F482884

General Info

Members Datasets Scaffolds Average Seq Length
836 423 783 340

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10106053|Ga0163163_101060531
Length 391
Sequence MAAALLADGGGRRHDLHNTVEIANGVPAKNVEQRHKVALQVSRFGAHVVKCAIGGLLAMSLRLSVLDQSPVSDGSTGGDALKNSVDLARLTEGLGYQRYWVAEHHGTPMLACASPEILIGPIAAATTNLRVGSGGVMLPHYSPLKVAENFSMLGGLYGDRIDLAVGRAPGSDPLTAFALQRDRRQAAPDDFPEQLSELLAYEWNRMPANHRFARLGKLPGGSTRPEVWLLGSSPQSAVWAAELGLPYAFADFINPAGAEIAAYYRQHYEPSETNPAPRTTAAIWALCAETDEAAWRLAASSRMAFTLFMQGTLIPVPPIETALAFLAEHPESAEALGRRRRWIVGSPKTVRAGIETLAAQYQADEIMIVTITYDHAARRRSYELIAESFLS

Samples

Sample ID Description Type Environment
1 2519103095 Burkholderia sp. KJ006 Isolate Nodule
2 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
3 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
4 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
5 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
6 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
7 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
8 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
9 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
10 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
11 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
12 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
13 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
14 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
15 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
16 2818991452 Burkholderia cepacia 561 Isolate Unclassified
17 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
18 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
19 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
20 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
21 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
22 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
23 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
24 2904564687 Burkholderia sp. 571 Isolate Unclassified
25 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
26 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
27 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
28 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
29 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
30 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
31 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
32 2928163908 Burkholderia sp. 567 Isolate Unclassified
33 2928170801 Burkholderia sp. 572 Isolate Unclassified
34 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
35 2928536128 Burkholderia sola 565 Isolate Unclassified
36 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
37 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
38 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
39 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
40 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
41 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
42 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
43 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
44 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
47 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
48 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
49 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
50 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
51 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
52 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
53 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
54 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
55 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
56 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
57 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
58 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
59 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
60 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
61 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
62 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
63 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
64 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
65 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
66 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
67 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
68 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
69 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
70 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
71 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
72 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
73 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
74 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
75 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
76 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
77 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
78 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
79 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
80 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
81 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
82 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
83 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
84 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
85 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
86 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
87 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
88 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
89 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
90 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
91 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
92 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
93 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
94 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
95 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
96 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
102 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
103 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
104 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
105 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
106 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
107 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
108 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
109 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
110 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
111 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
112 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
113 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
114 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
115 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
116 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
117 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
118 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
119 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
120 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
121 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
123 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
124 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
125 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
126 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
127 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
130 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
131 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
133 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
134 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
137 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
138 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
139 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
140 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
141 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
142 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
143 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
144 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
145 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
146 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
147 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
151 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
152 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
155 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
156 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
157 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
161 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
162 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
163 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
164 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
165 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
166 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
234 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
235 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
236 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
237 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
238 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
239 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
240 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
241 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
242 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
244 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
245 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
246 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
247 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
248 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
249 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
250 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
251 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
252 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
253 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
254 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
255 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
256 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
257 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
258 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
259 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
260 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
261 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
262 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
263 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
264 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
265 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
266 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
267 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
268 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
270 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
271 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
272 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
273 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
274 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
275 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
276 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
277 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
278 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
279 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
280 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
281 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
282 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
283 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
284 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
285 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
286 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
287 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
288 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
289 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
290 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
291 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
292 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
293 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
294 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
295 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
296 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
297 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
298 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
299 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
300 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
301 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
302 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
303 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
304 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
305 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
306 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
307 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
308 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
309 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
310 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
311 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
312 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
313 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
314 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
315 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
316 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
