300048914 Ga0496111_0120465 Ga0496111_0120465_143_907 237
648 3300048914 Ga0496111_0230872 Ga0496111_0230872_583_1344 237
649 3300048915 Ga0496112_0000014 Ga0496112_0000014_65_832 237
650 3300048915 Ga0496112_0000590 Ga0496112_0000590_50_817 237
651 3300048915 Ga0496112_0045788 Ga0496112_0045788_2571_3332 237
652 3300048915 Ga0496112_0066467 Ga0496112_0066467_978_1793 237
653 3300048915 Ga0496112_0096875 Ga0496112_0096875_315_1076 237
654 3300048915 Ga0496112_0292386 Ga0496112_0292386_513_1322 237
655 3300048916 Ga0496113_0106631 Ga0496113_0106631_422_1183 237
656 3300048916 Ga0496113_0332810 Ga0496113_0332810_49_810 237
657 3300048916 Ga0496113_0336513 Ga0496113_0336513_23_784 237
658 3300048916 Ga0496113_0571363 Ga0496113_0571363_59_868 237
659 3300048918 Ga0496115_0105098 Ga0496115_0105098_1329_2090 237
660 3300048918 Ga0496115_0480644 Ga0496115_0480644_49_810 237
661 3300048918 Ga0496115_0604639 Ga0496115_0604639_57_818 237
662 3300048919 Ga0496116_0001982 Ga0496116_0001982_14894_15673 237
663 3300048920 Ga0496117_0021414 Ga0496117_0021414_3723_4502 237
664 3300048921 Ga0496118_0039825 Ga0496118_0039825_1694_2473 237
665 3300048922 Ga0496119_0167995 Ga0496119_0167995_238_999 237
666 3300048922 Ga0496119_0224518 Ga0496119_0224518_123_884 237
667 3300048924 Ga0496121_0000379 Ga0496121_0000379_90263_91024 237
668 3300048924 Ga0496121_0134182 Ga0496121_0134182_764_1534 237
669 3300048924 Ga0496121_0142705 Ga0496121_0142705_981_1745 237
670 3300048924 Ga0496121_0411611 Ga0496121_0411611_97_861 237
671 3300048925 Ga0496122_0095791 Ga0496122_0095791_382_1146 237
672 3300048927 Ga0496124_0139987 Ga0496124_0139987_696_1475 237
673 3300048927 Ga0496124_0274664 Ga0496124_0274664_69_833 237
674 3300048927 Ga0496124_0320749 Ga0496124_0320749_70_840 237
675 3300048928 Ga0496125_0000199 Ga0496125_0000199_105825_106586 237
676 3300048928 Ga0496125_0000964 Ga0496125_0000964_11184_11945 237
677 3300048928 Ga0496125_0036169 Ga0496125_0036169_3182_3961 237
678 3300048928 Ga0496125_0213882 Ga0496125_0213882_54_815 237
679 3300048929 Ga0496126_0009808 Ga0496126_0009808_5283_6047 237
680 3300048929 Ga0496126_0011726 Ga0496126_0011726_8248_9009 237
681 3300048929 Ga0496126_0027947 Ga0496126_0027947_3087_3848 237
682 3300048929 Ga0496126_0064385 Ga0496126_0064385_1890_2651 237
683 3300048929 Ga0496126_0102702 Ga0496126_0102702_1336_2115 237
684 3300048929 Ga0496126_0157970 Ga0496126_0157970_1148_1909 237
685 3300048929 Ga0496126_0172815 Ga0496126_0172815_41_802 237
686 3300049459 Ga0495678_084732 Ga0495678_084732_341_1105 237
687 3300049568 Ga0501031_0000712 Ga0501031_0000712_9755_10558 237
688 3300049569 Ga0501032_0001162 Ga0501032_0001162_13633_14436 237
689 3300049569 Ga0501032_0205935 Ga0501032_0205935_321_1082 237
690 3300049569 Ga0501032_0317195 Ga0501032_0317195_90_851 237
691 3300049570 Ga0501033_0000163 Ga0501033_0000163_38017_38820 237
692 3300049570 Ga0501033_0017017 Ga0501033_0017017_4140_4901 237
693 3300049570 Ga0501033_0028416 Ga0501033_0028416_694_1455 237
694 3300049570 Ga0501033_0178507 Ga0501033_0178507_381_1142 237
695 3300049571 Ga0501034_0000202 Ga0501034_0000202_16170_16973 237
696 3300049571 Ga0501034_0703859 Ga0501034_0703859_58_819 237
697 3300049572 Ga0501036_0000021 Ga0501036_0000021_16239_17042 237
698 3300049573 Ga0501037_0001561 Ga0501037_0001561_5001_5804 237
699 3300049573 Ga0501037_0077304 Ga0501037_0077304_530_1291 237
700 3300049574 Ga0501038_0000226 Ga0501038_0000226_12531_13334 237
701 3300049574 Ga0501038_0201201 Ga0501038_0201201_420_1181 237
702 3300049575 Ga0501039_0001542 Ga0501039_0001542_15107_15910 237
703 3300049575 Ga0501039_0091639 Ga0501039_0091639_288_1058 237
704 3300049578 Ga0501042_0219802 Ga0501042_0219802_200_961 237
705 3300049579 Ga0501043_0000297 Ga0501043_0000297_5432_6235 237
706 3300049579 Ga0501043_0216935 Ga0501043_0216935_50_811 237
707 3300049580 Ga0501046_0000354 Ga0501046_0000354_17452_18255 237
708 3300049580 Ga0501046_0123794 Ga0501046_0123794_1101_1862 237
709 3300049581 Ga0501047_0000232 Ga0501047_0000232_15960_16763 237
710 3300049581 Ga0501047_0076009 Ga0501047_0076009_2221_2982 237
