F482884
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 836 | 423 | 783 | 340 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_10106053|Ga0163163_101060531 |
| Length | 391 |
| Sequence | MAAALLADGGGRRHDLHNTVEIANGVPAKNVEQRHKVALQVSRFGAHVVKCAIGGLLAMSLRLSVLDQSPVSDGSTGGDALKNSVDLARLTEGLGYQRYWVAEHHGTPMLACASPEILIGPIAAATTNLRVGSGGVMLPHYSPLKVAENFSMLGGLYGDRIDLAVGRAPGSDPLTAFALQRDRRQAAPDDFPEQLSELLAYEWNRMPANHRFARLGKLPGGSTRPEVWLLGSSPQSAVWAAELGLPYAFADFINPAGAEIAAYYRQHYEPSETNPAPRTTAAIWALCAETDEAAWRLAASSRMAFTLFMQGTLIPVPPIETALAFLAEHPESAEALGRRRRWIVGSPKTVRAGIETLAAQYQADEIMIVTITYDHAARRRSYELIAESFLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 2 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 3 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 4 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 5 | 2599185353 | Staphylococcus sp. NFPP34 | Isolate | Rhizoplane |
| 6 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 7 | 2600254943 | Staphylococcus pasteuri NFIX07 | Isolate | Rhizoplane |
| 8 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 9 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 10 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 11 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 12 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 13 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 14 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 15 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 16 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 17 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 18 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 19 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 20 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 21 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 22 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 23 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 24 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 25 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 26 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 27 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 28 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 29 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 30 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 31 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 32 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 33 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 34 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 35 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 36 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 37 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 38 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 39 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 40 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 41 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 42 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 43 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 44 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 46 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 47 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 48 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 49 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 50 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 53 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 54 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 55 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 56 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 57 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 63 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 66 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 68 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 75 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 89 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 90 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 98 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 102 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 104 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 105 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 106 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 107 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 108 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 109 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 110 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 111 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 112 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 113 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 114 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 116 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 117 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 118 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 119 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 120 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 121 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 123 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 124 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 125 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 126 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 127 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 130 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 156 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 157 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 158 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 161 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 162 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 163 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 164 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 165 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 166 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 235 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 236 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 238 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 239 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 242 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 244 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 246 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 247 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 248 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 249 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 250 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 251 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 252 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 253 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 254 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 255 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 256 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 257 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 258 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 259 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 260 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 261 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 262 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 263 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 264 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 265 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 266 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 267 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 268 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 272 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 273 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 274 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 277 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 278 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 279 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 280 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 281 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 282 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 284 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 285 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 286 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 287 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 288 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 289 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 290 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 291 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 292 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 293 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 294 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 295 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 296 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 297 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 298 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 299 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 300 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 301 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 302 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 303 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 304 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 305 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 306 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 352 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 353 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 354 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 355 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 358 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 359 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 360 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 361 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 362 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 363 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 364 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 365 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 366 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 367 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 368 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 369 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 370 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 393 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 395 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 396 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 403 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 409 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 410 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 413 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 414 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 415 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 416 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 417 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 418 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 419 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 420 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 421 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 422 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 423 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.94 |
| Metatranscriptomes | 0.72 |
| Isolates | 6.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.36 |
| Bulb | 0 |
| Endosphere | 7.42 |
| Nodule | 0.12 |
| Rhizoplane | 3.83 |
| Rhizosphere | 81.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10014070 | 3300001991 | Bacteria | 1472 |
| 2 | JGI25151J46595_10026305 | 3300003187 | Bacteria | 2350 |
| 3 | JGI25406J46586_10006971 | 3300003203 | Bacteria | 5188 |
| 4 | JGI25404J52841_10000124 | 3300003659 | Bacteria | 7972 |
| 5 | Ga0055538_1000311 | 3300003751 | Bacteria | 23220 |
| 6 | Ga0055532_1000155 | 3300003758 | Bacteria | 60784 |
| 7 | Ga0055532_1000997 | 3300003758 | Bacteria | 8906 |
| 8 | Ga0055532_1001799 | 3300003758 | Bacteria | 5328 |
| 9 | Ga0055532_1002590 | 3300003758 | Bacteria | 3620 |
| 10 | Ga0055527_1000231 | 3300003760 | Bacteria | 35482 |
| 11 | Ga0055527_1002809 | 3300003760 | Bacteria | 2788 |
| 12 | Ga0055535_1000492 | 3300003761 | Bacteria | 35482 |
| 13 | Ga0055535_1000587 | 3300003761 | Bacteria | 30358 |
| 14 | Ga0055542_1000613 | 3300003762 | Bacteria | 30358 |
| 15 | Ga0055529_1000525 | 3300003763 | Bacteria | 33133 |
| 16 | Ga0055529_1003706 | 3300003763 | Bacteria | 2470 |
| 17 | Ga0055540_1010060 | 3300003792 | Bacteria | 3185 |
| 18 | Ga0055541_1003263 | 3300003841 | Bacteria | 3076 |
| 19 | Ga0058692_1012022 | 3300003856 | Bacteria | 2067 |
| 20 | Ga0058859_11760707 | 3300004798 | Bacteria | 7869 |
| 21 | Ga0058860_12215240 | 3300004801 | Bacteria | 5997 |
| 22 | Ga0070658_10027709 | 3300005327 | Bacteria | 4546 |
| 23 | Ga0070658_10038905 | 3300005327 | Bacteria | 3836 |
| 24 | Ga0070658_10162752 | 3300005327 | Bacteria | 1872 |
| 25 | Ga0070676_10000889 | 3300005328 | Bacteria | 14761 |
| 26 | Ga0070683_100007574 | 3300005329 | Bacteria | 9181 |
| 27 | Ga0070683_100027055 | 3300005329 | Bacteria | 5169 |
| 28 | Ga0070683_100047264 | 3300005329 | Bacteria | 3976 |
| 29 | Ga0070690_100046400 | 3300005330 | Bacteria | 2762 |
| 30 | Ga0070670_100010701 | 3300005331 | Bacteria | 7838 |
| 31 | Ga0068869_100000428 | 3300005334 | Bacteria | 22992 |
| 32 | Ga0068869_100254383 | 3300005334 | Bacteria | 1404 |
| 33 | Ga0070666_10004788 | 3300005335 | Bacteria | 8275 |
| 34 | Ga0070666_10021603 | 3300005335 | Bacteria | 4172 |
| 35 | Ga0070680_100007774 | 3300005336 | Bacteria | 8172 |
| 36 | Ga0070680_100020646 | 3300005336 | Bacteria | 5229 |
| 37 | Ga0070680_100025999 | 3300005336 | Bacteria | 4681 |
| 38 | Ga0068868_100000387 | 3300005338 | Bacteria | 29954 |
| 39 | Ga0068868_100085970 | 3300005338 | Bacteria | 2528 |
| 40 | Ga0068868_100351339 | 3300005338 | Bacteria | 1263 |
| 41 | Ga0070660_100000098 | 3300005339 | Bacteria | 52986 |
| 42 | Ga0070660_100027936 | 3300005339 | Bacteria | 4216 |
| 43 | Ga0070660_100328258 | 3300005339 | Bacteria | 1258 |
| 44 | Ga0070689_100063724 | 3300005340 | Bacteria | 2868 |
| 45 | Ga0070689_100255672 | 3300005340 | Bacteria | 1447 |
| 46 | Ga0070691_10005555 | 3300005341 | Bacteria | 5738 |
| 47 | Ga0070687_100005017 | 3300005343 | Bacteria | 5332 |
| 48 | Ga0070668_100041434 | 3300005347 | Bacteria | 3528 |
| 49 | Ga0070675_100007001 | 3300005354 | Bacteria | 8666 |
| 50 | Ga0070675_100057389 | 3300005354 | Bacteria | 3209 |
| 51 | Ga0070675_100190903 | 3300005354 | Bacteria | 1775 |
| 52 | Ga0070671_100026180 | 3300005355 | Bacteria | 4793 |
| 53 | Ga0070673_100000015 | 3300005364 | Bacteria | 118064 |
| 54 | Ga0070673_100188489 | 3300005364 | Bacteria | 1770 |
| 55 | Ga0070688_100103605 | 3300005365 | Bacteria | 1880 |
| 56 | Ga0070659_100000259 | 3300005366 | Bacteria | 41636 |