317 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
318 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
319 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
320 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
321 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
322 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
323 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
324 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
325 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
326 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
327 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
328 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
329 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
330 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
331 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
332 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
333 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
334 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
335 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
336 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
337 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
338 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
339 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
340 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
341 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
342 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
343 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
344 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
345 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
346 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
347 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
348 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
349 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
350 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
351 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
352 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
353 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
354 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
355 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
356 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
357 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
358 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
359 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
360 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
361 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
362 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
363 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
364 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
365 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
366 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
367 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
368 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
369 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
370 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
379 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
380 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
381 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
382 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
383 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
384 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
385 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
386 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
387 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
388 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
389 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
392 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
393 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
394 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
395 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
396 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
397 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
398 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
399 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
400 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
401 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
402 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
403 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
404 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
405 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
406 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
407 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
408 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
409 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
410 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
411 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
412 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
413 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
414 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
415 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
416 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
417 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
418 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
419 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
420 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
421 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
422 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
423 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.94
Metatranscriptomes 0.72
Isolates 6.34

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 7.42
Nodule 0.12
Rhizoplane 3.83
Rhizosphere 81.34
Stem 0
Stem Tuber 0
Unclassified 6.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10014070 3300001991 Bacteria 1472
2 JGI25151J46595_10026305 3300003187 Bacteria 2350
3 JGI25406J46586_10006971 3300003203 Bacteria 5188
4 JGI25404J52841_10000124 3300003659 Bacteria 7972
5 Ga0055538_1000311 3300003751 Bacteria 23220
6 Ga0055532_1000155 3300003758 Bacteria 60784
7 Ga0055532_1000997 3300003758 Bacteria 8906
8 Ga0055532_1001799 3300003758 Bacteria 5328
9 Ga0055532_1002590 3300003758 Bacteria 3620
10 Ga0055527_1000231 3300003760 Bacteria 35482
11 Ga0055527_1002809 3300003760 Bacteria 2788
12 Ga0055535_1000492 3300003761 Bacteria 35482
13 Ga0055535_1000587 3300003761 Bacteria 30358
14 Ga0055542_1000613 3300003762 Bacteria 30358
15 Ga0055529_1000525 3300003763 Bacteria 33133
16 Ga0055529_1003706 3300003763 Bacteria 2470
17 Ga0055540_1010060 3300003792 Bacteria 3185
18 Ga0055541_1003263 3300003841 Bacteria 3076
19 Ga0058692_1012022 3300003856 Bacteria 2067
20 Ga0058859_11760707 3300004798 Bacteria 7869
21 Ga0058860_12215240 3300004801 Bacteria 5997
22 Ga0070658_10027709 3300005327 Bacteria 4546
23 Ga0070658_10038905 3300005327 Bacteria 3836
24 Ga0070658_10162752 3300005327 Bacteria 1872
25 Ga0070676_10000889 3300005328 Bacteria 14761
26 Ga0070683_100007574 3300005329 Bacteria 9181
27 Ga0070683_100027055 3300005329 Bacteria 5169
28 Ga0070683_100047264 3300005329 Bacteria 3976
29 Ga0070690_100046400 3300005330 Bacteria 2762
30 Ga0070670_100010701 3300005331 Bacteria 7838
31 Ga0068869_100000428 3300005334 Bacteria 22992
32 Ga0068869_100254383 3300005334 Bacteria 1404
33 Ga0070666_10004788 3300005335 Bacteria 8275
34 Ga0070666_10021603 3300005335 Bacteria 4172
35 Ga0070680_100007774 3300005336 Bacteria 8172
36 Ga0070680_100020646 3300005336 Bacteria 5229
37 Ga0070680_100025999 3300005336 Bacteria 4681
38 Ga0068868_100000387 3300005338 Bacteria 29954
39 Ga0068868_100085970 3300005338 Bacteria 2528
40 Ga0068868_100351339 3300005338 Bacteria 1263
41 Ga0070660_100000098 3300005339 Bacteria 52986
42 Ga0070660_100027936 3300005339 Bacteria 4216
43 Ga0070660_100328258 3300005339 Bacteria 1258
44 Ga0070689_100063724 3300005340 Bacteria 2868
45 Ga0070689_100255672 3300005340 Bacteria 1447
46 Ga0070691_10005555 3300005341 Bacteria 5738
47 Ga0070687_100005017 3300005343 Bacteria 5332
48 Ga0070668_100041434 3300005347 Bacteria 3528
49 Ga0070675_100007001 3300005354 Bacteria 8666
50 Ga0070675_100057389 3300005354 Bacteria 3209
51 Ga0070675_100190903 3300005354 Bacteria 1775
52 Ga0070671_100026180 3300005355 Bacteria 4793
53 Ga0070673_100000015 3300005364 Bacteria 118064
54 Ga0070673_100188489 3300005364 Bacteria 1770
55 Ga0070688_100103605 3300005365 Bacteria 1880
56 Ga0070659_100000259 3300005366 Bacteria 41636
57 Ga0070659_100001090 3300005366 Bacteria 19781
58 Ga0070659_100187651 3300005366 Bacteria 1698
59 Ga0070659_100305882 3300005366 Bacteria 1327
60 Ga0070667_100024721 3300005367 Bacteria 4991
61 Ga0070709_10233480 3300005434 Bacteria 1317
62 Ga0070714_100025070 3300005435 Bacteria 4919
63 Ga0070714_100041036 3300005435 Bacteria 3903
64 Ga0070713_100003315 3300005436 Bacteria 10617
65 Ga0070713_100012130 3300005436 Bacteria 6310
66 Ga0070710_10000014 3300005437 Bacteria 103956
67 Ga0070701_10000650 3300005438 Bacteria 12156
68 Ga0070711_100076569 3300005439 Bacteria 2372
69 Ga0070700_100000961 3300005441 Bacteria 14231
70 Ga0070700_100240667 3300005441 Bacteria 1293
71 Ga0070708_100014104 3300005445 Bacteria 6569
72 Ga0070663_100011412 3300005455 Bacteria 5577
73 Ga0070663_100021502 3300005455 Bacteria 4292
74 Ga0070663_100204458 3300005455 Bacteria 1543
75 Ga0070678_100049230 3300005456 Bacteria 3040
76 Ga0070678_100370869 3300005456 Bacteria 1236
77 Ga0070662_100010643 3300005457 Bacteria 6048
78 Ga0070681_10007963 3300005458 Bacteria 10371
79 Ga0070681_10008145 3300005458 Bacteria 10260
80 Ga0070681_10053595 3300005458 Bacteria 4020
81 Ga0070681_10103075 3300005458 Bacteria 2798
82 Ga0070681_10110162 3300005458 Bacteria 2693
83 Ga0070681_10131930 3300005458 Bacteria 2430
84 Ga0070681_10207528 3300005458 Bacteria 1876
85 Ga0068867_100000030 3300005459 Bacteria 86560
86 Ga0068867_100015726 3300005459 Bacteria 5369
87 Ga0070685_10014989 3300005466 Bacteria 4114
88 Ga0070706_100026528 3300005467 Bacteria 5330
89 Ga0070706_100049831 3300005467 Bacteria 3864
90 Ga0070707_100028668 3300005468 Bacteria 5298
91 Ga0070698_100001905 3300005471 Bacteria 23252
92 Ga0070698_100020372 3300005471 Bacteria 6951
93 Ga0070699_100112833 3300005518 Bacteria 2388
94 Ga0070699_100317243 3300005518 Bacteria 1400
95 Ga0070699_100359125 3300005518 Bacteria 1313
96 Ga0070679_100007731 3300005530 Bacteria 10065
97 Ga0070679_100012355 3300005530 Bacteria 8156
98 Ga0070679_100052825 3300005530 Bacteria 4045
99 Ga0070679_100102311 3300005530 Bacteria 2851
100 Ga0070679_100186986 3300005530 Bacteria 2041
101 Ga0070684_100021352 3300005535 Bacteria 5386
102 Ga0070684_100043240 3300005535 Bacteria 3889
103 Ga0070684_100218906 3300005535 Bacteria 1737
104 Ga0068853_100041546 3300005539 Bacteria 3929
105 Ga0068853_100141220 3300005539 Bacteria 2162
106 Ga0070672_100141568 3300005543 Bacteria 1984
107 Ga0070672_100422455 3300005543 Bacteria 1145
108 Ga0070686_100008772 3300005544 Bacteria 5665
109 Ga0070665_100000127 3300005548 Bacteria 145671
110 Ga0070665_100003284 3300005548 Bacteria 17361
111 Ga0070665_100004697 3300005548 Bacteria 14259
112 Ga0070665_100004797 3300005548 Bacteria 14071
113 Ga0070665_100005214 3300005548 Bacteria 13447
114 Ga0070665_100008563 3300005548 Bacteria 10351
115 Ga0070665_100010364 3300005548 Bacteria 9430
116 Ga0070665_100031233 3300005548 Bacteria 5361
117 Ga0068855_100023792 3300005563 Bacteria 7337
118 Ga0068855_100058840 3300005563 Bacteria 4498
119 Ga0068855_100082043 3300005563 Bacteria 3737
120 Ga0068855_100399846 3300005563 Bacteria 1505
121 Ga0070664_100108712 3300005564 Bacteria 2418
122 Ga0070664_100123701 3300005564 Bacteria 2267
123 Ga0068857_100166877 3300005577 Bacteria 2000
124 Ga0068856_100021501 3300005614 Bacteria 6270
125 Ga0068856_100048263 3300005614 Bacteria 4195
126 Ga0068856_100050783 3300005614 Bacteria 4089
127 Ga0068856_100059333 3300005614 Bacteria 3780
128 Ga0068856_100075876 3300005614 Bacteria 3330
129 Ga0068852_100003564 3300005616 Bacteria 10894
130 Ga0068852_100004932 3300005616 Bacteria 9476
131 Ga0068852_100012575 3300005616 Bacteria 6431
132 Ga0068852_100018498 3300005616 Bacteria 5490
133 Ga0068859_100038929 3300005617 Bacteria 4769
134 Ga0068859_100040981 3300005617 Bacteria 4652
135 Ga0068863_100004411 3300005841 Bacteria 13874
136 Ga0068863_100286023 3300005841 Bacteria 1598
137 Ga0068858_100007783 3300005842 Bacteria 10346
138 Ga0068858_100332056 3300005842 Bacteria 1454
139 Ga0068858_100345905 3300005842 Bacteria 1424
140 Ga0068860_100000147 3300005843 Bacteria 115672
141 Ga0068860_100036957 3300005843 Bacteria 4676
142 Ga0068860_100155896 3300005843 Bacteria 2201
143 Ga0081455_10000707 3300005937 Bacteria 43296
144 Ga0081455_10001850 3300005937 Bacteria 25469
145 Ga0081455_10003642 3300005937 Bacteria 17650
146 Ga0081455_10010780 3300005937 Bacteria 9236
147 Ga0081455_10014432 3300005937 Bacteria 7744
148 Ga0081455_10031924 3300005937 Bacteria 4754
149 Ga0081538_10000484 3300005981 Bacteria 44674
150 Ga0081538_10007819 3300005981 Bacteria 9176
151 Ga0081538_10012023 3300005981 Bacteria 6970
152 Ga0081540_1000281 3300005983 Bacteria 52990
153 Ga0081540_1015203 3300005983 Bacteria 4883
154 Ga0081540_1028893 3300005983 Bacteria 3102
155 Ga0081539_10002042 3300005985 Bacteria 30343
156 Ga0081539_10004424 3300005985 Bacteria 15535
157 Ga0081539_10005465 3300005985 Bacteria 12954
158 Ga0081539_10042018 3300005985 Bacteria 2666
159 Ga0070717_10137915 3300006028 Bacteria 2102
160 Ga0075365_10034624 3300006038 Bacteria 3262
161 Ga0075365_10176115 3300006038 Bacteria 1494