711 3300049582 Ga0501048_0000050 Ga0501048_0000050_16884_17687 237
712 3300049583 Ga0501067_0001956 Ga0501067_0001956_2642_3445 237
713 3300049584 Ga0501068_0005647 Ga0501068_0005647_2183_2986 237
714 3300049585 Ga0501069_0013995 Ga0501069_0013995_3391_4194 237
715 3300049586 Ga0501070_0012142 Ga0501070_0012142_49_810 237
716 3300049586 Ga0501070_0252540 Ga0501070_0252540_629_1390 237
717 3300049587 Ga0501071_0071472 Ga0501071_0071472_741_1547 237
718 3300049588 Ga0501072_0002675 Ga0501072_0002675_9643_10446 237
719 3300049589 Ga0501073_0000329 Ga0501073_0000329_26189_26992 237
720 3300049590 Ga0501074_0000092 Ga0501074_0000092_16412_17215 237
721 3300049592 Ga0501076_0262901 Ga0501076_0262901_434_1237 237
722 3300049741 Ga0501079_0026857 Ga0501079_0026857_2201_3004 237
723 3300049742 Ga0501080_0003432 Ga0501080_0003432_11340_12143 237
724 3300049744 Ga0501083_0107217 Ga0501083_0107217_338_1141 237
725 3300049822 Ga0501035_0000120 Ga0501035_0000120_52927_53730 237
726 3300049822 Ga0501035_0155462 Ga0501035_0155462_526_1287 237
727 3300049822 Ga0501035_0155631 Ga0501035_0155631_878_1639 237
728 3300049823 Ga0501044_0000179 Ga0501044_0000179_73964_74767 237
729 3300049823 Ga0501044_0181637 Ga0501044_0181637_86_847 237
730 3300049823 Ga0501044_0181763 Ga0501044_0181763_474_1235 237
731 3300049823 Ga0501044_0408919 Ga0501044_0408919_89_850 237
732 3300049823 Ga0501044_0556973 Ga0501044_0556973_179_982 237
733 3300049824 Ga0501045_0009859 Ga0501045_0009859_972_1775 237
734 3300050489 nmdc:mga03683_96169_c1 nmdc:mga03683_96169_c1_474_1235 237
735 3300050490 nmdc:mga03n38_230662_c1 nmdc:mga03n38_230662_c1_154_918 237
736 3300050490 nmdc:mga03n38_5857_c1 nmdc:mga03n38_5857_c1_433_1197 237
737 3300050490 nmdc:mga03n38_72170_c1 nmdc:mga03n38_72170_c1_230_991 237
738 3300050491 nmdc:mga00v17_190560_c1 nmdc:mga00v17_190560_c1_338_1102 237
739 3300050491 nmdc:mga00v17_42278_c1 nmdc:mga00v17_42278_c1_1125_1904 237
740 3300050492 nmdc:mga0yw44_126007_c1 nmdc:mga0yw44_126007_c1_797_1558 237
741 3300050492 nmdc:mga0yw44_295905_c1 nmdc:mga0yw44_295905_c1_28_792 237
742 3300050494 nmdc:mga06z11_167171_c1 nmdc:mga06z11_167171_c1_323_1087 237
743 3300050494 nmdc:mga06z11_26303_c1 nmdc:mga06z11_26303_c1_586_1392 237
744 3300050495 nmdc:mga04h51_58700_c1 nmdc:mga04h51_58700_c1_343_1107 237
745 3300050495 nmdc:mga04h51_60168_c1 nmdc:mga04h51_60168_c1_229_993 237
746 3300050496 nmdc:mga07m45_51114_c1 nmdc:mga07m45_51114_c1_691_1470 237
747 3300050496 nmdc:mga07m45_71267_c1 nmdc:mga07m45_71267_c1_115_876 237
748 3300050508 nmdc:mga09592_440437_c1 nmdc:mga09592_440437_c1_111_875 237
749 3300050511 nmdc:mga08y16_490201_c1 nmdc:mga08y16_490201_c1_33_854 237
750 3300050516 nmdc:mga0sz30_5222_c1 nmdc:mga0sz30_5222_c1_2767_3546 237
751 3300053077 Ga0495601_0028806 Ga0495601_0028806_149_910 237
752 3300053078 Ga0495612_0072948 Ga0495612_0072948_548_1309 237
753 3300053085 Ga0495619_0006768 Ga0495619_0006768_3156_3917 237
754 3300053085 Ga0495619_0064113 Ga0495619_0064113_780_1541 237
755 3300053092 Ga0500583_0022152 Ga0500583_0022152_1610_2374 237
756 3300053093 Ga0500651_0162632 Ga0500651_0162632_182_988 237
757 3300053094 Ga0500566_0018229 Ga0500566_0018229_856_1617 237
758 3300053094 Ga0500566_0145806 Ga0500566_0145806_304_1065 237
759 3300053096 Ga0500641_0027059 Ga0500641_0027059_394_1200 237
760 3300053102 Ga0500554_002502 Ga0500554_002502_2058_2819 237
761 3300053104 Ga0500556_0000003 Ga0500556_0000003_57319_58083 237
762 3300053104 Ga0500556_0063239 Ga0500556_0063239_576_1340 237
763 3300053119 Ga0500595_000414 Ga0500595_000414_20731_21492 237
764 3300053125 Ga0500618_028139 Ga0500618_028139_359_1123 237
765 3300053130 Ga0500642_0072461 Ga0500642_0072461_92_853 237
766 3300053139 Ga0500568_0007066 Ga0500568_0007066_1046_1807 237
767 3300053142 Ga0500577_0058518 Ga0500577_0058518_336_1100 237
768 3300053146 Ga0500588_0121232 Ga0500588_0121232_28_789 237
769 3300053147 Ga0500589_044338 Ga0500589_044338_41_805 237
770 3300053148 Ga0500590_098273 Ga0500590_098273_51_857 237
771 3300053162 Ga0500638_006577 Ga0500638_006577_1963_2724 237