| 57 | Ga0070659_100001090 | 3300005366 | Bacteria | 19781 |
| 58 | Ga0070659_100187651 | 3300005366 | Bacteria | 1698 |
| 59 | Ga0070659_100305882 | 3300005366 | Bacteria | 1327 |
| 60 | Ga0070667_100024721 | 3300005367 | Bacteria | 4991 |
| 61 | Ga0070709_10233480 | 3300005434 | Bacteria | 1317 |
| 62 | Ga0070714_100025070 | 3300005435 | Bacteria | 4919 |
| 63 | Ga0070714_100041036 | 3300005435 | Bacteria | 3903 |
| 64 | Ga0070713_100003315 | 3300005436 | Bacteria | 10617 |
| 65 | Ga0070713_100012130 | 3300005436 | Bacteria | 6310 |
| 66 | Ga0070710_10000014 | 3300005437 | Bacteria | 103956 |
| 67 | Ga0070701_10000650 | 3300005438 | Bacteria | 12156 |
| 68 | Ga0070711_100076569 | 3300005439 | Bacteria | 2372 |
| 69 | Ga0070700_100000961 | 3300005441 | Bacteria | 14231 |
| 70 | Ga0070700_100240667 | 3300005441 | Bacteria | 1293 |
| 71 | Ga0070708_100014104 | 3300005445 | Bacteria | 6569 |
| 72 | Ga0070663_100011412 | 3300005455 | Bacteria | 5577 |
| 73 | Ga0070663_100021502 | 3300005455 | Bacteria | 4292 |
| 74 | Ga0070663_100204458 | 3300005455 | Bacteria | 1543 |
| 75 | Ga0070678_100049230 | 3300005456 | Bacteria | 3040 |
| 76 | Ga0070678_100370869 | 3300005456 | Bacteria | 1236 |
| 77 | Ga0070662_100010643 | 3300005457 | Bacteria | 6048 |
| 78 | Ga0070681_10007963 | 3300005458 | Bacteria | 10371 |
| 79 | Ga0070681_10008145 | 3300005458 | Bacteria | 10260 |
| 80 | Ga0070681_10053595 | 3300005458 | Bacteria | 4020 |
| 81 | Ga0070681_10103075 | 3300005458 | Bacteria | 2798 |
| 82 | Ga0070681_10110162 | 3300005458 | Bacteria | 2693 |
| 83 | Ga0070681_10131930 | 3300005458 | Bacteria | 2430 |
| 84 | Ga0070681_10207528 | 3300005458 | Bacteria | 1876 |
| 85 | Ga0068867_100000030 | 3300005459 | Bacteria | 86560 |
| 86 | Ga0068867_100015726 | 3300005459 | Bacteria | 5369 |
| 87 | Ga0070685_10014989 | 3300005466 | Bacteria | 4114 |
| 88 | Ga0070706_100026528 | 3300005467 | Bacteria | 5330 |
| 89 | Ga0070706_100049831 | 3300005467 | Bacteria | 3864 |
| 90 | Ga0070707_100028668 | 3300005468 | Bacteria | 5298 |
| 91 | Ga0070698_100001905 | 3300005471 | Bacteria | 23252 |
| 92 | Ga0070698_100020372 | 3300005471 | Bacteria | 6951 |
| 93 | Ga0070699_100112833 | 3300005518 | Bacteria | 2388 |
| 94 | Ga0070699_100317243 | 3300005518 | Bacteria | 1400 |
| 95 | Ga0070699_100359125 | 3300005518 | Bacteria | 1313 |
| 96 | Ga0070679_100007731 | 3300005530 | Bacteria | 10065 |
| 97 | Ga0070679_100012355 | 3300005530 | Bacteria | 8156 |
| 98 | Ga0070679_100052825 | 3300005530 | Bacteria | 4045 |
| 99 | Ga0070679_100102311 | 3300005530 | Bacteria | 2851 |
| 100 | Ga0070679_100186986 | 3300005530 | Bacteria | 2041 |
| 101 | Ga0070684_100021352 | 3300005535 | Bacteria | 5386 |
| 102 | Ga0070684_100043240 | 3300005535 | Bacteria | 3889 |
| 103 | Ga0070684_100218906 | 3300005535 | Bacteria | 1737 |
| 104 | Ga0068853_100041546 | 3300005539 | Bacteria | 3929 |
| 105 | Ga0068853_100141220 | 3300005539 | Bacteria | 2162 |
| 106 | Ga0070672_100141568 | 3300005543 | Bacteria | 1984 |
| 107 | Ga0070672_100422455 | 3300005543 | Bacteria | 1145 |
| 108 | Ga0070686_100008772 | 3300005544 | Bacteria | 5665 |
| 109 | Ga0070665_100000127 | 3300005548 | Bacteria | 145671 |
| 110 | Ga0070665_100003284 | 3300005548 | Bacteria | 17361 |
| 111 | Ga0070665_100004697 | 3300005548 | Bacteria | 14259 |
| 112 | Ga0070665_100004797 | 3300005548 | Bacteria | 14071 |
| 113 | Ga0070665_100005214 | 3300005548 | Bacteria | 13447 |
| 114 | Ga0070665_100008563 | 3300005548 | Bacteria | 10351 |
| 115 | Ga0070665_100010364 | 3300005548 | Bacteria | 9430 |
| 116 | Ga0070665_100031233 | 3300005548 | Bacteria | 5361 |
| 117 | Ga0068855_100023792 | 3300005563 | Bacteria | 7337 |
| 118 | Ga0068855_100058840 | 3300005563 | Bacteria | 4498 |
| 119 | Ga0068855_100082043 | 3300005563 | Bacteria | 3737 |
| 120 | Ga0068855_100399846 | 3300005563 | Bacteria | 1505 |
| 121 | Ga0070664_100108712 | 3300005564 | Bacteria | 2418 |
| 122 | Ga0070664_100123701 | 3300005564 | Bacteria | 2267 |
| 123 | Ga0068857_100166877 | 3300005577 | Bacteria | 2000 |
| 124 | Ga0068856_100021501 | 3300005614 | Bacteria | 6270 |
| 125 | Ga0068856_100048263 | 3300005614 | Bacteria | 4195 |
| 126 | Ga0068856_100050783 | 3300005614 | Bacteria | 4089 |
| 127 | Ga0068856_100059333 | 3300005614 | Bacteria | 3780 |
| 128 | Ga0068856_100075876 | 3300005614 | Bacteria | 3330 |
| 129 | Ga0068852_100003564 | 3300005616 | Bacteria | 10894 |
| 130 | Ga0068852_100004932 | 3300005616 | Bacteria | 9476 |
| 131 | Ga0068852_100012575 | 3300005616 | Bacteria | 6431 |
| 132 | Ga0068852_100018498 | 3300005616 | Bacteria | 5490 |
| 133 | Ga0068859_100038929 | 3300005617 | Bacteria | 4769 |
| 134 | Ga0068859_100040981 | 3300005617 | Bacteria | 4652 |
| 135 | Ga0068863_100004411 | 3300005841 | Bacteria | 13874 |
| 136 | Ga0068863_100286023 | 3300005841 | Bacteria | 1598 |
| 137 | Ga0068858_100007783 | 3300005842 | Bacteria | 10346 |
| 138 | Ga0068858_100332056 | 3300005842 | Bacteria | 1454 |
| 139 | Ga0068858_100345905 | 3300005842 | Bacteria | 1424 |
| 140 | Ga0068860_100000147 | 3300005843 | Bacteria | 115672 |
| 141 | Ga0068860_100036957 | 3300005843 | Bacteria | 4676 |
| 142 | Ga0068860_100155896 | 3300005843 | Bacteria | 2201 |
| 143 | Ga0081455_10000707 | 3300005937 | Bacteria | 43296 |
| 144 | Ga0081455_10001850 | 3300005937 | Bacteria | 25469 |
| 145 | Ga0081455_10003642 | 3300005937 | Bacteria | 17650 |
| 146 | Ga0081455_10010780 | 3300005937 | Bacteria | 9236 |
| 147 | Ga0081455_10014432 | 3300005937 | Bacteria | 7744 |
| 148 | Ga0081455_10031924 | 3300005937 | Bacteria | 4754 |
| 149 | Ga0081538_10000484 | 3300005981 | Bacteria | 44674 |
| 150 | Ga0081538_10007819 | 3300005981 | Bacteria | 9176 |
| 151 | Ga0081538_10012023 | 3300005981 | Bacteria | 6970 |
| 152 | Ga0081540_1000281 | 3300005983 | Bacteria | 52990 |
| 153 | Ga0081540_1015203 | 3300005983 | Bacteria | 4883 |
| 154 | Ga0081540_1028893 | 3300005983 | Bacteria | 3102 |
| 155 | Ga0081539_10002042 | 3300005985 | Bacteria | 30343 |
| 156 | Ga0081539_10004424 | 3300005985 | Bacteria | 15535 |
| 157 | Ga0081539_10005465 | 3300005985 | Bacteria | 12954 |
| 158 | Ga0081539_10042018 | 3300005985 | Bacteria | 2666 |
| 159 | Ga0070717_10137915 | 3300006028 | Bacteria | 2102 |
| 160 | Ga0075365_10034624 | 3300006038 | Bacteria | 3262 |
| 161 | Ga0075365_10176115 | 3300006038 | Bacteria | 1494 |
| 162 | Ga0075365_10196654 | 3300006038 | Bacteria | 1412 |
| 163 | Ga0070715_10095106 | 3300006163 | Bacteria | 1379 |
| 164 | Ga0075362_10002045 | 3300006177 | Bacteria | 6653 |
| 165 | Ga0075362_10126965 | 3300006177 | Bacteria | 1211 |
| 166 | Ga0075367_10001439 | 3300006178 | Bacteria | 10224 |
| 167 | Ga0075367_10171237 | 3300006178 | Bacteria | 1352 |
| 168 | Ga0075369_10018646 | 3300006186 | Bacteria | 2827 |
| 169 | Ga0075369_10059993 | 3300006186 | Bacteria | 1658 |
| 170 | Ga0075366_10003714 | 3300006195 | Bacteria | 8107 |
| 171 | Ga0075366_10054447 | 3300006195 | Bacteria | 2376 |
| 172 | Ga0097621_100000790 | 3300006237 | Bacteria | 22260 |
| 173 | Ga0097621_100015101 | 3300006237 | Bacteria | 5800 |
| 174 | Ga0097621_100057962 | 3300006237 | Bacteria | 3169 |
| 175 | Ga0068871_100017420 | 3300006358 | Bacteria | 5437 |
| 176 | Ga0068871_100049086 | 3300006358 | Bacteria | 3410 |
| 177 | Ga0068871_100053152 | 3300006358 | Bacteria | 3282 |
| 178 | Ga0068871_100138513 | 3300006358 | Bacteria | 2068 |
| 179 | Ga0068871_100168275 | 3300006358 | Bacteria | 1877 |
| 180 | Ga0075430_100149231 | 3300006846 | Bacteria | 1947 |
| 181 | Ga0075430_100229074 | 3300006846 | Bacteria | 1541 |
| 182 | Ga0075431_100032872 | 3300006847 | Bacteria | 5346 |
| 183 | Ga0075431_100044294 | 3300006847 | Bacteria | 4590 |
| 184 | Ga0075431_100318918 | 3300006847 | Bacteria | 1567 |
| 185 | Ga0075434_100311743 | 3300006871 | Bacteria | 1594 |
| 186 | Ga0075429_100017118 | 3300006880 | Bacteria | 6268 |
| 187 | Ga0075429_100177448 | 3300006880 | Bacteria | 1867 |
| 188 | Ga0068865_100000021 | 3300006881 | Bacteria | 103137 |
| 189 | Ga0068865_100029981 | 3300006881 | Bacteria | 3614 |
| 190 | Ga0097620_100038930 | 3300006931 | Bacteria | 4769 |
| 191 | Ga0097620_100040981 | 3300006931 | Bacteria | 4652 |
| 192 | Ga0099794_10133691 | 3300007265 | Unclassified | 1254 |
| 193 | Ga0105240_10003340 | 3300009093 | Bacteria | 24982 |
| 194 | Ga0105240_10003571 | 3300009093 | Bacteria | 24129 |
| 195 | Ga0105240_10005993 | 3300009093 | Bacteria | 17972 |
| 196 | Ga0105240_10008942 | 3300009093 | Bacteria | 14243 |
| 197 | Ga0105240_10025509 | 3300009093 | Bacteria | 7766 |
| 198 | Ga0105240_10086111 | 3300009093 | Bacteria | 3848 |
| 199 | Ga0105240_10094537 | 3300009093 | Bacteria | 3645 |
| 200 | Ga0105240_10235068 | 3300009093 | Unclassified | 2127 |
| 201 | Ga0105240_10236366 | 3300009093 | Bacteria | 2120 |
| 202 | Ga0105240_10493162 | 3300009093 | Bacteria | 1363 |
| 203 | Ga0111539_10007055 | 3300009094 | Bacteria | 14411 |
| 204 | Ga0111539_10050943 | 3300009094 | Bacteria | 4932 |
| 205 | Ga0111539_10082204 | 3300009094 | Bacteria | 3788 |
| 206 | Ga0111539_10109421 | 3300009094 | Bacteria | 3243 |
| 207 | Ga0111539_10149798 | 3300009094 | Bacteria | 2731 |
| 208 | Ga0111539_10210282 | 3300009094 | Bacteria | 2267 |
| 209 | Ga0111539_10374882 | 3300009094 | Bacteria | 1657 |
| 210 | Ga0105245_10003301 | 3300009098 | Bacteria | 14485 |
| 211 | Ga0105245_10186517 | 3300009098 | Bacteria | 1985 |
| 212 | Ga0105247_10140655 | 3300009101 | Bacteria | 1581 |
| 213 | Ga0114129_10088169 | 3300009147 | Bacteria | 4302 |
| 214 | Ga0105243_10001112 | 3300009148 | Bacteria | 24427 |
| 215 | Ga0105243_10046078 | 3300009148 | Bacteria | 3428 |
| 216 | Ga0105243_10166599 | 3300009148 | Bacteria | 1905 |
| 217 | Ga0105242_10005683 | 3300009176 | Bacteria | 9626 |
| 218 | Ga0105242_10027481 | 3300009176 | Bacteria | 4518 |
| 219 | Ga0105242_10163228 | 3300009176 | Bacteria | 1952 |
| 220 | Ga0105242_10524473 | 3300009176 | Bacteria | 1131 |
| 221 | Ga0105248_10029611 | 3300009177 | Bacteria | 6108 |
| 222 | Ga0105248_10051768 | 3300009177 | Bacteria | 4607 |
| 223 | Ga0105248_10079115 | 3300009177 | Bacteria | 3695 |
| 224 | Ga0105248_10196134 | 3300009177 | Bacteria | 2275 |
| 225 | Ga0105248_10211825 | 3300009177 | Bacteria | 2183 |
| 226 | Ga0105248_10571914 | 3300009177 | Bacteria | 1275 |
| 227 | Ga0105237_10025150 | 3300009545 | Bacteria | 6090 |
| 228 | Ga0105238_10029872 | 3300009551 | Bacteria | 5549 |
| 229 | Ga0105238_10035203 | 3300009551 | Bacteria | 5092 |
| 230 | Ga0105249_10000090 | 3300009553 | Bacteria | 127963 |
| 231 | Ga0105249_10064900 | 3300009553 | Bacteria | 3357 |
| 232 | Ga0105249_10107888 | 3300009553 | Bacteria | 2628 |
| 233 | Ga0105249_10341298 | 3300009553 | Bacteria | 1515 |
| 234 | Ga0105239_10002103 | 3300010375 | Bacteria | 25743 |
| 235 | Ga0105239_10009527 | 3300010375 | Bacteria | 10931 |
| 236 | Ga0105239_10072996 | 3300010375 | Bacteria | 3773 |
| 237 | Ga0105246_10004310 | 3300011119 | Bacteria | 8653 |
| 238 | Ga0105246_10028187 | 3300011119 | Bacteria | 3687 |
| 239 | Ga0157373_10072834 | 3300013100 | Bacteria | 2425 |
| 240 | Ga0157370_10007123 | 3300013104 | Bacteria | 12201 |
| 241 | Ga0157370_10077981 | 3300013104 | Bacteria | 3120 |
| 242 | Ga0157370_10101939 | 3300013104 | Bacteria | 2688 |
| 243 | Ga0157370_10109590 | 3300013104 | Bacteria | 2581 |
| 244 | Ga0157370_10391901 | 3300013104 | Unclassified | 1279 |
| 245 | Ga0157369_10001951 | 3300013105 | Bacteria | 24849 |
| 246 | Ga0157369_10006254 | 3300013105 | Bacteria | 13819 |
| 247 | Ga0157369_10220736 | 3300013105 | Bacteria | 1984 |
| 248 | Ga0157369_10415753 | 3300013105 | Bacteria | 1394 |
| 249 | Ga0157369_10446926 | 3300013105 | Bacteria | 1339 |
| 250 | Ga0157374_10007766 | 3300013296 | Bacteria | 9154 |
| 251 | Ga0157374_10016092 | 3300013296 | Bacteria | 6571 |
| 252 | Ga0157374_10258264 | 3300013296 | Bacteria | 1715 |
| 253 | Ga0157378_10000702 | 3300013297 | Bacteria | 31331 |
| 254 | Ga0157378_10002783 | 3300013297 | Bacteria | 15589 |
| 255 | Ga0157378_10003705 | 3300013297 | Bacteria | 13557 |
| 256 | Ga0163162_10606432 | 3300013306 | Bacteria | 1221 |
| 257 | Ga0163162_11242027 | 3300013306 | Bacteria | 846 |
| 258 | Ga0157372_10023313 | 3300013307 | Bacteria | 6708 |
| 259 | Ga0157372_10032896 | 3300013307 | Bacteria | 5690 |
| 260 | Ga0157372_10213207 | 3300013307 | Bacteria | 2238 |
| 261 | Ga0157375_10001073 | 3300013308 | Bacteria | 23687 |
| 262 | Ga0157375_10770632 | 3300013308 | Bacteria | 1112 |
| 263 | Ga0163163_10051003 | 3300014325 | Bacteria | 4078 |
| 264 | Ga0163163_10070914 | 3300014325 | Bacteria | 3471 |
| 265 | Ga0163163_10075367 | 3300014325 | Bacteria | 3367 |
| 266 | Ga0163163_10106053 | 3300014325 | Bacteria | 2836 |
| 267 | Ga0163163_10188046 | 3300014325 | Bacteria | 2113 |
| 268 | Ga0163163_10363751 | 3300014325 | Bacteria | 1503 |
| 269 | Ga0157377_10010953 | 3300014745 | Bacteria | 4508 |
| 270 | Ga0157377_10030377 | 3300014745 | Bacteria | 2927 |
| 271 | Ga0157377_10170477 | 3300014745 | Bacteria | 1361 |
| 272 | Ga0157379_10321410 | 3300014968 | Bacteria | 1413 |
| 273 | Ga0157376_10000078 | 3300014969 | Bacteria | 72879 |
| 274 | Ga0157376_10025465 | 3300014969 | Bacteria | 4660 |
| 275 | Ga0157376_10125891 | 3300014969 | Bacteria | 2279 |
| 276 | Ga0182006_1017252 | 3300015261 | Bacteria | 3069 |
| 277 | Ga0182006_1072260 | 3300015261 | Bacteria | 1276 |
| 278 | Ga0182007_10035208 | 3300015262 | Bacteria | 1688 |
| 279 | Ga0182005_1030528 | 3300015265 | Bacteria | 1468 |
| 280 | Ga0163161_10190292 | 3300017792 | Bacteria | 1577 |
| 281 | Ga0206353_10402294 | 3300020082 | Bacteria | 4841 |
| 282 | Ga0206353_11402362 | 3300020082 | Bacteria | 1952 |
| 283 | Ga0206353_11421135 | 3300020082 | Bacteria | 1367 |
| 284 | Ga0213873_10000004 | 3300021358 | Bacteria | 774374 |
| 285 | Ga0213872_10000008 | 3300021361 | Bacteria | 226283 |
| 286 | Ga0213872_10000079 | 3300021361 | Bacteria | 89092 |
| 287 | Ga0213874_10015475 | 3300021377 | Bacteria | 2013 |
| 288 | Ga0213876_10000007 | 3300021384 | Bacteria | 670340 |
| 289 | Ga0213876_10000555 | 3300021384 | Bacteria | 27950 |
| 290 | Ga0213876_10003528 | 3300021384 | Bacteria | 8921 |
| 291 | Ga0213876_10059302 | 3300021384 | Bacteria | 2020 |
| 292 | Ga0213875_10002705 | 3300021388 | Bacteria | 10470 |
| 293 | Ga0213875_10009086 | 3300021388 | Bacteria | 5050 |
| 294 | Ga0213875_10023369 | 3300021388 | Bacteria | 2952 |
| 295 | Ga0228598_1002491 | 3300024227 | Unclassified | 4009 |
| 296 | Ga0209784_100210 | 3300025224 | Bacteria | 40823 |
| 297 | Ga0209566_100295 | 3300025225 | Bacteria | 45189 |
| 298 | Ga0209566_100813 | 3300025225 | Bacteria | 16057 |
| 299 | Ga0209672_100062 | 3300025228 | Bacteria | 204912 |
| 300 | Ga0209672_100105 | 3300025228 | Bacteria | 102667 |
| 301 | Ga0209147_100012 | 3300025229 | Bacteria | 681990 |
| 302 | Ga0209147_100078 | 3300025229 | Bacteria | 204912 |
| 303 | Ga0209147_100145 | 3300025229 | Bacteria | 106552 |
| 304 | Ga0209147_100204 | 3300025229 | Bacteria | 64495 |
| 305 | Ga0209258_100107 | 3300025242 | Bacteria | 206572 |
| 306 | Ga0209258_100108 | 3300025242 | Bacteria | 204912 |