162 Ga0075365_10196654 3300006038 Bacteria 1412
163 Ga0070715_10095106 3300006163 Bacteria 1379
164 Ga0075362_10002045 3300006177 Bacteria 6653
165 Ga0075362_10126965 3300006177 Bacteria 1211
166 Ga0075367_10001439 3300006178 Bacteria 10224
167 Ga0075367_10171237 3300006178 Bacteria 1352
168 Ga0075369_10018646 3300006186 Bacteria 2827
169 Ga0075369_10059993 3300006186 Bacteria 1658
170 Ga0075366_10003714 3300006195 Bacteria 8107
171 Ga0075366_10054447 3300006195 Bacteria 2376
172 Ga0097621_100000790 3300006237 Bacteria 22260
173 Ga0097621_100015101 3300006237 Bacteria 5800
174 Ga0097621_100057962 3300006237 Bacteria 3169
175 Ga0068871_100017420 3300006358 Bacteria 5437
176 Ga0068871_100049086 3300006358 Bacteria 3410
177 Ga0068871_100053152 3300006358 Bacteria 3282
178 Ga0068871_100138513 3300006358 Bacteria 2068
179 Ga0068871_100168275 3300006358 Bacteria 1877
180 Ga0075430_100149231 3300006846 Bacteria 1947
181 Ga0075430_100229074 3300006846 Bacteria 1541
182 Ga0075431_100032872 3300006847 Bacteria 5346
183 Ga0075431_100044294 3300006847 Bacteria 4590
184 Ga0075431_100318918 3300006847 Bacteria 1567
185 Ga0075434_100311743 3300006871 Bacteria 1594
186 Ga0075429_100017118 3300006880 Bacteria 6268
187 Ga0075429_100177448 3300006880 Bacteria 1867
188 Ga0068865_100000021 3300006881 Bacteria 103137
189 Ga0068865_100029981 3300006881 Bacteria 3614
190 Ga0097620_100038930 3300006931 Bacteria 4769
191 Ga0097620_100040981 3300006931 Bacteria 4652
192 Ga0099794_10133691 3300007265 Unclassified 1254
193 Ga0105240_10003340 3300009093 Bacteria 24982
194 Ga0105240_10003571 3300009093 Bacteria 24129
195 Ga0105240_10005993 3300009093 Bacteria 17972
196 Ga0105240_10008942 3300009093 Bacteria 14243
197 Ga0105240_10025509 3300009093 Bacteria 7766
198 Ga0105240_10086111 3300009093 Bacteria 3848
199 Ga0105240_10094537 3300009093 Bacteria 3645
200 Ga0105240_10235068 3300009093 Unclassified 2127
201 Ga0105240_10236366 3300009093 Bacteria 2120
202 Ga0105240_10493162 3300009093 Bacteria 1363
203 Ga0111539_10007055 3300009094 Bacteria 14411
204 Ga0111539_10050943 3300009094 Bacteria 4932
205 Ga0111539_10082204 3300009094 Bacteria 3788
206 Ga0111539_10109421 3300009094 Bacteria 3243
207 Ga0111539_10149798 3300009094 Bacteria 2731
208 Ga0111539_10210282 3300009094 Bacteria 2267
209 Ga0111539_10374882 3300009094 Bacteria 1657
210 Ga0105245_10003301 3300009098 Bacteria 14485
211 Ga0105245_10186517 3300009098 Bacteria 1985
212 Ga0105247_10140655 3300009101 Bacteria 1581
213 Ga0114129_10088169 3300009147 Bacteria 4302
214 Ga0105243_10001112 3300009148 Bacteria 24427
215 Ga0105243_10046078 3300009148 Bacteria 3428
216 Ga0105243_10166599 3300009148 Bacteria 1905
217 Ga0105242_10005683 3300009176 Bacteria 9626
218 Ga0105242_10027481 3300009176 Bacteria 4518
219 Ga0105242_10163228 3300009176 Bacteria 1952
220 Ga0105242_10524473 3300009176 Bacteria 1131
221 Ga0105248_10029611 3300009177 Bacteria 6108
222 Ga0105248_10051768 3300009177 Bacteria 4607
223 Ga0105248_10079115 3300009177 Bacteria 3695
224 Ga0105248_10196134 3300009177 Bacteria 2275
225 Ga0105248_10211825 3300009177 Bacteria 2183
226 Ga0105248_10571914 3300009177 Bacteria 1275
227 Ga0105237_10025150 3300009545 Bacteria 6090
228 Ga0105238_10029872 3300009551 Bacteria 5549
229 Ga0105238_10035203 3300009551 Bacteria 5092
230 Ga0105249_10000090 3300009553 Bacteria 127963
231 Ga0105249_10064900 3300009553 Bacteria 3357
232 Ga0105249_10107888 3300009553 Bacteria 2628
233 Ga0105249_10341298 3300009553 Bacteria 1515
234 Ga0105239_10002103 3300010375 Bacteria 25743
235 Ga0105239_10009527 3300010375 Bacteria 10931
236 Ga0105239_10072996 3300010375 Bacteria 3773
237 Ga0105246_10004310 3300011119 Bacteria 8653
238 Ga0105246_10028187 3300011119 Bacteria 3687
239 Ga0157373_10072834 3300013100 Bacteria 2425
240 Ga0157370_10007123 3300013104 Bacteria 12201
241 Ga0157370_10077981 3300013104 Bacteria 3120
242 Ga0157370_10101939 3300013104 Bacteria 2688
243 Ga0157370_10109590 3300013104 Bacteria 2581
244 Ga0157370_10391901 3300013104 Unclassified 1279
245 Ga0157369_10001951 3300013105 Bacteria 24849
246 Ga0157369_10006254 3300013105 Bacteria 13819
247 Ga0157369_10220736 3300013105 Bacteria 1984
248 Ga0157369_10415753 3300013105 Bacteria 1394
249 Ga0157369_10446926 3300013105 Bacteria 1339
250 Ga0157374_10007766 3300013296 Bacteria 9154
251 Ga0157374_10016092 3300013296 Bacteria 6571
252 Ga0157374_10258264 3300013296 Bacteria 1715
253 Ga0157378_10000702 3300013297 Bacteria 31331
254 Ga0157378_10002783 3300013297 Bacteria 15589
255 Ga0157378_10003705 3300013297 Bacteria 13557
256 Ga0163162_10606432 3300013306 Bacteria 1221
257 Ga0163162_11242027 3300013306 Bacteria 846
258 Ga0157372_10023313 3300013307 Bacteria 6708
259 Ga0157372_10032896 3300013307 Bacteria 5690
260 Ga0157372_10213207 3300013307 Bacteria 2238
261 Ga0157375_10001073 3300013308 Bacteria 23687
262 Ga0157375_10770632 3300013308 Bacteria 1112
263 Ga0163163_10051003 3300014325 Bacteria 4078
264 Ga0163163_10070914 3300014325 Bacteria 3471
265 Ga0163163_10075367 3300014325 Bacteria 3367
266 Ga0163163_10106053 3300014325 Bacteria 2836
267 Ga0163163_10188046 3300014325 Bacteria 2113
268 Ga0163163_10363751 3300014325 Bacteria 1503
269 Ga0157377_10010953 3300014745 Bacteria 4508
270 Ga0157377_10030377 3300014745 Bacteria 2927
271 Ga0157377_10170477 3300014745 Bacteria 1361
272 Ga0157379_10321410 3300014968 Bacteria 1413
273 Ga0157376_10000078 3300014969 Bacteria 72879
274 Ga0157376_10025465 3300014969 Bacteria 4660
275 Ga0157376_10125891 3300014969 Bacteria 2279
276 Ga0182006_1017252 3300015261 Bacteria 3069
277 Ga0182006_1072260 3300015261 Bacteria 1276
278 Ga0182007_10035208 3300015262 Bacteria 1688
279 Ga0182005_1030528 3300015265 Bacteria 1468
280 Ga0163161_10190292 3300017792 Bacteria 1577
281 Ga0206353_10402294 3300020082 Bacteria 4841
282 Ga0206353_11402362 3300020082 Bacteria 1952
283 Ga0206353_11421135 3300020082 Bacteria 1367
284 Ga0213873_10000004 3300021358 Bacteria 774374
285 Ga0213872_10000008 3300021361 Bacteria 226283
286 Ga0213872_10000079 3300021361 Bacteria 89092
287 Ga0213874_10015475 3300021377 Bacteria 2013
288 Ga0213876_10000007 3300021384 Bacteria 670340
289 Ga0213876_10000555 3300021384 Bacteria 27950
290 Ga0213876_10003528 3300021384 Bacteria 8921
291 Ga0213876_10059302 3300021384 Bacteria 2020
292 Ga0213875_10002705 3300021388 Bacteria 10470
293 Ga0213875_10009086 3300021388 Bacteria 5050
294 Ga0213875_10023369 3300021388 Bacteria 2952
295 Ga0228598_1002491 3300024227 Unclassified 4009
296 Ga0209784_100210 3300025224 Bacteria 40823
297 Ga0209566_100295 3300025225 Bacteria 45189
298 Ga0209566_100813 3300025225 Bacteria 16057
299 Ga0209672_100062 3300025228 Bacteria 204912
300 Ga0209672_100105 3300025228 Bacteria 102667
301 Ga0209147_100012 3300025229 Bacteria 681990
302 Ga0209147_100078 3300025229 Bacteria 204912
303 Ga0209147_100145 3300025229 Bacteria 106552
304 Ga0209147_100204 3300025229 Bacteria 64495
305 Ga0209258_100107 3300025242 Bacteria 206572
306 Ga0209258_100108 3300025242 Bacteria 204912
307 Ga0209148_1000022 3300025254 Bacteria 681990
308 Ga0209148_1001178 3300025254 Bacteria 15050
309 Ga0209148_1001231 3300025254 Bacteria 14363
310 Ga0209455_1000024 3300025272 Bacteria 676133
311 Ga0209455_1000383 3300025272 Bacteria 39626
312 Ga0209455_1001254 3300025272 Bacteria 11922
313 Ga0209673_1000026 3300025273 Bacteria 373739
314 Ga0209564_1007061 3300025295 Bacteria 5880
315 Ga0207697_10000243 3300025315 Bacteria 29799
316 Ga0207692_10000003 3300025898 Bacteria 431531
317 Ga0207642_10081502 3300025899 Bacteria 1573
318 Ga0207688_10001364 3300025901 Bacteria 12684
319 Ga0207647_10010091 3300025904 Bacteria 6680
320 Ga0207699_10003733 3300025906 Bacteria 7275
321 Ga0207645_10002373 3300025907 Bacteria 14850
322 Ga0207643_10120115 3300025908 Bacteria 1556
323 Ga0207705_10005553 3300025909 Bacteria 9428
324 Ga0207705_10073631 3300025909 Bacteria 2478
325 Ga0207705_10077733 3300025909 Bacteria 2414
326 Ga0207705_10108705 3300025909 Bacteria 2047
327 Ga0207684_10042655 3300025910 Bacteria 3847
328 Ga0207684_10076985 3300025910 Bacteria 2836
329 Ga0207707_10003121 3300025912 Bacteria 14712
330 Ga0207707_10020251 3300025912 Bacteria 5807
331 Ga0207707_10029292 3300025912 Bacteria 4813
332 Ga0207707_10045352 3300025912 Bacteria 3831
333 Ga0207707_10046940 3300025912 Bacteria 3762
334 Ga0207695_10000205 3300025913 Bacteria 162702
335 Ga0207695_10006943 3300025913 Bacteria 14539
336 Ga0207695_10030945 3300025913 Bacteria 5884
337 Ga0207695_10041182 3300025913 Bacteria 4945
338 Ga0207695_10082876 3300025913 Bacteria 3241
339 Ga0207695_10146371 3300025913 Unclassified 2306
340 Ga0207695_10147947 3300025913 Bacteria 2290
341 Ga0207695_10165399 3300025913 Bacteria 2141
342 Ga0207695_10170406 3300025913 Bacteria 2103
343 Ga0207695_10326089 3300025913 Bacteria 1424
344 Ga0207671_10113764 3300025914 Bacteria 2062
345 Ga0207660_10008792 3300025917 Bacteria 6529
346 Ga0207660_10033479 3300025917 Bacteria 3555
347 Ga0207660_10060286 3300025917 Bacteria 2727
348 Ga0207662_10004173 3300025918 Bacteria 7568
349 Ga0207662_10189833 3300025918 Bacteria 1325
350 Ga0207657_10000053 3300025919 Bacteria 107963
351 Ga0207657_10004491 3300025919 Bacteria 14748
352 Ga0207657_10009720 3300025919 Bacteria 9645
353 Ga0207657_10056371 3300025919 Bacteria 3391
354 Ga0207649_10015628 3300025920 Bacteria 4263
355 Ga0207649_10103251 3300025920 Bacteria 1891
356 Ga0207652_10082324 3300025921 Bacteria 2816
357 Ga0207652_10095758 3300025921 Bacteria 2615
358 Ga0207652_10233970 3300025921 Bacteria 1656
359 Ga0207652_10273568 3300025921 Bacteria 1523
360 Ga0207646_10009412 3300025922 Bacteria 9655
361 Ga0207646_10020234 3300025922 Bacteria 6168
362 Ga0207694_10043711 3300025924 Bacteria 3458
363 Ga0207694_10193313 3300025924 Bacteria 1654
364 Ga0207694_10205747 3300025924 Unclassified 1602
365 Ga0207650_10119299 3300025925 Bacteria 2051
366 Ga0207650_10314795 3300025925 Bacteria 1281
367 Ga0207659_10000241 3300025926 Bacteria 33277
368 Ga0207659_10058429 3300025926 Bacteria 2769
369 Ga0207687_10000683 3300025927 Bacteria 22873
370 Ga0207700_10152025 3300025928 Bacteria 1914
371 Ga0207664_10017879 3300025929 Bacteria 5208
372 Ga0207644_10012241 3300025931 Bacteria 5696
373 Ga0207690_10000009 3300025932 Bacteria 366044
374 Ga0207690_10000057 3300025932 Bacteria 100648
375 Ga0207690_10008222 3300025932 Bacteria 6189
376 Ga0207690_10048246 3300025932 Bacteria 2830
377 Ga0207706_10021245 3300025933 Bacteria 5831
378 Ga0207686_10006604 3300025934 Bacteria 6251
379 Ga0207686_10007103 3300025934 Bacteria 6025
380 Ga0207709_10000118 3300025935 Bacteria 122125
381 Ga0207709_10100927 3300025935 Bacteria 1908
382 Ga0207704_10000027 3300025938 Bacteria 122372
383 Ga0207704_10091173 3300025938 Bacteria 2002
384 Ga0207691_10185734 3300025940 Bacteria 1815
385 Ga0207711_10096398 3300025941 Bacteria 2610
386 Ga0207711_10112623 3300025941 Unclassified 2422
387 Ga0207689_10000309 3300025942 Bacteria 44940
388 Ga0207689_10006387 3300025942 Bacteria 10435
389 Ga0207661_10000599 3300025944 Bacteria 22999
390 Ga0207661_10274397 3300025944 Bacteria 1505
391 Ga0207661_10340584 3300025944 Bacteria 1351
392 Ga0207679_10124810 3300025945 Bacteria 2056
393 Ga0207667_10014344 3300025949 Bacteria 9038
394 Ga0207667_10028283 3300025949 Bacteria 6090
395 Ga0207667_10113171 3300025949 Bacteria 2798
396 Ga0207667_10159436 3300025949 Bacteria 2321
397 Ga0207667_10509630 3300025949 Bacteria 1220
398 Ga0207651_10000016 3300025960 Bacteria 122094
399 Ga0207712_10000903 3300025961 Bacteria 21480
400 Ga0207712_10035255 3300025961 Bacteria 3397
401 Ga0207668_10151910 3300025972 Bacteria 1794
402 Ga0207658_10014726 3300025986 Bacteria 5359
403 Ga0207677_10000171 3300026023 Bacteria 51383
404 Ga0207703_10005310 3300026035 Bacteria 10383
405 Ga0207703_10404848 3300026035 Bacteria 1267
406 Ga0207639_10024134 3300026041 Bacteria 4397
407 Ga0207678_10009219 3300026067 Bacteria 8684
408 Ga0207678_10016820 3300026067 Bacteria 6423
409 Ga0207708_10000047 3300026075 Bacteria 115550
410 Ga0207708_10030220 3300026075 Bacteria 4109
411 Ga0207702_10009858 3300026078 Bacteria 8006
412 Ga0207702_10059276 3300026078 Bacteria 3260
413 Ga0207702_10087599 3300026078 Bacteria 2718
414 Ga0207702_10097825 3300026078 Bacteria 2583
415 Ga0207641_10003377 3300026088 Bacteria 14176
416 Ga0207641_10079686 3300026088 Bacteria 2840
417 Ga0207648_10000116 3300026089 Bacteria 77755
418 Ga0207648_10009228 3300026089 Bacteria 9475
419 Ga0207674_10120923 3300026116 Bacteria 2586
420 Ga0207675_100016103 3300026118 Bacteria 6984
421 Ga0207683_10027190 3300026121 Bacteria 4943
422 Ga0207683_10145779 3300026121 Bacteria 2135
423 Ga0207683_10338914 3300026121 Bacteria 1379
424 Ga0207698_10006545 3300026142 Bacteria 7279
425 Ga0207698_10015498 3300026142 Bacteria 5105
426 Ga0207698_10028826 3300026142 Bacteria 3965
427 Ga0207698_10281730 3300026142 Bacteria 1538
428 Ga0209371_1000195 3300027312 Bacteria 89403
429 Ga0209371_1000467 3300027312 Bacteria 39808
430 Ga0209371_1006068 3300027312 Bacteria 4591
431 Ga0207428_10167670 3300027907 Bacteria 1664
432 Ga0268266_10000924 3300028379 Bacteria 37565
433 Ga0268266_10001659 3300028379 Bacteria 25701
434 Ga0268266_10003855 3300028379 Bacteria 14632
435 Ga0268266_10005825 3300028379 Bacteria 11403
436 Ga0268266_10046783 3300028379 Bacteria 3704
437 Ga0268266_10066384 3300028379 Bacteria 3120
438 Ga0268266_10261282 3300028379 Bacteria 1605
439 Ga0268265_10456974 3300028380 Bacteria 1194
440 Ga0268264_10000033 3300028381 Bacteria 404123
441 Ga0268264_10000138 3300028381 Bacteria 172597
442 Ga0268264_10011411 3300028381 Bacteria 7340
443 Ga0268264_10039433 3300028381 Bacteria 3903