772 3300053723 Ga0500567_131420 Ga0500567_131420_49_813 237
773 3300053727 Ga0500611_023524 Ga0500611_023524_329_1093 237
774 3300053730 Ga0500645_028254 Ga0500645_028254_757_1521 237
775 3300054114 Ga0501084_0136077 Ga0501084_0136077_985_1788 237
776 3300055283 Ga0500661_000369 Ga0500661_000369_5391_6152 237
777 3300060353 Ga0501082_0011284 Ga0501082_0011284_5513_6316 237
778 iso_pu_bacteria 2513237098 2513678794 237
779 iso_pu_bacteria 2791355199 2793080685 237
780 iso_pu_bacteria 2903748898 2903749653 237
781 iso_pu_bacteria 2903768456 2903773693 237
782 iso_pu_bacteria 2908739725 2908741281 237
783 iso_pu_bacteria 2922361189 2922361599 237
784 3300001979 JGI24740J21852_10001727 JGI24740J21852_100017279 238
785 3300001989 JGI24739J22299_10042523 JGI24739J22299_100425231 238
786 3300005457 Ga0070662_100060953 Ga0070662_1000609532 238
787 3300005539 Ga0068853_100014882 Ga0068853_1000148822 238
788 3300005539 Ga0068853_100058051 Ga0068853_1000580513 238
789 3300005563 Ga0068855_100012537 Ga0068855_1000125372 238
790 3300005577 Ga0068857_100010486 Ga0068857_1000104866 238
791 3300005577 Ga0068857_100061831 Ga0068857_1000618312 238
792 3300005578 Ga0068854_100150890 Ga0068854_1001508902 238
793 3300005614 Ga0068856_100003444 Ga0068856_10000344411 238
794 3300005617 Ga0068859_100696730 Ga0068859_1006967302 238
795 3300005834 Ga0068851_10047145 Ga0068851_100471452 238
796 3300006173 Ga0070716_100006104 Ga0070716_1000061042 238
797 3300006931 Ga0097620_100696728 Ga0097620_1006967282 238
798 3300007788 Ga0099795_10005252 Ga0099795_100052522 238
799 3300009093 Ga0105240_10000603 Ga0105240_100006036 238
800 3300009093 Ga0105240_10027536 Ga0105240_100275366 238
801 3300009101 Ga0105247_10038942 Ga0105247_100389422 238
802 3300009174 Ga0105241_10000075 Ga0105241_1000007558 238
803 3300009174 Ga0105241_10358381 Ga0105241_103583811 238
804 3300009545 Ga0105237_10178285 Ga0105237_101782852 238
805 3300009545 Ga0105237_10307093 Ga0105237_103070932 238
806 3300009551 Ga0105238_10020719 Ga0105238_100207192 238
807 3300009551 Ga0105238_10409590 Ga0105238_104095902 238
808 3300010375 Ga0105239_10084018 Ga0105239_100840182 238
809 3300010375 Ga0105239_10239306 Ga0105239_102393061 238
810 3300010375 Ga0105239_10300514 Ga0105239_103005142 238
811 3300025297 Ga0209758_1003949 Ga0209758_100394913 238
812 3300025321 Ga0207656_10012124 Ga0207656_100121243 238
813 3300025900 Ga0207710_10044201 Ga0207710_100442012 238
814 3300025904 Ga0207647_10011690 Ga0207647_100116904 238
815 3300025911 Ga0207654_10000037 Ga0207654_100000373 238
816 3300025913 Ga0207695_10000283 Ga0207695_100002836 238
817 3300025913 Ga0207695_10000286 Ga0207695_1000028669 238
818 3300025914 Ga0207671_10120702 Ga0207671_101207022 238
819 3300025915 Ga0207693_10090228 Ga0207693_100902282 238
820 3300025924 Ga0207694_10000120 Ga0207694_1000012013 238
821 3300025924 Ga0207694_10091488 Ga0207694_100914882 238
822 3300025924 Ga0207694_10149516 Ga0207694_101495162 238
823 3300025933 Ga0207706_10052332 Ga0207706_100523322 238
824 3300025939 Ga0207665_10062181 Ga0207665_100621813 238
825 3300025949 Ga0207667_10141047 Ga0207667_101410472 238
826 3300025981 Ga0207640_10028018 Ga0207640_100280183 238
827 3300025981 Ga0207640_10677966 Ga0207640_106779661 238
828 3300026078 Ga0207702_10000019 Ga0207702_10000019105 238
829 3300026116 Ga0207674_10016041 Ga0207674_100160416 238
830 3300026116 Ga0207674_10064435 Ga0207674_100644353 238
831 3300035171 Ga0373946_0039677 Ga0373946_0039677_860_1624 238
832 3300035695 Ga0373927_0003904 Ga0373927_0003904_5598_6362 238
833 3300035725 Ga0373947_0002662 Ga0373947_0002662_1340_2104 238
834 3300046455 Ga0495603_0071843 Ga0495603_0071843_676_1440 238
835 3300046472 Ga0495580_0085278 Ga0495580_0085278_1188_1952 238
836 3300046507 Ga0495606_0307896 Ga0495606_0307896_17_781 238
837 3300048921 Ga0496118_0105489 Ga0496118_0105489_25_789 238
838 3300048924 Ga0496121_0007216 Ga0496121_0007216_9548_10312 238
839 3300048924 Ga0496121_0202708 Ga0496121_0202708_97_879 238
840 3300048929 Ga0496126_0003657 Ga0496126_0003657_4352_5167 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