| 307 | Ga0209148_1000022 | 3300025254 | Bacteria | 681990 |
| 308 | Ga0209148_1001178 | 3300025254 | Bacteria | 15050 |
| 309 | Ga0209148_1001231 | 3300025254 | Bacteria | 14363 |
| 310 | Ga0209455_1000024 | 3300025272 | Bacteria | 676133 |
| 311 | Ga0209455_1000383 | 3300025272 | Bacteria | 39626 |
| 312 | Ga0209455_1001254 | 3300025272 | Bacteria | 11922 |
| 313 | Ga0209673_1000026 | 3300025273 | Bacteria | 373739 |
| 314 | Ga0209564_1007061 | 3300025295 | Bacteria | 5880 |
| 315 | Ga0207697_10000243 | 3300025315 | Bacteria | 29799 |
| 316 | Ga0207692_10000003 | 3300025898 | Bacteria | 431531 |
| 317 | Ga0207642_10081502 | 3300025899 | Bacteria | 1573 |
| 318 | Ga0207688_10001364 | 3300025901 | Bacteria | 12684 |
| 319 | Ga0207647_10010091 | 3300025904 | Bacteria | 6680 |
| 320 | Ga0207699_10003733 | 3300025906 | Bacteria | 7275 |
| 321 | Ga0207645_10002373 | 3300025907 | Bacteria | 14850 |
| 322 | Ga0207643_10120115 | 3300025908 | Bacteria | 1556 |
| 323 | Ga0207705_10005553 | 3300025909 | Bacteria | 9428 |
| 324 | Ga0207705_10073631 | 3300025909 | Bacteria | 2478 |
| 325 | Ga0207705_10077733 | 3300025909 | Bacteria | 2414 |
| 326 | Ga0207705_10108705 | 3300025909 | Bacteria | 2047 |
| 327 | Ga0207684_10042655 | 3300025910 | Bacteria | 3847 |
| 328 | Ga0207684_10076985 | 3300025910 | Bacteria | 2836 |
| 329 | Ga0207707_10003121 | 3300025912 | Bacteria | 14712 |
| 330 | Ga0207707_10020251 | 3300025912 | Bacteria | 5807 |
| 331 | Ga0207707_10029292 | 3300025912 | Bacteria | 4813 |
| 332 | Ga0207707_10045352 | 3300025912 | Bacteria | 3831 |
| 333 | Ga0207707_10046940 | 3300025912 | Bacteria | 3762 |
| 334 | Ga0207695_10000205 | 3300025913 | Bacteria | 162702 |
| 335 | Ga0207695_10006943 | 3300025913 | Bacteria | 14539 |
| 336 | Ga0207695_10030945 | 3300025913 | Bacteria | 5884 |
| 337 | Ga0207695_10041182 | 3300025913 | Bacteria | 4945 |
| 338 | Ga0207695_10082876 | 3300025913 | Bacteria | 3241 |
| 339 | Ga0207695_10146371 | 3300025913 | Unclassified | 2306 |
| 340 | Ga0207695_10147947 | 3300025913 | Bacteria | 2290 |
| 341 | Ga0207695_10165399 | 3300025913 | Bacteria | 2141 |
| 342 | Ga0207695_10170406 | 3300025913 | Bacteria | 2103 |
| 343 | Ga0207695_10326089 | 3300025913 | Bacteria | 1424 |
| 344 | Ga0207671_10113764 | 3300025914 | Bacteria | 2062 |
| 345 | Ga0207660_10008792 | 3300025917 | Bacteria | 6529 |
| 346 | Ga0207660_10033479 | 3300025917 | Bacteria | 3555 |
| 347 | Ga0207660_10060286 | 3300025917 | Bacteria | 2727 |
| 348 | Ga0207662_10004173 | 3300025918 | Bacteria | 7568 |
| 349 | Ga0207662_10189833 | 3300025918 | Bacteria | 1325 |
| 350 | Ga0207657_10000053 | 3300025919 | Bacteria | 107963 |
| 351 | Ga0207657_10004491 | 3300025919 | Bacteria | 14748 |
| 352 | Ga0207657_10009720 | 3300025919 | Bacteria | 9645 |
| 353 | Ga0207657_10056371 | 3300025919 | Bacteria | 3391 |
| 354 | Ga0207649_10015628 | 3300025920 | Bacteria | 4263 |
| 355 | Ga0207649_10103251 | 3300025920 | Bacteria | 1891 |
| 356 | Ga0207652_10082324 | 3300025921 | Bacteria | 2816 |
| 357 | Ga0207652_10095758 | 3300025921 | Bacteria | 2615 |
| 358 | Ga0207652_10233970 | 3300025921 | Bacteria | 1656 |
| 359 | Ga0207652_10273568 | 3300025921 | Bacteria | 1523 |
| 360 | Ga0207646_10009412 | 3300025922 | Bacteria | 9655 |
| 361 | Ga0207646_10020234 | 3300025922 | Bacteria | 6168 |
| 362 | Ga0207694_10043711 | 3300025924 | Bacteria | 3458 |
| 363 | Ga0207694_10193313 | 3300025924 | Bacteria | 1654 |
| 364 | Ga0207694_10205747 | 3300025924 | Unclassified | 1602 |
| 365 | Ga0207650_10119299 | 3300025925 | Bacteria | 2051 |
| 366 | Ga0207650_10314795 | 3300025925 | Bacteria | 1281 |
| 367 | Ga0207659_10000241 | 3300025926 | Bacteria | 33277 |
| 368 | Ga0207659_10058429 | 3300025926 | Bacteria | 2769 |
| 369 | Ga0207687_10000683 | 3300025927 | Bacteria | 22873 |
| 370 | Ga0207700_10152025 | 3300025928 | Bacteria | 1914 |
| 371 | Ga0207664_10017879 | 3300025929 | Bacteria | 5208 |
| 372 | Ga0207644_10012241 | 3300025931 | Bacteria | 5696 |
| 373 | Ga0207690_10000009 | 3300025932 | Bacteria | 366044 |
| 374 | Ga0207690_10000057 | 3300025932 | Bacteria | 100648 |
| 375 | Ga0207690_10008222 | 3300025932 | Bacteria | 6189 |
| 376 | Ga0207690_10048246 | 3300025932 | Bacteria | 2830 |
| 377 | Ga0207706_10021245 | 3300025933 | Bacteria | 5831 |
| 378 | Ga0207686_10006604 | 3300025934 | Bacteria | 6251 |
| 379 | Ga0207686_10007103 | 3300025934 | Bacteria | 6025 |
| 380 | Ga0207709_10000118 | 3300025935 | Bacteria | 122125 |
| 381 | Ga0207709_10100927 | 3300025935 | Bacteria | 1908 |
| 382 | Ga0207704_10000027 | 3300025938 | Bacteria | 122372 |
| 383 | Ga0207704_10091173 | 3300025938 | Bacteria | 2002 |
| 384 | Ga0207691_10185734 | 3300025940 | Bacteria | 1815 |
| 385 | Ga0207711_10096398 | 3300025941 | Bacteria | 2610 |
| 386 | Ga0207711_10112623 | 3300025941 | Unclassified | 2422 |
| 387 | Ga0207689_10000309 | 3300025942 | Bacteria | 44940 |
| 388 | Ga0207689_10006387 | 3300025942 | Bacteria | 10435 |
| 389 | Ga0207661_10000599 | 3300025944 | Bacteria | 22999 |
| 390 | Ga0207661_10274397 | 3300025944 | Bacteria | 1505 |
| 391 | Ga0207661_10340584 | 3300025944 | Bacteria | 1351 |
| 392 | Ga0207679_10124810 | 3300025945 | Bacteria | 2056 |
| 393 | Ga0207667_10014344 | 3300025949 | Bacteria | 9038 |
| 394 | Ga0207667_10028283 | 3300025949 | Bacteria | 6090 |
| 395 | Ga0207667_10113171 | 3300025949 | Bacteria | 2798 |
| 396 | Ga0207667_10159436 | 3300025949 | Bacteria | 2321 |
| 397 | Ga0207667_10509630 | 3300025949 | Bacteria | 1220 |
| 398 | Ga0207651_10000016 | 3300025960 | Bacteria | 122094 |
| 399 | Ga0207712_10000903 | 3300025961 | Bacteria | 21480 |
| 400 | Ga0207712_10035255 | 3300025961 | Bacteria | 3397 |
| 401 | Ga0207668_10151910 | 3300025972 | Bacteria | 1794 |
| 402 | Ga0207658_10014726 | 3300025986 | Bacteria | 5359 |
| 403 | Ga0207677_10000171 | 3300026023 | Bacteria | 51383 |
| 404 | Ga0207703_10005310 | 3300026035 | Bacteria | 10383 |
| 405 | Ga0207703_10404848 | 3300026035 | Bacteria | 1267 |
| 406 | Ga0207639_10024134 | 3300026041 | Bacteria | 4397 |
| 407 | Ga0207678_10009219 | 3300026067 | Bacteria | 8684 |
| 408 | Ga0207678_10016820 | 3300026067 | Bacteria | 6423 |
| 409 | Ga0207708_10000047 | 3300026075 | Bacteria | 115550 |
| 410 | Ga0207708_10030220 | 3300026075 | Bacteria | 4109 |
| 411 | Ga0207702_10009858 | 3300026078 | Bacteria | 8006 |
| 412 | Ga0207702_10059276 | 3300026078 | Bacteria | 3260 |
| 413 | Ga0207702_10087599 | 3300026078 | Bacteria | 2718 |
| 414 | Ga0207702_10097825 | 3300026078 | Bacteria | 2583 |
| 415 | Ga0207641_10003377 | 3300026088 | Bacteria | 14176 |
| 416 | Ga0207641_10079686 | 3300026088 | Bacteria | 2840 |
| 417 | Ga0207648_10000116 | 3300026089 | Bacteria | 77755 |
| 418 | Ga0207648_10009228 | 3300026089 | Bacteria | 9475 |
| 419 | Ga0207674_10120923 | 3300026116 | Bacteria | 2586 |
| 420 | Ga0207675_100016103 | 3300026118 | Bacteria | 6984 |
| 421 | Ga0207683_10027190 | 3300026121 | Bacteria | 4943 |
| 422 | Ga0207683_10145779 | 3300026121 | Bacteria | 2135 |
| 423 | Ga0207683_10338914 | 3300026121 | Bacteria | 1379 |
| 424 | Ga0207698_10006545 | 3300026142 | Bacteria | 7279 |
| 425 | Ga0207698_10015498 | 3300026142 | Bacteria | 5105 |
| 426 | Ga0207698_10028826 | 3300026142 | Bacteria | 3965 |
| 427 | Ga0207698_10281730 | 3300026142 | Bacteria | 1538 |
| 428 | Ga0209371_1000195 | 3300027312 | Bacteria | 89403 |
| 429 | Ga0209371_1000467 | 3300027312 | Bacteria | 39808 |
| 430 | Ga0209371_1006068 | 3300027312 | Bacteria | 4591 |
| 431 | Ga0207428_10167670 | 3300027907 | Bacteria | 1664 |
| 432 | Ga0268266_10000924 | 3300028379 | Bacteria | 37565 |
| 433 | Ga0268266_10001659 | 3300028379 | Bacteria | 25701 |
| 434 | Ga0268266_10003855 | 3300028379 | Bacteria | 14632 |
| 435 | Ga0268266_10005825 | 3300028379 | Bacteria | 11403 |
| 436 | Ga0268266_10046783 | 3300028379 | Bacteria | 3704 |
| 437 | Ga0268266_10066384 | 3300028379 | Bacteria | 3120 |
| 438 | Ga0268266_10261282 | 3300028379 | Bacteria | 1605 |
| 439 | Ga0268265_10456974 | 3300028380 | Bacteria | 1194 |
| 440 | Ga0268264_10000033 | 3300028381 | Bacteria | 404123 |
| 441 | Ga0268264_10000138 | 3300028381 | Bacteria | 172597 |
| 442 | Ga0268264_10011411 | 3300028381 | Bacteria | 7340 |
| 443 | Ga0268264_10039433 | 3300028381 | Bacteria | 3903 |
| 444 | Ga0268264_10138104 | 3300028381 | Bacteria | 2170 |
| 445 | Ga0265337_1000126 | 3300028556 | Bacteria | 38633 |
| 446 | Ga0265326_10000144 | 3300028558 | Bacteria | 37151 |
| 447 | Ga0265319_1034801 | 3300028563 | Bacteria | 1731 |
| 448 | Ga0265334_10014951 | 3300028573 | Bacteria | 3230 |
| 449 | Ga0265322_10000009 | 3300028654 | Bacteria | 170768 |
| 450 | Ga0307515_10000066 | 3300028794 | Bacteria | 244076 |
| 451 | Ga0265338_10014175 | 3300028800 | Bacteria | 8906 |
| 452 | Ga0265338_10049640 | 3300028800 | Bacteria | 3801 |
| 453 | Ga0265338_10079466 | 3300028800 | Bacteria | 2760 |
| 454 | Ga0265324_10000389 | 3300029957 | Bacteria | 31898 |
| 455 | Ga0268256_1000168 | 3300030500 | Bacteria | 81587 |
| 456 | Ga0268256_1000566 | 3300030500 | Bacteria | 29863 |
| 457 | Ga0268256_1001844 | 3300030500 | Bacteria | 11807 |
| 458 | Ga0265760_10004349 | 3300031090 | Unclassified | 4067 |
| 459 | Ga0265330_10051908 | 3300031235 | Bacteria | 1797 |
| 460 | Ga0265332_10008765 | 3300031238 | Bacteria | 4530 |
| 461 | Ga0265328_10003668 | 3300031239 | Bacteria | 6766 |
| 462 | Ga0265320_10000024 | 3300031240 | Bacteria | 170768 |
| 463 | Ga0265320_10041151 | 3300031240 | Bacteria | 2299 |
| 464 | Ga0265329_10002956 | 3300031242 | Bacteria | 7560 |
| 465 | Ga0265340_10018544 | 3300031247 | Bacteria | 3589 |
| 466 | Ga0265339_10011561 | 3300031249 | Bacteria | 5426 |
| 467 | Ga0265339_10021505 | 3300031249 | Bacteria | 3751 |
| 468 | Ga0265331_10000894 | 3300031250 | Bacteria | 24175 |
| 469 | Ga0265331_10006208 | 3300031250 | Bacteria | 7091 |
| 470 | Ga0265327_10000227 | 3300031251 | Bacteria | 114777 |
| 471 | Ga0307513_10000017 | 3300031456 | Bacteria | 282386 |
| 472 | Ga0307509_10071000 | 3300031507 | Bacteria | 3634 |
| 473 | Ga0307408_100000028 | 3300031548 | Bacteria | 233440 |
| 474 | Ga0265313_10000079 | 3300031595 | Bacteria | 95515 |
| 475 | Ga0265314_10000570 | 3300031711 | Bacteria | 46890 |
| 476 | Ga0265314_10033616 | 3300031711 | Bacteria | 3756 |
| 477 | Ga0265314_10162660 | 3300031711 | Bacteria | 1356 |
| 478 | Ga0307516_10005910 | 3300031730 | Bacteria | 14486 |
| 479 | Ga0307410_10293254 | 3300031852 | Bacteria | 1281 |
| 480 | Ga0307410_10361999 | 3300031852 | Bacteria | 1162 |
| 481 | Ga0307406_10002397 | 3300031901 | Bacteria | 10188 |
| 482 | Ga0307406_10024232 | 3300031901 | Bacteria | 3622 |
| 483 | Ga0307406_10150143 | 3300031901 | Bacteria | 1661 |
| 484 | Ga0307407_10000744 | 3300031903 | Bacteria | 10678 |
| 485 | Ga0307407_10174488 | 3300031903 | Bacteria | 1419 |
| 486 | Ga0307412_10004845 | 3300031911 | Bacteria | 7509 |
| 487 | Ga0307412_10271217 | 3300031911 | Bacteria | 1328 |
| 488 | Ga0307409_100024328 | 3300031995 | Bacteria | 4222 |
| 489 | Ga0307409_100035351 | 3300031995 | Bacteria | 3661 |
| 490 | Ga0307409_100161087 | 3300031995 | Bacteria | 1962 |
| 491 | Ga0307409_100368405 | 3300031995 | Bacteria | 1361 |
| 492 | Ga0307416_100003103 | 3300032002 | Bacteria | 9724 |
| 493 | Ga0307414_10002550 | 3300032004 | Bacteria | 9575 |
| 494 | Ga0307411_10243318 | 3300032005 | Bacteria | 1410 |
| 495 | Ga0307415_100081996 | 3300032126 | Bacteria | 2306 |
| 496 | Ga0373926_0028143 | 3300035083 | Bacteria | 1972 |
| 497 | Ga0373926_0061881 | 3300035083 | Bacteria | 1366 |
| 498 | Ga0373923_0001712 | 3300035111 | Unclassified | 6439 |
| 499 | Ga0373932_0056766 | 3300035112 | Bacteria | 1178 |
| 500 | Ga0373945_0009684 | 3300035116 | Bacteria | 3161 |
| 501 | Ga0373954_0078404 | 3300035118 | Unclassified | 1576 |
| 502 | Ga0373960_0004844 | 3300035121 | Bacteria | 3099 |
| 503 | Ga0373943_0004078 | 3300035170 | Bacteria | 6630 |
| 504 | Ga0373946_0004504 | 3300035171 | Bacteria | 4991 |
| 505 | Ga0373955_0006678 | 3300035172 | Bacteria | 5264 |
| 506 | Ga0373955_0053770 | 3300035172 | Bacteria | 2200 |
| 507 | Ga0373962_0054469 | 3300035242 | Bacteria | 1160 |
| 508 | Ga0373924_0125186 | 3300035410 | Bacteria | 1117 |
| 509 | Ga0373931_0035941 | 3300035691 | Bacteria | 2579 |
| 510 | Ga0373935_0017397 | 3300035692 | Bacteria | 4361 |
| 511 | Ga0373927_0016957 | 3300035695 | Bacteria | 4800 |
| 512 | Ga0373927_0023943 | 3300035695 | Bacteria | 3994 |
| 513 | Ga0373927_0094995 | 3300035695 | Unclassified | 1937 |
| 514 | Ga0373937_0056926 | 3300036401 | Unclassified | 3590 |
| 515 | Ga0373937_0283051 | 3300036401 | Unclassified | 1566 |
| 516 | Ga0373937_0423310 | 3300036401 | Bacteria | 1264 |
| 517 | Ga0373925_0009583 | 3300037068 | Bacteria | 7057 |
| 518 | Ga0373925_0336624 | 3300037068 | Bacteria | 1223 |
| 519 | Ga0395899_0001048 | 3300037312 | Bacteria | 25043 |
| 520 | Ga0395899_0024104 | 3300037312 | Bacteria | 4603 |
| 521 | Ga0395899_0053532 | 3300037312 | Bacteria | 2988 |
| 522 | Ga0395900_0003285 | 3300037418 | Bacteria | 17503 |
| 523 | Ga0395900_0005953 | 3300037418 | Bacteria | 12733 |
| 524 | Ga0395900_0010110 | 3300037418 | Bacteria | 9649 |
| 525 | Ga0395900_0082924 | 3300037418 | Bacteria | 3294 |
| 526 | Ga0395900_0107609 | 3300037418 | Bacteria | 2864 |
| 527 | Ga0395898_0025658 | 3300037466 | Bacteria | 5936 |
| 528 | Ga0395898_0040821 | 3300037466 | Bacteria | 4586 |
| 529 | Ga0395898_0268242 | 3300037466 | Bacteria | 1628 |
| 530 | Ga0395905_0101742 | 3300037471 | Bacteria | 2697 |
| 531 | Ga0436364_0409699 | 3300037853 | Bacteria | 3757 |
| 532 | Ga0436364_0527107 | 3300037853 | Bacteria | 72365 |
| 533 | Ga0436364_0857265 | 3300037853 | Bacteria | 7664 |
| 534 | Ga0436364_1548394 | 3300037853 | Bacteria | 98245 |
| 535 | Ga0395901_0001587 | 3300038443 | Bacteria | 23512 |
| 536 | Ga0395901_0004093 | 3300038443 | Bacteria | 14696 |
| 537 | Ga0395901_0028392 | 3300038443 | Bacteria | 5753 |
| 538 | Ga0436365_0212021 | 3300039437 | Bacteria | 9772 |
| 539 | Ga0436365_0394061 | 3300039437 | Bacteria | 142715 |
| 540 | Ga0436365_0787653 | 3300039437 | Bacteria | 18550 |
| 541 | Ga0436365_1011053 | 3300039437 | Bacteria | 25340 |
| 542 | Ga0436365_1308047 | 3300039437 | Bacteria | 1178 |
| 543 | Ga0436365_1609485 | 3300039437 | Bacteria | 2317 |
| 544 | Ga0436365_1612362 | 3300039437 | Bacteria | 3356 |
| 545 | Ga0436365_1647369 | 3300039437 | Bacteria | 25384 |
| 546 | Ga0436360_0422338 | 3300039438 | Bacteria | 46106 |
| 547 | Ga0436361_0296121 | 3300039447 | Bacteria | 160237 |
| 548 | Ga0436361_0400659 | 3300039447 | Bacteria | 7945 |
| 549 | Ga0436361_0757401 | 3300039447 | Bacteria | 49858 |
| 550 | Ga0436363_0587086 | 3300039450 | Bacteria | 17071 |
| 551 | Ga0436363_0654378 | 3300039450 | Unclassified | 4718 |
| 552 | Ga0436363_1583874 | 3300039450 | Bacteria | 34394 |
| 553 | Ga0436362_0290430 | 3300039453 | Bacteria | 772596 |
| 554 | Ga0436362_0871163 | 3300039453 | Bacteria | 15371 |
| 555 | Ga0439466_0001763 | 3300041411 | Bacteria | 8467 |
| 556 | Ga0439462_0035591 | 3300042015 | Bacteria | 1324 |