444 Ga0268264_10138104 3300028381 Bacteria 2170
445 Ga0265337_1000126 3300028556 Bacteria 38633
446 Ga0265326_10000144 3300028558 Bacteria 37151
447 Ga0265319_1034801 3300028563 Bacteria 1731
448 Ga0265334_10014951 3300028573 Bacteria 3230
449 Ga0265322_10000009 3300028654 Bacteria 170768
450 Ga0307515_10000066 3300028794 Bacteria 244076
451 Ga0265338_10014175 3300028800 Bacteria 8906
452 Ga0265338_10049640 3300028800 Bacteria 3801
453 Ga0265338_10079466 3300028800 Bacteria 2760
454 Ga0265324_10000389 3300029957 Bacteria 31898
455 Ga0268256_1000168 3300030500 Bacteria 81587
456 Ga0268256_1000566 3300030500 Bacteria 29863
457 Ga0268256_1001844 3300030500 Bacteria 11807
458 Ga0265760_10004349 3300031090 Unclassified 4067
459 Ga0265330_10051908 3300031235 Bacteria 1797
460 Ga0265332_10008765 3300031238 Bacteria 4530
461 Ga0265328_10003668 3300031239 Bacteria 6766
462 Ga0265320_10000024 3300031240 Bacteria 170768
463 Ga0265320_10041151 3300031240 Bacteria 2299
464 Ga0265329_10002956 3300031242 Bacteria 7560
465 Ga0265340_10018544 3300031247 Bacteria 3589
466 Ga0265339_10011561 3300031249 Bacteria 5426
467 Ga0265339_10021505 3300031249 Bacteria 3751
468 Ga0265331_10000894 3300031250 Bacteria 24175
469 Ga0265331_10006208 3300031250 Bacteria 7091
470 Ga0265327_10000227 3300031251 Bacteria 114777
471 Ga0307513_10000017 3300031456 Bacteria 282386
472 Ga0307509_10071000 3300031507 Bacteria 3634
473 Ga0307408_100000028 3300031548 Bacteria 233440
474 Ga0265313_10000079 3300031595 Bacteria 95515
475 Ga0265314_10000570 3300031711 Bacteria 46890
476 Ga0265314_10033616 3300031711 Bacteria 3756
477 Ga0265314_10162660 3300031711 Bacteria 1356
478 Ga0307516_10005910 3300031730 Bacteria 14486
479 Ga0307410_10293254 3300031852 Bacteria 1281
480 Ga0307410_10361999 3300031852 Bacteria 1162
481 Ga0307406_10002397 3300031901 Bacteria 10188
482 Ga0307406_10024232 3300031901 Bacteria 3622
483 Ga0307406_10150143 3300031901 Bacteria 1661
484 Ga0307407_10000744 3300031903 Bacteria 10678
485 Ga0307407_10174488 3300031903 Bacteria 1419
486 Ga0307412_10004845 3300031911 Bacteria 7509
487 Ga0307412_10271217 3300031911 Bacteria 1328
488 Ga0307409_100024328 3300031995 Bacteria 4222
489 Ga0307409_100035351 3300031995 Bacteria 3661
490 Ga0307409_100161087 3300031995 Bacteria 1962
491 Ga0307409_100368405 3300031995 Bacteria 1361
492 Ga0307416_100003103 3300032002 Bacteria 9724
493 Ga0307414_10002550 3300032004 Bacteria 9575
494 Ga0307411_10243318 3300032005 Bacteria 1410
495 Ga0307415_100081996 3300032126 Bacteria 2306
496 Ga0373926_0028143 3300035083 Bacteria 1972
497 Ga0373926_0061881 3300035083 Bacteria 1366
498 Ga0373923_0001712 3300035111 Unclassified 6439
499 Ga0373932_0056766 3300035112 Bacteria 1178
500 Ga0373945_0009684 3300035116 Bacteria 3161
501 Ga0373954_0078404 3300035118 Unclassified 1576
502 Ga0373960_0004844 3300035121 Bacteria 3099
503 Ga0373943_0004078 3300035170 Bacteria 6630
504 Ga0373946_0004504 3300035171 Bacteria 4991
505 Ga0373955_0006678 3300035172 Bacteria 5264
506 Ga0373955_0053770 3300035172 Bacteria 2200
507 Ga0373962_0054469 3300035242 Bacteria 1160
508 Ga0373924_0125186 3300035410 Bacteria 1117
509 Ga0373931_0035941 3300035691 Bacteria 2579
510 Ga0373935_0017397 3300035692 Bacteria 4361
511 Ga0373927_0016957 3300035695 Bacteria 4800
512 Ga0373927_0023943 3300035695 Bacteria 3994
513 Ga0373927_0094995 3300035695 Unclassified 1937
514 Ga0373937_0056926 3300036401 Unclassified 3590
515 Ga0373937_0283051 3300036401 Unclassified 1566
516 Ga0373937_0423310 3300036401 Bacteria 1264
517 Ga0373925_0009583 3300037068 Bacteria 7057
518 Ga0373925_0336624 3300037068 Bacteria 1223
519 Ga0395899_0001048 3300037312 Bacteria 25043
520 Ga0395899_0024104 3300037312 Bacteria 4603
521 Ga0395899_0053532 3300037312 Bacteria 2988
522 Ga0395900_0003285 3300037418 Bacteria 17503
523 Ga0395900_0005953 3300037418 Bacteria 12733
524 Ga0395900_0010110 3300037418 Bacteria 9649
525 Ga0395900_0082924 3300037418 Bacteria 3294
526 Ga0395900_0107609 3300037418 Bacteria 2864
527 Ga0395898_0025658 3300037466 Bacteria 5936
528 Ga0395898_0040821 3300037466 Bacteria 4586
529 Ga0395898_0268242 3300037466 Bacteria 1628
530 Ga0395905_0101742 3300037471 Bacteria 2697
531 Ga0436364_0409699 3300037853 Bacteria 3757
532 Ga0436364_0527107 3300037853 Bacteria 72365
533 Ga0436364_0857265 3300037853 Bacteria 7664
534 Ga0436364_1548394 3300037853 Bacteria 98245
535 Ga0395901_0001587 3300038443 Bacteria 23512
536 Ga0395901_0004093 3300038443 Bacteria 14696
537 Ga0395901_0028392 3300038443 Bacteria 5753
538 Ga0436365_0212021 3300039437 Bacteria 9772
539 Ga0436365_0394061 3300039437 Bacteria 142715
540 Ga0436365_0787653 3300039437 Bacteria 18550
541 Ga0436365_1011053 3300039437 Bacteria 25340
542 Ga0436365_1308047 3300039437 Bacteria 1178
543 Ga0436365_1609485 3300039437 Bacteria 2317
544 Ga0436365_1612362 3300039437 Bacteria 3356
545 Ga0436365_1647369 3300039437 Bacteria 25384
546 Ga0436360_0422338 3300039438 Bacteria 46106
547 Ga0436361_0296121 3300039447 Bacteria 160237
548 Ga0436361_0400659 3300039447 Bacteria 7945
549 Ga0436361_0757401 3300039447 Bacteria 49858
550 Ga0436363_0587086 3300039450 Bacteria 17071
551 Ga0436363_0654378 3300039450 Unclassified 4718
552 Ga0436363_1583874 3300039450 Bacteria 34394
553 Ga0436362_0290430 3300039453 Bacteria 772596
554 Ga0436362_0871163 3300039453 Bacteria 15371
555 Ga0439466_0001763 3300041411 Bacteria 8467
556 Ga0439462_0035591 3300042015 Bacteria 1324
557 Ga0439440_0011036 3300042993 Bacteria 1900
558 Ga0453683_0003525 3300044673 Bacteria 11503
559 Ga0466966_0037442 3300044684 Bacteria 3129
560 Ga0466961_0037790 3300044693 Bacteria 3097
561 Ga0466961_0054521 3300044693 Bacteria 2550
562 Ga0466970_0016305 3300044765 Bacteria 3827
563 Ga0466970_0028875 3300044765 Bacteria 2917
564 Ga0466960_0016166 3300044901 Bacteria 3232
565 Ga0466959_0077474 3300045049 Bacteria 2399
566 Ga0466959_0143372 3300045049 Bacteria 1687
567 Ga0466959_0164722 3300045049 Unclassified 1557
568 Ga0451576_0036904 3300045051 Bacteria 5178
569 Ga0451576_0451197 3300045051 Bacteria 1350
570 Ga0466958_0005932 3300045836 Bacteria 6604
571 Ga0466958_0023519 3300045836 Bacteria 3618
572 Ga0466967_0000343 3300045976 Bacteria 21442
573 Ga0466967_0037977 3300045976 Bacteria 4127
574 Ga0466967_0059951 3300045976 Bacteria 3370
575 Ga0466967_0098084 3300045976 Bacteria 2675
576 Ga0466967_0109220 3300045976 Bacteria 2539
577 Ga0466967_0380273 3300045976 Bacteria 1371
578 Ga0495592_0015796 3300046454 Bacteria 5728
579 Ga0495629_0047601 3300046459 Bacteria 3008
580 Ga0495641_0000458 3300046461 Bacteria 33934
581 Ga0495651_0005707 3300046462 Bacteria 9485
582 Ga0495653_0005801 3300046463 Bacteria 10102
583 Ga0495653_0009609 3300046463 Unclassified 7910
584 Ga0495580_0007926 3300046472 Bacteria 8496
585 Ga0495580_0071886 3300046472 Bacteria 2417
586 Ga0495580_0126661 3300046472 Bacteria 1772
587 Ga0495582_0187513 3300046473 Bacteria 1179
588 Ga0495639_0126262 3300046475 Bacteria 1223
589 Ga0495664_0015717 3300046477 Unclassified 4307
590 Ga0495594_0000017 3300046499 Bacteria 88992
591 Ga0495596_0125383 3300046500 Bacteria 997
592 Ga0495608_0034078 3300046511 Bacteria 3438
593 Ga0495620_0002096 3300046515 Bacteria 11595
594 Ga0495628_0000081 3300046516 Bacteria 74176
595 Ga0495628_0010519 3300046516 Bacteria 7854
596 Ga0495628_0082803 3300046516 Unclassified 2492
597 Ga0495628_0169594 3300046516 Bacteria 1655
598 Ga0495630_0028903 3300046517 Bacteria 4120
599 Ga0495630_0039449 3300046517 Bacteria 3530
600 Ga0495630_0146635 3300046517 Bacteria 1795
601 Ga0495630_0347018 3300046517 Bacteria 1136
602 Ga0495631_0031811 3300046518 Bacteria 2381
603 Ga0495644_0010665 3300046523 Bacteria 3539
604 Ga0495652_0000022 3300046529 Bacteria 178368
605 Ga0495652_0010794 3300046529 Bacteria 8280
606 Ga0495652_0040858 3300046529 Unclassified 4008
607 Ga0495640_0038820 3300046533 Viruses 3347
608 Ga0495640_0121907 3300046533 Bacteria 1694
609 Ga0495586_0002941 3300046535 Bacteria 9187
610 Ga0495586_0039939 3300046535 Unclassified 2523
611 Ga0495586_0203984 3300046535 Bacteria 1121
612 Ga0495587_0000812 3300046536 Bacteria 20799
613 Ga0495587_0033679 3300046536 Bacteria 3091
614 Ga0495587_0050817 3300046536 Bacteria 2453
615 Ga0495645_0000098 3300046543 Bacteria 59944
616 Ga0495645_0015934 3300046543 Viruses 5356
617 Ga0495645_0108093 3300046543 Unclassified 1971
618 Ga0495645_0133399 3300046543 Bacteria 1738
619 Ga0495622_0000057 3300046557 Bacteria 97942
620 Ga0495667_0071630 3300046559 Bacteria 2260
621 Ga0495656_0092122 3300046615 Bacteria 1388
622 Ga0495634_0039730 3300046642 Bacteria 3203
623 Ga0495635_0110175 3300046663 Bacteria 1881
624 Ga0495588_0115021 3300046674 Bacteria 1418
625 Ga0495657_0015602 3300046675 Bacteria 5552
626 Ga0495657_0059077 3300046675 Bacteria 2545
627 Ga0495657_0140290 3300046675 Bacteria 1507
628 Ga0495646_0003444 3300046680 Bacteria 9846
629 Ga0495669_0024665 3300046684 Bacteria 2619
630 Ga0495613_0000397 3300046689 Bacteria 37243
631 Ga0495613_0104714 3300046689 Bacteria 2043
632 Ga0495613_0252322 3300046689 Bacteria 1231
633 Ga0495613_0287868 3300046689 Bacteria 1140
634 Ga0495624_0011138 3300046690 Unclassified 6186
635 Ga0495604_0012072 3300047317 Bacteria 6869
636 Ga0495604_0026503 3300047317 Bacteria 4614
637 Ga0495674_0003091 3300047319 Bacteria 16177
638 Ga0495674_0009954 3300047319 Bacteria 9016
639 Ga0495674_0053462 3300047319 Bacteria 3550
640 Ga0495674_0111298 3300047319 Bacteria 2321
641 Ga0495672_0024603 3300047320 Bacteria 3875
642 Ga0495680_0000426 3300047322 Bacteria 47283
643 Ga0495680_0001560 3300047322 Bacteria 24536
644 Ga0495680_0068338 3300047322 Bacteria 2715
645 Ga0495675_0000394 3300047444 Bacteria 30207
646 Ga0495675_0002656 3300047444 Bacteria 10709
647 Ga0495675_0013384 3300047444 Bacteria 5178
648 Ga0495675_0063195 3300047444 Bacteria 2343
649 Ga0495673_0051127 3300047469 Bacteria 1811
650 Ga0495684_0000431 3300047471 Bacteria 34259
651 Ga0495684_0002041 3300047471 Bacteria 16252
652 Ga0495684_0014397 3300047471 Viruses 6086
653 Ga0495686_0000011 3300047472 Bacteria 514750
654 Ga0495686_0042204 3300047472 Bacteria 2902
655 Ga0495593_0009498 3300047673 Unclassified 5643
656 Ga0495602_0012580 3300048088 Bacteria 8686
657 Ga0495602_0150086 3300048088 Unclassified 1833
658 Ga0495602_0166364 3300048088 Bacteria 1716
659 Ga0496100_0006847 3300048903 Bacteria 6244
660 Ga0496101_0002546 3300048904 Bacteria 11181
661 Ga0496102_0028527 3300048905 Bacteria 4986
662 Ga0496102_0047822 3300048905 Bacteria 3889
663 Ga0496102_0114885 3300048905 Bacteria 2512
664 Ga0496105_0089133 3300048908 Bacteria 2548
665 Ga0496105_0095898 3300048908 Bacteria 2450
666 Ga0496106_0045863 3300048909 Bacteria 3285
667 Ga0496107_0108611 3300048910 Bacteria 2038
668 Ga0496108_0153329 3300048911 Bacteria 1989
669 Ga0496109_0001274 3300048912 Bacteria 20900
670 Ga0496109_0002595 3300048912 Bacteria 15136
671 Ga0496109_0024472 3300048912 Bacteria 5369
672 Ga0496110_0006769 3300048913 Bacteria 9117
673 Ga0496110_0063311 3300048913 Bacteria 3268
674 Ga0496110_0109984 3300048913 Bacteria 2475
675 Ga0496110_0396896 3300048913 Bacteria 1257
676 Ga0496111_0032964 3300048914 Bacteria 3694
677 Ga0496112_0035906 3300048915 Bacteria 4831
678 Ga0496112_0050315 3300048915 Bacteria 4086
679 Ga0496112_0067609 3300048915 Bacteria 3527
680 Ga0496112_0168670 3300048915 Bacteria 2155
681 Ga0496113_0092541 3300048916 Bacteria 2332
682 Ga0496114_0003080 3300048917 Bacteria 12777
683 Ga0496115_0356377 3300048918 Bacteria 1193
684 Ga0496117_0004162 3300048920 Bacteria 16171
685 Ga0496117_0020188 3300048920 Bacteria 5442
686 Ga0496118_0000450 3300048921 Bacteria 68053
687 Ga0496118_0024273 3300048921 Bacteria 5241
688 Ga0496119_0148347 3300048922 Bacteria 1259
689 Ga0496121_0005238 3300048924 Bacteria 16778
690 Ga0496121_0178875 3300048924 Bacteria 1533
691 Ga0496122_0026111 3300048925 Bacteria 5050
692 Ga0496123_0036090 3300048926 Bacteria 3512
693 Ga0496124_0000070 3300048927 Bacteria 220875
694 Ga0496124_0000355 3300048927 Bacteria 83748
695 Ga0496124_0006021 3300048927 Bacteria 13370
696 Ga0501031_0210726 3300049568 Bacteria 1266
697 Ga0501034_0001852 3300049571 Bacteria 26847
698 Ga0501034_0002374 3300049571 Bacteria 22862
699 Ga0501034_0132419 3300049571 Bacteria 2476
700 Ga0501036_0049412 3300049572 Bacteria 3562
701 Ga0501036_0234452 3300049572 Bacteria 1540
702 Ga0501039_0055354 3300049575 Bacteria 3072
703 Ga0501039_0062195 3300049575 Bacteria 2892
704 Ga0501040_0081832 3300049576 Bacteria 2238
705 Ga0501040_0168003 3300049576 Bacteria 1552
706 Ga0501040_0213159 3300049576 Bacteria 1373
707 Ga0501041_0022365 3300049577 Bacteria 3785
708 Ga0501041_0162333 3300049577 Bacteria 1397
709 Ga0501041_0217069 3300049577 Bacteria 1200
710 Ga0501047_0088218 3300049581 Bacteria 2979
711 Ga0501047_0159791 3300049581 Bacteria 2125
712 Ga0501047_0260409 3300049581 Bacteria 1582
713 Ga0501048_0030175 3300049582 Bacteria 3925
714 Ga0501048_0091121 3300049582 Bacteria 2151
715 Ga0501048_0147367 3300049582 Bacteria 1665
716 Ga0501068_0058162 3300049584 Bacteria 2345
717 Ga0501070_0000493 3300049586 Bacteria 35853
718 Ga0501070_0124471 3300049586 Bacteria 2131
719 Ga0501071_0020975 3300049587 Bacteria 4548
720 Ga0501072_0094503 3300049588 Bacteria 2375
721 Ga0501072_0205028 3300049588 Bacteria 1572
722 Ga0501074_0200833 3300049590 Bacteria 1421
723 Ga0501075_0104920 3300049591 Bacteria 2148
724 Ga0501075_0166588 3300049591 Bacteria 1681
725 Ga0501075_0179050 3300049591 Bacteria 1618
726 Ga0501076_0014021 3300049592 Bacteria 6024
727 Ga0501076_0038612 3300049592 Bacteria 3749
728 Ga0501077_0138678 3300049593 Bacteria 1542