30

276

0.93

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

35

274

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o34-assembly1.cif.gz_C thne from s.clavuligerus 0.8431 6 202
3qmj-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase echa8_6 from mycobacterium marinum 0.8365 4 213
3qmj-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase echa8_6 from mycobacterium marinum 0.8182 4 213
4elx-assembly1.cif.gz_F structure of apo e.coli. 1,4-dihydroxy-2- naphthoyl coa synthases with cl 0.8169 4 202
3fdu-assembly2.cif.gz_D crystal structure of a putative enoyl-coa hydratase/isomerase from acinetobacter baumannii 0.8069 1 226
ID Description Score Start End Superfamily
3rsiC01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9345 4 56 3.30.300.220
4nekC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8627 2 201 3.90.226.10
4f47A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8626 4 201 3.90.226.10
1dciC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8613 1 198 3.90.226.10
4nekC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8584 2 201 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A1J5P3J2-F1-model_v4 2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) 0.9104 1 151 GO:0004165
GO:0004300
GO:0005777
AF-A0A131Y2F7-F1-model_v4 Putative enoyl-coa hydratase/isomerase 0.8575 3 193 GO:0000062
GO:0004165
GO:0005777
AF-A0A2E2U0C1-F1-model_v4 deleted 0.8449 1 202
AF-A0A538LM92-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.8445 4 198 GO:0006635
GO:0016836
GO:0016853
AF-A0A257KJZ7-F1-model_v4 Enoyl-CoA hydratase 0.8413 1 192 GO:0004165
GO:0005777

Feature Viewer

pLDDT pTM Quality
82.03 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map