| 557 | Ga0439440_0011036 | 3300042993 | Bacteria | 1900 |
| 558 | Ga0453683_0003525 | 3300044673 | Bacteria | 11503 |
| 559 | Ga0466966_0037442 | 3300044684 | Bacteria | 3129 |
| 560 | Ga0466961_0037790 | 3300044693 | Bacteria | 3097 |
| 561 | Ga0466961_0054521 | 3300044693 | Bacteria | 2550 |
| 562 | Ga0466970_0016305 | 3300044765 | Bacteria | 3827 |
| 563 | Ga0466970_0028875 | 3300044765 | Bacteria | 2917 |
| 564 | Ga0466960_0016166 | 3300044901 | Bacteria | 3232 |
| 565 | Ga0466959_0077474 | 3300045049 | Bacteria | 2399 |
| 566 | Ga0466959_0143372 | 3300045049 | Bacteria | 1687 |
| 567 | Ga0466959_0164722 | 3300045049 | Unclassified | 1557 |
| 568 | Ga0451576_0036904 | 3300045051 | Bacteria | 5178 |
| 569 | Ga0451576_0451197 | 3300045051 | Bacteria | 1350 |
| 570 | Ga0466958_0005932 | 3300045836 | Bacteria | 6604 |
| 571 | Ga0466958_0023519 | 3300045836 | Bacteria | 3618 |
| 572 | Ga0466967_0000343 | 3300045976 | Bacteria | 21442 |
| 573 | Ga0466967_0037977 | 3300045976 | Bacteria | 4127 |
| 574 | Ga0466967_0059951 | 3300045976 | Bacteria | 3370 |
| 575 | Ga0466967_0098084 | 3300045976 | Bacteria | 2675 |
| 576 | Ga0466967_0109220 | 3300045976 | Bacteria | 2539 |
| 577 | Ga0466967_0380273 | 3300045976 | Bacteria | 1371 |
| 578 | Ga0495592_0015796 | 3300046454 | Bacteria | 5728 |
| 579 | Ga0495629_0047601 | 3300046459 | Bacteria | 3008 |
| 580 | Ga0495641_0000458 | 3300046461 | Bacteria | 33934 |
| 581 | Ga0495651_0005707 | 3300046462 | Bacteria | 9485 |
| 582 | Ga0495653_0005801 | 3300046463 | Bacteria | 10102 |
| 583 | Ga0495653_0009609 | 3300046463 | Unclassified | 7910 |
| 584 | Ga0495580_0007926 | 3300046472 | Bacteria | 8496 |
| 585 | Ga0495580_0071886 | 3300046472 | Bacteria | 2417 |
| 586 | Ga0495580_0126661 | 3300046472 | Bacteria | 1772 |
| 587 | Ga0495582_0187513 | 3300046473 | Bacteria | 1179 |
| 588 | Ga0495639_0126262 | 3300046475 | Bacteria | 1223 |
| 589 | Ga0495664_0015717 | 3300046477 | Unclassified | 4307 |
| 590 | Ga0495594_0000017 | 3300046499 | Bacteria | 88992 |
| 591 | Ga0495596_0125383 | 3300046500 | Bacteria | 997 |
| 592 | Ga0495608_0034078 | 3300046511 | Bacteria | 3438 |
| 593 | Ga0495620_0002096 | 3300046515 | Bacteria | 11595 |
| 594 | Ga0495628_0000081 | 3300046516 | Bacteria | 74176 |
| 595 | Ga0495628_0010519 | 3300046516 | Bacteria | 7854 |
| 596 | Ga0495628_0082803 | 3300046516 | Unclassified | 2492 |
| 597 | Ga0495628_0169594 | 3300046516 | Bacteria | 1655 |
| 598 | Ga0495630_0028903 | 3300046517 | Bacteria | 4120 |
| 599 | Ga0495630_0039449 | 3300046517 | Bacteria | 3530 |
| 600 | Ga0495630_0146635 | 3300046517 | Bacteria | 1795 |
| 601 | Ga0495630_0347018 | 3300046517 | Bacteria | 1136 |
| 602 | Ga0495631_0031811 | 3300046518 | Bacteria | 2381 |
| 603 | Ga0495644_0010665 | 3300046523 | Bacteria | 3539 |
| 604 | Ga0495652_0000022 | 3300046529 | Bacteria | 178368 |
| 605 | Ga0495652_0010794 | 3300046529 | Bacteria | 8280 |
| 606 | Ga0495652_0040858 | 3300046529 | Unclassified | 4008 |
| 607 | Ga0495640_0038820 | 3300046533 | Viruses | 3347 |
| 608 | Ga0495640_0121907 | 3300046533 | Bacteria | 1694 |
| 609 | Ga0495586_0002941 | 3300046535 | Bacteria | 9187 |
| 610 | Ga0495586_0039939 | 3300046535 | Unclassified | 2523 |
| 611 | Ga0495586_0203984 | 3300046535 | Bacteria | 1121 |
| 612 | Ga0495587_0000812 | 3300046536 | Bacteria | 20799 |
| 613 | Ga0495587_0033679 | 3300046536 | Bacteria | 3091 |
| 614 | Ga0495587_0050817 | 3300046536 | Bacteria | 2453 |
| 615 | Ga0495645_0000098 | 3300046543 | Bacteria | 59944 |
| 616 | Ga0495645_0015934 | 3300046543 | Viruses | 5356 |
| 617 | Ga0495645_0108093 | 3300046543 | Unclassified | 1971 |
| 618 | Ga0495645_0133399 | 3300046543 | Bacteria | 1738 |
| 619 | Ga0495622_0000057 | 3300046557 | Bacteria | 97942 |
| 620 | Ga0495667_0071630 | 3300046559 | Bacteria | 2260 |
| 621 | Ga0495656_0092122 | 3300046615 | Bacteria | 1388 |
| 622 | Ga0495634_0039730 | 3300046642 | Bacteria | 3203 |
| 623 | Ga0495635_0110175 | 3300046663 | Bacteria | 1881 |
| 624 | Ga0495588_0115021 | 3300046674 | Bacteria | 1418 |
| 625 | Ga0495657_0015602 | 3300046675 | Bacteria | 5552 |
| 626 | Ga0495657_0059077 | 3300046675 | Bacteria | 2545 |
| 627 | Ga0495657_0140290 | 3300046675 | Bacteria | 1507 |
| 628 | Ga0495646_0003444 | 3300046680 | Bacteria | 9846 |
| 629 | Ga0495669_0024665 | 3300046684 | Bacteria | 2619 |
| 630 | Ga0495613_0000397 | 3300046689 | Bacteria | 37243 |
| 631 | Ga0495613_0104714 | 3300046689 | Bacteria | 2043 |
| 632 | Ga0495613_0252322 | 3300046689 | Bacteria | 1231 |
| 633 | Ga0495613_0287868 | 3300046689 | Bacteria | 1140 |
| 634 | Ga0495624_0011138 | 3300046690 | Unclassified | 6186 |
| 635 | Ga0495604_0012072 | 3300047317 | Bacteria | 6869 |
| 636 | Ga0495604_0026503 | 3300047317 | Bacteria | 4614 |
| 637 | Ga0495674_0003091 | 3300047319 | Bacteria | 16177 |
| 638 | Ga0495674_0009954 | 3300047319 | Bacteria | 9016 |
| 639 | Ga0495674_0053462 | 3300047319 | Bacteria | 3550 |
| 640 | Ga0495674_0111298 | 3300047319 | Bacteria | 2321 |
| 641 | Ga0495672_0024603 | 3300047320 | Bacteria | 3875 |
| 642 | Ga0495680_0000426 | 3300047322 | Bacteria | 47283 |
| 643 | Ga0495680_0001560 | 3300047322 | Bacteria | 24536 |
| 644 | Ga0495680_0068338 | 3300047322 | Bacteria | 2715 |
| 645 | Ga0495675_0000394 | 3300047444 | Bacteria | 30207 |
| 646 | Ga0495675_0002656 | 3300047444 | Bacteria | 10709 |
| 647 | Ga0495675_0013384 | 3300047444 | Bacteria | 5178 |
| 648 | Ga0495675_0063195 | 3300047444 | Bacteria | 2343 |
| 649 | Ga0495673_0051127 | 3300047469 | Bacteria | 1811 |
| 650 | Ga0495684_0000431 | 3300047471 | Bacteria | 34259 |
| 651 | Ga0495684_0002041 | 3300047471 | Bacteria | 16252 |
| 652 | Ga0495684_0014397 | 3300047471 | Viruses | 6086 |
| 653 | Ga0495686_0000011 | 3300047472 | Bacteria | 514750 |
| 654 | Ga0495686_0042204 | 3300047472 | Bacteria | 2902 |
| 655 | Ga0495593_0009498 | 3300047673 | Unclassified | 5643 |
| 656 | Ga0495602_0012580 | 3300048088 | Bacteria | 8686 |
| 657 | Ga0495602_0150086 | 3300048088 | Unclassified | 1833 |
| 658 | Ga0495602_0166364 | 3300048088 | Bacteria | 1716 |
| 659 | Ga0496100_0006847 | 3300048903 | Bacteria | 6244 |
| 660 | Ga0496101_0002546 | 3300048904 | Bacteria | 11181 |
| 661 | Ga0496102_0028527 | 3300048905 | Bacteria | 4986 |
| 662 | Ga0496102_0047822 | 3300048905 | Bacteria | 3889 |
| 663 | Ga0496102_0114885 | 3300048905 | Bacteria | 2512 |
| 664 | Ga0496105_0089133 | 3300048908 | Bacteria | 2548 |
| 665 | Ga0496105_0095898 | 3300048908 | Bacteria | 2450 |
| 666 | Ga0496106_0045863 | 3300048909 | Bacteria | 3285 |
| 667 | Ga0496107_0108611 | 3300048910 | Bacteria | 2038 |
| 668 | Ga0496108_0153329 | 3300048911 | Bacteria | 1989 |
| 669 | Ga0496109_0001274 | 3300048912 | Bacteria | 20900 |
| 670 | Ga0496109_0002595 | 3300048912 | Bacteria | 15136 |
| 671 | Ga0496109_0024472 | 3300048912 | Bacteria | 5369 |
| 672 | Ga0496110_0006769 | 3300048913 | Bacteria | 9117 |
| 673 | Ga0496110_0063311 | 3300048913 | Bacteria | 3268 |
| 674 | Ga0496110_0109984 | 3300048913 | Bacteria | 2475 |
| 675 | Ga0496110_0396896 | 3300048913 | Bacteria | 1257 |
| 676 | Ga0496111_0032964 | 3300048914 | Bacteria | 3694 |
| 677 | Ga0496112_0035906 | 3300048915 | Bacteria | 4831 |
| 678 | Ga0496112_0050315 | 3300048915 | Bacteria | 4086 |
| 679 | Ga0496112_0067609 | 3300048915 | Bacteria | 3527 |
| 680 | Ga0496112_0168670 | 3300048915 | Bacteria | 2155 |
| 681 | Ga0496113_0092541 | 3300048916 | Bacteria | 2332 |
| 682 | Ga0496114_0003080 | 3300048917 | Bacteria | 12777 |
| 683 | Ga0496115_0356377 | 3300048918 | Bacteria | 1193 |
| 684 | Ga0496117_0004162 | 3300048920 | Bacteria | 16171 |
| 685 | Ga0496117_0020188 | 3300048920 | Bacteria | 5442 |
| 686 | Ga0496118_0000450 | 3300048921 | Bacteria | 68053 |
| 687 | Ga0496118_0024273 | 3300048921 | Bacteria | 5241 |
| 688 | Ga0496119_0148347 | 3300048922 | Bacteria | 1259 |
| 689 | Ga0496121_0005238 | 3300048924 | Bacteria | 16778 |
| 690 | Ga0496121_0178875 | 3300048924 | Bacteria | 1533 |
| 691 | Ga0496122_0026111 | 3300048925 | Bacteria | 5050 |
| 692 | Ga0496123_0036090 | 3300048926 | Bacteria | 3512 |
| 693 | Ga0496124_0000070 | 3300048927 | Bacteria | 220875 |
| 694 | Ga0496124_0000355 | 3300048927 | Bacteria | 83748 |
| 695 | Ga0496124_0006021 | 3300048927 | Bacteria | 13370 |
| 696 | Ga0501031_0210726 | 3300049568 | Bacteria | 1266 |
| 697 | Ga0501034_0001852 | 3300049571 | Bacteria | 26847 |
| 698 | Ga0501034_0002374 | 3300049571 | Bacteria | 22862 |
| 699 | Ga0501034_0132419 | 3300049571 | Bacteria | 2476 |
| 700 | Ga0501036_0049412 | 3300049572 | Bacteria | 3562 |
| 701 | Ga0501036_0234452 | 3300049572 | Bacteria | 1540 |
| 702 | Ga0501039_0055354 | 3300049575 | Bacteria | 3072 |
| 703 | Ga0501039_0062195 | 3300049575 | Bacteria | 2892 |
| 704 | Ga0501040_0081832 | 3300049576 | Bacteria | 2238 |
| 705 | Ga0501040_0168003 | 3300049576 | Bacteria | 1552 |
| 706 | Ga0501040_0213159 | 3300049576 | Bacteria | 1373 |
| 707 | Ga0501041_0022365 | 3300049577 | Bacteria | 3785 |
| 708 | Ga0501041_0162333 | 3300049577 | Bacteria | 1397 |
| 709 | Ga0501041_0217069 | 3300049577 | Bacteria | 1200 |
| 710 | Ga0501047_0088218 | 3300049581 | Bacteria | 2979 |
| 711 | Ga0501047_0159791 | 3300049581 | Bacteria | 2125 |
| 712 | Ga0501047_0260409 | 3300049581 | Bacteria | 1582 |
| 713 | Ga0501048_0030175 | 3300049582 | Bacteria | 3925 |
| 714 | Ga0501048_0091121 | 3300049582 | Bacteria | 2151 |
| 715 | Ga0501048_0147367 | 3300049582 | Bacteria | 1665 |
| 716 | Ga0501068_0058162 | 3300049584 | Bacteria | 2345 |
| 717 | Ga0501070_0000493 | 3300049586 | Bacteria | 35853 |
| 718 | Ga0501070_0124471 | 3300049586 | Bacteria | 2131 |
| 719 | Ga0501071_0020975 | 3300049587 | Bacteria | 4548 |
| 720 | Ga0501072_0094503 | 3300049588 | Bacteria | 2375 |
| 721 | Ga0501072_0205028 | 3300049588 | Bacteria | 1572 |
| 722 | Ga0501074_0200833 | 3300049590 | Bacteria | 1421 |
| 723 | Ga0501075_0104920 | 3300049591 | Bacteria | 2148 |
| 724 | Ga0501075_0166588 | 3300049591 | Bacteria | 1681 |
| 725 | Ga0501075_0179050 | 3300049591 | Bacteria | 1618 |
| 726 | Ga0501076_0014021 | 3300049592 | Bacteria | 6024 |
| 727 | Ga0501076_0038612 | 3300049592 | Bacteria | 3749 |
| 728 | Ga0501077_0138678 | 3300049593 | Bacteria | 1542 |
| 729 | Ga0501080_0242574 | 3300049742 | Bacteria | 1644 |
| 730 | Ga0501081_0137809 | 3300049743 | Bacteria | 1748 |
| 731 | Ga0501083_0004416 | 3300049744 | Bacteria | 9923 |
| 732 | Ga0501035_0220233 | 3300049822 | Bacteria | 1621 |
| 733 | Ga0501044_0099928 | 3300049823 | Bacteria | 2920 |
| 734 | Ga0501044_0255447 | 3300049823 | Bacteria | 1692 |
| 735 | Ga0501045_0041787 | 3300049824 | Bacteria | 3337 |
| 736 | nmdc:mga03683_11410_c1 | 3300050489 | Bacteria | 3217 |
| 737 | nmdc:mga03683_1905_c1 | 3300050489 | Bacteria | 6367 |
| 738 | nmdc:mga03683_2466_c1 | 3300050489 | Bacteria | 5751 |
| 739 | nmdc:mga03683_26879_c1 | 3300050489 | Bacteria | 2274 |
| 740 | nmdc:mga03683_53201_c1 | 3300050489 | Bacteria | 1694 |
| 741 | nmdc:mga0yw44_151110_c1 | 3300050492 | Bacteria | 1515 |
| 742 | nmdc:mga0yw44_34699_c1 | 3300050492 | Bacteria | 2958 |
| 743 | nmdc:mga0yw44_38717_c1 | 3300050492 | Bacteria | 2823 |
| 744 | nmdc:mga0yw44_43251_c1 | 3300050492 | Bacteria | 2688 |
| 745 | nmdc:mga0k408_3429_c1 | 3300050493 | Bacteria | 8394 |
| 746 | nmdc:mga0k408_64745_c1 | 3300050493 | Bacteria | 2127 |
| 747 | nmdc:mga06z11_113473_c1 | 3300050494 | Bacteria | 1503 |
| 748 | nmdc:mga06z11_3645_c1 | 3300050494 | Bacteria | 5977 |
| 749 | nmdc:mga05p37_29071_c1 | 3300050507 | Bacteria | 6746 |
| 750 | nmdc:mga05p37_7730_c1 | 3300050507 | Bacteria | 12689 |
| 751 | nmdc:mga09592_107672_c1 | 3300050508 | Bacteria | 2391 |
| 752 | nmdc:mga09592_190066_c1 | 3300050508 | Bacteria | 1777 |
| 753 | nmdc:mga09592_281689_c1 | 3300050508 | Bacteria | 1442 |
| 754 | nmdc:mga0qj67_165193_c1 | 3300050509 | Bacteria | 1797 |
| 755 | nmdc:mga0qj67_165418_c1 | 3300050509 | Bacteria | 1796 |
| 756 | nmdc:mga0qj67_294956_c1 | 3300050509 | Bacteria | 1314 |
| 757 | nmdc:mga0qj67_86146_c1 | 3300050509 | Bacteria | 2520 |
| 758 | nmdc:mga06r32_132326_c1 | 3300050510 | Bacteria | 2467 |
| 759 | nmdc:mga06r32_49457_c1 | 3300050510 | Bacteria | 4020 |
| 760 | nmdc:mga08y16_133236_c1 | 3300050511 | Bacteria | 2583 |
| 761 | nmdc:mga08y16_3246_c1 | 3300050511 | Bacteria | 16834 |
| 762 | nmdc:mga08y16_49984_c1 | 3300050511 | Bacteria | 4375 |
| 763 | nmdc:mga0rr50_107084_c1 | 3300050513 | Bacteria | 2206 |
| 764 | nmdc:mga0sz30_86040_c1 | 3300050516 | Bacteria | 1364 |
| 765 | Ga0495601_0046956 | 3300053077 | Bacteria | 2718 |
| 766 | Ga0495612_0102483 | 3300053078 | Bacteria | 1220 |
| 767 | Ga0495595_0058018 | 3300053084 | Bacteria | 1807 |
| 768 | Ga0495595_0064284 | 3300053084 | Bacteria | 1724 |
| 769 | Ga0495595_0107469 | 3300053084 | Bacteria | 1351 |
| 770 | Ga0495619_0009244 | 3300053085 | Bacteria | 6227 |
| 771 | Ga0495619_0037547 | 3300053085 | Bacteria | 3157 |
| 772 | Ga0495619_0062911 | 3300053085 | Bacteria | 2471 |
| 773 | Ga0500644_0079885 | 3300053088 | Bacteria | 1200 |
| 774 | Ga0500641_0014773 | 3300053096 | Bacteria | 2885 |
| 775 | Ga0500616_0013215 | 3300053153 | Bacteria | 4804 |
| 776 | Ga0501084_0122869 | 3300054114 | Bacteria | 2184 |
| 777 | Ga0501084_0292239 | 3300054114 | Bacteria | 1376 |
| 778 | Ga0501084_0383425 | 3300054114 | Bacteria | 1188 |
| 779 | Ga0501082_0296033 | 3300060353 | Bacteria | 1409 |
| 780 | Ga0466962_0017954 | 3300061719 | Bacteria | 3404 |
| 781 | Ga0466962_0070598 | 3300061719 | Bacteria | 1669 |
| 782 | Ga0530510_0058683 | 3300061734 | Bacteria | 2783 |
| 783 | Ga0530510_0180455 | 3300061734 | Bacteria | 1565 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013306 | Ga0163162_11242027 | Ga0163162_112420271 | 255 |
| 2 | 3300046500 | Ga0495596_0125383 | Ga0495596_0125383_13_870 | 276 |
| 3 | 3300031995 | Ga0307409_100024328 | Ga0307409_1000243284 | 280 |
| 4 | 3300053078 | Ga0495612_0102483 | Ga0495612_0102483_299_1195 | 282 |
| 5 | 3300026067 | Ga0207678_10016820 | Ga0207678_100168207 | 283 |
| 6 | 3300031852 | Ga0307410_10293254 | Ga0307410_102932542 | 284 |
| 7 | 3300031901 | Ga0307406_10150143 | Ga0307406_101501432 | 284 |
| 8 | 3300003203 | JGI25406J46586_10006971 | JGI25406J46586_100069713 | 291 |
| 9 | 3300005985 | Ga0081539_10002042 | Ga0081539_1000204233 | 291 |
| 10 | 3300006880 | Ga0075429_100177448 | Ga0075429_1001774482 | 292 |
| 11 | 3300009094 | Ga0111539_10050943 | Ga0111539_100509434 | 292 |
| 12 | 3300020082 | Ga0206353_11421135 | Ga0206353_114211351 | 292 |
| 13 | 3300050508 | nmdc:mga09592_281689_c1 | nmdc:mga09592_281689_c1_142_1149 | 292 |
| 14 | 3300054114 | Ga0501084_0383425 | Ga0501084_0383425_237_1166 | 295 |
| 15 | 3300050492 | nmdc:mga0yw44_43251_c1 | nmdc:mga0yw44_43251_c1_98_1141 | 299 |
| 16 | 3300006195 | Ga0075366_10003714 | Ga0075366_100037147 | 302 |
| 17 | 3300003751 | Ga0055538_1000311 | Ga0055538_10003114 | 304 |
| 18 | 3300025224 | Ga0209784_100210 | Ga0209784_10021031 | 304 |
| 19 | 3300005539 | Ga0068853_100041546 | Ga0068853_1000415463 | 305 |
| 20 | 3300009094 | Ga0111539_10149798 | Ga0111539_101497983 | 305 |