729 Ga0501080_0242574 3300049742 Bacteria 1644
730 Ga0501081_0137809 3300049743 Bacteria 1748
731 Ga0501083_0004416 3300049744 Bacteria 9923
732 Ga0501035_0220233 3300049822 Bacteria 1621
733 Ga0501044_0099928 3300049823 Bacteria 2920
734 Ga0501044_0255447 3300049823 Bacteria 1692
735 Ga0501045_0041787 3300049824 Bacteria 3337
736 nmdc:mga03683_11410_c1 3300050489 Bacteria 3217
737 nmdc:mga03683_1905_c1 3300050489 Bacteria 6367
738 nmdc:mga03683_2466_c1 3300050489 Bacteria 5751
739 nmdc:mga03683_26879_c1 3300050489 Bacteria 2274
740 nmdc:mga03683_53201_c1 3300050489 Bacteria 1694
741 nmdc:mga0yw44_151110_c1 3300050492 Bacteria 1515
742 nmdc:mga0yw44_34699_c1 3300050492 Bacteria 2958
743 nmdc:mga0yw44_38717_c1 3300050492 Bacteria 2823
744 nmdc:mga0yw44_43251_c1 3300050492 Bacteria 2688
745 nmdc:mga0k408_3429_c1 3300050493 Bacteria 8394
746 nmdc:mga0k408_64745_c1 3300050493 Bacteria 2127
747 nmdc:mga06z11_113473_c1 3300050494 Bacteria 1503
748 nmdc:mga06z11_3645_c1 3300050494 Bacteria 5977
749 nmdc:mga05p37_29071_c1 3300050507 Bacteria 6746
750 nmdc:mga05p37_7730_c1 3300050507 Bacteria 12689
751 nmdc:mga09592_107672_c1 3300050508 Bacteria 2391
752 nmdc:mga09592_190066_c1 3300050508 Bacteria 1777
753 nmdc:mga09592_281689_c1 3300050508 Bacteria 1442
754 nmdc:mga0qj67_165193_c1 3300050509 Bacteria 1797
755 nmdc:mga0qj67_165418_c1 3300050509 Bacteria 1796
756 nmdc:mga0qj67_294956_c1 3300050509 Bacteria 1314
757 nmdc:mga0qj67_86146_c1 3300050509 Bacteria 2520
758 nmdc:mga06r32_132326_c1 3300050510 Bacteria 2467
759 nmdc:mga06r32_49457_c1 3300050510 Bacteria 4020
760 nmdc:mga08y16_133236_c1 3300050511 Bacteria 2583
761 nmdc:mga08y16_3246_c1 3300050511 Bacteria 16834
762 nmdc:mga08y16_49984_c1 3300050511 Bacteria 4375
763 nmdc:mga0rr50_107084_c1 3300050513 Bacteria 2206
764 nmdc:mga0sz30_86040_c1 3300050516 Bacteria 1364
765 Ga0495601_0046956 3300053077 Bacteria 2718
766 Ga0495612_0102483 3300053078 Bacteria 1220
767 Ga0495595_0058018 3300053084 Bacteria 1807
768 Ga0495595_0064284 3300053084 Bacteria 1724
769 Ga0495595_0107469 3300053084 Bacteria 1351
770 Ga0495619_0009244 3300053085 Bacteria 6227
771 Ga0495619_0037547 3300053085 Bacteria 3157
772 Ga0495619_0062911 3300053085 Bacteria 2471
773 Ga0500644_0079885 3300053088 Bacteria 1200
774 Ga0500641_0014773 3300053096 Bacteria 2885
775 Ga0500616_0013215 3300053153 Bacteria 4804
776 Ga0501084_0122869 3300054114 Bacteria 2184
777 Ga0501084_0292239 3300054114 Bacteria 1376
778 Ga0501084_0383425 3300054114 Bacteria 1188
779 Ga0501082_0296033 3300060353 Bacteria 1409
780 Ga0466962_0017954 3300061719 Bacteria 3404
781 Ga0466962_0070598 3300061719 Bacteria 1669
782 Ga0530510_0058683 3300061734 Bacteria 2783
783 Ga0530510_0180455 3300061734 Bacteria 1565

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_11242027 Ga0163162_112420271 255
2 3300046500 Ga0495596_0125383 Ga0495596_0125383_13_870 276
3 3300031995 Ga0307409_100024328 Ga0307409_1000243284 280
4 3300053078 Ga0495612_0102483 Ga0495612_0102483_299_1195 282
5 3300026067 Ga0207678_10016820 Ga0207678_100168207 283
6 3300031852 Ga0307410_10293254 Ga0307410_102932542 284
7 3300031901 Ga0307406_10150143 Ga0307406_101501432 284
8 3300003203 JGI25406J46586_10006971 JGI25406J46586_100069713 291
9 3300005985 Ga0081539_10002042 Ga0081539_1000204233 291
10 3300006880 Ga0075429_100177448 Ga0075429_1001774482 292
11 3300009094 Ga0111539_10050943 Ga0111539_100509434 292
12 3300020082 Ga0206353_11421135 Ga0206353_114211351 292
13 3300050508 nmdc:mga09592_281689_c1 nmdc:mga09592_281689_c1_142_1149 292
14 3300054114 Ga0501084_0383425 Ga0501084_0383425_237_1166 295
15 3300050492 nmdc:mga0yw44_43251_c1 nmdc:mga0yw44_43251_c1_98_1141 299
16 3300006195 Ga0075366_10003714 Ga0075366_100037147 302
17 3300003751 Ga0055538_1000311 Ga0055538_10003114 304
18 3300025224 Ga0209784_100210 Ga0209784_10021031 304
19 3300005539 Ga0068853_100041546 Ga0068853_1000415463 305
20 3300009094 Ga0111539_10149798 Ga0111539_101497983 305
21 3300026041 Ga0207639_10024134 Ga0207639_100241343 305
22 3300027907 Ga0207428_10167670 Ga0207428_101676703 305
23 3300050511 nmdc:mga08y16_133236_c1 nmdc:mga08y16_133236_c1_629_1636 305
24 3300053085 Ga0495619_0037547 Ga0495619_0037547_1332_2300 307
25 3300032126 Ga0307415_100081996 Ga0307415_1000819962 308
26 iso_pu_bacteria 2974315732 2974316109 308
27 iso_pu_bacteria 2984523437 2984524271 308
28 3300005327 Ga0070658_10162752 Ga0070658_101627522 310
29 3300021388 Ga0213875_10023369 Ga0213875_100233692 310
30 3300025909 Ga0207705_10077733 Ga0207705_100777332 310
31 3300037853 Ga0436364_0527107 Ga0436364_0527107_21232_22269 310
32 3300049577 Ga0501041_0217069 Ga0501041_0217069_11_988 311
33 3300061734 Ga0530510_0058683 Ga0530510_0058683_1490_2467 311
34 3300005329 Ga0070683_100007574 Ga0070683_1000075746 312
35 3300005366 Ga0070659_100187651 Ga0070659_1001876512 312
36 3300005457 Ga0070662_100010643 Ga0070662_1000106434 312
37 3300005530 Ga0070679_100186986 Ga0070679_1001869863 312
38 3300005616 Ga0068852_100003564 Ga0068852_1000035644 312
39 3300005841 Ga0068863_100286023 Ga0068863_1002860232 312
40 3300009176 Ga0105242_10163228 Ga0105242_101632282 312
41 3300009176 Ga0105242_10524473 Ga0105242_105244731 312
42 3300014325 Ga0163163_10188046 Ga0163163_101880463 312
43 3300025921 Ga0207652_10273568 Ga0207652_102735681 312
44 3300025942 Ga0207689_10006387 Ga0207689_100063872 312
45 3300026142 Ga0207698_10006545 Ga0207698_100065455 312
46 3300037853 Ga0436364_0409699 Ga0436364_0409699_338_1393 312
47 3300049576 Ga0501040_0081832 Ga0501040_0081832_382_1410 312
48 3300005441 Ga0070700_100240667 Ga0070700_1002406671 313
49 3300005455 Ga0070663_100204458 Ga0070663_1002044581 313
50 3300009094 Ga0111539_10374882 Ga0111539_103748822 313
51 3300009148 Ga0105243_10046078 Ga0105243_100460782 313
52 3300009553 Ga0105249_10341298 Ga0105249_103412982 313
53 3300010375 Ga0105239_10009527 Ga0105239_1000952711 313
54 3300014325 Ga0163163_10051003 Ga0163163_100510035 313
55 3300014325 Ga0163163_10363751 Ga0163163_103637512 313
56 3300014745 Ga0157377_10030377 Ga0157377_100303773 313
57 3300025972 Ga0207668_10151910 Ga0207668_101519102 313
58 3300026075 Ga0207708_10030220 Ga0207708_100302202 313
59 3300026118 Ga0207675_100016103 Ga0207675_1000161033 313
60 3300026121 Ga0207683_10338914 Ga0207683_103389142 313
61 3300048905 Ga0496102_0028527 Ga0496102_0028527_2224_3207 313
62 3300048908 Ga0496105_0089133 Ga0496105_0089133_770_1753 313
63 3300048913 Ga0496110_0109984 Ga0496110_0109984_496_1479 313
64 3300005617 Ga0068859_100038929 Ga0068859_1000389294 314
65 3300006931 Ga0097620_100038930 Ga0097620_1000389304 314
66 3300009177 Ga0105248_10196134 Ga0105248_101961342 314
67 3300014325 Ga0163163_10070914 Ga0163163_100709144 314
68 3300028380 Ga0268265_10456974 Ga0268265_104569741 314
69 3300046689 Ga0495613_0104714 Ga0495613_0104714_161_1150 314
70 iso_pu_bacteria 2738541271 2738689174 314
71 iso_pu_bacteria 2738543016 2739264561 314
72 3300013308 Ga0157375_10770632 Ga0157375_107706321 315
73 3300005330 Ga0070690_100046400 Ga0070690_1000464002 316
74 3300005334 Ga0068869_100254383 Ga0068869_1002543831 316
75 3300005459 Ga0068867_100015726 Ga0068867_1000157261 316
76 3300005548 Ga0070665_100010364 Ga0070665_1000103647 316
77 3300009148 Ga0105243_10166599 Ga0105243_101665992 316
78 3300009553 Ga0105249_10107888 Ga0105249_101078883 316
79 3300013296 Ga0157374_10258264 Ga0157374_102582642 316
80 3300025934 Ga0207686_10007103 Ga0207686_100071034 316
81 3300025935 Ga0207709_10100927 Ga0207709_101009271 316
82 3300026089 Ga0207648_10009228 Ga0207648_1000922811 316
83 3300044693 Ga0466961_0037790 Ga0466961_0037790_41_1036 316
84 3300048915 Ga0496112_0035906 Ga0496112_0035906_176_1180 316
85 3300005563 Ga0068855_100399846 Ga0068855_1003998461 317
86 3300006177 Ga0075362_10002045 Ga0075362_100020452 317
87 3300025949 Ga0207667_10028283 Ga0207667_100282833 317
88 3300027312 Ga0209371_1006068 Ga0209371_10060681 317
89 3300050489 nmdc:mga03683_2466_c1 nmdc:mga03683_2466_c1_2882_3925 317
90 3300006028 Ga0070717_10137915 Ga0070717_101379152 318
91 3300009093 Ga0105240_10003340 Ga0105240_1000334013 318
92 3300025913 Ga0207695_10006943 Ga0207695_1000694310 318
93 3300031995 Ga0307409_100035351 Ga0307409_1000353512 318
94 3300035083 Ga0373926_0028143 Ga0373926_0028143_177_1154 318
95 3300039450 Ga0436363_0654378 Ga0436363_0654378_1862_2863 318
96 3300046674 Ga0495588_0115021 Ga0495588_0115021_287_1318 318
97 3300048927 Ga0496124_0000355 Ga0496124_0000355_7835_8878 318
98 3300005338 Ga0068868_100085970 Ga0068868_1000859703 319
99 3300006881 Ga0068865_100029981 Ga0068865_1000299811 319
100 3300026121 Ga0207683_10145779 Ga0207683_101457792 319
101 3300030500 Ga0268256_1001844 Ga0268256_10018447 319
102 3300039437 Ga0436365_1308047 Ga0436365_1308047_89_1063 319
103 3300049581 Ga0501047_0159791 Ga0501047_0159791_538_1518 319
104 3300049591 Ga0501075_0179050 Ga0501075_0179050_536_1564 319
105 iso_pu_bacteria 2857357740 2857357926 319
106 iso_pu_bacteria 2981990288 2981991739 319
107 iso_pu_bacteria 2984592036 2984595522 319
108 iso_pu_bacteria 641736154 642414586 319
109 iso_pu_bacteria 2600254943 2600402027 320
110 3300005548 Ga0070665_100005214 Ga0070665_1000052145 321
111 3300028379 Ga0268266_10066384 Ga0268266_100663842 321
112 3300028556 Ga0265337_1000126 Ga0265337_10001265 321
113 3300028558 Ga0265326_10000144 Ga0265326_1000014435 321
114 3300028654 Ga0265322_10000009 Ga0265322_1000000976 321
115 3300029957 Ga0265324_10000389 Ga0265324_1000038910 321
116 3300031239 Ga0265328_10003668 Ga0265328_100036682 321
117 3300031240 Ga0265320_10000024 Ga0265320_1000002499 321
118 3300031242 Ga0265329_10002956 Ga0265329_100029562 321
119 3300031249 Ga0265339_10011561 Ga0265339_100115612 321
120 3300031250 Ga0265331_10000894 Ga0265331_100008946 321
121 3300031251 Ga0265327_10000227 Ga0265327_10000227100 321
122 3300031507 Ga0307509_10071000 Ga0307509_100710002 321
123 3300031711 Ga0265314_10000570 Ga0265314_1000057036 321
124 3300049577 Ga0501041_0022365 Ga0501041_0022365_2193_3203 321
125 3300049591 Ga0501075_0104920 Ga0501075_0104920_621_1631 321
126 3300049593 Ga0501077_0138678 Ga0501077_0138678_20_1030 321
127 3300049822 Ga0501035_0220233 Ga0501035_0220233_74_1084 321
128 3300049824 Ga0501045_0041787 Ga0501045_0041787_1493_2503 321
129 3300005842 Ga0068858_100345905 Ga0068858_1003459052 322
130 3300009093 Ga0105240_10025509 Ga0105240_100255094 322
131 3300015261 Ga0182006_1017252 Ga0182006_10172522 322
132 3300025913 Ga0207695_10326089 Ga0207695_103260891 322
133 3300025933 Ga0207706_10021245 Ga0207706_100212457 322
134 3300031995 Ga0307409_100161087 Ga0307409_1001610872 322
135 3300035083 Ga0373926_0061881 Ga0373926_0061881_296_1315 322
136 3300049568 Ga0501031_0210726 Ga0501031_0210726_131_1120 322
137 3300049572 Ga0501036_0049412 Ga0501036_0049412_1760_2749 322
138 3300049575 Ga0501039_0055354 Ga0501039_0055354_219_1208 322
139 3300049575 Ga0501039_0062195 Ga0501039_0062195_914_1903 322
140 3300049576 Ga0501040_0168003 Ga0501040_0168003_140_1129 322
141 3300049577 Ga0501041_0162333 Ga0501041_0162333_324_1313 322
142 3300049582 Ga0501048_0030175 Ga0501048_0030175_1977_2966 322
143 3300049586 Ga0501070_0000493 Ga0501070_0000493_13528_14511 322
144 3300049588 Ga0501072_0094503 Ga0501072_0094503_293_1282 322
145 3300049590 Ga0501074_0200833 Ga0501074_0200833_267_1250 322
146 3300049591 Ga0501075_0166588 Ga0501075_0166588_545_1534 322
147 3300049592 Ga0501076_0014021 Ga0501076_0014021_3558_4547 322
148 3300049592 Ga0501076_0038612 Ga0501076_0038612_579_1568 322
149 3300054114 Ga0501084_0292239 Ga0501084_0292239_64_1053 322
150 iso_pu_bacteria 2519103095 2519461521 322
151 iso_pu_bacteria 2582581311 2585290722 322
152 iso_pu_bacteria 2599185239 2599734894 322
153 iso_pu_bacteria 2599185240 2599745307 322
154 iso_pu_bacteria 2599185353 2600198463 322
155 iso_pu_bacteria 2599185355 2600207215 322
156 iso_pu_bacteria 2675903129 2676741025 322
157 iso_pu_bacteria 2816332253 2817258405 322
158 iso_pu_bacteria 2816332256 2817281180 322
159 iso_pu_bacteria 2816332286 2817452131 322
160 iso_pu_bacteria 2818991452 2819635841 322
161 iso_pu_bacteria 2863421361 2863422283 322
162 iso_pu_bacteria 2870068957 2870075474 322
163 iso_pu_bacteria 2904564687 2904564803 322
164 iso_pu_bacteria 2904571731 2904572501 322
165 iso_pu_bacteria 2928157003 2928159182 322
166 iso_pu_bacteria 2928163908 2928168011 322
167 iso_pu_bacteria 2928170801 2928175166 322
168 iso_pu_bacteria 2928536128 2928537823 322
169 iso_pu_bacteria 2981990288 2981992621 322
170 iso_pu_bacteria 641736154 642419179 322
171 iso_pu_bacteria 8018845410 8018847778 322
172 iso_pu_bacteria 8020807995 8020814073 322
173 iso_pu_bacteria 8020938398 8020941946 322
174 iso_pu_bacteria 8020945358 8020948097 322
175 iso_pu_bacteria 8020953355 8020958580 322
176 iso_pu_bacteria 8021120328 8021121927 322
177 iso_pu_bacteria 8040167225 8040167504 322
178 iso_pu_bacteria 8040173305 8040175647 322
179 3300003758 Ga0055532_1000155 Ga0055532_10001554 323
180 3300003856 Ga0058692_1012022 Ga0058692_10120222 323
181 3300013105 Ga0157369_10001951 Ga0157369_100019518 323
182 3300020082 Ga0206353_10402294 Ga0206353_104022944 323
183 3300021361 Ga0213872_10000008 Ga0213872_1000000836 323
184 3300025225 Ga0209566_100295 Ga0209566_1002957 323
185 3300025229 Ga0209147_100204 Ga0209147_1002044 323
186 3300025254 Ga0209148_1001178 Ga0209148_10011785 323
187 3300025272 Ga0209455_1000383 Ga0209455_100038341 323
188 3300025922 Ga0207646_10020234 Ga0207646_100202346 323
189 3300025949 Ga0207667_10014344 Ga0207667_100143442 323
190 3300025949 Ga0207667_10509630 Ga0207667_105096302 323
191 3300027312 Ga0209371_1000195 Ga0209371_100019559 323
192 3300028563 Ga0265319_1034801 Ga0265319_10348012 323
193 3300030500 Ga0268256_1000168 Ga0268256_100016824 323
194 3300031238 Ga0265332_10008765 Ga0265332_100087653 323
195 3300031240 Ga0265320_10041151 Ga0265320_100411513 323
196 3300031249 Ga0265339_10021505 Ga0265339_100215051 323
197 3300031250 Ga0265331_10006208 Ga0265331_100062083 323
198 3300031595 Ga0265313_10000079 Ga0265313_1000007931 323
199 3300031711 Ga0265314_10162660 Ga0265314_101626602 323
200 3300037418 Ga0395900_0082924 Ga0395900_0082924_356_1408 323
201 3300039447 Ga0436361_0757401 Ga0436361_0757401_19806_20807 323
202 3300042993 Ga0439440_0011036 Ga0439440_0011036_126_1142 323
203 3300044901 Ga0466960_0016166 Ga0466960_0016166_1758_2774 323
204 3300045836 Ga0466958_0005932 Ga0466958_0005932_2668_3669 323
205 3300045976 Ga0466967_0380273 Ga0466967_0380273_133_1134 323
206 3300048920 Ga0496117_0020188 Ga0496117_0020188_1869_2870 323
207 3300048921 Ga0496118_0024273 Ga0496118_0024273_3551_4552 323
208 3300049588 Ga0501072_0205028 Ga0501072_0205028_61_1167 323
209 3300049823 Ga0501044_0099928 Ga0501044_0099928_1037_2023 323
210 iso_pu_bacteria 2799112218 2799185813 323
211 iso_pu_bacteria 8039098773 8039101184 323
212 3300003792 Ga0055540_1010060 Ga0055540_10100602 324
213 3300005354 Ga0070675_100007001 Ga0070675_1000070018 324
214 3300005438 Ga0070701_10000650 Ga0070701_100006506 324
215 3300005458 Ga0070681_10207528 Ga0070681_102075281 324
216 3300006178 Ga0075367_10001439 Ga0075367_100014397 324
217 3300006358 Ga0068871_100138513 Ga0068871_1001385132 324
218 3300009177 Ga0105248_10051768 Ga0105248_100517682 324
219 3300013307 Ga0157372_10213207 Ga0157372_102132072 324
220 3300021361 Ga0213872_10000079 Ga0213872_1000007953 324
221 3300025926 Ga0207659_10000241 Ga0207659_1000024121 324
222 3300025941 Ga0207711_10112623 Ga0207711_101126232 324
223 3300028573 Ga0265334_10014951 Ga0265334_100149512 324
224 3300031235 Ga0265330_10051908 Ga0265330_100519082 324
225 3300031548 Ga0307408_100000028 Ga0307408_100000028184 324
226 3300035116 Ga0373945_0009684 Ga0373945_0009684_752_1747 324
227 3300035170 Ga0373943_0004078 Ga0373943_0004078_5415_6410 324
228 3300035171 Ga0373946_0004504 Ga0373946_0004504_1124_2119 324
229 3300035172 Ga0373955_0006678 Ga0373955_0006678_2532_3527 324
230 3300035692 Ga0373935_0017397 Ga0373935_0017397_120_1115 324
231 3300037068 Ga0373925_0009583 Ga0373925_0009583_3677_4672 324
232 3300039447 Ga0436361_0296121 Ga0436361_0296121_106411_107415 324
233 3300046473 Ga0495582_0187513 Ga0495582_0187513_174_1169 324
234 3300048903 Ga0496100_0006847 Ga0496100_0006847_3556_4551 324
235 3300048904 Ga0496101_0002546 Ga0496101_0002546_1061_2056 324
236 3300048917 Ga0496114_0003080 Ga0496114_0003080_2296_3291 324
237 3300049581 Ga0501047_0260409 Ga0501047_0260409_142_1119 324
238 3300049586 Ga0501070_0124471 Ga0501070_0124471_1112_2089 324
239 3300049742 Ga0501080_0242574 Ga0501080_0242574_522_1499 324
240 3300050494 nmdc:mga06z11_3645_c1 nmdc:mga06z11_3645_c1_4288_5313 324
241 3300053084 Ga0495595_0058018 Ga0495595_0058018_750_1745 324
242 3300053084 Ga0495595_0107469 Ga0495595_0107469_134_1129 324
243 iso_pu_bacteria 2823421272 2823421435 324
244 3300005335 Ga0070666_10004788 Ga0070666_100047889 325
245 3300005338 Ga0068868_100351339 Ga0068868_1003513392 325
246 3300005339 Ga0070660_100328258 Ga0070660_1003282581 325
247 3300005340 Ga0070689_100063724 Ga0070689_1000637242 325
248 3300005347 Ga0070668_100041434 Ga0070668_1000414343 325
249 3300005355 Ga0070671_100026180 Ga0070671_1000261803 325
250 3300005366 Ga0070659_100305882 Ga0070659_1003058822 325
251 3300005367 Ga0070667_100024721 Ga0070667_1000247211 325
252 3300005435 Ga0070714_100041036 Ga0070714_1000410362 325
253 3300005436 Ga0070713_100012130 Ga0070713_1000121303 325
254 3300005439 Ga0070711_100076569 Ga0070711_1000765692 325
255 3300005456 Ga0070678_100049230 Ga0070678_1000492303 325
256 3300005535 Ga0070684_100021352 Ga0070684_1000213523 325
257 3300005548 Ga0070665_100004797 Ga0070665_1000047975 325
258 3300005548 Ga0070665_100031233 Ga0070665_1000312334 325
259 3300005563 Ga0068855_100023792 Ga0068855_1000237923 325
260 3300005564 Ga0070664_100108712 Ga0070664_1001087123 325
261 3300005841 Ga0068863_100004411 Ga0068863_10000441112 325
262 3300005842 Ga0068858_100007783 Ga0068858_1000077839 325
263 3300005843 Ga0068860_100000147 Ga0068860_10000014741 325
264 3300005843 Ga0068860_100155896 Ga0068860_1001558962 325
265 3300005937 Ga0081455_10000707 Ga0081455_1000070731 325
266 3300005983 Ga0081540_1028893 Ga0081540_10288933 325
267 3300006195 Ga0075366_10054447 Ga0075366_100544473 325
268 3300006237 Ga0097621_100000790 Ga0097621_10000079020 325
269 3300006358 Ga0068871_100017420 Ga0068871_1000174203 325
270 3300009093 Ga0105240_10094537 Ga0105240_100945372 325
271 3300009093 Ga0105240_10236366 Ga0105240_102363665 325
272 3300009093 Ga0105240_10493162 Ga0105240_104931622 325
273 3300013104 Ga0157370_10109590 Ga0157370_101095902 325
274 3300013105 Ga0157369_10415753 Ga0157369_104157532 325
275 3300013306 Ga0163162_10606432 Ga0163162_106064322 325
276 3300014968 Ga0157379_10321410 Ga0157379_103214102 325
277 3300014969 Ga0157376_10125891 Ga0157376_101258912 325
278 3300021358 Ga0213873_10000004 Ga0213873_10000004446 325
279 3300021384 Ga0213876_10000007 Ga0213876_10000007446 325
280 3300025899 Ga0207642_10081502 Ga0207642_100815022 325
281 3300025909 Ga0207705_10073631 Ga0207705_100736312 325
282 3300025913 Ga0207695_10147947 Ga0207695_101479475 325
283 3300025913 Ga0207695_10170406 Ga0207695_101704062 325
284 3300025918 Ga0207662_10189833 Ga0207662_101898331 325
285 3300025920 Ga0207649_10103251 Ga0207649_101032512 325
286 3300025928 Ga0207700_10152025 Ga0207700_101520251 325
287 3300025929 Ga0207664_10017879 Ga0207664_100178791 325
288 3300025931 Ga0207644_10012241 Ga0207644_100122414 325
289 3300025938 Ga0207704_10091173 Ga0207704_100911733 325
290 3300025944 Ga0207661_10340584 Ga0207661_103405842 325
291 3300025949 Ga0207667_10159436 Ga0207667_101594362 325
292 3300025986 Ga0207658_10014726 Ga0207658_100147262 325
293 3300026035 Ga0207703_10005310 Ga0207703_100053109 325
294 3300026088 Ga0207641_10003377 Ga0207641_100033774 325
295 3300026116 Ga0207674_10120923 Ga0207674_101209232 325
296 3300026121 Ga0207683_10027190 Ga0207683_100271904 325
297 3300028379 Ga0268266_10001659 Ga0268266_100016597 325
298 3300028381 Ga0268264_10000033 Ga0268264_1000003350 325
299 3300028381 Ga0268264_10000138 Ga0268264_1000013872 325
300 3300028381 Ga0268264_10138104 Ga0268264_101381042 325
301 3300028794 Ga0307515_10000066 Ga0307515_1000006657 325
302 3300035112 Ga0373932_0056766 Ga0373932_0056766_156_1157 325
303 3300035410 Ga0373924_0125186 Ga0373924_0125186_26_1018 325
304 3300035691 Ga0373931_0035941 Ga0373931_0035941_1537_2529 325
305 3300037068 Ga0373925_0336624 Ga0373925_0336624_10_1002 325
306 3300037312 Ga0395899_0001048 Ga0395899_0001048_57_1049 325
307 3300037312 Ga0395899_0024104 Ga0395899_0024104_2836_3855 325
308 3300037418 Ga0395900_0003285 Ga0395900_0003285_10785_11777 325
309 3300037418 Ga0395900_0010110 Ga0395900_0010110_8460_9479 325
310 3300037418 Ga0395900_0107609 Ga0395900_0107609_1575_2567 325
311 3300037466 Ga0395898_0040821 Ga0395898_0040821_3038_4030 325
312 3300037471 Ga0395905_0101742 Ga0395905_0101742_932_1951 325
313 3300038443 Ga0395901_0004093 Ga0395901_0004093_6457_7449 325
314 3300038443 Ga0395901_0028392 Ga0395901_0028392_2532_3551 325
315 3300039437 Ga0436365_0394061 Ga0436365_0394061_83740_84732 325
316 3300039453 Ga0436362_0290430 Ga0436362_0290430_278895_279887 325
317 3300041411 Ga0439466_0001763 Ga0439466_0001763_5328_6332 325
318 3300045051 Ga0451576_0451197 Ga0451576_0451197_33_1079 325
319 3300049571 Ga0501034_0001852 Ga0501034_0001852_16935_17927 325
320 3300049571 Ga0501034_0002374 Ga0501034_0002374_13763_14755 325
321 3300049571 Ga0501034_0132419 Ga0501034_0132419_1023_2015 325
322 3300049581 Ga0501047_0088218 Ga0501047_0088218_1792_2784 325
323 3300049584 Ga0501068_0058162 Ga0501068_0058162_484_1476 325
324 3300049823 Ga0501044_0255447 Ga0501044_0255447_270_1262 325
325 3300050489 nmdc:mga03683_26879_c1 nmdc:mga03683_26879_c1_784_1776 325
326 3300050493 nmdc:mga0k408_3429_c1 nmdc:mga0k408_3429_c1_6505_7497 325
327 3300053088 Ga0500644_0079885 Ga0500644_0079885_144_1136 325
328 3300003758 Ga0055532_1000997 Ga0055532_10009977 326
329 3300003758 Ga0055532_1001799 Ga0055532_10017992 326
330 3300003758 Ga0055532_1002590 Ga0055532_10025902 326
331 3300003760 Ga0055527_1000231 Ga0055527_100023124 326
332 3300003760 Ga0055527_1002809 Ga0055527_10028092 326
333 3300003761 Ga0055535_1000492 Ga0055535_10004926 326
334 3300003761 Ga0055535_1000587 Ga0055535_100058717 326
335 3300003762 Ga0055542_1000613 Ga0055542_100061317 326
336 3300003763 Ga0055529_1000525 Ga0055529_100052518 326
337 3300003763 Ga0055529_1003706 Ga0055529_10037062 326
338 3300003841 Ga0055541_1003263 Ga0055541_10032632 326
339 3300005327 Ga0070658_10038905 Ga0070658_100389053 326
340 3300005339 Ga0070660_100000098 Ga0070660_10000009817 326
341 3300005366 Ga0070659_100000259 Ga0070659_10000025923 326
342 3300005434 Ga0070709_10233480 Ga0070709_102334802 326
343 3300005436 Ga0070713_100003315 Ga0070713_1000033155 326
344 3300005455 Ga0070663_100011412 Ga0070663_1000114124 326
345 3300005458 Ga0070681_10110162 Ga0070681_101101623 326
346 3300005539 Ga0068853_100141220 Ga0068853_1001412202 326
347 3300005548 Ga0070665_100003284 Ga0070665_10000328420 326
348 3300005577 Ga0068857_100166877 Ga0068857_1001668772 326
349 3300005614 Ga0068856_100075876 Ga0068856_1000758765 326
350 3300005616 Ga0068852_100004932 Ga0068852_1000049326 326
351 3300006237 Ga0097621_100015101 Ga0097621_1000151016 326
352 3300006358 Ga0068871_100049086 Ga0068871_1000490863 326
353 3300006847 Ga0075431_100044294 Ga0075431_1000442944 326
354 3300009093 Ga0105240_10003571 Ga0105240_1000357112 326
355 3300009177 Ga0105248_10571914 Ga0105248_105719141 326
356 3300009545 Ga0105237_10025150 Ga0105237_100251502 326
357 3300009551 Ga0105238_10029872 Ga0105238_100298722 326
358 3300010375 Ga0105239_10002103 Ga0105239_1000210310 326
359 3300013297 Ga0157378_10003705 Ga0157378_100037059 326
360 3300014325 Ga0163163_10106053 Ga0163163_101060531 326
361 3300014745 Ga0157377_10170477 Ga0157377_101704771 326
362 3300014969 Ga0157376_10025465 Ga0157376_100254652 326
363 3300015261 Ga0182006_1072260 Ga0182006_10722601 326
364 3300015262 Ga0182007_10035208 Ga0182007_100352082 326
365 3300015265 Ga0182005_1030528 Ga0182005_10305282 326
366 3300025225 Ga0209566_100813 Ga0209566_10081314 326
367 3300025228 Ga0209672_100062 Ga0209672_100062173 326
368 3300025228 Ga0209672_100105 Ga0209672_10010583 326
369 3300025229 Ga0209147_100012 Ga0209147_100012608 326
370 3300025229 Ga0209147_100078 Ga0209147_100078173 326
371 3300025229 Ga0209147_100145 Ga0209147_10014574 326
372 3300025242 Ga0209258_100107 Ga0209258_100107168 326
373 3300025242 Ga0209258_100108 Ga0209258_100108173 326
374 3300025254 Ga0209148_1000022 Ga0209148_100002219 326
375 3300025254 Ga0209148_1001231 Ga0209148_10012319 326
376 3300025272 Ga0209455_1000024 Ga0209455_1000024604 326
377 3300025272 Ga0209455_1001254 Ga0209455_10012545 326
378 3300025273 Ga0209673_1000026 Ga0209673_1000026296 326
379 3300025295 Ga0209564_1007061 Ga0209564_10070614 326
380 3300025904 Ga0207647_10010091 Ga0207647_100100916 326
381 3300025906 Ga0207699_10003733 Ga0207699_100037334 326
382 3300025909 Ga0207705_10108705 Ga0207705_101087052 326
383 3300025913 Ga0207695_10000205 Ga0207695_10000205121 326
384 3300025913 Ga0207695_10041182 Ga0207695_100411822 326
385 3300025914 Ga0207671_10113764 Ga0207671_101137642 326
386 3300025919 Ga0207657_10000053 Ga0207657_1000005355 326
387 3300025932 Ga0207690_10000009 Ga0207690_1000000940 326
388 3300025932 Ga0207690_10048246 Ga0207690_100482463 326
389 3300026067 Ga0207678_10009219 Ga0207678_100092197 326
390 3300026142 Ga0207698_10028826 Ga0207698_100288262 326
391 3300027312 Ga0209371_1000467 Ga0209371_100046725 326
392 3300028379 Ga0268266_10003855 Ga0268266_100038556 326
393 3300030500 Ga0268256_1000566 Ga0268256_100056617 326
394 3300037466 Ga0395898_0268242 Ga0395898_0268242_330_1379 326
395 3300038443 Ga0395901_0001587 Ga0395901_0001587_20211_21209 326
396 3300039437 Ga0436365_1609485 Ga0436365_1609485_899_1903 326
397 3300039437 Ga0436365_1647369 Ga0436365_1647369_14646_15638 326
398 3300046459 Ga0495629_0047601 Ga0495629_0047601_117_1118 326
399 3300046472 Ga0495580_0071886 Ga0495580_0071886_656_1657 326
400 3300046511 Ga0495608_0034078 Ga0495608_0034078_1637_2638 326
401 3300046516 Ga0495628_0169594 Ga0495628_0169594_581_1582 326
402 3300046517 Ga0495630_0039449 Ga0495630_0039449_2090_3091 326
403 3300046536 Ga0495587_0033679 Ga0495587_0033679_694_1695 326
404 3300046543 Ga0495645_0133399 Ga0495645_0133399_156_1157 326
405 3300046642 Ga0495634_0039730 Ga0495634_0039730_1856_2857 326
406 3300046663 Ga0495635_0110175 Ga0495635_0110175_492_1493 326
407 3300046675 Ga0495657_0140290 Ga0495657_0140290_443_1444 326
408 3300046684 Ga0495669_0024665 Ga0495669_0024665_839_1843 326
409 3300046689 Ga0495613_0000397 Ga0495613_0000397_17733_18734 326
410 3300047317 Ga0495604_0026503 Ga0495604_0026503_2651_3652 326
411 3300047322 Ga0495680_0068338 Ga0495680_0068338_1540_2541 326
412 3300047471 Ga0495684_0000431 Ga0495684_0000431_9771_10772 326
413 3300048908 Ga0496105_0095898 Ga0496105_0095898_1210_2238 326
414 3300048924 Ga0496121_0178875 Ga0496121_0178875_413_1462 326
415 3300053077 Ga0495601_0046956 Ga0495601_0046956_817_1818 326
416 3300053084 Ga0495595_0064284 Ga0495595_0064284_378_1379 326