| 21 | 3300026041 | Ga0207639_10024134 | Ga0207639_100241343 | 305 |
| 22 | 3300027907 | Ga0207428_10167670 | Ga0207428_101676703 | 305 |
| 23 | 3300050511 | nmdc:mga08y16_133236_c1 | nmdc:mga08y16_133236_c1_629_1636 | 305 |
| 24 | 3300053085 | Ga0495619_0037547 | Ga0495619_0037547_1332_2300 | 307 |
| 25 | 3300032126 | Ga0307415_100081996 | Ga0307415_1000819962 | 308 |
| 26 | iso_pu_bacteria | 2974315732 | 2974316109 | 308 |
| 27 | iso_pu_bacteria | 2984523437 | 2984524271 | 308 |
| 28 | 3300005327 | Ga0070658_10162752 | Ga0070658_101627522 | 310 |
| 29 | 3300021388 | Ga0213875_10023369 | Ga0213875_100233692 | 310 |
| 30 | 3300025909 | Ga0207705_10077733 | Ga0207705_100777332 | 310 |
| 31 | 3300037853 | Ga0436364_0527107 | Ga0436364_0527107_21232_22269 | 310 |
| 32 | 3300049577 | Ga0501041_0217069 | Ga0501041_0217069_11_988 | 311 |
| 33 | 3300061734 | Ga0530510_0058683 | Ga0530510_0058683_1490_2467 | 311 |
| 34 | 3300005329 | Ga0070683_100007574 | Ga0070683_1000075746 | 312 |
| 35 | 3300005366 | Ga0070659_100187651 | Ga0070659_1001876512 | 312 |
| 36 | 3300005457 | Ga0070662_100010643 | Ga0070662_1000106434 | 312 |
| 37 | 3300005530 | Ga0070679_100186986 | Ga0070679_1001869863 | 312 |
| 38 | 3300005616 | Ga0068852_100003564 | Ga0068852_1000035644 | 312 |
| 39 | 3300005841 | Ga0068863_100286023 | Ga0068863_1002860232 | 312 |
| 40 | 3300009176 | Ga0105242_10163228 | Ga0105242_101632282 | 312 |
| 41 | 3300009176 | Ga0105242_10524473 | Ga0105242_105244731 | 312 |
| 42 | 3300014325 | Ga0163163_10188046 | Ga0163163_101880463 | 312 |
| 43 | 3300025921 | Ga0207652_10273568 | Ga0207652_102735681 | 312 |
| 44 | 3300025942 | Ga0207689_10006387 | Ga0207689_100063872 | 312 |
| 45 | 3300026142 | Ga0207698_10006545 | Ga0207698_100065455 | 312 |
| 46 | 3300037853 | Ga0436364_0409699 | Ga0436364_0409699_338_1393 | 312 |
| 47 | 3300049576 | Ga0501040_0081832 | Ga0501040_0081832_382_1410 | 312 |
| 48 | 3300005441 | Ga0070700_100240667 | Ga0070700_1002406671 | 313 |
| 49 | 3300005455 | Ga0070663_100204458 | Ga0070663_1002044581 | 313 |
| 50 | 3300009094 | Ga0111539_10374882 | Ga0111539_103748822 | 313 |
| 51 | 3300009148 | Ga0105243_10046078 | Ga0105243_100460782 | 313 |
| 52 | 3300009553 | Ga0105249_10341298 | Ga0105249_103412982 | 313 |
| 53 | 3300010375 | Ga0105239_10009527 | Ga0105239_1000952711 | 313 |
| 54 | 3300014325 | Ga0163163_10051003 | Ga0163163_100510035 | 313 |
| 55 | 3300014325 | Ga0163163_10363751 | Ga0163163_103637512 | 313 |
| 56 | 3300014745 | Ga0157377_10030377 | Ga0157377_100303773 | 313 |
| 57 | 3300025972 | Ga0207668_10151910 | Ga0207668_101519102 | 313 |
| 58 | 3300026075 | Ga0207708_10030220 | Ga0207708_100302202 | 313 |
| 59 | 3300026118 | Ga0207675_100016103 | Ga0207675_1000161033 | 313 |
| 60 | 3300026121 | Ga0207683_10338914 | Ga0207683_103389142 | 313 |
| 61 | 3300048905 | Ga0496102_0028527 | Ga0496102_0028527_2224_3207 | 313 |
| 62 | 3300048908 | Ga0496105_0089133 | Ga0496105_0089133_770_1753 | 313 |
| 63 | 3300048913 | Ga0496110_0109984 | Ga0496110_0109984_496_1479 | 313 |
| 64 | 3300005617 | Ga0068859_100038929 | Ga0068859_1000389294 | 314 |
| 65 | 3300006931 | Ga0097620_100038930 | Ga0097620_1000389304 | 314 |
| 66 | 3300009177 | Ga0105248_10196134 | Ga0105248_101961342 | 314 |
| 67 | 3300014325 | Ga0163163_10070914 | Ga0163163_100709144 | 314 |
| 68 | 3300028380 | Ga0268265_10456974 | Ga0268265_104569741 | 314 |
| 69 | 3300046689 | Ga0495613_0104714 | Ga0495613_0104714_161_1150 | 314 |
| 70 | iso_pu_bacteria | 2738541271 | 2738689174 | 314 |
| 71 | iso_pu_bacteria | 2738543016 | 2739264561 | 314 |
| 72 | 3300013308 | Ga0157375_10770632 | Ga0157375_107706321 | 315 |
| 73 | 3300005330 | Ga0070690_100046400 | Ga0070690_1000464002 | 316 |
| 74 | 3300005334 | Ga0068869_100254383 | Ga0068869_1002543831 | 316 |
| 75 | 3300005459 | Ga0068867_100015726 | Ga0068867_1000157261 | 316 |
| 76 | 3300005548 | Ga0070665_100010364 | Ga0070665_1000103647 | 316 |
| 77 | 3300009148 | Ga0105243_10166599 | Ga0105243_101665992 | 316 |
| 78 | 3300009553 | Ga0105249_10107888 | Ga0105249_101078883 | 316 |
| 79 | 3300013296 | Ga0157374_10258264 | Ga0157374_102582642 | 316 |
| 80 | 3300025934 | Ga0207686_10007103 | Ga0207686_100071034 | 316 |
| 81 | 3300025935 | Ga0207709_10100927 | Ga0207709_101009271 | 316 |
| 82 | 3300026089 | Ga0207648_10009228 | Ga0207648_1000922811 | 316 |
| 83 | 3300044693 | Ga0466961_0037790 | Ga0466961_0037790_41_1036 | 316 |
| 84 | 3300048915 | Ga0496112_0035906 | Ga0496112_0035906_176_1180 | 316 |
| 85 | 3300005563 | Ga0068855_100399846 | Ga0068855_1003998461 | 317 |
| 86 | 3300006177 | Ga0075362_10002045 | Ga0075362_100020452 | 317 |
| 87 | 3300025949 | Ga0207667_10028283 | Ga0207667_100282833 | 317 |
| 88 | 3300027312 | Ga0209371_1006068 | Ga0209371_10060681 | 317 |
| 89 | 3300050489 | nmdc:mga03683_2466_c1 | nmdc:mga03683_2466_c1_2882_3925 | 317 |
| 90 | 3300006028 | Ga0070717_10137915 | Ga0070717_101379152 | 318 |
| 91 | 3300009093 | Ga0105240_10003340 | Ga0105240_1000334013 | 318 |
| 92 | 3300025913 | Ga0207695_10006943 | Ga0207695_1000694310 | 318 |
| 93 | 3300031995 | Ga0307409_100035351 | Ga0307409_1000353512 | 318 |
| 94 | 3300035083 | Ga0373926_0028143 | Ga0373926_0028143_177_1154 | 318 |
| 95 | 3300039450 | Ga0436363_0654378 | Ga0436363_0654378_1862_2863 | 318 |
| 96 | 3300046674 | Ga0495588_0115021 | Ga0495588_0115021_287_1318 | 318 |
| 97 | 3300048927 | Ga0496124_0000355 | Ga0496124_0000355_7835_8878 | 318 |
| 98 | 3300005338 | Ga0068868_100085970 | Ga0068868_1000859703 | 319 |
| 99 | 3300006881 | Ga0068865_100029981 | Ga0068865_1000299811 | 319 |
| 100 | 3300026121 | Ga0207683_10145779 | Ga0207683_101457792 | 319 |
| 101 | 3300030500 | Ga0268256_1001844 | Ga0268256_10018447 | 319 |
| 102 | 3300039437 | Ga0436365_1308047 | Ga0436365_1308047_89_1063 | 319 |
| 103 | 3300049581 | Ga0501047_0159791 | Ga0501047_0159791_538_1518 | 319 |
| 104 | 3300049591 | Ga0501075_0179050 | Ga0501075_0179050_536_1564 | 319 |
| 105 | iso_pu_bacteria | 2857357740 | 2857357926 | 319 |
| 106 | iso_pu_bacteria | 2981990288 | 2981991739 | 319 |
| 107 | iso_pu_bacteria | 2984592036 | 2984595522 | 319 |
| 108 | iso_pu_bacteria | 641736154 | 642414586 | 319 |
| 109 | iso_pu_bacteria | 2600254943 | 2600402027 | 320 |
| 110 | 3300005548 | Ga0070665_100005214 | Ga0070665_1000052145 | 321 |
| 111 | 3300028379 | Ga0268266_10066384 | Ga0268266_100663842 | 321 |
| 112 | 3300028556 | Ga0265337_1000126 | Ga0265337_10001265 | 321 |
| 113 | 3300028558 | Ga0265326_10000144 | Ga0265326_1000014435 | 321 |
| 114 | 3300028654 | Ga0265322_10000009 | Ga0265322_1000000976 | 321 |
| 115 | 3300029957 | Ga0265324_10000389 | Ga0265324_1000038910 | 321 |
| 116 | 3300031239 | Ga0265328_10003668 | Ga0265328_100036682 | 321 |
| 117 | 3300031240 | Ga0265320_10000024 | Ga0265320_1000002499 | 321 |
| 118 | 3300031242 | Ga0265329_10002956 | Ga0265329_100029562 | 321 |
| 119 | 3300031249 | Ga0265339_10011561 | Ga0265339_100115612 | 321 |
| 120 | 3300031250 | Ga0265331_10000894 | Ga0265331_100008946 | 321 |
| 121 | 3300031251 | Ga0265327_10000227 | Ga0265327_10000227100 | 321 |
| 122 | 3300031507 | Ga0307509_10071000 | Ga0307509_100710002 | 321 |
| 123 | 3300031711 | Ga0265314_10000570 | Ga0265314_1000057036 | 321 |
| 124 | 3300049577 | Ga0501041_0022365 | Ga0501041_0022365_2193_3203 | 321 |
| 125 | 3300049591 | Ga0501075_0104920 | Ga0501075_0104920_621_1631 | 321 |
| 126 | 3300049593 | Ga0501077_0138678 | Ga0501077_0138678_20_1030 | 321 |
| 127 | 3300049822 | Ga0501035_0220233 | Ga0501035_0220233_74_1084 | 321 |
| 128 | 3300049824 | Ga0501045_0041787 | Ga0501045_0041787_1493_2503 | 321 |
| 129 | 3300005842 | Ga0068858_100345905 | Ga0068858_1003459052 | 322 |
| 130 | 3300009093 | Ga0105240_10025509 | Ga0105240_100255094 | 322 |
| 131 | 3300015261 | Ga0182006_1017252 | Ga0182006_10172522 | 322 |
| 132 | 3300025913 | Ga0207695_10326089 | Ga0207695_103260891 | 322 |
| 133 | 3300025933 | Ga0207706_10021245 | Ga0207706_100212457 | 322 |
| 134 | 3300031995 | Ga0307409_100161087 | Ga0307409_1001610872 | 322 |
| 135 | 3300035083 | Ga0373926_0061881 | Ga0373926_0061881_296_1315 | 322 |
| 136 | 3300049568 | Ga0501031_0210726 | Ga0501031_0210726_131_1120 | 322 |
| 137 | 3300049572 | Ga0501036_0049412 | Ga0501036_0049412_1760_2749 | 322 |
| 138 | 3300049575 | Ga0501039_0055354 | Ga0501039_0055354_219_1208 | 322 |
| 139 | 3300049575 | Ga0501039_0062195 | Ga0501039_0062195_914_1903 | 322 |
| 140 | 3300049576 | Ga0501040_0168003 | Ga0501040_0168003_140_1129 | 322 |
| 141 | 3300049577 | Ga0501041_0162333 | Ga0501041_0162333_324_1313 | 322 |
| 142 | 3300049582 | Ga0501048_0030175 | Ga0501048_0030175_1977_2966 | 322 |
| 143 | 3300049586 | Ga0501070_0000493 | Ga0501070_0000493_13528_14511 | 322 |
| 144 | 3300049588 | Ga0501072_0094503 | Ga0501072_0094503_293_1282 | 322 |
| 145 | 3300049590 | Ga0501074_0200833 | Ga0501074_0200833_267_1250 | 322 |
| 146 | 3300049591 | Ga0501075_0166588 | Ga0501075_0166588_545_1534 | 322 |
| 147 | 3300049592 | Ga0501076_0014021 | Ga0501076_0014021_3558_4547 | 322 |
| 148 | 3300049592 | Ga0501076_0038612 | Ga0501076_0038612_579_1568 | 322 |
| 149 | 3300054114 | Ga0501084_0292239 | Ga0501084_0292239_64_1053 | 322 |
| 150 | iso_pu_bacteria | 2519103095 | 2519461521 | 322 |
| 151 | iso_pu_bacteria | 2582581311 | 2585290722 | 322 |
| 152 | iso_pu_bacteria | 2599185239 | 2599734894 | 322 |
| 153 | iso_pu_bacteria | 2599185240 | 2599745307 | 322 |
| 154 | iso_pu_bacteria | 2599185353 | 2600198463 | 322 |
| 155 | iso_pu_bacteria | 2599185355 | 2600207215 | 322 |
| 156 | iso_pu_bacteria | 2675903129 | 2676741025 | 322 |
| 157 | iso_pu_bacteria | 2816332253 | 2817258405 | 322 |
| 158 | iso_pu_bacteria | 2816332256 | 2817281180 | 322 |
| 159 | iso_pu_bacteria | 2816332286 | 2817452131 | 322 |
| 160 | iso_pu_bacteria | 2818991452 | 2819635841 | 322 |
| 161 | iso_pu_bacteria | 2863421361 | 2863422283 | 322 |
| 162 | iso_pu_bacteria | 2870068957 | 2870075474 | 322 |
| 163 | iso_pu_bacteria | 2904564687 | 2904564803 | 322 |
| 164 | iso_pu_bacteria | 2904571731 | 2904572501 | 322 |
| 165 | iso_pu_bacteria | 2928157003 | 2928159182 | 322 |
| 166 | iso_pu_bacteria | 2928163908 | 2928168011 | 322 |
| 167 | iso_pu_bacteria | 2928170801 | 2928175166 | 322 |
| 168 | iso_pu_bacteria | 2928536128 | 2928537823 | 322 |
| 169 | iso_pu_bacteria | 2981990288 | 2981992621 | 322 |
| 170 | iso_pu_bacteria | 641736154 | 642419179 | 322 |
| 171 | iso_pu_bacteria | 8018845410 | 8018847778 | 322 |
| 172 | iso_pu_bacteria | 8020807995 | 8020814073 | 322 |
| 173 | iso_pu_bacteria | 8020938398 | 8020941946 | 322 |
| 174 | iso_pu_bacteria | 8020945358 | 8020948097 | 322 |
| 175 | iso_pu_bacteria | 8020953355 | 8020958580 | 322 |
| 176 | iso_pu_bacteria | 8021120328 | 8021121927 | 322 |
| 177 | iso_pu_bacteria | 8040167225 | 8040167504 | 322 |
| 178 | iso_pu_bacteria | 8040173305 | 8040175647 | 322 |
| 179 | 3300003758 | Ga0055532_1000155 | Ga0055532_10001554 | 323 |
| 180 | 3300003856 | Ga0058692_1012022 | Ga0058692_10120222 | 323 |
| 181 | 3300013105 | Ga0157369_10001951 | Ga0157369_100019518 | 323 |
| 182 | 3300020082 | Ga0206353_10402294 | Ga0206353_104022944 | 323 |
| 183 | 3300021361 | Ga0213872_10000008 | Ga0213872_1000000836 | 323 |
| 184 | 3300025225 | Ga0209566_100295 | Ga0209566_1002957 | 323 |
| 185 | 3300025229 | Ga0209147_100204 | Ga0209147_1002044 | 323 |
| 186 | 3300025254 | Ga0209148_1001178 | Ga0209148_10011785 | 323 |
| 187 | 3300025272 | Ga0209455_1000383 | Ga0209455_100038341 | 323 |
| 188 | 3300025922 | Ga0207646_10020234 | Ga0207646_100202346 | 323 |
| 189 | 3300025949 | Ga0207667_10014344 | Ga0207667_100143442 | 323 |
| 190 | 3300025949 | Ga0207667_10509630 | Ga0207667_105096302 | 323 |
| 191 | 3300027312 | Ga0209371_1000195 | Ga0209371_100019559 | 323 |
| 192 | 3300028563 | Ga0265319_1034801 | Ga0265319_10348012 | 323 |
| 193 | 3300030500 | Ga0268256_1000168 | Ga0268256_100016824 | 323 |
| 194 | 3300031238 | Ga0265332_10008765 | Ga0265332_100087653 | 323 |
| 195 | 3300031240 | Ga0265320_10041151 | Ga0265320_100411513 | 323 |
| 196 | 3300031249 | Ga0265339_10021505 | Ga0265339_100215051 | 323 |
| 197 | 3300031250 | Ga0265331_10006208 | Ga0265331_100062083 | 323 |
| 198 | 3300031595 | Ga0265313_10000079 | Ga0265313_1000007931 | 323 |
| 199 | 3300031711 | Ga0265314_10162660 | Ga0265314_101626602 | 323 |
| 200 | 3300037418 | Ga0395900_0082924 | Ga0395900_0082924_356_1408 | 323 |
| 201 | 3300039447 | Ga0436361_0757401 | Ga0436361_0757401_19806_20807 | 323 |
| 202 | 3300042993 | Ga0439440_0011036 | Ga0439440_0011036_126_1142 | 323 |
| 203 | 3300044901 | Ga0466960_0016166 | Ga0466960_0016166_1758_2774 | 323 |
| 204 | 3300045836 | Ga0466958_0005932 | Ga0466958_0005932_2668_3669 | 323 |
| 205 | 3300045976 | Ga0466967_0380273 | Ga0466967_0380273_133_1134 | 323 |
| 206 | 3300048920 | Ga0496117_0020188 | Ga0496117_0020188_1869_2870 | 323 |
| 207 | 3300048921 | Ga0496118_0024273 | Ga0496118_0024273_3551_4552 | 323 |
| 208 | 3300049588 | Ga0501072_0205028 | Ga0501072_0205028_61_1167 | 323 |
| 209 | 3300049823 | Ga0501044_0099928 | Ga0501044_0099928_1037_2023 | 323 |
| 210 | iso_pu_bacteria | 2799112218 | 2799185813 | 323 |
| 211 | iso_pu_bacteria | 8039098773 | 8039101184 | 323 |
| 212 | 3300003792 | Ga0055540_1010060 | Ga0055540_10100602 | 324 |
| 213 | 3300005354 | Ga0070675_100007001 | Ga0070675_1000070018 | 324 |
| 214 | 3300005438 | Ga0070701_10000650 | Ga0070701_100006506 | 324 |
| 215 | 3300005458 | Ga0070681_10207528 | Ga0070681_102075281 | 324 |
| 216 | 3300006178 | Ga0075367_10001439 | Ga0075367_100014397 | 324 |
| 217 | 3300006358 | Ga0068871_100138513 | Ga0068871_1001385132 | 324 |
| 218 | 3300009177 | Ga0105248_10051768 | Ga0105248_100517682 | 324 |
| 219 | 3300013307 | Ga0157372_10213207 | Ga0157372_102132072 | 324 |
| 220 | 3300021361 | Ga0213872_10000079 | Ga0213872_1000007953 | 324 |
| 221 | 3300025926 | Ga0207659_10000241 | Ga0207659_1000024121 | 324 |
| 222 | 3300025941 | Ga0207711_10112623 | Ga0207711_101126232 | 324 |
| 223 | 3300028573 | Ga0265334_10014951 | Ga0265334_100149512 | 324 |
| 224 | 3300031235 | Ga0265330_10051908 | Ga0265330_100519082 | 324 |
| 225 | 3300031548 | Ga0307408_100000028 | Ga0307408_100000028184 | 324 |
| 226 | 3300035116 | Ga0373945_0009684 | Ga0373945_0009684_752_1747 | 324 |
| 227 | 3300035170 | Ga0373943_0004078 | Ga0373943_0004078_5415_6410 | 324 |
| 228 | 3300035171 | Ga0373946_0004504 | Ga0373946_0004504_1124_2119 | 324 |
| 229 | 3300035172 | Ga0373955_0006678 | Ga0373955_0006678_2532_3527 | 324 |
| 230 | 3300035692 | Ga0373935_0017397 | Ga0373935_0017397_120_1115 | 324 |
| 231 | 3300037068 | Ga0373925_0009583 | Ga0373925_0009583_3677_4672 | 324 |
| 232 | 3300039447 | Ga0436361_0296121 | Ga0436361_0296121_106411_107415 | 324 |
| 233 | 3300046473 | Ga0495582_0187513 | Ga0495582_0187513_174_1169 | 324 |
| 234 | 3300048903 | Ga0496100_0006847 | Ga0496100_0006847_3556_4551 | 324 |
| 235 | 3300048904 | Ga0496101_0002546 | Ga0496101_0002546_1061_2056 | 324 |
| 236 | 3300048917 | Ga0496114_0003080 | Ga0496114_0003080_2296_3291 | 324 |
| 237 | 3300049581 | Ga0501047_0260409 | Ga0501047_0260409_142_1119 | 324 |
| 238 | 3300049586 | Ga0501070_0124471 | Ga0501070_0124471_1112_2089 | 324 |