417 3300053085 Ga0495619_0009244 Ga0495619_0009244_2078_3079 326
418 3300003187 JGI25151J46595_10026305 JGI25151J46595_100263053 327
419 3300005335 Ga0070666_10021603 Ga0070666_100216033 327
420 3300005466 Ga0070685_10014989 Ga0070685_100149894 327
421 3300005467 Ga0070706_100049831 Ga0070706_1000498313 327
422 3300005468 Ga0070707_100028668 Ga0070707_1000286682 327
423 3300005471 Ga0070698_100020372 Ga0070698_1000203728 327
424 3300005518 Ga0070699_100317243 Ga0070699_1003172431 327
425 3300005548 Ga0070665_100000127 Ga0070665_10000012733 327
426 3300006163 Ga0070715_10095106 Ga0070715_100951062 327
427 3300006358 Ga0068871_100053152 Ga0068871_1000531523 327
428 3300009101 Ga0105247_10140655 Ga0105247_101406552 327
429 3300009177 Ga0105248_10079115 Ga0105248_100791153 327
430 3300025910 Ga0207684_10076985 Ga0207684_100769852 327
431 3300025922 Ga0207646_10009412 Ga0207646_100094126 327
432 3300025941 Ga0207711_10096398 Ga0207711_100963981 327
433 3300026035 Ga0207703_10404848 Ga0207703_104048481 327
434 3300028379 Ga0268266_10000924 Ga0268266_1000092439 327
435 3300028800 Ga0265338_10014175 Ga0265338_100141757 327
436 3300028800 Ga0265338_10049640 Ga0265338_100496405 327
437 3300028800 Ga0265338_10079466 Ga0265338_100794663 327
438 3300031247 Ga0265340_10018544 Ga0265340_100185445 327
439 3300031711 Ga0265314_10033616 Ga0265314_100336161 327
440 3300035695 Ga0373927_0016957 Ga0373927_0016957_966_1973 327
441 3300045976 Ga0466967_0109220 Ga0466967_0109220_326_1351 327
442 3300048918 Ga0496115_0356377 Ga0496115_0356377_124_1131 327
443 3300060353 Ga0501082_0296033 Ga0501082_0296033_154_1164 327
444 3300005329 Ga0070683_100027055 Ga0070683_1000270556 328
445 3300005343 Ga0070687_100005017 Ga0070687_1000050176 328
446 3300005435 Ga0070714_100025070 Ga0070714_1000250702 328
447 3300005530 Ga0070679_100102311 Ga0070679_1001023113 328
448 3300005535 Ga0070684_100043240 Ga0070684_1000432402 328
449 3300005985 Ga0081539_10042018 Ga0081539_100420183 328
450 3300009177 Ga0105248_10211825 Ga0105248_102118252 328
451 3300013307 Ga0157372_10032896 Ga0157372_100328962 328
452 3300025912 Ga0207707_10045352 Ga0207707_100453522 328
453 3300025918 Ga0207662_10004173 Ga0207662_100041737 328
454 3300025944 Ga0207661_10274397 Ga0207661_102743972 328
455 3300026142 Ga0207698_10281730 Ga0207698_102817301 328
456 3300035242 Ga0373962_0054469 Ga0373962_0054469_16_1068 328
457 3300044673 Ga0453683_0003525 Ga0453683_0003525_10040_11047 328
458 3300044693 Ga0466961_0054521 Ga0466961_0054521_850_1878 328
459 3300045049 Ga0466959_0164722 Ga0466959_0164722_250_1278 328
460 3300045051 Ga0451576_0036904 Ga0451576_0036904_1748_2755 328
461 3300050513 nmdc:mga0rr50_107084_c1 nmdc:mga0rr50_107084_c1_232_1242 328
462 3300004798 Ga0058859_11760707 Ga0058859_117607072 329
463 3300004801 Ga0058860_12215240 Ga0058860_122152408 329
464 3300005339 Ga0070660_100027936 Ga0070660_1000279363 329
465 3300005354 Ga0070675_100057389 Ga0070675_1000573892 329
466 3300005364 Ga0070673_100188489 Ga0070673_1001884892 329
467 3300005366 Ga0070659_100001090 Ga0070659_1000010909 329
468 3300005455 Ga0070663_100021502 Ga0070663_1000215022 329
469 3300005458 Ga0070681_10053595 Ga0070681_100535953 329
470 3300005530 Ga0070679_100007731 Ga0070679_1000077318 329
471 3300005544 Ga0070686_100008772 Ga0070686_1000087729 329
472 3300005614 Ga0068856_100021501 Ga0068856_1000215014 329
473 3300005616 Ga0068852_100018498 Ga0068852_1000184986 329
474 3300005937 Ga0081455_10001850 Ga0081455_1000185018 329
475 3300005981 Ga0081538_10012023 Ga0081538_100120236 329
476 3300005983 Ga0081540_1015203 Ga0081540_10152032 329
477 3300006237 Ga0097621_100057962 Ga0097621_1000579622 329
478 3300006358 Ga0068871_100168275 Ga0068871_1001682752 329
479 3300006846 Ga0075430_100149231 Ga0075430_1001492312 329
480 3300006871 Ga0075434_100311743 Ga0075434_1003117432 329
481 3300006880 Ga0075429_100017118 Ga0075429_1000171183 329
482 3300009093 Ga0105240_10008942 Ga0105240_1000894217 329
483 3300009094 Ga0111539_10109421 Ga0111539_101094213 329
484 3300009094 Ga0111539_10210282 Ga0111539_102102822 329
485 3300009177 Ga0105248_10029611 Ga0105248_100296114 329
486 3300010375 Ga0105239_10072996 Ga0105239_100729966 329
487 3300013104 Ga0157370_10007123 Ga0157370_100071234 329
488 3300013105 Ga0157369_10006254 Ga0157369_1000625412 329
489 3300013307 Ga0157372_10023313 Ga0157372_100233134 329
490 3300017792 Ga0163161_10190292 Ga0163161_101902921 329
491 3300020082 Ga0206353_11402362 Ga0206353_114023623 329
492 3300025910 Ga0207684_10042655 Ga0207684_100426552 329
493 3300025912 Ga0207707_10003121 Ga0207707_1000312115 329
494 3300025913 Ga0207695_10030945 Ga0207695_100309455 329
495 3300025913 Ga0207695_10165399 Ga0207695_101653993 329
496 3300025917 Ga0207660_10033479 Ga0207660_100334795 329
497 3300025919 Ga0207657_10009720 Ga0207657_1000972010 329
498 3300025920 Ga0207649_10015628 Ga0207649_100156284 329
499 3300025924 Ga0207694_10043711 Ga0207694_100437112 329
500 3300025932 Ga0207690_10008222 Ga0207690_100082222 329
501 3300025944 Ga0207661_10000599 Ga0207661_1000059918 329
502 3300026078 Ga0207702_10059276 Ga0207702_100592762 329
503 3300039437 Ga0436365_1612362 Ga0436365_1612362_1580_2614 329
504 3300042015 Ga0439462_0035591 Ga0439462_0035591_181_1203 329
505 3300045976 Ga0466967_0059951 Ga0466967_0059951_2122_3174 329
506 3300045976 Ga0466967_0098084 Ga0466967_0098084_1230_2285 329
507 3300046461 Ga0495641_0000458 Ga0495641_0000458_23941_24945 329
508 3300046475 Ga0495639_0126262 Ga0495639_0126262_145_1149 329
509 3300046515 Ga0495620_0002096 Ga0495620_0002096_7013_8020 329
510 3300046518 Ga0495631_0031811 Ga0495631_0031811_649_1653 329
511 3300046523 Ga0495644_0010665 Ga0495644_0010665_816_1820 329
512 3300046535 Ga0495586_0203984 Ga0495586_0203984_13_1026 329
513 3300046615 Ga0495656_0092122 Ga0495656_0092122_283_1287 329
514 3300047469 Ga0495673_0051127 Ga0495673_0051127_214_1218 329
515 3300047472 Ga0495686_0000011 Ga0495686_0000011_289143_290147 329
516 3300047472 Ga0495686_0042204 Ga0495686_0042204_747_1751 329
517 3300048911 Ga0496108_0153329 Ga0496108_0153329_839_1855 329
518 3300048927 Ga0496124_0006021 Ga0496124_0006021_10588_11706 329
519 3300049572 Ga0501036_0234452 Ga0501036_0234452_125_1207 329
520 3300049582 Ga0501048_0147367 Ga0501048_0147367_383_1465 329
521 3300049743 Ga0501081_0137809 Ga0501081_0137809_471_1553 329
522 3300049744 Ga0501083_0004416 Ga0501083_0004416_7869_8888 329
523 3300050507 nmdc:mga05p37_29071_c1 nmdc:mga05p37_29071_c1_274_1344 329
524 3300050507 nmdc:mga05p37_7730_c1 nmdc:mga05p37_7730_c1_504_1574 329
525 3300050508 nmdc:mga09592_107672_c1 nmdc:mga09592_107672_c1_1204_2274 329
526 3300050508 nmdc:mga09592_190066_c1 nmdc:mga09592_190066_c1_169_1251 329
527 3300050509 nmdc:mga0qj67_165193_c1 nmdc:mga0qj67_165193_c1_656_1726 329
528 3300050509 nmdc:mga0qj67_294956_c1 nmdc:mga0qj67_294956_c1_137_1219 329
529 3300050510 nmdc:mga06r32_49457_c1 nmdc:mga06r32_49457_c1_2732_3802 329
530 3300050511 nmdc:mga08y16_49984_c1 nmdc:mga08y16_49984_c1_3193_4275 329
531 3300054114 Ga0501084_0122869 Ga0501084_0122869_546_1628 329
532 3300061734 Ga0530510_0180455 Ga0530510_0180455_97_1179 329
533 3300005327 Ga0070658_10027709 Ga0070658_100277092 330
534 3300005336 Ga0070680_100007774 Ga0070680_1000077743 330
535 3300005336 Ga0070680_100025999 Ga0070680_1000259993 330
536 3300005340 Ga0070689_100255672 Ga0070689_1002556722 330
537 3300005341 Ga0070691_10005555 Ga0070691_100055552 330
538 3300005354 Ga0070675_100190903 Ga0070675_1001909032 330
539 3300005445 Ga0070708_100014104 Ga0070708_1000141044 330
540 3300005458 Ga0070681_10007963 Ga0070681_100079634 330
541 3300005458 Ga0070681_10008145 Ga0070681_100081455 330
542 3300005467 Ga0070706_100026528 Ga0070706_1000265283 330
543 3300005518 Ga0070699_100112833 Ga0070699_1001128333 330
544 3300005530 Ga0070679_100012355 Ga0070679_1000123553 330
545 3300005548 Ga0070665_100004697 Ga0070665_10000469712 330
546 3300005563 Ga0068855_100058840 Ga0068855_1000588402 330
547 3300005614 Ga0068856_100050783 Ga0068856_1000507832 330
548 3300005843 Ga0068860_100036957 Ga0068860_1000369572 330
549 3300005937 Ga0081455_10003642 Ga0081455_1000364212 330
550 3300005937 Ga0081455_10010780 Ga0081455_100107806 330
551 3300005985 Ga0081539_10004424 Ga0081539_100044246 330
552 3300006038 Ga0075365_10034624 Ga0075365_100346244 330
553 3300006038 Ga0075365_10176115 Ga0075365_101761152 330
554 3300006177 Ga0075362_10126965 Ga0075362_101269651 330
555 3300006178 Ga0075367_10171237 Ga0075367_101712372 330
556 3300006186 Ga0075369_10018646 Ga0075369_100186463 330
557 3300006186 Ga0075369_10059993 Ga0075369_100599932 330
558 3300007265 Ga0099794_10133691 Ga0099794_101336911 330
559 3300009093 Ga0105240_10086111 Ga0105240_100861113 330
560 3300009094 Ga0111539_10082204 Ga0111539_100822046 330
561 3300013100 Ga0157373_10072834 Ga0157373_100728343 330
562 3300013104 Ga0157370_10101939 Ga0157370_101019394 330
563 3300013105 Ga0157369_10446926 Ga0157369_104469262 330
564 3300025908 Ga0207643_10120115 Ga0207643_101201152 330
565 3300025909 Ga0207705_10005553 Ga0207705_100055533 330
566 3300025912 Ga0207707_10020251 Ga0207707_100202513 330
567 3300025912 Ga0207707_10029292 Ga0207707_100292922 330
568 3300025913 Ga0207695_10082876 Ga0207695_100828762 330
569 3300025917 Ga0207660_10008792 Ga0207660_100087924 330
570 3300025917 Ga0207660_10060286 Ga0207660_100602862 330
571 3300025921 Ga0207652_10082324 Ga0207652_100823242 330
572 3300025925 Ga0207650_10314795 Ga0207650_103147952 330
573 3300025926 Ga0207659_10058429 Ga0207659_100584292 330
574 3300025949 Ga0207667_10113171 Ga0207667_101131712 330
575 3300026088 Ga0207641_10079686 Ga0207641_100796862 330
576 3300028379 Ga0268266_10005825 Ga0268266_100058254 330
577 3300028381 Ga0268264_10011411 Ga0268264_100114116 330
578 3300031911 Ga0307412_10271217 Ga0307412_102712172 330
579 3300035121 Ga0373960_0004844 Ga0373960_0004844_532_1590 330
580 3300037312 Ga0395899_0053532 Ga0395899_0053532_131_1144 330
581 3300037418 Ga0395900_0005953 Ga0395900_0005953_3972_4985 330
582 3300037466 Ga0395898_0025658 Ga0395898_0025658_888_1901 330
583 3300037853 Ga0436364_0857265 Ga0436364_0857265_5413_6444 330
584 3300045836 Ga0466958_0023519 Ga0466958_0023519_2561_3598 330
585 3300050489 nmdc:mga03683_11410_c1 nmdc:mga03683_11410_c1_2040_3059 330
586 3300050489 nmdc:mga03683_1905_c1 nmdc:mga03683_1905_c1_1536_2546 330
587 3300050489 nmdc:mga03683_53201_c1 nmdc:mga03683_53201_c1_269_1279 330
588 3300050492 nmdc:mga0yw44_151110_c1 nmdc:mga0yw44_151110_c1_142_1152 330
589 3300050492 nmdc:mga0yw44_34699_c1 nmdc:mga0yw44_34699_c1_441_1451 330
590 3300050492 nmdc:mga0yw44_38717_c1 nmdc:mga0yw44_38717_c1_232_1251 330
591 3300050493 nmdc:mga0k408_64745_c1 nmdc:mga0k408_64745_c1_73_1083 330
592 3300050494 nmdc:mga06z11_113473_c1 nmdc:mga06z11_113473_c1_148_1167 330
593 3300050509 nmdc:mga0qj67_165418_c1 nmdc:mga0qj67_165418_c1_426_1511 330
594 3300050516 nmdc:mga0sz30_86040_c1 nmdc:mga0sz30_86040_c1_42_1052 330
595 3300053085 Ga0495619_0062911 Ga0495619_0062911_838_1875 330
596 3300053096 Ga0500641_0014773 Ga0500641_0014773_11_1021 330
597 3300053153 Ga0500616_0013215 Ga0500616_0013215_3611_4630 330
598 3300061719 Ga0466962_0017954 Ga0466962_0017954_972_2009 330
599 3300005441 Ga0070700_100000961 Ga0070700_1000009619 331
600 3300005456 Ga0070678_100370869 Ga0070678_1003708691 331
601 3300005471 Ga0070698_100001905 Ga0070698_1000019053 331
602 3300005617 Ga0068859_100040981 Ga0068859_1000409812 331
603 3300005981 Ga0081538_10000484 Ga0081538_1000048434 331
604 3300005985 Ga0081539_10005465 Ga0081539_100054653 331
605 3300006931 Ga0097620_100040981 Ga0097620_1000409816 331
606 3300026075 Ga0207708_10000047 Ga0207708_10000047106 331
607 3300028381 Ga0268264_10039433 Ga0268264_100394332 331
608 3300031456 Ga0307513_10000017 Ga0307513_1000001772 331
609 3300031730 Ga0307516_10005910 Ga0307516_100059108 331
610 3300031903 Ga0307407_10174488 Ga0307407_101744881 331
611 3300046517 Ga0495630_0028903 Ga0495630_0028903_1551_2594 331
612 3300046543 Ga0495645_0000098 Ga0495645_0000098_37336_38361 331
613 3300047319 Ga0495674_0111298 Ga0495674_0111298_270_1313 331
614 3300047444 Ga0495675_0013384 Ga0495675_0013384_2692_3735 331
615 iso_pu_bacteria 2818991472 2819745622 331
616 iso_pu_bacteria 2904430863 2904433515 331
617 iso_pu_bacteria 2904501621 2904503981 331
618 iso_pu_bacteria 2908674828 2908676946 331
619 iso_pu_bacteria 2909074476 2909076878 331
620 iso_pu_bacteria 2919039151 2919039490 331
621 iso_pu_bacteria 2919042368 2919042885 331
622 iso_pu_bacteria 2928104781 2928106150 331
623 iso_pu_bacteria 2928500415 2928502088 331
624 iso_pu_bacteria 2939660829 2939664223 331
625 iso_pu_bacteria 2984551494 2984554832 331
626 3300005937 Ga0081455_10031924 Ga0081455_100319245 332
627 3300005981 Ga0081538_10007819 Ga0081538_1000781914 332
628 3300006846 Ga0075430_100229074 Ga0075430_1002290742 332
629 3300006847 Ga0075431_100032872 Ga0075431_1000328726 332
630 3300006847 Ga0075431_100318918 Ga0075431_1003189182 332
631 3300021384 Ga0213876_10059302 Ga0213876_100593021 332
632 3300026078 Ga0207702_10087599 Ga0207702_100875994 332
633 3300028379 Ga0268266_10261282 Ga0268266_102612822 332
634 3300031852 Ga0307410_10361999 Ga0307410_103619991 332
635 3300031901 Ga0307406_10002397 Ga0307406_100023977 332
636 3300031901 Ga0307406_10024232 Ga0307406_100242323 332
637 3300031903 Ga0307407_10000744 Ga0307407_100007445 332
638 3300031911 Ga0307412_10004845 Ga0307412_100048454 332
639 3300031995 Ga0307409_100368405 Ga0307409_1003684052 332
640 3300032002 Ga0307416_100003103 Ga0307416_1000031035 332
641 3300032004 Ga0307414_10002550 Ga0307414_100025505 332
642 3300032005 Ga0307411_10243318 Ga0307411_102433182 332
643 3300035695 Ga0373927_0023943 Ga0373927_0023943_2139_3191 332
644 3300036401 Ga0373937_0423310 Ga0373937_0423310_83_1111 332
645 3300039437 Ga0436365_0212021 Ga0436365_0212021_4915_5961 332
646 3300044684 Ga0466966_0037442 Ga0466966_0037442_1428_2489 332
647 3300044765 Ga0466970_0016305 Ga0466970_0016305_663_1724 332
648 3300045049 Ga0466959_0077474 Ga0466959_0077474_997_2058 332
649 3300045976 Ga0466967_0000343 Ga0466967_0000343_12021_13070 332
650 3300046472 Ga0495580_0007926 Ga0495580_0007926_6536_7588 332
651 3300046499 Ga0495594_0000017 Ga0495594_0000017_87405_88418 332
652 3300046689 Ga0495613_0287868 Ga0495613_0287868_83_1129 332
653 3300048905 Ga0496102_0047822 Ga0496102_0047822_1095_2135 332
654 3300048905 Ga0496102_0114885 Ga0496102_0114885_143_1186 332
655 3300048910 Ga0496107_0108611 Ga0496107_0108611_846_1886 332
656 3300048912 Ga0496109_0002595 Ga0496109_0002595_13522_14562 332
657 3300048913 Ga0496110_0006769 Ga0496110_0006769_96_1136 332
658 3300048915 Ga0496112_0050315 Ga0496112_0050315_1618_2658 332
659 3300048916 Ga0496113_0092541 Ga0496113_0092541_1238_2278 332
660 3300048920 Ga0496117_0004162 Ga0496117_0004162_9151_10194 332
661 3300048921 Ga0496118_0000450 Ga0496118_0000450_40629_41672 332
662 3300048922 Ga0496119_0148347 Ga0496119_0148347_15_1058 332
663 3300048924 Ga0496121_0005238 Ga0496121_0005238_14504_15547 332
664 3300048925 Ga0496122_0026111 Ga0496122_0026111_3979_5022 332
665 3300048926 Ga0496123_0036090 Ga0496123_0036090_291_1334 332
666 3300048927 Ga0496124_0000070 Ga0496124_0000070_176907_177950 332
667 3300049576 Ga0501040_0213159 Ga0501040_0213159_148_1194 332
668 3300049582 Ga0501048_0091121 Ga0501048_0091121_31_1059 332
669 3300049587 Ga0501071_0020975 Ga0501071_0020975_1197_2243 332
670 3300050509 nmdc:mga0qj67_86146_c1 nmdc:mga0qj67_86146_c1_274_1299 332
671 3300050510 nmdc:mga06r32_132326_c1 nmdc:mga06r32_132326_c1_727_1752 332
672 iso_pu_bacteria 2751185788 2753302683 332
673 3300005336 Ga0070680_100020646 Ga0070680_1000206464 333
674 3300005458 Ga0070681_10131930 Ga0070681_101319304 333
675 3300005548 Ga0070665_100008563 Ga0070665_1000085635 333
676 3300005563 Ga0068855_100082043 Ga0068855_1000820432 333
677 3300005614 Ga0068856_100059333 Ga0068856_1000593332 333
678 3300005616 Ga0068852_100012575 Ga0068852_1000125754 333
679 3300005937 Ga0081455_10014432 Ga0081455_100144322 333
680 3300009093 Ga0105240_10005993 Ga0105240_100059939 333
681 3300009094 Ga0111539_10007055 Ga0111539_100070552 333
682 3300013104 Ga0157370_10391901 Ga0157370_103919012 333
683 3300025912 Ga0207707_10046940 Ga0207707_100469404 333
684 3300025919 Ga0207657_10056371 Ga0207657_100563712 333
685 3300025921 Ga0207652_10095758 Ga0207652_100957583 333
686 3300025924 Ga0207694_10205747 Ga0207694_102057473 333
687 3300026078 Ga0207702_10097825 Ga0207702_100978252 333
688 3300026142 Ga0207698_10015498 Ga0207698_100154984 333
689 3300028379 Ga0268266_10046783 Ga0268266_100467832 333
690 3300044765 Ga0466970_0028875 Ga0466970_0028875_1287_2327 333
691 3300045049 Ga0466959_0143372 Ga0466959_0143372_411_1451 333
692 3300046454 Ga0495592_0015796 Ga0495592_0015796_3986_5035 333
693 3300046463 Ga0495653_0005801 Ga0495653_0005801_3070_4119 333
694 3300046516 Ga0495628_0000081 Ga0495628_0000081_68620_69669 333
695 3300046517 Ga0495630_0146635 Ga0495630_0146635_463_1512 333
696 3300046529 Ga0495652_0010794 Ga0495652_0010794_4614_5663 333
697 3300046533 Ga0495640_0038820 Ga0495640_0038820_328_1377 333
698 3300046535 Ga0495586_0002941 Ga0495586_0002941_1504_2547 333
699 3300046536 Ga0495587_0000812 Ga0495587_0000812_13232_14281 333
700 3300046543 Ga0495645_0015934 Ga0495645_0015934_1855_2904 333
701 3300046675 Ga0495657_0059077 Ga0495657_0059077_966_2015 333
702 3300047317 Ga0495604_0012072 Ga0495604_0012072_3602_4651 333
703 3300047319 Ga0495674_0003091 Ga0495674_0003091_6010_7059 333
704 3300047319 Ga0495674_0053462 Ga0495674_0053462_326_1369 333
705 3300047322 Ga0495680_0001560 Ga0495680_0001560_20613_21662 333
706 3300047444 Ga0495675_0000394 Ga0495675_0000394_2722_3771 333
707 3300047471 Ga0495684_0014397 Ga0495684_0014397_2423_3472 333
708 3300048088 Ga0495602_0012580 Ga0495602_0012580_3116_4165 333
709 3300048913 Ga0496110_0396896 Ga0496110_0396896_15_1058 333
710 3300048914 Ga0496111_0032964 Ga0496111_0032964_2004_3047 333
711 3300048915 Ga0496112_0168670 Ga0496112_0168670_219_1262 333
712 3300050511 nmdc:mga08y16_3246_c1 nmdc:mga08y16_3246_c1_15312_16349 333
713 3300005329 Ga0070683_100047264 Ga0070683_1000472642 334
714 3300006038 Ga0075365_10196654 Ga0075365_101966541 334
715 3300009093 Ga0105240_10235068 Ga0105240_102350682 334
716 3300009098 Ga0105245_10186517 Ga0105245_101865172 334
717 3300009147 Ga0114129_10088169 Ga0114129_100881693 334
718 3300009176 Ga0105242_10027481 Ga0105242_100274814 334
719 3300009553 Ga0105249_10000090 Ga0105249_100000908 334
720 3300011119 Ga0105246_10028187 Ga0105246_100281873 334
721 3300013105 Ga0157369_10220736 Ga0157369_102207362 334
722 3300013296 Ga0157374_10016092 Ga0157374_100160927 334
723 3300013297 Ga0157378_10000702 Ga0157378_1000070211 334
724 3300021388 Ga0213875_10002705 Ga0213875_100027057 334
725 3300024227 Ga0228598_1002491 Ga0228598_10024913 334
726 3300025913 Ga0207695_10146371 Ga0207695_101463712 334
727 3300025961 Ga0207712_10000903 Ga0207712_1000090313 334
728 3300031090 Ga0265760_10004349 Ga0265760_100043494 334
729 3300035111 Ga0373923_0001712 Ga0373923_0001712_553_1611 334
730 3300035118 Ga0373954_0078404 Ga0373954_0078404_116_1174 334
731 3300035695 Ga0373927_0094995 Ga0373927_0094995_284_1342 334
732 3300036401 Ga0373937_0056926 Ga0373937_0056926_2041_3099 334
733 3300036401 Ga0373937_0283051 Ga0373937_0283051_220_1278 334
734 3300037853 Ga0436364_1548394 Ga0436364_1548394_87543_88586 334
735 3300046462 Ga0495651_0005707 Ga0495651_0005707_6471_7535 334
736 3300046463 Ga0495653_0009609 Ga0495653_0009609_6737_7795 334
737 3300046472 Ga0495580_0126661 Ga0495580_0126661_618_1676 334
738 3300046477 Ga0495664_0015717 Ga0495664_0015717_1403_2461 334
739 3300046516 Ga0495628_0010519 Ga0495628_0010519_2362_3420 334
740 3300046516 Ga0495628_0082803 Ga0495628_0082803_1247_2305 334
741 3300046517 Ga0495630_0347018 Ga0495630_0347018_14_1072 334
742 3300046529 Ga0495652_0000022 Ga0495652_0000022_3815_4837 334
743 3300046529 Ga0495652_0040858 Ga0495652_0040858_2300_3358 334
744 3300046535 Ga0495586_0039939 Ga0495586_0039939_123_1181 334
745 3300046536 Ga0495587_0050817 Ga0495587_0050817_985_2043 334
746 3300046543 Ga0495645_0108093 Ga0495645_0108093_52_1110 334
747 3300046559 Ga0495667_0071630 Ga0495667_0071630_876_1940 334
748 3300046675 Ga0495657_0015602 Ga0495657_0015602_636_1694 334
749 3300046680 Ga0495646_0003444 Ga0495646_0003444_6680_7738 334
750 3300046689 Ga0495613_0252322 Ga0495613_0252322_68_1126 334
751 3300046690 Ga0495624_0011138 Ga0495624_0011138_1480_2538 334
752 3300047319 Ga0495674_0009954 Ga0495674_0009954_3356_4414 334
753 3300047320 Ga0495672_0024603 Ga0495672_0024603_1113_2156 334
754 3300047322 Ga0495680_0000426 Ga0495680_0000426_31987_33051 334
755 3300047444 Ga0495675_0002656 Ga0495675_0002656_128_1186 334
756 3300047444 Ga0495675_0063195 Ga0495675_0063195_101_1165 334
757 3300047471 Ga0495684_0002041 Ga0495684_0002041_13505_14563 334
758 3300047673 Ga0495593_0009498 Ga0495593_0009498_4451_5509 334
759 3300048088 Ga0495602_0150086 Ga0495602_0150086_292_1350 334
760 3300048088 Ga0495602_0166364 Ga0495602_0166364_588_1652 334
761 3300048909 Ga0496106_0045863 Ga0496106_0045863_674_1729 334
762 3300048915 Ga0496112_0067609 Ga0496112_0067609_2112_3167 334
763 3300061719 Ga0466962_0070598 Ga0466962_0070598_458_1504 334
764 3300005331 Ga0070670_100010701 Ga0070670_1000107014 335
765 3300005365 Ga0070688_100103605 Ga0070688_1001036052 335
766 3300005437 Ga0070710_10000014 Ga0070710_1000001418 335
767 3300005458 Ga0070681_10103075 Ga0070681_101030753 335
768 3300005518 Ga0070699_100359125 Ga0070699_1003591251 335
769 3300005530 Ga0070679_100052825 Ga0070679_1000528252 335
770 3300005535 Ga0070684_100218906 Ga0070684_1002189062 335
771 3300005543 Ga0070672_100141568 Ga0070672_1001415682 335
772 3300005564 Ga0070664_100123701 Ga0070664_1001237012 335
773 3300005842 Ga0068858_100332056 Ga0068858_1003320562 335
774 3300009551 Ga0105238_10035203 Ga0105238_100352032 335
775 3300013104 Ga0157370_10077981 Ga0157370_100779813 335
776 3300014325 Ga0163163_10075367 Ga0163163_100753673 335
777 3300025315 Ga0207697_10000243 Ga0207697_1000024319 335
778 3300025898 Ga0207692_10000003 Ga0207692_10000003258 335
779 3300025901 Ga0207688_10001364 Ga0207688_1000136412 335
780 3300025919 Ga0207657_10004491 Ga0207657_1000449111 335
781 3300025921 Ga0207652_10233970 Ga0207652_102339701 335
782 3300025924 Ga0207694_10193313 Ga0207694_101933132 335
783 3300025925 Ga0207650_10119299 Ga0207650_101192992 335
784 3300025932 Ga0207690_10000057 Ga0207690_1000005744 335
785 3300025940 Ga0207691_10185734 Ga0207691_101857342 335
786 3300025945 Ga0207679_10124810 Ga0207679_101248101 335
787 3300035172 Ga0373955_0053770 Ga0373955_0053770_127_1212 335
788 3300039438 Ga0436360_0422338 Ga0436360_0422338_26996_28117 335
789 3300039447 Ga0436361_0400659 Ga0436361_0400659_64_1185 335
790 3300045976 Ga0466967_0037977 Ga0466967_0037977_2923_3963 335
791 3300048912 Ga0496109_0024472 Ga0496109_0024472_3078_4151 335
792 3300048913 Ga0496110_0063311 Ga0496110_0063311_364_1443 335
793 3300003659 JGI25404J52841_10000124 JGI25404J52841_100001248 336
794 3300005983 Ga0081540_1000281 Ga0081540_100028114 336
795 3300021377 Ga0213874_10015475 Ga0213874_100154752 336
796 3300021384 Ga0213876_10000555 Ga0213876_100005556 336
797 3300021384 Ga0213876_10003528 Ga0213876_100035289 336
798 3300021388 Ga0213875_10009086 Ga0213875_100090864 336
799 3300039437 Ga0436365_0787653 Ga0436365_0787653_1804_2850 336
800 3300039437 Ga0436365_1011053 Ga0436365_1011053_21031_22131 336
801 3300039450 Ga0436363_0587086 Ga0436363_0587086_4474_5520 336
802 3300039450 Ga0436363_1583874 Ga0436363_1583874_27505_28575 336
803 3300039453 Ga0436362_0871163 Ga0436362_0871163_14024_15070 336
804 3300046533 Ga0495640_0121907 Ga0495640_0121907_366_1448 336
805 3300046557 Ga0495622_0000057 Ga0495622_0000057_96354_97418 336
806 3300048912 Ga0496109_0001274 Ga0496109_0001274_16846_17898 337
807 3300001991 JGI24743J22301_10014070 JGI24743J22301_100140702 338
808 3300005328 Ga0070676_10000889 Ga0070676_1000088913 338
809 3300005334 Ga0068869_100000428 Ga0068869_10000042813 338
810 3300005338 Ga0068868_100000387 Ga0068868_10000038717 338
811 3300005364 Ga0070673_100000015 Ga0070673_10000001558 338
812 3300005459 Ga0068867_100000030 Ga0068867_10000003024 338
813 3300005543 Ga0070672_100422455 Ga0070672_1004224551 338
814 3300005614 Ga0068856_100048263 Ga0068856_1000482634 338
815 3300006881 Ga0068865_100000021 Ga0068865_10000002159 338
816 3300009098 Ga0105245_10003301 Ga0105245_1000330110 338
817 3300009148 Ga0105243_10001112 Ga0105243_1000111216 338
818 3300009176 Ga0105242_10005683 Ga0105242_1000568310 338
819 3300009553 Ga0105249_10064900 Ga0105249_100649003 338
820 3300011119 Ga0105246_10004310 Ga0105246_1000431012 338
821 3300013296 Ga0157374_10007766 Ga0157374_100077665 338
822 3300013297 Ga0157378_10002783 Ga0157378_1000278311 338
823 3300013308 Ga0157375_10001073 Ga0157375_100010735 338
824 3300014745 Ga0157377_10010953 Ga0157377_100109533 338
825 3300014969 Ga0157376_10000078 Ga0157376_1000007819 338
826 3300025907 Ga0207645_10002373 Ga0207645_100023733 338
827 3300025927 Ga0207687_10000683 Ga0207687_1000068311 338
828 3300025934 Ga0207686_10006604 Ga0207686_100066043 338
829 3300025935 Ga0207709_10000118 Ga0207709_1000011863 338
830 3300025938 Ga0207704_10000027 Ga0207704_1000002763 338
831 3300025942 Ga0207689_10000309 Ga0207689_1000030920 338
832 3300025960 Ga0207651_10000016 Ga0207651_1000001663 338
833 3300025961 Ga0207712_10035255 Ga0207712_100352552 338
834 3300026023 Ga0207677_10000171 Ga0207677_1000017141 338
835 3300026078 Ga0207702_10009858 Ga0207702_100098584 338
836 3300026089 Ga0207648_10000116 Ga0207648_1000011613 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

60

364

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4us5-assembly2.cif.gz_D crystal structure of apo-msno8 0.9269 3 333
4us5-assembly2.cif.gz_C crystal structure of apo-msno8 0.923 3 333
4us5-assembly1.cif.gz_A crystal structure of apo-msno8 0.9212 3 333
4us5-assembly2.cif.gz_C crystal structure of apo-msno8 0.915 3 333
4us5-assembly1.cif.gz_A crystal structure of apo-msno8 0.9131 3 333
ID Description Score Start End Superfamily
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9143 2 328 3.20.20.30
4us5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9075 3 333 3.20.20.30
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9035 2 328 3.20.20.30
4us5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8993 3 333 3.20.20.30
af_Q2FXV3_1_329_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8855 1 328 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A7W0MVQ3-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9881 3 332 GO:0005829
GO:0016705
AF-A0A2K9ITW5-F1-model_v4 Limonene 1,2-monooxygenase (EC 1.14.13.107) 0.985 4 112 GO:0005829
GO:0052601
AF-A0A7Y2Q2N7-F1-model_v4 deleted 0.9848 4 110
AF-A0A4Q5R4S9-F1-model_v4 MsnO8 family LLM class oxidoreductase (EC 1.-.-.-) 0.9835 4 122 GO:0005829
GO:0016705
AF-A0A3B9QRI4-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9795 4 152 GO:0005829
GO:0016705

Feature Viewer

pLDDT pTM Quality
93.36 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map