| 239 | 3300049742 | Ga0501080_0242574 | Ga0501080_0242574_522_1499 | 324 |
| 240 | 3300050494 | nmdc:mga06z11_3645_c1 | nmdc:mga06z11_3645_c1_4288_5313 | 324 |
| 241 | 3300053084 | Ga0495595_0058018 | Ga0495595_0058018_750_1745 | 324 |
| 242 | 3300053084 | Ga0495595_0107469 | Ga0495595_0107469_134_1129 | 324 |
| 243 | iso_pu_bacteria | 2823421272 | 2823421435 | 324 |
| 244 | 3300005335 | Ga0070666_10004788 | Ga0070666_100047889 | 325 |
| 245 | 3300005338 | Ga0068868_100351339 | Ga0068868_1003513392 | 325 |
| 246 | 3300005339 | Ga0070660_100328258 | Ga0070660_1003282581 | 325 |
| 247 | 3300005340 | Ga0070689_100063724 | Ga0070689_1000637242 | 325 |
| 248 | 3300005347 | Ga0070668_100041434 | Ga0070668_1000414343 | 325 |
| 249 | 3300005355 | Ga0070671_100026180 | Ga0070671_1000261803 | 325 |
| 250 | 3300005366 | Ga0070659_100305882 | Ga0070659_1003058822 | 325 |
| 251 | 3300005367 | Ga0070667_100024721 | Ga0070667_1000247211 | 325 |
| 252 | 3300005435 | Ga0070714_100041036 | Ga0070714_1000410362 | 325 |
| 253 | 3300005436 | Ga0070713_100012130 | Ga0070713_1000121303 | 325 |
| 254 | 3300005439 | Ga0070711_100076569 | Ga0070711_1000765692 | 325 |
| 255 | 3300005456 | Ga0070678_100049230 | Ga0070678_1000492303 | 325 |
| 256 | 3300005535 | Ga0070684_100021352 | Ga0070684_1000213523 | 325 |
| 257 | 3300005548 | Ga0070665_100004797 | Ga0070665_1000047975 | 325 |
| 258 | 3300005548 | Ga0070665_100031233 | Ga0070665_1000312334 | 325 |
| 259 | 3300005563 | Ga0068855_100023792 | Ga0068855_1000237923 | 325 |
| 260 | 3300005564 | Ga0070664_100108712 | Ga0070664_1001087123 | 325 |
| 261 | 3300005841 | Ga0068863_100004411 | Ga0068863_10000441112 | 325 |
| 262 | 3300005842 | Ga0068858_100007783 | Ga0068858_1000077839 | 325 |
| 263 | 3300005843 | Ga0068860_100000147 | Ga0068860_10000014741 | 325 |
| 264 | 3300005843 | Ga0068860_100155896 | Ga0068860_1001558962 | 325 |
| 265 | 3300005937 | Ga0081455_10000707 | Ga0081455_1000070731 | 325 |
| 266 | 3300005983 | Ga0081540_1028893 | Ga0081540_10288933 | 325 |
| 267 | 3300006195 | Ga0075366_10054447 | Ga0075366_100544473 | 325 |
| 268 | 3300006237 | Ga0097621_100000790 | Ga0097621_10000079020 | 325 |
| 269 | 3300006358 | Ga0068871_100017420 | Ga0068871_1000174203 | 325 |
| 270 | 3300009093 | Ga0105240_10094537 | Ga0105240_100945372 | 325 |
| 271 | 3300009093 | Ga0105240_10236366 | Ga0105240_102363665 | 325 |
| 272 | 3300009093 | Ga0105240_10493162 | Ga0105240_104931622 | 325 |
| 273 | 3300013104 | Ga0157370_10109590 | Ga0157370_101095902 | 325 |
| 274 | 3300013105 | Ga0157369_10415753 | Ga0157369_104157532 | 325 |
| 275 | 3300013306 | Ga0163162_10606432 | Ga0163162_106064322 | 325 |
| 276 | 3300014968 | Ga0157379_10321410 | Ga0157379_103214102 | 325 |
| 277 | 3300014969 | Ga0157376_10125891 | Ga0157376_101258912 | 325 |
| 278 | 3300021358 | Ga0213873_10000004 | Ga0213873_10000004446 | 325 |
| 279 | 3300021384 | Ga0213876_10000007 | Ga0213876_10000007446 | 325 |
| 280 | 3300025899 | Ga0207642_10081502 | Ga0207642_100815022 | 325 |
| 281 | 3300025909 | Ga0207705_10073631 | Ga0207705_100736312 | 325 |
| 282 | 3300025913 | Ga0207695_10147947 | Ga0207695_101479475 | 325 |
| 283 | 3300025913 | Ga0207695_10170406 | Ga0207695_101704062 | 325 |
| 284 | 3300025918 | Ga0207662_10189833 | Ga0207662_101898331 | 325 |
| 285 | 3300025920 | Ga0207649_10103251 | Ga0207649_101032512 | 325 |
| 286 | 3300025928 | Ga0207700_10152025 | Ga0207700_101520251 | 325 |
| 287 | 3300025929 | Ga0207664_10017879 | Ga0207664_100178791 | 325 |
| 288 | 3300025931 | Ga0207644_10012241 | Ga0207644_100122414 | 325 |
| 289 | 3300025938 | Ga0207704_10091173 | Ga0207704_100911733 | 325 |
| 290 | 3300025944 | Ga0207661_10340584 | Ga0207661_103405842 | 325 |
| 291 | 3300025949 | Ga0207667_10159436 | Ga0207667_101594362 | 325 |
| 292 | 3300025986 | Ga0207658_10014726 | Ga0207658_100147262 | 325 |
| 293 | 3300026035 | Ga0207703_10005310 | Ga0207703_100053109 | 325 |
| 294 | 3300026088 | Ga0207641_10003377 | Ga0207641_100033774 | 325 |
| 295 | 3300026116 | Ga0207674_10120923 | Ga0207674_101209232 | 325 |
| 296 | 3300026121 | Ga0207683_10027190 | Ga0207683_100271904 | 325 |
| 297 | 3300028379 | Ga0268266_10001659 | Ga0268266_100016597 | 325 |
| 298 | 3300028381 | Ga0268264_10000033 | Ga0268264_1000003350 | 325 |
| 299 | 3300028381 | Ga0268264_10000138 | Ga0268264_1000013872 | 325 |
| 300 | 3300028381 | Ga0268264_10138104 | Ga0268264_101381042 | 325 |
| 301 | 3300028794 | Ga0307515_10000066 | Ga0307515_1000006657 | 325 |
| 302 | 3300035112 | Ga0373932_0056766 | Ga0373932_0056766_156_1157 | 325 |
| 303 | 3300035410 | Ga0373924_0125186 | Ga0373924_0125186_26_1018 | 325 |
| 304 | 3300035691 | Ga0373931_0035941 | Ga0373931_0035941_1537_2529 | 325 |
| 305 | 3300037068 | Ga0373925_0336624 | Ga0373925_0336624_10_1002 | 325 |
| 306 | 3300037312 | Ga0395899_0001048 | Ga0395899_0001048_57_1049 | 325 |
| 307 | 3300037312 | Ga0395899_0024104 | Ga0395899_0024104_2836_3855 | 325 |
| 308 | 3300037418 | Ga0395900_0003285 | Ga0395900_0003285_10785_11777 | 325 |
| 309 | 3300037418 | Ga0395900_0010110 | Ga0395900_0010110_8460_9479 | 325 |
| 310 | 3300037418 | Ga0395900_0107609 | Ga0395900_0107609_1575_2567 | 325 |
| 311 | 3300037466 | Ga0395898_0040821 | Ga0395898_0040821_3038_4030 | 325 |
| 312 | 3300037471 | Ga0395905_0101742 | Ga0395905_0101742_932_1951 | 325 |
| 313 | 3300038443 | Ga0395901_0004093 | Ga0395901_0004093_6457_7449 | 325 |
| 314 | 3300038443 | Ga0395901_0028392 | Ga0395901_0028392_2532_3551 | 325 |
| 315 | 3300039437 | Ga0436365_0394061 | Ga0436365_0394061_83740_84732 | 325 |
| 316 | 3300039453 | Ga0436362_0290430 | Ga0436362_0290430_278895_279887 | 325 |
| 317 | 3300041411 | Ga0439466_0001763 | Ga0439466_0001763_5328_6332 | 325 |
| 318 | 3300045051 | Ga0451576_0451197 | Ga0451576_0451197_33_1079 | 325 |
| 319 | 3300049571 | Ga0501034_0001852 | Ga0501034_0001852_16935_17927 | 325 |
| 320 | 3300049571 | Ga0501034_0002374 | Ga0501034_0002374_13763_14755 | 325 |
| 321 | 3300049571 | Ga0501034_0132419 | Ga0501034_0132419_1023_2015 | 325 |
| 322 | 3300049581 | Ga0501047_0088218 | Ga0501047_0088218_1792_2784 | 325 |
| 323 | 3300049584 | Ga0501068_0058162 | Ga0501068_0058162_484_1476 | 325 |
| 324 | 3300049823 | Ga0501044_0255447 | Ga0501044_0255447_270_1262 | 325 |
| 325 | 3300050489 | nmdc:mga03683_26879_c1 | nmdc:mga03683_26879_c1_784_1776 | 325 |
| 326 | 3300050493 | nmdc:mga0k408_3429_c1 | nmdc:mga0k408_3429_c1_6505_7497 | 325 |
| 327 | 3300053088 | Ga0500644_0079885 | Ga0500644_0079885_144_1136 | 325 |
| 328 | 3300003758 | Ga0055532_1000997 | Ga0055532_10009977 | 326 |
| 329 | 3300003758 | Ga0055532_1001799 | Ga0055532_10017992 | 326 |
| 330 | 3300003758 | Ga0055532_1002590 | Ga0055532_10025902 | 326 |
| 331 | 3300003760 | Ga0055527_1000231 | Ga0055527_100023124 | 326 |
| 332 | 3300003760 | Ga0055527_1002809 | Ga0055527_10028092 | 326 |
| 333 | 3300003761 | Ga0055535_1000492 | Ga0055535_10004926 | 326 |
| 334 | 3300003761 | Ga0055535_1000587 | Ga0055535_100058717 | 326 |
| 335 | 3300003762 | Ga0055542_1000613 | Ga0055542_100061317 | 326 |
| 336 | 3300003763 | Ga0055529_1000525 | Ga0055529_100052518 | 326 |
| 337 | 3300003763 | Ga0055529_1003706 | Ga0055529_10037062 | 326 |
| 338 | 3300003841 | Ga0055541_1003263 | Ga0055541_10032632 | 326 |
| 339 | 3300005327 | Ga0070658_10038905 | Ga0070658_100389053 | 326 |
| 340 | 3300005339 | Ga0070660_100000098 | Ga0070660_10000009817 | 326 |
| 341 | 3300005366 | Ga0070659_100000259 | Ga0070659_10000025923 | 326 |
| 342 | 3300005434 | Ga0070709_10233480 | Ga0070709_102334802 | 326 |
| 343 | 3300005436 | Ga0070713_100003315 | Ga0070713_1000033155 | 326 |
| 344 | 3300005455 | Ga0070663_100011412 | Ga0070663_1000114124 | 326 |
| 345 | 3300005458 | Ga0070681_10110162 | Ga0070681_101101623 | 326 |
| 346 | 3300005539 | Ga0068853_100141220 | Ga0068853_1001412202 | 326 |
| 347 | 3300005548 | Ga0070665_100003284 | Ga0070665_10000328420 | 326 |
| 348 | 3300005577 | Ga0068857_100166877 | Ga0068857_1001668772 | 326 |
| 349 | 3300005614 | Ga0068856_100075876 | Ga0068856_1000758765 | 326 |
| 350 | 3300005616 | Ga0068852_100004932 | Ga0068852_1000049326 | 326 |
| 351 | 3300006237 | Ga0097621_100015101 | Ga0097621_1000151016 | 326 |
| 352 | 3300006358 | Ga0068871_100049086 | Ga0068871_1000490863 | 326 |
| 353 | 3300006847 | Ga0075431_100044294 | Ga0075431_1000442944 | 326 |
| 354 | 3300009093 | Ga0105240_10003571 | Ga0105240_1000357112 | 326 |
| 355 | 3300009177 | Ga0105248_10571914 | Ga0105248_105719141 | 326 |
| 356 | 3300009545 | Ga0105237_10025150 | Ga0105237_100251502 | 326 |
| 357 | 3300009551 | Ga0105238_10029872 | Ga0105238_100298722 | 326 |
| 358 | 3300010375 | Ga0105239_10002103 | Ga0105239_1000210310 | 326 |
| 359 | 3300013297 | Ga0157378_10003705 | Ga0157378_100037059 | 326 |
| 360 | 3300014325 | Ga0163163_10106053 | Ga0163163_101060531 | 326 |
| 361 | 3300014745 | Ga0157377_10170477 | Ga0157377_101704771 | 326 |
| 362 | 3300014969 | Ga0157376_10025465 | Ga0157376_100254652 | 326 |
| 363 | 3300015261 | Ga0182006_1072260 | Ga0182006_10722601 | 326 |
| 364 | 3300015262 | Ga0182007_10035208 | Ga0182007_100352082 | 326 |
| 365 | 3300015265 | Ga0182005_1030528 | Ga0182005_10305282 | 326 |
| 366 | 3300025225 | Ga0209566_100813 | Ga0209566_10081314 | 326 |
| 367 | 3300025228 | Ga0209672_100062 | Ga0209672_100062173 | 326 |
| 368 | 3300025228 | Ga0209672_100105 | Ga0209672_10010583 | 326 |
| 369 | 3300025229 | Ga0209147_100012 | Ga0209147_100012608 | 326 |
| 370 | 3300025229 | Ga0209147_100078 | Ga0209147_100078173 | 326 |
| 371 | 3300025229 | Ga0209147_100145 | Ga0209147_10014574 | 326 |
| 372 | 3300025242 | Ga0209258_100107 | Ga0209258_100107168 | 326 |
| 373 | 3300025242 | Ga0209258_100108 | Ga0209258_100108173 | 326 |
| 374 | 3300025254 | Ga0209148_1000022 | Ga0209148_100002219 | 326 |
| 375 | 3300025254 | Ga0209148_1001231 | Ga0209148_10012319 | 326 |
| 376 | 3300025272 | Ga0209455_1000024 | Ga0209455_1000024604 | 326 |
| 377 | 3300025272 | Ga0209455_1001254 | Ga0209455_10012545 | 326 |
| 378 | 3300025273 | Ga0209673_1000026 | Ga0209673_1000026296 | 326 |
| 379 | 3300025295 | Ga0209564_1007061 | Ga0209564_10070614 | 326 |
| 380 | 3300025904 | Ga0207647_10010091 | Ga0207647_100100916 | 326 |
| 381 | 3300025906 | Ga0207699_10003733 | Ga0207699_100037334 | 326 |
| 382 | 3300025909 | Ga0207705_10108705 | Ga0207705_101087052 | 326 |
| 383 | 3300025913 | Ga0207695_10000205 | Ga0207695_10000205121 | 326 |
| 384 | 3300025913 | Ga0207695_10041182 | Ga0207695_100411822 | 326 |
| 385 | 3300025914 | Ga0207671_10113764 | Ga0207671_101137642 | 326 |
| 386 | 3300025919 | Ga0207657_10000053 | Ga0207657_1000005355 | 326 |
| 387 | 3300025932 | Ga0207690_10000009 | Ga0207690_1000000940 | 326 |
| 388 | 3300025932 | Ga0207690_10048246 | Ga0207690_100482463 | 326 |
| 389 | 3300026067 | Ga0207678_10009219 | Ga0207678_100092197 | 326 |
| 390 | 3300026142 | Ga0207698_10028826 | Ga0207698_100288262 | 326 |
| 391 | 3300027312 | Ga0209371_1000467 | Ga0209371_100046725 | 326 |
| 392 | 3300028379 | Ga0268266_10003855 | Ga0268266_100038556 | 326 |
| 393 | 3300030500 | Ga0268256_1000566 | Ga0268256_100056617 | 326 |
| 394 | 3300037466 | Ga0395898_0268242 | Ga0395898_0268242_330_1379 | 326 |
| 395 | 3300038443 | Ga0395901_0001587 | Ga0395901_0001587_20211_21209 | 326 |
| 396 | 3300039437 | Ga0436365_1609485 | Ga0436365_1609485_899_1903 | 326 |
| 397 | 3300039437 | Ga0436365_1647369 | Ga0436365_1647369_14646_15638 | 326 |
| 398 | 3300046459 | Ga0495629_0047601 | Ga0495629_0047601_117_1118 | 326 |
| 399 | 3300046472 | Ga0495580_0071886 | Ga0495580_0071886_656_1657 | 326 |
| 400 | 3300046511 | Ga0495608_0034078 | Ga0495608_0034078_1637_2638 | 326 |
| 401 | 3300046516 | Ga0495628_0169594 | Ga0495628_0169594_581_1582 | 326 |
| 402 | 3300046517 | Ga0495630_0039449 | Ga0495630_0039449_2090_3091 | 326 |
| 403 | 3300046536 | Ga0495587_0033679 | Ga0495587_0033679_694_1695 | 326 |
| 404 | 3300046543 | Ga0495645_0133399 | Ga0495645_0133399_156_1157 | 326 |
| 405 | 3300046642 | Ga0495634_0039730 | Ga0495634_0039730_1856_2857 | 326 |
| 406 | 3300046663 | Ga0495635_0110175 | Ga0495635_0110175_492_1493 | 326 |
| 407 | 3300046675 | Ga0495657_0140290 | Ga0495657_0140290_443_1444 | 326 |
| 408 | 3300046684 | Ga0495669_0024665 | Ga0495669_0024665_839_1843 | 326 |
| 409 | 3300046689 | Ga0495613_0000397 | Ga0495613_0000397_17733_18734 | 326 |
| 410 | 3300047317 | Ga0495604_0026503 | Ga0495604_0026503_2651_3652 | 326 |
| 411 | 3300047322 | Ga0495680_0068338 | Ga0495680_0068338_1540_2541 | 326 |
| 412 | 3300047471 | Ga0495684_0000431 | Ga0495684_0000431_9771_10772 | 326 |
| 413 | 3300048908 | Ga0496105_0095898 | Ga0496105_0095898_1210_2238 | 326 |
| 414 | 3300048924 | Ga0496121_0178875 | Ga0496121_0178875_413_1462 | 326 |
| 415 | 3300053077 | Ga0495601_0046956 | Ga0495601_0046956_817_1818 | 326 |
| 416 | 3300053084 | Ga0495595_0064284 | Ga0495595_0064284_378_1379 | 326 |
| 417 | 3300053085 | Ga0495619_0009244 | Ga0495619_0009244_2078_3079 | 326 |
| 418 | 3300003187 | JGI25151J46595_10026305 | JGI25151J46595_100263053 | 327 |
| 419 | 3300005335 | Ga0070666_10021603 | Ga0070666_100216033 | 327 |
| 420 | 3300005466 | Ga0070685_10014989 | Ga0070685_100149894 | 327 |
| 421 | 3300005467 | Ga0070706_100049831 | Ga0070706_1000498313 | 327 |
| 422 | 3300005468 | Ga0070707_100028668 | Ga0070707_1000286682 | 327 |
| 423 | 3300005471 | Ga0070698_100020372 | Ga0070698_1000203728 | 327 |
| 424 | 3300005518 | Ga0070699_100317243 | Ga0070699_1003172431 | 327 |
| 425 | 3300005548 | Ga0070665_100000127 | Ga0070665_10000012733 | 327 |
| 426 | 3300006163 | Ga0070715_10095106 | Ga0070715_100951062 | 327 |
| 427 | 3300006358 | Ga0068871_100053152 | Ga0068871_1000531523 | 327 |
| 428 | 3300009101 | Ga0105247_10140655 | Ga0105247_101406552 | 327 |
| 429 | 3300009177 | Ga0105248_10079115 | Ga0105248_100791153 | 327 |
| 430 | 3300025910 | Ga0207684_10076985 | Ga0207684_100769852 | 327 |
| 431 | 3300025922 | Ga0207646_10009412 | Ga0207646_100094126 | 327 |
| 432 | 3300025941 | Ga0207711_10096398 | Ga0207711_100963981 | 327 |
| 433 | 3300026035 | Ga0207703_10404848 | Ga0207703_104048481 | 327 |
| 434 | 3300028379 | Ga0268266_10000924 | Ga0268266_1000092439 | 327 |
| 435 | 3300028800 | Ga0265338_10014175 | Ga0265338_100141757 | 327 |
| 436 | 3300028800 | Ga0265338_10049640 | Ga0265338_100496405 | 327 |
| 437 | 3300028800 | Ga0265338_10079466 | Ga0265338_100794663 | 327 |
| 438 | 3300031247 | Ga0265340_10018544 | Ga0265340_100185445 | 327 |
| 439 | 3300031711 | Ga0265314_10033616 | Ga0265314_100336161 | 327 |
| 440 | 3300035695 | Ga0373927_0016957 | Ga0373927_0016957_966_1973 | 327 |
| 441 | 3300045976 | Ga0466967_0109220 | Ga0466967_0109220_326_1351 | 327 |
| 442 | 3300048918 | Ga0496115_0356377 | Ga0496115_0356377_124_1131 | 327 |
| 443 | 3300060353 | Ga0501082_0296033 | Ga0501082_0296033_154_1164 | 327 |
| 444 | 3300005329 | Ga0070683_100027055 | Ga0070683_1000270556 | 328 |
| 445 | 3300005343 | Ga0070687_100005017 | Ga0070687_1000050176 | 328 |
| 446 | 3300005435 | Ga0070714_100025070 | Ga0070714_1000250702 | 328 |
| 447 | 3300005530 | Ga0070679_100102311 | Ga0070679_1001023113 | 328 |
| 448 | 3300005535 | Ga0070684_100043240 | Ga0070684_1000432402 | 328 |
| 449 | 3300005985 | Ga0081539_10042018 | Ga0081539_100420183 | 328 |
| 450 | 3300009177 | Ga0105248_10211825 | Ga0105248_102118252 | 328 |
| 451 | 3300013307 | Ga0157372_10032896 | Ga0157372_100328962 | 328 |
| 452 | 3300025912 | Ga0207707_10045352 | Ga0207707_100453522 | 328 |
| 453 | 3300025918 | Ga0207662_10004173 | Ga0207662_100041737 | 328 |
| 454 | 3300025944 | Ga0207661_10274397 | Ga0207661_102743972 | 328 |
| 455 | 3300026142 | Ga0207698_10281730 | Ga0207698_102817301 | 328 |
| 456 | 3300035242 | Ga0373962_0054469 | Ga0373962_0054469_16_1068 | 328 |
| 457 | 3300044673 | Ga0453683_0003525 | Ga0453683_0003525_10040_11047 | 328 |
| 458 | 3300044693 | Ga0466961_0054521 | Ga0466961_0054521_850_1878 | 328 |
| 459 | 3300045049 | Ga0466959_0164722 | Ga0466959_0164722_250_1278 | 328 |
| 460 | 3300045051 | Ga0451576_0036904 | Ga0451576_0036904_1748_2755 | 328 |
| 461 | 3300050513 | nmdc:mga0rr50_107084_c1 | nmdc:mga0rr50_107084_c1_232_1242 | 328 |
| 462 | 3300004798 | Ga0058859_11760707 | Ga0058859_117607072 | 329 |
| 463 | 3300004801 | Ga0058860_12215240 | Ga0058860_122152408 | 329 |
| 464 | 3300005339 | Ga0070660_100027936 | Ga0070660_1000279363 | 329 |
| 465 | 3300005354 | Ga0070675_100057389 | Ga0070675_1000573892 | 329 |
| 466 | 3300005364 | Ga0070673_100188489 | Ga0070673_1001884892 | 329 |
| 467 | 3300005366 | Ga0070659_100001090 | Ga0070659_1000010909 | 329 |
| 468 | 3300005455 | Ga0070663_100021502 | Ga0070663_1000215022 | 329 |
| 469 | 3300005458 | Ga0070681_10053595 | Ga0070681_100535953 | 329 |
| 470 | 3300005530 | Ga0070679_100007731 | Ga0070679_1000077318 | 329 |
| 471 | 3300005544 | Ga0070686_100008772 | Ga0070686_1000087729 | 329 |
| 472 | 3300005614 | Ga0068856_100021501 | Ga0068856_1000215014 | 329 |
| 473 | 3300005616 | Ga0068852_100018498 | Ga0068852_1000184986 | 329 |
| 474 | 3300005937 | Ga0081455_10001850 | Ga0081455_1000185018 | 329 |
| 475 | 3300005981 | Ga0081538_10012023 | Ga0081538_100120236 | 329 |
| 476 | 3300005983 | Ga0081540_1015203 | Ga0081540_10152032 | 329 |
| 477 | 3300006237 | Ga0097621_100057962 | Ga0097621_1000579622 | 329 |
| 478 | 3300006358 | Ga0068871_100168275 | Ga0068871_1001682752 | 329 |
| 479 | 3300006846 | Ga0075430_100149231 | Ga0075430_1001492312 | 329 |
| 480 | 3300006871 | Ga0075434_100311743 | Ga0075434_1003117432 | 329 |
| 481 | 3300006880 | Ga0075429_100017118 | Ga0075429_1000171183 | 329 |
| 482 | 3300009093 | Ga0105240_10008942 | Ga0105240_1000894217 | 329 |
| 483 | 3300009094 | Ga0111539_10109421 | Ga0111539_101094213 | 329 |
| 484 | 3300009094 | Ga0111539_10210282 | Ga0111539_102102822 | 329 |
| 485 | 3300009177 | Ga0105248_10029611 | Ga0105248_100296114 | 329 |
| 486 | 3300010375 | Ga0105239_10072996 | Ga0105239_100729966 | 329 |
| 487 | 3300013104 | Ga0157370_10007123 | Ga0157370_100071234 | 329 |
| 488 | 3300013105 | Ga0157369_10006254 | Ga0157369_1000625412 | 329 |
| 489 | 3300013307 | Ga0157372_10023313 | Ga0157372_100233134 | 329 |
| 490 | 3300017792 | Ga0163161_10190292 | Ga0163161_101902921 | 329 |
| 491 | 3300020082 | Ga0206353_11402362 | Ga0206353_114023623 | 329 |
| 492 | 3300025910 | Ga0207684_10042655 | Ga0207684_100426552 | 329 |
| 493 | 3300025912 | Ga0207707_10003121 | Ga0207707_1000312115 | 329 |
| 494 | 3300025913 | Ga0207695_10030945 | Ga0207695_100309455 | 329 |
| 495 | 3300025913 | Ga0207695_10165399 | Ga0207695_101653993 | 329 |
| 496 | 3300025917 | Ga0207660_10033479 | Ga0207660_100334795 | 329 |
| 497 | 3300025919 | Ga0207657_10009720 | Ga0207657_1000972010 | 329 |
| 498 | 3300025920 | Ga0207649_10015628 | Ga0207649_100156284 | 329 |
| 499 | 3300025924 | Ga0207694_10043711 | Ga0207694_100437112 | 329 |
| 500 | 3300025932 | Ga0207690_10008222 | Ga0207690_100082222 | 329 |
| 501 | 3300025944 | Ga0207661_10000599 | Ga0207661_1000059918 | 329 |
| 502 | 3300026078 | Ga0207702_10059276 | Ga0207702_100592762 | 329 |
| 503 | 3300039437 | Ga0436365_1612362 | Ga0436365_1612362_1580_2614 | 329 |
| 504 | 3300042015 | Ga0439462_0035591 | Ga0439462_0035591_181_1203 | 329 |
| 505 | 3300045976 | Ga0466967_0059951 | Ga0466967_0059951_2122_3174 | 329 |
| 506 | 3300045976 | Ga0466967_0098084 | Ga0466967_0098084_1230_2285 | 329 |
| 507 | 3300046461 | Ga0495641_0000458 | Ga0495641_0000458_23941_24945 | 329 |
| 508 | 3300046475 | Ga0495639_0126262 | Ga0495639_0126262_145_1149 | 329 |
| 509 | 3300046515 | Ga0495620_0002096 | Ga0495620_0002096_7013_8020 | 329 |
| 510 | 3300046518 | Ga0495631_0031811 | Ga0495631_0031811_649_1653 | 329 |
| 511 | 3300046523 | Ga0495644_0010665 | Ga0495644_0010665_816_1820 | 329 |
| 512 | 3300046535 | Ga0495586_0203984 | Ga0495586_0203984_13_1026 | 329 |
| 513 | 3300046615 | Ga0495656_0092122 | Ga0495656_0092122_283_1287 | 329 |
| 514 | 3300047469 | Ga0495673_0051127 | Ga0495673_0051127_214_1218 | 329 |
| 515 | 3300047472 | Ga0495686_0000011 | Ga0495686_0000011_289143_290147 | 329 |
| 516 | 3300047472 | Ga0495686_0042204 | Ga0495686_0042204_747_1751 | 329 |
| 517 | 3300048911 | Ga0496108_0153329 | Ga0496108_0153329_839_1855 | 329 |
| 518 | 3300048927 | Ga0496124_0006021 | Ga0496124_0006021_10588_11706 | 329 |
| 519 | 3300049572 | Ga0501036_0234452 | Ga0501036_0234452_125_1207 | 329 |
| 520 | 3300049582 | Ga0501048_0147367 | Ga0501048_0147367_383_1465 | 329 |
| 521 | 3300049743 | Ga0501081_0137809 | Ga0501081_0137809_471_1553 | 329 |
| 522 | 3300049744 | Ga0501083_0004416 | Ga0501083_0004416_7869_8888 | 329 |
| 523 | 3300050507 | nmdc:mga05p37_29071_c1 | nmdc:mga05p37_29071_c1_274_1344 | 329 |
| 524 | 3300050507 | nmdc:mga05p37_7730_c1 | nmdc:mga05p37_7730_c1_504_1574 | 329 |
| 525 | 3300050508 | nmdc:mga09592_107672_c1 | nmdc:mga09592_107672_c1_1204_2274 | 329 |
| 526 | 3300050508 | nmdc:mga09592_190066_c1 | nmdc:mga09592_190066_c1_169_1251 | 329 |
| 527 | 3300050509 | nmdc:mga0qj67_165193_c1 | nmdc:mga0qj67_165193_c1_656_1726 | 329 |
| 528 | 3300050509 | nmdc:mga0qj67_294956_c1 | nmdc:mga0qj67_294956_c1_137_1219 | 329 |
| 529 | 3300050510 | nmdc:mga06r32_49457_c1 | nmdc:mga06r32_49457_c1_2732_3802 | 329 |
| 530 | 3300050511 | nmdc:mga08y16_49984_c1 | nmdc:mga08y16_49984_c1_3193_4275 | 329 |
| 531 | 3300054114 | Ga0501084_0122869 | Ga0501084_0122869_546_1628 | 329 |
| 532 | 3300061734 | Ga0530510_0180455 | Ga0530510_0180455_97_1179 | 329 |
| 533 | 3300005327 | Ga0070658_10027709 | Ga0070658_100277092 | 330 |
| 534 | 3300005336 | Ga0070680_100007774 | Ga0070680_1000077743 | 330 |
| 535 | 3300005336 | Ga0070680_100025999 | Ga0070680_1000259993 | 330 |
| 536 | 3300005340 | Ga0070689_100255672 | Ga0070689_1002556722 | 330 |
| 537 | 3300005341 | Ga0070691_10005555 | Ga0070691_100055552 | 330 |
| 538 | 3300005354 | Ga0070675_100190903 | Ga0070675_1001909032 | 330 |
| 539 | 3300005445 | Ga0070708_100014104 | Ga0070708_1000141044 | 330 |
| 540 | 3300005458 | Ga0070681_10007963 | Ga0070681_100079634 | 330 |
| 541 | 3300005458 | Ga0070681_10008145 | Ga0070681_100081455 | 330 |
| 542 | 3300005467 | Ga0070706_100026528 | Ga0070706_1000265283 | 330 |
| 543 | 3300005518 | Ga0070699_100112833 | Ga0070699_1001128333 | 330 |
| 544 | 3300005530 | Ga0070679_100012355 | Ga0070679_1000123553 | 330 |
| 545 | 3300005548 | Ga0070665_100004697 | Ga0070665_10000469712 | 330 |
| 546 | 3300005563 | Ga0068855_100058840 | Ga0068855_1000588402 | 330 |
| 547 | 3300005614 | Ga0068856_100050783 | Ga0068856_1000507832 | 330 |
| 548 | 3300005843 | Ga0068860_100036957 | Ga0068860_1000369572 | 330 |
| 549 | 3300005937 | Ga0081455_10003642 | Ga0081455_1000364212 | 330 |
| 550 | 3300005937 | Ga0081455_10010780 | Ga0081455_100107806 | 330 |
| 551 | 3300005985 | Ga0081539_10004424 | Ga0081539_100044246 | 330 |
| 552 | 3300006038 | Ga0075365_10034624 | Ga0075365_100346244 | 330 |
| 553 | 3300006038 | Ga0075365_10176115 | Ga0075365_101761152 | 330 |
| 554 | 3300006177 | Ga0075362_10126965 | Ga0075362_101269651 | 330 |
| 555 | 3300006178 | Ga0075367_10171237 | Ga0075367_101712372 | 330 |
| 556 | 3300006186 | Ga0075369_10018646 | Ga0075369_100186463 | 330 |
| 557 | 3300006186 | Ga0075369_10059993 | Ga0075369_100599932 | 330 |
| 558 | 3300007265 | Ga0099794_10133691 | Ga0099794_101336911 | 330 |
| 559 | 3300009093 | Ga0105240_10086111 | Ga0105240_100861113 | 330 |
| 560 | 3300009094 | Ga0111539_10082204 | Ga0111539_100822046 | 330 |
| 561 | 3300013100 | Ga0157373_10072834 | Ga0157373_100728343 | 330 |
| 562 | 3300013104 | Ga0157370_10101939 | Ga0157370_101019394 | 330 |
| 563 | 3300013105 | Ga0157369_10446926 | Ga0157369_104469262 | 330 |
| 564 | 3300025908 | Ga0207643_10120115 | Ga0207643_101201152 | 330 |
| 565 | 3300025909 | Ga0207705_10005553 | Ga0207705_100055533 | 330 |
| 566 | 3300025912 | Ga0207707_10020251 | Ga0207707_100202513 | 330 |
| 567 | 3300025912 | Ga0207707_10029292 | Ga0207707_100292922 | 330 |
| 568 | 3300025913 | Ga0207695_10082876 | Ga0207695_100828762 | 330 |
| 569 | 3300025917 | Ga0207660_10008792 | Ga0207660_100087924 | 330 |
| 570 | 3300025917 | Ga0207660_10060286 | Ga0207660_100602862 | 330 |
| 571 | 3300025921 | Ga0207652_10082324 | Ga0207652_100823242 | 330 |
| 572 | 3300025925 | Ga0207650_10314795 | Ga0207650_103147952 | 330 |
| 573 | 3300025926 | Ga0207659_10058429 | Ga0207659_100584292 | 330 |
| 574 | 3300025949 | Ga0207667_10113171 | Ga0207667_101131712 | 330 |
| 575 | 3300026088 | Ga0207641_10079686 | Ga0207641_100796862 | 330 |
| 576 | 3300028379 | Ga0268266_10005825 | Ga0268266_100058254 | 330 |
| 577 | 3300028381 | Ga0268264_10011411 | Ga0268264_100114116 | 330 |
| 578 | 3300031911 | Ga0307412_10271217 | Ga0307412_102712172 | 330 |
| 579 | 3300035121 | Ga0373960_0004844 | Ga0373960_0004844_532_1590 | 330 |
| 580 | 3300037312 | Ga0395899_0053532 | Ga0395899_0053532_131_1144 | 330 |
| 581 | 3300037418 | Ga0395900_0005953 | Ga0395900_0005953_3972_4985 | 330 |
| 582 | 3300037466 | Ga0395898_0025658 | Ga0395898_0025658_888_1901 | 330 |
| 583 | 3300037853 | Ga0436364_0857265 | Ga0436364_0857265_5413_6444 | 330 |
| 584 | 3300045836 | Ga0466958_0023519 | Ga0466958_0023519_2561_3598 | 330 |
| 585 | 3300050489 | nmdc:mga03683_11410_c1 | nmdc:mga03683_11410_c1_2040_3059 | 330 |
| 586 | 3300050489 | nmdc:mga03683_1905_c1 | nmdc:mga03683_1905_c1_1536_2546 | 330 |
| 587 | 3300050489 | nmdc:mga03683_53201_c1 | nmdc:mga03683_53201_c1_269_1279 | 330 |
| 588 | 3300050492 | nmdc:mga0yw44_151110_c1 | nmdc:mga0yw44_151110_c1_142_1152 | 330 |
| 589 | 3300050492 | nmdc:mga0yw44_34699_c1 | nmdc:mga0yw44_34699_c1_441_1451 | 330 |
| 590 | 3300050492 | nmdc:mga0yw44_38717_c1 | nmdc:mga0yw44_38717_c1_232_1251 | 330 |
| 591 | 3300050493 | nmdc:mga0k408_64745_c1 | nmdc:mga0k408_64745_c1_73_1083 | 330 |
| 592 | 3300050494 | nmdc:mga06z11_113473_c1 | nmdc:mga06z11_113473_c1_148_1167 | 330 |
| 593 | 3300050509 | nmdc:mga0qj67_165418_c1 | nmdc:mga0qj67_165418_c1_426_1511 | 330 |
| 594 | 3300050516 | nmdc:mga0sz30_86040_c1 | nmdc:mga0sz30_86040_c1_42_1052 | 330 |
| 595 | 3300053085 | Ga0495619_0062911 | Ga0495619_0062911_838_1875 | 330 |
| 596 | 3300053096 | Ga0500641_0014773 | Ga0500641_0014773_11_1021 | 330 |
| 597 | 3300053153 | Ga0500616_0013215 | Ga0500616_0013215_3611_4630 | 330 |
| 598 | 3300061719 | Ga0466962_0017954 | Ga0466962_0017954_972_2009 | 330 |
| 599 | 3300005441 | Ga0070700_100000961 | Ga0070700_1000009619 | 331 |
| 600 | 3300005456 | Ga0070678_100370869 | Ga0070678_1003708691 | 331 |
| 601 | 3300005471 | Ga0070698_100001905 | Ga0070698_1000019053 | 331 |
| 602 | 3300005617 | Ga0068859_100040981 | Ga0068859_1000409812 | 331 |
| 603 | 3300005981 | Ga0081538_10000484 | Ga0081538_1000048434 | 331 |
| 604 | 3300005985 | Ga0081539_10005465 | Ga0081539_100054653 | 331 |
| 605 | 3300006931 | Ga0097620_100040981 | Ga0097620_1000409816 | 331 |
| 606 | 3300026075 | Ga0207708_10000047 | Ga0207708_10000047106 | 331 |
| 607 | 3300028381 | Ga0268264_10039433 | Ga0268264_100394332 | 331 |
| 608 | 3300031456 | Ga0307513_10000017 | Ga0307513_1000001772 | 331 |
| 609 | 3300031730 | Ga0307516_10005910 | Ga0307516_100059108 | 331 |
| 610 | 3300031903 | Ga0307407_10174488 | Ga0307407_101744881 | 331 |
| 611 | 3300046517 | Ga0495630_0028903 | Ga0495630_0028903_1551_2594 | 331 |
| 612 | 3300046543 | Ga0495645_0000098 | Ga0495645_0000098_37336_38361 | 331 |
| 613 | 3300047319 | Ga0495674_0111298 | Ga0495674_0111298_270_1313 | 331 |
| 614 | 3300047444 | Ga0495675_0013384 | Ga0495675_0013384_2692_3735 | 331 |
| 615 | iso_pu_bacteria | 2818991472 | 2819745622 | 331 |
| 616 | iso_pu_bacteria | 2904430863 | 2904433515 | 331 |
| 617 | iso_pu_bacteria | 2904501621 | 2904503981 | 331 |
| 618 | iso_pu_bacteria | 2908674828 | 2908676946 | 331 |
| 619 | iso_pu_bacteria | 2909074476 | 2909076878 | 331 |
| 620 | iso_pu_bacteria | 2919039151 | 2919039490 | 331 |
| 621 | iso_pu_bacteria | 2919042368 | 2919042885 | 331 |
| 622 | iso_pu_bacteria | 2928104781 | 2928106150 | 331 |
| 623 | iso_pu_bacteria | 2928500415 | 2928502088 | 331 |
| 624 | iso_pu_bacteria | 2939660829 | 2939664223 | 331 |
| 625 | iso_pu_bacteria | 2984551494 | 2984554832 | 331 |
| 626 | 3300005937 | Ga0081455_10031924 | Ga0081455_100319245 | 332 |
| 627 | 3300005981 | Ga0081538_10007819 | Ga0081538_1000781914 | 332 |
| 628 | 3300006846 | Ga0075430_100229074 | Ga0075430_1002290742 | 332 |
| 629 | 3300006847 | Ga0075431_100032872 | Ga0075431_1000328726 | 332 |
| 630 | 3300006847 | Ga0075431_100318918 | Ga0075431_1003189182 | 332 |
| 631 | 3300021384 | Ga0213876_10059302 | Ga0213876_100593021 | 332 |
| 632 | 3300026078 | Ga0207702_10087599 | Ga0207702_100875994 | 332 |
| 633 | 3300028379 | Ga0268266_10261282 | Ga0268266_102612822 | 332 |
| 634 | 3300031852 | Ga0307410_10361999 | Ga0307410_103619991 | 332 |
| 635 | 3300031901 | Ga0307406_10002397 | Ga0307406_100023977 | 332 |
| 636 | 3300031901 | Ga0307406_10024232 | Ga0307406_100242323 | 332 |
| 637 | 3300031903 | Ga0307407_10000744 | Ga0307407_100007445 | 332 |
| 638 | 3300031911 | Ga0307412_10004845 | Ga0307412_100048454 | 332 |
| 639 | 3300031995 | Ga0307409_100368405 | Ga0307409_1003684052 | 332 |
| 640 | 3300032002 | Ga0307416_100003103 | Ga0307416_1000031035 | 332 |
| 641 | 3300032004 | Ga0307414_10002550 | Ga0307414_100025505 | 332 |
| 642 | 3300032005 | Ga0307411_10243318 | Ga0307411_102433182 | 332 |
| 643 | 3300035695 | Ga0373927_0023943 | Ga0373927_0023943_2139_3191 | 332 |
| 644 | 3300036401 | Ga0373937_0423310 | Ga0373937_0423310_83_1111 | 332 |
| 645 | 3300039437 | Ga0436365_0212021 | Ga0436365_0212021_4915_5961 | 332 |
| 646 | 3300044684 | Ga0466966_0037442 | Ga0466966_0037442_1428_2489 | 332 |
| 647 | 3300044765 | Ga0466970_0016305 | Ga0466970_0016305_663_1724 | 332 |
| 648 | 3300045049 | Ga0466959_0077474 | Ga0466959_0077474_997_2058 | 332 |
| 649 | 3300045976 | Ga0466967_0000343 | Ga0466967_0000343_12021_13070 | 332 |
| 650 | 3300046472 | Ga0495580_0007926 | Ga0495580_0007926_6536_7588 | 332 |
| 651 | 3300046499 | Ga0495594_0000017 | Ga0495594_0000017_87405_88418 | 332 |
| 652 | 3300046689 | Ga0495613_0287868 | Ga0495613_0287868_83_1129 | 332 |
| 653 | 3300048905 | Ga0496102_0047822 | Ga0496102_0047822_1095_2135 | 332 |
| 654 | 3300048905 | Ga0496102_0114885 | Ga0496102_0114885_143_1186 | 332 |
| 655 | 3300048910 | Ga0496107_0108611 | Ga0496107_0108611_846_1886 | 332 |
| 656 | 3300048912 | Ga0496109_0002595 | Ga0496109_0002595_13522_14562 | 332 |
| 657 | 3300048913 | Ga0496110_0006769 | Ga0496110_0006769_96_1136 | 332 |
| 658 | 3300048915 | Ga0496112_0050315 | Ga0496112_0050315_1618_2658 | 332 |
| 659 | 3300048916 | Ga0496113_0092541 | Ga0496113_0092541_1238_2278 | 332 |
| 660 | 3300048920 | Ga0496117_0004162 | Ga0496117_0004162_9151_10194 | 332 |
| 661 | 3300048921 | Ga0496118_0000450 | Ga0496118_0000450_40629_41672 | 332 |
| 662 | 3300048922 | Ga0496119_0148347 | Ga0496119_0148347_15_1058 | 332 |
| 663 | 3300048924 | Ga0496121_0005238 | Ga0496121_0005238_14504_15547 | 332 |
| 664 | 3300048925 | Ga0496122_0026111 | Ga0496122_0026111_3979_5022 | 332 |
| 665 | 3300048926 | Ga0496123_0036090 | Ga0496123_0036090_291_1334 | 332 |
| 666 | 3300048927 | Ga0496124_0000070 | Ga0496124_0000070_176907_177950 | 332 |
| 667 | 3300049576 | Ga0501040_0213159 | Ga0501040_0213159_148_1194 | 332 |
| 668 | 3300049582 | Ga0501048_0091121 | Ga0501048_0091121_31_1059 | 332 |
| 669 | 3300049587 | Ga0501071_0020975 | Ga0501071_0020975_1197_2243 | 332 |
| 670 | 3300050509 | nmdc:mga0qj67_86146_c1 | nmdc:mga0qj67_86146_c1_274_1299 | 332 |
| 671 | 3300050510 | nmdc:mga06r32_132326_c1 | nmdc:mga06r32_132326_c1_727_1752 | 332 |
| 672 | iso_pu_bacteria | 2751185788 | 2753302683 | 332 |
| 673 | 3300005336 | Ga0070680_100020646 | Ga0070680_1000206464 | 333 |
| 674 | 3300005458 | Ga0070681_10131930 | Ga0070681_101319304 | 333 |
| 675 | 3300005548 | Ga0070665_100008563 | Ga0070665_1000085635 | 333 |
| 676 | 3300005563 | Ga0068855_100082043 | Ga0068855_1000820432 | 333 |
| 677 | 3300005614 | Ga0068856_100059333 | Ga0068856_1000593332 | 333 |
| 678 | 3300005616 | Ga0068852_100012575 | Ga0068852_1000125754 | 333 |
| 679 | 3300005937 | Ga0081455_10014432 | Ga0081455_100144322 | 333 |
| 680 | 3300009093 | Ga0105240_10005993 | Ga0105240_100059939 | 333 |
| 681 | 3300009094 | Ga0111539_10007055 | Ga0111539_100070552 | 333 |
| 682 | 3300013104 | Ga0157370_10391901 | Ga0157370_103919012 | 333 |
| 683 | 3300025912 | Ga0207707_10046940 | Ga0207707_100469404 | 333 |
| 684 | 3300025919 | Ga0207657_10056371 | Ga0207657_100563712 | 333 |
| 685 | 3300025921 | Ga0207652_10095758 | Ga0207652_100957583 | 333 |
| 686 | 3300025924 | Ga0207694_10205747 | Ga0207694_102057473 | 333 |
| 687 | 3300026078 | Ga0207702_10097825 | Ga0207702_100978252 | 333 |
| 688 | 3300026142 | Ga0207698_10015498 | Ga0207698_100154984 | 333 |
| 689 | 3300028379 | Ga0268266_10046783 | Ga0268266_100467832 | 333 |
| 690 | 3300044765 | Ga0466970_0028875 | Ga0466970_0028875_1287_2327 | 333 |
| 691 | 3300045049 | Ga0466959_0143372 | Ga0466959_0143372_411_1451 | 333 |
| 692 | 3300046454 | Ga0495592_0015796 | Ga0495592_0015796_3986_5035 | 333 |
| 693 | 3300046463 | Ga0495653_0005801 | Ga0495653_0005801_3070_4119 | 333 |
| 694 | 3300046516 | Ga0495628_0000081 | Ga0495628_0000081_68620_69669 | 333 |
| 695 | 3300046517 | Ga0495630_0146635 | Ga0495630_0146635_463_1512 | 333 |
| 696 | 3300046529 | Ga0495652_0010794 | Ga0495652_0010794_4614_5663 | 333 |
| 697 | 3300046533 | Ga0495640_0038820 | Ga0495640_0038820_328_1377 | 333 |
| 698 | 3300046535 | Ga0495586_0002941 | Ga0495586_0002941_1504_2547 | 333 |
| 699 | 3300046536 | Ga0495587_0000812 | Ga0495587_0000812_13232_14281 | 333 |
| 700 | 3300046543 | Ga0495645_0015934 | Ga0495645_0015934_1855_2904 | 333 |
| 701 | 3300046675 | Ga0495657_0059077 | Ga0495657_0059077_966_2015 | 333 |
| 702 | 3300047317 | Ga0495604_0012072 | Ga0495604_0012072_3602_4651 | 333 |
| 703 | 3300047319 | Ga0495674_0003091 | Ga0495674_0003091_6010_7059 | 333 |
| 704 | 3300047319 | Ga0495674_0053462 | Ga0495674_0053462_326_1369 | 333 |
| 705 | 3300047322 | Ga0495680_0001560 | Ga0495680_0001560_20613_21662 | 333 |
| 706 | 3300047444 | Ga0495675_0000394 | Ga0495675_0000394_2722_3771 | 333 |
| 707 | 3300047471 | Ga0495684_0014397 | Ga0495684_0014397_2423_3472 | 333 |
| 708 | 3300048088 | Ga0495602_0012580 | Ga0495602_0012580_3116_4165 | 333 |
| 709 | 3300048913 | Ga0496110_0396896 | Ga0496110_0396896_15_1058 | 333 |
| 710 | 3300048914 | Ga0496111_0032964 | Ga0496111_0032964_2004_3047 | 333 |
| 711 | 3300048915 | Ga0496112_0168670 | Ga0496112_0168670_219_1262 | 333 |
| 712 | 3300050511 | nmdc:mga08y16_3246_c1 | nmdc:mga08y16_3246_c1_15312_16349 | 333 |
| 713 | 3300005329 | Ga0070683_100047264 | Ga0070683_1000472642 | 334 |
| 714 | 3300006038 | Ga0075365_10196654 | Ga0075365_101966541 | 334 |
| 715 | 3300009093 | Ga0105240_10235068 | Ga0105240_102350682 | 334 |
| 716 | 3300009098 | Ga0105245_10186517 | Ga0105245_101865172 | 334 |
| 717 | 3300009147 | Ga0114129_10088169 | Ga0114129_100881693 | 334 |
| 718 | 3300009176 | Ga0105242_10027481 | Ga0105242_100274814 | 334 |
| 719 | 3300009553 | Ga0105249_10000090 | Ga0105249_100000908 | 334 |
| 720 | 3300011119 | Ga0105246_10028187 | Ga0105246_100281873 | 334 |
| 721 | 3300013105 | Ga0157369_10220736 | Ga0157369_102207362 | 334 |
| 722 | 3300013296 | Ga0157374_10016092 | Ga0157374_100160927 | 334 |
| 723 | 3300013297 | Ga0157378_10000702 | Ga0157378_1000070211 | 334 |
| 724 | 3300021388 | Ga0213875_10002705 | Ga0213875_100027057 | 334 |
| 725 | 3300024227 | Ga0228598_1002491 | Ga0228598_10024913 | 334 |
| 726 | 3300025913 | Ga0207695_10146371 | Ga0207695_101463712 | 334 |
| 727 | 3300025961 | Ga0207712_10000903 | Ga0207712_1000090313 | 334 |
| 728 | 3300031090 | Ga0265760_10004349 | Ga0265760_100043494 | 334 |
| 729 | 3300035111 | Ga0373923_0001712 | Ga0373923_0001712_553_1611 | 334 |
| 730 | 3300035118 | Ga0373954_0078404 | Ga0373954_0078404_116_1174 | 334 |
| 731 | 3300035695 | Ga0373927_0094995 | Ga0373927_0094995_284_1342 | 334 |
| 732 | 3300036401 | Ga0373937_0056926 | Ga0373937_0056926_2041_3099 | 334 |
| 733 | 3300036401 | Ga0373937_0283051 | Ga0373937_0283051_220_1278 | 334 |
| 734 | 3300037853 | Ga0436364_1548394 | Ga0436364_1548394_87543_88586 | 334 |
| 735 | 3300046462 | Ga0495651_0005707 | Ga0495651_0005707_6471_7535 | 334 |
| 736 | 3300046463 | Ga0495653_0009609 | Ga0495653_0009609_6737_7795 | 334 |
| 737 | 3300046472 | Ga0495580_0126661 | Ga0495580_0126661_618_1676 | 334 |
| 738 | 3300046477 | Ga0495664_0015717 | Ga0495664_0015717_1403_2461 | 334 |
| 739 | 3300046516 | Ga0495628_0010519 | Ga0495628_0010519_2362_3420 | 334 |
| 740 | 3300046516 | Ga0495628_0082803 | Ga0495628_0082803_1247_2305 | 334 |
| 741 | 3300046517 | Ga0495630_0347018 | Ga0495630_0347018_14_1072 | 334 |
| 742 | 3300046529 | Ga0495652_0000022 | Ga0495652_0000022_3815_4837 | 334 |
| 743 | 3300046529 | Ga0495652_0040858 | Ga0495652_0040858_2300_3358 | 334 |
| 744 | 3300046535 | Ga0495586_0039939 | Ga0495586_0039939_123_1181 | 334 |
| 745 | 3300046536 | Ga0495587_0050817 | Ga0495587_0050817_985_2043 | 334 |
| 746 | 3300046543 | Ga0495645_0108093 | Ga0495645_0108093_52_1110 | 334 |
| 747 | 3300046559 | Ga0495667_0071630 | Ga0495667_0071630_876_1940 | 334 |
| 748 | 3300046675 | Ga0495657_0015602 | Ga0495657_0015602_636_1694 | 334 |
| 749 | 3300046680 | Ga0495646_0003444 | Ga0495646_0003444_6680_7738 | 334 |
| 750 | 3300046689 | Ga0495613_0252322 | Ga0495613_0252322_68_1126 | 334 |
| 751 | 3300046690 | Ga0495624_0011138 | Ga0495624_0011138_1480_2538 | 334 |
| 752 | 3300047319 | Ga0495674_0009954 | Ga0495674_0009954_3356_4414 | 334 |
| 753 | 3300047320 | Ga0495672_0024603 | Ga0495672_0024603_1113_2156 | 334 |
| 754 | 3300047322 | Ga0495680_0000426 | Ga0495680_0000426_31987_33051 | 334 |
| 755 | 3300047444 | Ga0495675_0002656 | Ga0495675_0002656_128_1186 | 334 |
| 756 | 3300047444 | Ga0495675_0063195 | Ga0495675_0063195_101_1165 | 334 |
| 757 | 3300047471 | Ga0495684_0002041 | Ga0495684_0002041_13505_14563 | 334 |
| 758 | 3300047673 | Ga0495593_0009498 | Ga0495593_0009498_4451_5509 | 334 |
| 759 | 3300048088 | Ga0495602_0150086 | Ga0495602_0150086_292_1350 | 334 |
| 760 | 3300048088 | Ga0495602_0166364 | Ga0495602_0166364_588_1652 | 334 |
| 761 | 3300048909 | Ga0496106_0045863 | Ga0496106_0045863_674_1729 | 334 |
| 762 | 3300048915 | Ga0496112_0067609 | Ga0496112_0067609_2112_3167 | 334 |
| 763 | 3300061719 | Ga0466962_0070598 | Ga0466962_0070598_458_1504 | 334 |
| 764 | 3300005331 | Ga0070670_100010701 | Ga0070670_1000107014 | 335 |
| 765 | 3300005365 | Ga0070688_100103605 | Ga0070688_1001036052 | 335 |
| 766 | 3300005437 | Ga0070710_10000014 | Ga0070710_1000001418 | 335 |
| 767 | 3300005458 | Ga0070681_10103075 | Ga0070681_101030753 | 335 |
| 768 | 3300005518 | Ga0070699_100359125 | Ga0070699_1003591251 | 335 |
| 769 | 3300005530 | Ga0070679_100052825 | Ga0070679_1000528252 | 335 |
| 770 | 3300005535 | Ga0070684_100218906 | Ga0070684_1002189062 | 335 |
| 771 | 3300005543 | Ga0070672_100141568 | Ga0070672_1001415682 | 335 |
| 772 | 3300005564 | Ga0070664_100123701 | Ga0070664_1001237012 | 335 |
| 773 | 3300005842 | Ga0068858_100332056 | Ga0068858_1003320562 | 335 |
| 774 | 3300009551 | Ga0105238_10035203 | Ga0105238_100352032 | 335 |
| 775 | 3300013104 | Ga0157370_10077981 | Ga0157370_100779813 | 335 |
| 776 | 3300014325 | Ga0163163_10075367 | Ga0163163_100753673 | 335 |
| 777 | 3300025315 | Ga0207697_10000243 | Ga0207697_1000024319 | 335 |
| 778 | 3300025898 | Ga0207692_10000003 | Ga0207692_10000003258 | 335 |
| 779 | 3300025901 | Ga0207688_10001364 | Ga0207688_1000136412 | 335 |
| 780 | 3300025919 | Ga0207657_10004491 | Ga0207657_1000449111 | 335 |
| 781 | 3300025921 | Ga0207652_10233970 | Ga0207652_102339701 | 335 |
| 782 | 3300025924 | Ga0207694_10193313 | Ga0207694_101933132 | 335 |
| 783 | 3300025925 | Ga0207650_10119299 | Ga0207650_101192992 | 335 |
| 784 | 3300025932 | Ga0207690_10000057 | Ga0207690_1000005744 | 335 |
| 785 | 3300025940 | Ga0207691_10185734 | Ga0207691_101857342 | 335 |
| 786 | 3300025945 | Ga0207679_10124810 | Ga0207679_101248101 | 335 |
| 787 | 3300035172 | Ga0373955_0053770 | Ga0373955_0053770_127_1212 | 335 |
| 788 | 3300039438 | Ga0436360_0422338 | Ga0436360_0422338_26996_28117 | 335 |
| 789 | 3300039447 | Ga0436361_0400659 | Ga0436361_0400659_64_1185 | 335 |
| 790 | 3300045976 | Ga0466967_0037977 | Ga0466967_0037977_2923_3963 | 335 |
| 791 | 3300048912 | Ga0496109_0024472 | Ga0496109_0024472_3078_4151 | 335 |
| 792 | 3300048913 | Ga0496110_0063311 | Ga0496110_0063311_364_1443 | 335 |
| 793 | 3300003659 | JGI25404J52841_10000124 | JGI25404J52841_100001248 | 336 |
| 794 | 3300005983 | Ga0081540_1000281 | Ga0081540_100028114 | 336 |
| 795 | 3300021377 | Ga0213874_10015475 | Ga0213874_100154752 | 336 |
| 796 | 3300021384 | Ga0213876_10000555 | Ga0213876_100005556 | 336 |
| 797 | 3300021384 | Ga0213876_10003528 | Ga0213876_100035289 | 336 |
| 798 | 3300021388 | Ga0213875_10009086 | Ga0213875_100090864 | 336 |
| 799 | 3300039437 | Ga0436365_0787653 | Ga0436365_0787653_1804_2850 | 336 |
| 800 | 3300039437 | Ga0436365_1011053 | Ga0436365_1011053_21031_22131 | 336 |
| 801 | 3300039450 | Ga0436363_0587086 | Ga0436363_0587086_4474_5520 | 336 |
| 802 | 3300039450 | Ga0436363_1583874 | Ga0436363_1583874_27505_28575 | 336 |
| 803 | 3300039453 | Ga0436362_0871163 | Ga0436362_0871163_14024_15070 | 336 |
| 804 | 3300046533 | Ga0495640_0121907 | Ga0495640_0121907_366_1448 | 336 |
| 805 | 3300046557 | Ga0495622_0000057 | Ga0495622_0000057_96354_97418 | 336 |
| 806 | 3300048912 | Ga0496109_0001274 | Ga0496109_0001274_16846_17898 | 337 |
| 807 | 3300001991 | JGI24743J22301_10014070 | JGI24743J22301_100140702 | 338 |
| 808 | 3300005328 | Ga0070676_10000889 | Ga0070676_1000088913 | 338 |
| 809 | 3300005334 | Ga0068869_100000428 | Ga0068869_10000042813 | 338 |
| 810 | 3300005338 | Ga0068868_100000387 | Ga0068868_10000038717 | 338 |
| 811 | 3300005364 | Ga0070673_100000015 | Ga0070673_10000001558 | 338 |
| 812 | 3300005459 | Ga0068867_100000030 | Ga0068867_10000003024 | 338 |
| 813 | 3300005543 | Ga0070672_100422455 | Ga0070672_1004224551 | 338 |
| 814 | 3300005614 | Ga0068856_100048263 | Ga0068856_1000482634 | 338 |
| 815 | 3300006881 | Ga0068865_100000021 | Ga0068865_10000002159 | 338 |
| 816 | 3300009098 | Ga0105245_10003301 | Ga0105245_1000330110 | 338 |
| 817 | 3300009148 | Ga0105243_10001112 | Ga0105243_1000111216 | 338 |
| 818 | 3300009176 | Ga0105242_10005683 | Ga0105242_1000568310 | 338 |
| 819 | 3300009553 | Ga0105249_10064900 | Ga0105249_100649003 | 338 |
| 820 | 3300011119 | Ga0105246_10004310 | Ga0105246_1000431012 | 338 |
| 821 | 3300013296 | Ga0157374_10007766 | Ga0157374_100077665 | 338 |
| 822 | 3300013297 | Ga0157378_10002783 | Ga0157378_1000278311 | 338 |
| 823 | 3300013308 | Ga0157375_10001073 | Ga0157375_100010735 | 338 |
| 824 | 3300014745 | Ga0157377_10010953 | Ga0157377_100109533 | 338 |
| 825 | 3300014969 | Ga0157376_10000078 | Ga0157376_1000007819 | 338 |
| 826 | 3300025907 | Ga0207645_10002373 | Ga0207645_100023733 | 338 |
| 827 | 3300025927 | Ga0207687_10000683 | Ga0207687_1000068311 | 338 |
| 828 | 3300025934 | Ga0207686_10006604 | Ga0207686_100066043 | 338 |
| 829 | 3300025935 | Ga0207709_10000118 | Ga0207709_1000011863 | 338 |
| 830 | 3300025938 | Ga0207704_10000027 | Ga0207704_1000002763 | 338 |
| 831 | 3300025942 | Ga0207689_10000309 | Ga0207689_1000030920 | 338 |
| 832 | 3300025960 | Ga0207651_10000016 | Ga0207651_1000001663 | 338 |
| 833 | 3300025961 | Ga0207712_10035255 | Ga0207712_100352552 | 338 |
| 834 | 3300026023 | Ga0207677_10000171 | Ga0207677_1000017141 | 338 |
| 835 | 3300026078 | Ga0207702_10009858 | Ga0207702_100098584 | 338 |
| 836 | 3300026089 | Ga0207648_10000116 | Ga0207648_1000011613 | 338 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4us5-assembly2.cif.gz_D | crystal structure of apo-msno8 | 0.9269 | 3 | 333 |
| 4us5-assembly2.cif.gz_C | crystal structure of apo-msno8 | 0.923 | 3 | 333 |
| 4us5-assembly1.cif.gz_A | crystal structure of apo-msno8 | 0.9212 | 3 | 333 |
| 4us5-assembly2.cif.gz_C | crystal structure of apo-msno8 | 0.915 | 3 | 333 |
| 4us5-assembly1.cif.gz_A | crystal structure of apo-msno8 | 0.9131 | 3 | 333 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ADV5_3_330_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9143 | 2 | 328 | 3.20.20.30 |
| 4us5A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9075 | 3 | 333 | 3.20.20.30 |
| af_P0ADV5_3_330_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9035 | 2 | 328 | 3.20.20.30 |
| 4us5A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8993 | 3 | 333 | 3.20.20.30 |
| af_Q2FXV3_1_329_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8855 | 1 | 328 | 3.20.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0MVQ3-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9881 | 3 | 332 |
GO:0005829
GO:0016705 |
| AF-A0A2K9ITW5-F1-model_v4 | Limonene 1,2-monooxygenase (EC 1.14.13.107) | 0.985 | 4 | 112 |
GO:0005829
GO:0052601 |
| AF-A0A7Y2Q2N7-F1-model_v4 | deleted | 0.9848 | 4 | 110 |
|
| AF-A0A4Q5R4S9-F1-model_v4 | MsnO8 family LLM class oxidoreductase (EC 1.-.-.-) | 0.9835 | 4 | 122 |
GO:0005829
GO:0016705 |
| AF-A0A3B9QRI4-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9795 | 4 | 152 |
GO:0005829
GO:0016705 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar