F482878

General Info

Members Datasets Scaffolds Average Seq Length
836 570 572 465

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10263203|Ga0105248_102632032
Length 516
Sequence MDWLSNINFYFRCRSTSLGLLKNNQSAAKLRANPAPIHGLQRGSIVIKKILIANRGEIAVRIVRACAEMGIRSVAIYTDPDRYALHVKRADEAYNVGSDPLQGYLNAHRIVNLAVETGCDALHPGYGFLSENPEIARVCAERGVIFIGPSAEVIHRMGDKTEARKAMIAAKIPVTPGTEGNLANLDEARKEAARIGYPIMLKATSGGGGRGIRRCDNEDELGRNFDRVISEATKAFGSADVFLEKCIVNPKHIEVQVLADKHGNTIHLFERDCSIQRRNQKLVEIAPSPQLTPEQRAYVGDLAVRAAQAVGYENAGTVEFLLADNQVYFMEMNTRVQVEHTITEAITGVDIVREQIRIAAGLPLGYRQEDIHHRGFALQFRINAEDPKNNFLPTFGKISRYYAPGGPGVRVDTAIYTGYTIPPYFDSMCLKLIVWSLTWEESLNRASRALDDMRLQGIKTTAPYYQRILENPVFRSGKFDTSFVDAHPELLQYSDKKRPEEIALAIATAIAAYAGL

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
3 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
4 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
5 2511231004 Pseudomonas sp. GM102 Isolate Nodule
6 2511231006 Pseudomonas sp. GM17 Isolate Nodule
7 2511231007 Pseudomonas sp. GM18 Isolate Nodule
8 2511231008 Pseudomonas sp. GM21 Isolate Nodule
9 2511231010 Pseudomonas sp. GM25 Isolate Nodule
10 2511231011 Pseudomonas sp. GM30 Isolate Nodule
11 2511231012 Pseudomonas sp. GM33 Isolate Nodule
12 2511231014 Pseudomonas sp. GM48 Isolate Nodule
13 2511231015 Pseudomonas sp. GM49 Isolate Nodule
14 2511231016 Pseudomonas sp. GM50 Isolate Nodule
15 2511231017 Pseudomonas sp. GM55 Isolate Nodule
16 2511231018 Pseudomonas sp. GM60 Isolate Nodule
17 2511231019 Pseudomonas sp. GM67 Isolate Nodule
18 2511231020 Pseudomonas sp. GM74 Isolate Nodule
19 2511231021 Pseudomonas sp. GM78 Isolate Nodule
20 2511231022 Pseudomonas sp. GM79 Isolate Nodule
21 2511231023 Pseudomonas sp. GM80 Isolate Nodule
22 2511231024 Pseudomonas sp. GM84 Isolate Nodule
23 2511231031 Pseudomonas sp. GM16 Isolate Nodule
24 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
25 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
26 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
27 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
28 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
29 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
30 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
31 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
32 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
33 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
34 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
35 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
36 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
37 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
38 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
39 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
40 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
41 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
42 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
43 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
44 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
45 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
46 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
47 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
48 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
49 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
50 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
51 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
52 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
53 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
54 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
55 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
56 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
57 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
58 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
59 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
60 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
61 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
62 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
63 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
64 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
65 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
66 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
67 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
68 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
69 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
70 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
71 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
72 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
73 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
74 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
75 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
76 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
77 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
78 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
79 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
80 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
81 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
82 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
83 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
84 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
85 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
86 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
87 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
88 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
89 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
90 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
91 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
92 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
93 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
94 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
95 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
96 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
97 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
98 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
99 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
100 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
101 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
102 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
103 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
104 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
105 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
106 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
107 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
108 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
109 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
110 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
111 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
112 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
113 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
114 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
115 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
116 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
117 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
118 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
119 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
120 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
121 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
122 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
123 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
124 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
125 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
126 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
127 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
128 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
129 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
130 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
131 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
132 2765235841 Pseudomonas putida AA7 Isolate Unclassified
133 2773857670 Pseudomonas sp. 478 Isolate Unclassified
134 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
135 2773857673 Pseudomonas sp. 443 Isolate Unclassified
136 2784132063 Pseudomonas sp. 424 Isolate Unclassified
137 2784132072 Pseudomonas sp. 460 Isolate Unclassified
138 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
139 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
140 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
141 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
142 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
143 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
144 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
145 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
146 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
147 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
148 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
149 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
150 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
151 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
152 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
153 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
154 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
155 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
156 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
157 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
158 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
159 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
160 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
161 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
162 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
163 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
164 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
165 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
166 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
167 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
168 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
169 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
170 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
171 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
172 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
173 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
174 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
175 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
176 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
177 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
178 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
179 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
180 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
181 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
182 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
183 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
184 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
185 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
186 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
187 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
188 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
189 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
190 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
191 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
192 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
193 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
194 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
195 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
196 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
197 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
198 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
199 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
200 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
201 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
202 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
203 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
204 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
205 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
206 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
207 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
208 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
209 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
210 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
211 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
212 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
213 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
214 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
215 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
216 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
217 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
218 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
219 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
220 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
221 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
222 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
223 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
224 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
225 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
226 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
227 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
228 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
229 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
230 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
231 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
232 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
233 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
234 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
235 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
236 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
237 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
238 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
239 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
240 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
241 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
242 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
243 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
244 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
245 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
246 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
247 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
248 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
249 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
250 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
251 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
252 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
253 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
254 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
255 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
256 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
257 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
258 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
259 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
260 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
261 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
262 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
263 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
264 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
265 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
266 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
267 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
268 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
269 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
270 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
271 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
272 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
273 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
274 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
275 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
276 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
277 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
278 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
279 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
280 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
281 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
282 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
283 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
284 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
285 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
286 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
287 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
288 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
289 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
290 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
291 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
292 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
293 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
294 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
295 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
296 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
297 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
298 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
299 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
300 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
301 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
302 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
303 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
304 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
305 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
306 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
307 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
308 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
309 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
310 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
311 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
312 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
313 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
314 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
315 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
316 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
317 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
318 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
319 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
320 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
321 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
323 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
324 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
325 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
326 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
327 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
328 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
329 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
330 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
331 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
332 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
333 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
334 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
374 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
375 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
376 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
377 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
378 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
379 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
380 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
381 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
385 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
386 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
387 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
388 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
389 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
390 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
391 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
392 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
393 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
394 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
395 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
396 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
397 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
398 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
399 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
400 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
401 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
402 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
403 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
404 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
405 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
406 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
407 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
408 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
409 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
410 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
411 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
412 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
413 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
414 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
415 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
416 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
417 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
418 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
419 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
420 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
421 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
422 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
423 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
424 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
425 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
426 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
427 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
428 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
429 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
430 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
431 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
432 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
433 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
434 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
435 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
436 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
437 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
438 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
439 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
440 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
441 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
442 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
443 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
444 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
445 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
446 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
447 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
448 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
449 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
450 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
451 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
452 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
453 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
454 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
455 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
456 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
457 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
458 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
459 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
460 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
461 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
462 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
463 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
464 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
465 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
466 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
467 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
468 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
469 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
470 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
471 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
472 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
473 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
474 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
475 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
476 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
477 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
478 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
479 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
480 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
481 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
482 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
483 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
484 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
485 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
486 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
487 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
488 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
489 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
490 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
491 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
492 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
493 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
494 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
495 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
496 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
497 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
498 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
499 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
500 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
501 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
502 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
503 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
504 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
505 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
506 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
507 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
508 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
509 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
510 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
511 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
512 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
513 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
514 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
515 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
516 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
517 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
518 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
519 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
520 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
521 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
522 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
523 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
524 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
525 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
526 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
527 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
528 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
529 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
530 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
531 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
532 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
533 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
534 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
535 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
536 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
537 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
538 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
539 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
540 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
541 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
542 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
543 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
544 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
545 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
546 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
547 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
548 8052494512 Pseudomonas putida LD6 Isolate Unclassified
549 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
550 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
551 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
552 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
553 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
554 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
555 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
556 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
557 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
558 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
559 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
560 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
561 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
562 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
563 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
564 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
565 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
566 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
567 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
568 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
569 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
570 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 67.46
Metatranscriptomes 0.96
Isolates 31.58

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 7.06
Nodule 3.35
Rhizoplane 8.73
Rhizosphere 66.51
Stem 0
Stem Tuber 0
Unclassified 14.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_41 2124908027 Bacteria 51011
2 JGI24741J21665_1003852 3300001915 Bacteria 3465
3 Ga0055538_1000012 3300003751 Bacteria 353826
4 Ga0055539_1000017 3300003752 Bacteria 353873
5 Ga0055533_1000021 3300003756 Bacteria 353826
6 Ga0055532_1000020 3300003758 Bacteria 270853
7 Ga0055525_1000078 3300003759 Bacteria 165788
8 Ga0055536_1000055 3300003781 Bacteria 107659
9 Ga0055536_1000476 3300003781 Bacteria 27924
10 Ga0055536_1000603 3300003781 Bacteria 24478
11 Ga0055530_10000077 3300003791 Bacteria 84280
12 Ga0055540_1009768 3300003792 Bacteria 3273
13 Ga0055531_10002092 3300003794 Bacteria 13716
14 Ga0055541_1000012 3300003841 Bacteria 353826
15 Ga0058860_10937114 3300004801 Bacteria 3288
16 Ga0065714_10000021 3300005288 Bacteria 18064
17 Ga0065714_10064711 3300005288 Bacteria 22025
18 Ga0070658_10002968 3300005327 Bacteria 14058
19 Ga0070658_10029859 3300005327 Bacteria 4379
20 Ga0070683_100000009 3300005329 Bacteria 319830
21 Ga0070670_100000011 3300005331 Bacteria 263074
22 Ga0070670_100020516 3300005331 Bacteria 5681
23 Ga0070666_10038075 3300005335 Bacteria 3199
24 Ga0070680_100005647 3300005336 Bacteria 9479
25 Ga0068868_100003057 3300005338 Bacteria 11649
26 Ga0070660_100065481 3300005339 Bacteria 2828
27 Ga0070661_100000080 3300005344 Bacteria 77046
28 Ga0070692_10020839 3300005345 Bacteria 3182
29 Ga0070668_100004421 3300005347 Bacteria 10434
30 Ga0070668_100019840 3300005347 Bacteria 5065
31 Ga0070669_100005454 3300005353 Bacteria 9178
32 Ga0070669_100005479 3300005353 Bacteria 9160
33 Ga0070671_100000073 3300005355 Bacteria 64821
34 Ga0070671_100001935 3300005355 Bacteria 15878
35 Ga0070688_100002352 3300005365 Bacteria 9538
36 Ga0070659_100001997 3300005366 Bacteria 14589
37 Ga0070659_100006344 3300005366 Bacteria 8542
38 Ga0070667_100000092 3300005367 Bacteria 111329
39 Ga0070681_10005272 3300005458 Bacteria 12481
40 Ga0070685_10000035 3300005466 Bacteria 81433
41 Ga0070698_100100748 3300005471 Bacteria 2861
42 Ga0070699_100077181 3300005518 Bacteria 2900
43 Ga0070679_100011495 3300005530 Bacteria 8436
44 Ga0070679_100021297 3300005530 Bacteria 6327
45 Ga0070684_100002860 3300005535 Bacteria 12834
46 Ga0068853_100000102 3300005539 Bacteria 57320
47 Ga0068853_100109749 3300005539 Bacteria 2449
48 Ga0070665_100000505 3300005548 Bacteria 55944
49 Ga0070665_100026354 3300005548 Bacteria 5855
50 Ga0070665_100065364 3300005548 Bacteria 3649
51 Ga0070665_100262416 3300005548 Bacteria 1728
52 Ga0068855_100026342 3300005563 Bacteria 6955
53 Ga0068855_100064407 3300005563 Bacteria 4275
54 Ga0068854_100005563 3300005578 Bacteria 7962
55 Ga0068859_100000320 3300005617 Bacteria 48067
56 Ga0068859_100015061 3300005617 Bacteria 7764
57 Ga0068864_100000020 3300005618 Bacteria 263460
58 Ga0068851_10000039 3300005834 Bacteria 93193
59 Ga0068863_100016045 3300005841 Bacteria 7183
60 Ga0068858_100003076 3300005842 Bacteria 16705
61 Ga0068858_100075423 3300005842 Bacteria 3132
62 Ga0068860_100000260 3300005843 Bacteria 77214
63 Ga0068860_100007474 3300005843 Bacteria 10930
64 Ga0068860_100049278 3300005843 Bacteria 4012
65 Ga0068862_100004279 3300005844 Bacteria 12078
66 Ga0068862_100019392 3300005844 Bacteria 5676
67 Ga0068862_100069896 3300005844 Bacteria 3031
68 Ga0070717_10001865 3300006028 Bacteria 14733
69 Ga0075364_10039141 3300006051 Bacteria 3073
70 Ga0075370_10050119 3300006353 Bacteria 2368
71 Ga0097620_100000320 3300006931 Bacteria 48067
72 Ga0097620_100015061 3300006931 Bacteria 7764
73 Ga0099823_1000692 3300006944 Bacteria 24218
74 Ga0079104_1000189 3300006946 Bacteria 86039
75 Ga0079104_1000262 3300006946 Bacteria 69874
76 Ga0079104_1007624 3300006946 Bacteria 3887
77 Ga0079104_1018491 3300006946 Bacteria 1972
78 Ga0105251_10000100 3300009011 Bacteria 84424
79 Ga0105251_10000915 3300009011 Bacteria 26461
80 Ga0105251_10001857 3300009011 Bacteria 17362
81 Ga0105251_10005123 3300009011 Bacteria 8670
82 Ga0105251_10011509 3300009011 Bacteria 5050
83 Ga0105244_10000073 3300009036 Bacteria 115279
84 Ga0105244_10000534 3300009036 Bacteria 33919
85 Ga0105244_10019436 3300009036 Bacteria 3791
86 Ga0105244_10051692 3300009036 Bacteria 2094
87 Ga0105244_10077911 3300009036 Bacteria 1644
88 Ga0105250_10000138 3300009092 Bacteria 63230
89 Ga0105240_10007900 3300009093 Bacteria 15342
90 Ga0105240_10010977 3300009093 Bacteria 12686
91 Ga0105245_10000027 3300009098 Bacteria 162116
92 Ga0105245_10216271 3300009098 Bacteria 1847
93 Ga0105243_10000132 3300009148 Bacteria 85455
94 Ga0105243_10005537 3300009148 Bacteria 9840
95 Ga0105243_10007452 3300009148 Bacteria 8408
96 Ga0105242_10000617 3300009176 Bacteria 27878
97 Ga0105248_10130521 3300009177 Bacteria 2835
98 Ga0105248_10263203 3300009177 Bacteria 1941
99 Ga0105238_10000001 3300009551 Bacteria 2036163
100 Ga0105238_10141645 3300009551 Bacteria 2381
101 Ga0105249_10003939 3300009553 Bacteria 12817
102 Ga0105239_10048500 3300010375 Bacteria 4657
103 Ga0157373_10009007 3300013100 Bacteria 7385
104 Ga0157373_10157527 3300013100 Bacteria 1597
105 Ga0157373_10158545 3300013100 Bacteria 1592
106 Ga0157371_10000109 3300013102 Bacteria 124990
107 Ga0157371_10018042 3300013102 Bacteria 5226
108 Ga0157371_10033858 3300013102 Bacteria 3669
109 Ga0157370_10009649 3300013104 Bacteria 10265
110 Ga0157369_10001715 3300013105 Bacteria 26679
111 Ga0157369_10004000 3300013105 Bacteria 17485
112 Ga0157369_10299626 3300013105 Bacteria 1672
113 Ga0157374_10000005 3300013296 Bacteria 646767
114 Ga0157378_10000818 3300013297 Bacteria 28962
115 Ga0157378_10035068 3300013297 Bacteria 4436
116 Ga0163162_10000334 3300013306 Bacteria 43059
117 Ga0157372_10011591 3300013307 Bacteria 9381
118 Ga0157372_10062727 3300013307 Bacteria 4165
119 Ga0157372_10077969 3300013307 Bacteria 3743
120 Ga0157372_10078690 3300013307 Bacteria 3726
121 Ga0157375_10000009 3300013308 Bacteria 366440
122 Ga0157375_10000540 3300013308 Bacteria 33973
123 Ga0163163_10001645 3300014325 Bacteria 18808
124 Ga0163163_10003882 3300014325 Bacteria 12744
125 Ga0157377_10000001 3300014745 Bacteria 623098
126 Ga0157379_10000787 3300014968 Bacteria 25755
127 Ga0157376_10000011 3300014969 Bacteria 307434
128 Ga0206356_11006182 3300020070 Bacteria 2555
129 Ga0206349_1381135 3300020075 Bacteria 5198
130 Ga0206351_10045381 3300020077 Bacteria 3212
131 Ga0206352_10556016 3300020078 Bacteria 13390
132 Ga0206350_10298777 3300020080 Bacteria 4253
133 Ga0213873_10002380 3300021358 Bacteria 3249
134 Ga0213874_10000063 3300021377 Bacteria 15693
135 Ga0213876_10000064 3300021384 Bacteria 128492
136 Ga0213876_10000129 3300021384 Bacteria 82128
137 Ga0213876_10013932 3300021384 Bacteria 4261
138 Ga0224712_10005061 3300022467 Bacteria 3627
139 Ga0224712_10007864 3300022467 Bacteria 3125
140 Ga0209435_100365 3300025206 Bacteria 10198
141 Ga0209760_100020 3300025207 Bacteria 169879
142 Ga0209760_100148 3300025207 Bacteria 43685
143 Ga0209784_100007 3300025224 Bacteria 747715
144 Ga0209566_100009 3300025225 Bacteria 554018
145 Ga0209674_100021 3300025226 Bacteria 629811
146 Ga0209147_100009 3300025229 Bacteria 747409
147 Ga0209563_100018 3300025230 Bacteria 747850
148 Ga0207427_100005 3300025231 Bacteria 797999
149 Ga0207427_100006 3300025231 Bacteria 785415
150 Ga0209437_100013 3300025233 Bacteria 785457
151 Ga0209437_100018 3300025233 Bacteria 694400
152 Ga0209258_100321 3300025242 Bacteria 72995
153 Ga0209646_1000334 3300025246 Bacteria 35374
154 Ga0209677_100012 3300025253 Bacteria 554018
155 Ga0209233_1000021 3300025261 Bacteria 798078
156 Ga0209233_1000022 3300025261 Bacteria 785415
157 Ga0209675_1006633 3300025291 Bacteria 4605
158 Ga0209676_1000015 3300025292 Bacteria 784458
159 Ga0209676_1000271 3300025292 Bacteria 108269
160 Ga0209676_1000278 3300025292 Bacteria 106516
161 Ga0209676_1000765 3300025292 Bacteria 43254
162 Ga0209050_1000030 3300025298 Bacteria 463381
163 Ga0209050_1000061 3300025298 Bacteria 321435
164 Ga0209050_1000241 3300025298 Bacteria 118446
165 Ga0209051_1000012 3300025303 Bacteria 595474
166 Ga0209051_1000088 3300025303 Bacteria 180480
167 Ga0209051_1000203 3300025303 Bacteria 105272
168 Ga0209257_1000143 3300025304 Bacteria 199975
169 Ga0209257_1000807 3300025304 Bacteria 45532
170 Ga0207656_10000009 3300025321 Bacteria 245637
171 Ga0207696_1000055 3300025711 Bacteria 258289
172 Ga0207696_1000078 3300025711 Bacteria 207623
173 Ga0207696_1000080 3300025711 Bacteria 199217
174 Ga0207696_1000180 3300025711 Bacteria 98909
175 Ga0207696_1000184 3300025711 Bacteria 97606
176 Ga0207696_1002622 3300025711 Bacteria 8708
177 Ga0207655_1000033 3300025728 Bacteria 377066
178 Ga0207655_1000116 3300025728 Bacteria 161950
179 Ga0207655_1000261 3300025728 Bacteria 83123
180 Ga0207655_1000663 3300025728 Bacteria 40591
181 Ga0207655_1000757 3300025728 Bacteria 36205
182 Ga0207655_1001803 3300025728 Bacteria 18535
183 Ga0207655_1002198 3300025728 Bacteria 16194
184 Ga0207655_1002508 3300025728 Bacteria 14812
185 Ga0207655_1004440 3300025728 Bacteria 9948
186 Ga0207655_1007840 3300025728 Bacteria 6870
187 Ga0207655_1022044 3300025728 Bacteria 3207
188 Ga0207655_1022423 3300025728 Bacteria 3166
189 Ga0207655_1033080 3300025728 Bacteria 2350
190 Ga0207713_1000010 3300025735 Bacteria 528374
191 Ga0207713_1000188 3300025735 Bacteria 86627
192 Ga0207713_1001062 3300025735 Bacteria 23732
193 Ga0207713_1001543 3300025735 Bacteria 18099
194 Ga0207713_1002413 3300025735 Bacteria 13648
195 Ga0207713_1004194 3300025735 Bacteria 9452
196 Ga0207713_1005795 3300025735 Bacteria 7648
197 Ga0207713_1008678 3300025735 Bacteria 5811
198 Ga0207713_1013286 3300025735 Bacteria 4347
199 Ga0207713_1028154 3300025735 Bacteria 2540
200 Ga0207713_1045590 3300025735 Bacteria 1789
201 Ga0207710_10004718 3300025900 Bacteria 5911
202 Ga0207680_10007676 3300025903 Bacteria 5271
203 Ga0207705_10002011 3300025909 Bacteria 15815
204 Ga0207707_10009358 3300025912 Bacteria 8498
205 Ga0207695_10001655 3300025913 Bacteria 35911
206 Ga0207695_10039276 3300025913 Bacteria 5088
207 Ga0207695_10054590 3300025913 Bacteria 4170
208 Ga0207671_10000027 3300025914 Bacteria 264907
209 Ga0207660_10000450 3300025917 Bacteria 27082
210 Ga0207657_10000753 3300025919 Bacteria 34370
211 Ga0207657_10012142 3300025919 Bacteria 8511
212 Ga0207649_10000007 3300025920 Bacteria 334217
213 Ga0207652_10002123 3300025921 Bacteria 17019
214 Ga0207652_10052993 3300025921 Bacteria 3484
215 Ga0207681_10000059 3300025923 Bacteria 104079
216 Ga0207681_10001405 3300025923 Bacteria 15546
217 Ga0207681_10001723 3300025923 Bacteria 14052
218 Ga0207681_10002370 3300025923 Bacteria 11977
219 Ga0207681_10118515 3300025923 Bacteria 1938
220 Ga0207694_10000001 3300025924 Bacteria 4078485
221 Ga0207694_10135439 3300025924 Bacteria 1977
222 Ga0207650_10000025 3300025925 Bacteria 265351
223 Ga0207650_10000044 3300025925 Bacteria 183146
224 Ga0207650_10000089 3300025925 Bacteria 120962
225 Ga0207650_10000233 3300025925 Bacteria 61970
226 Ga0207687_10000006 3300025927 Bacteria 641680
227 Ga0207700_10023294 3300025928 Bacteria 4266
228 Ga0207644_10000104 3300025931 Bacteria 61701
229 Ga0207644_10001035 3300025931 Bacteria 17819
230 Ga0207690_10001238 3300025932 Bacteria 16133
231 Ga0207706_10007306 3300025933 Bacteria 10214
232 Ga0207686_10000349 3300025934 Bacteria 32873
233 Ga0207709_10000061 3300025935 Bacteria 199097
234 Ga0207709_10000063 3300025935 Bacteria 191397
235 Ga0207709_10003327 3300025935 Bacteria 9629
236 Ga0207709_10063043 3300025935 Bacteria 2322
237 Ga0207709_10073915 3300025935 Bacteria 2174
238 Ga0207711_10000773 3300025941 Bacteria 31492
239 Ga0207711_10036861 3300025941 Bacteria 4151
240 Ga0207689_10008147 3300025942 Bacteria 9139
241 Ga0207661_10000007 3300025944 Bacteria 471636
242 Ga0207679_10000013 3300025945 Bacteria 334197
243 Ga0207667_10004134 3300025949 Bacteria 17835
244 Ga0207668_10003520 3300025972 Bacteria 9198
245 Ga0207668_10004508 3300025972 Bacteria 8188
246 Ga0207668_10016601 3300025972 Bacteria 4597
247 Ga0207640_10000934 3300025981 Bacteria 16348
248 Ga0207658_10000008 3300025986 Bacteria 265351
249 Ga0207658_10011556 3300025986 Bacteria 6010
250 Ga0207677_10000195 3300026023 Bacteria 48707
251 Ga0207703_10090161 3300026035 Bacteria 2576
252 Ga0207639_10000006 3300026041 Bacteria 544415
253 Ga0207639_10000091 3300026041 Bacteria 76122
254 Ga0207641_10002563 3300026088 Bacteria 16724
255 Ga0207641_10018967 3300026088 Bacteria 5642
256 Ga0207641_10088251 3300026088 Bacteria 2707
257 Ga0207676_10000024 3300026095 Bacteria 265351
258 Ga0207674_10039659 3300026116 Bacteria 4881
259 Ga0209281_1000016 3300027111 Bacteria 588107
260 Ga0209281_1000091 3300027111 Bacteria 242588
261 Ga0209389_1000036 3300027296 Bacteria 126146
262 Ga0209371_1000193 3300027312 Bacteria 89712
263 Ga0209371_1001364 3300027312 Bacteria 16874
264 Ga0209981_1000784 3300027378 Bacteria 4012
265 Ga0209999_1005240 3300027543 Bacteria 2330
266 Ga0209983_1001207 3300027665 Bacteria 5728
267 Ga0209971_1000638 3300027682 Bacteria 9122
268 Ga0209813_10002464 3300027866 Bacteria 4238
269 Ga0268266_10000355 3300028379 Bacteria 70950
270 Ga0268266_10002403 3300028379 Bacteria 20178
271 Ga0268266_10020535 3300028379 Bacteria 5629
272 Ga0268265_10000665 3300028380 Bacteria 34098
273 Ga0268265_10002059 3300028380 Bacteria 15750
274 Ga0268264_10000169 3300028381 Bacteria 144978
275 Ga0268264_10000472 3300028381 Bacteria 54726
276 Ga0268264_10004482 3300028381 Bacteria 11915
277 Ga0265334_10004093 3300028573 Bacteria 6537
278 Ga0265338_10038175 3300028800 Bacteria 4555
279 Ga0265338_10073274 3300028800 Bacteria 2920
280 Ga0265338_10104720 3300028800 Bacteria 2295
281 Ga0265324_10000112 3300029957 Bacteria 64370
282 Ga0265324_10004519 3300029957 Bacteria 6247
283 Ga0268256_1000137 3300030500 Bacteria 100825
284 Ga0268256_1001172 3300030500 Bacteria 16874
285 Ga0307511_10002730 3300030521 Bacteria 18362
286 Ga0314311_1212095 3300030733 Bacteria 2045
287 Ga0316181_1029464 3300030744 Bacteria 3693
288 Ga0265328_10000042 3300031239 Bacteria 89241
289 Ga0265328_10014886 3300031239 Bacteria 3055
290 Ga0265320_10035888 3300031240 Bacteria 2510
291 Ga0265325_10017393 3300031241 Bacteria 3996
292 Ga0265325_10018926 3300031241 Bacteria 3815
293 Ga0265331_10000237 3300031250 Bacteria 66600
294 Ga0265331_10002760 3300031250 Bacteria 11660
295 Ga0265331_10008832 3300031250 Bacteria 5705
296 Ga0265331_10043357 3300031250 Bacteria 2179
297 Ga0265327_10000458 3300031251 Bacteria 73095
298 Ga0265327_10000517 3300031251 Bacteria 66613
299 Ga0265327_10000797 3300031251 Bacteria 48346
300 Ga0265327_10001071 3300031251 Bacteria 38153
301 Ga0265327_10002323 3300031251 Bacteria 20327
302 Ga0265327_10002826 3300031251 Bacteria 17525
303 Ga0265327_10006608 3300031251 Bacteria 9219
304 Ga0265327_10022916 3300031251 Bacteria 3714
305 Ga0307513_10000856 3300031456 Bacteria 44279
306 Ga0307513_10006523 3300031456 Bacteria 15243
307 Ga0307408_100000028 3300031548 Bacteria 233440
308 Ga0316579_10002627 3300031691 Bacteria 6824
309 Ga0316579_10002969 3300031691 Bacteria 6514
310 Ga0316579_10005772 3300031691 Bacteria 5016
311 Ga0316579_10010773 3300031691 Bacteria 3872
312 Ga0316579_10047315 3300031691 Bacteria 2008
313 Ga0265314_10000101 3300031711 Bacteria 129229
314 Ga0316576_10005802 3300031727 Bacteria 7609
315 Ga0316576_10033496 3300031727 Bacteria 3658
316 Ga0316576_10051906 3300031727 Bacteria 2985
317 Ga0316578_10001370 3300031728 Bacteria 9825
318 Ga0316578_10007862 3300031728 Bacteria 5386
319 Ga0316578_10018077 3300031728 Bacteria 3853
320 Ga0316578_10044839 3300031728 Bacteria 2573
321 Ga0307516_10103020 3300031730 Bacteria 2668
322 Ga0316577_10001334 3300031733 Bacteria 11567
323 Ga0316577_10027660 3300031733 Bacteria 3162
324 Ga0316577_10028093 3300031733 Bacteria 3138
325 Ga0307416_100255386 3300032002 Bacteria 1709
326 Ga0307414_10002499 3300032004 Bacteria 9643
327 Ga0307414_10074618 3300032004 Bacteria 2458
328 Ga0316583_10001482 3300032133 Bacteria 7860
329 Ga0316583_10004806 3300032133 Bacteria 4825
330 Ga0316583_10011726 3300032133 Bacteria 3161
331 Ga0373952_0000081 3300035092 Bacteria 12587
332 Ga0373956_0000111 3300035119 Bacteria 28217
333 Ga0316574_0000871 3300035398 Bacteria 13314
334 Ga0316574_0002338 3300035398 Bacteria 9472
335 Ga0316574_0002929 3300035398 Bacteria 8685
336 Ga0316574_0012683 3300035398 Bacteria 4827
337 Ga0316574_0032935 3300035398 Bacteria 3153
338 Ga0316574_0090224 3300035398 Bacteria 1953
339 Ga0316574_0119965 3300035398 Bacteria 1688
340 Ga0373927_0000014 3300035695 Bacteria 156951
341 Ga0373933_0005911 3300035724 Bacteria 6657
342 Ga0373933_0009530 3300035724 Bacteria 5304
343 Ga0316582_0001537 3300036647 Bacteria 10216
344 Ga0316582_0012443 3300036647 Bacteria 4751
345 Ga0316582_0017173 3300036647 Bacteria 4179
346 Ga0316582_0026698 3300036647 Bacteria 3478
347 Ga0316582_0032083 3300036647 Bacteria 3215
348 Ga0316582_0051849 3300036647 Bacteria 2605
349 Ga0316582_0058687 3300036647 Bacteria 2461
350 Ga0316584_0005374 3300036712 Bacteria 8593
351 Ga0316584_0005919 3300036712 Bacteria 8252
352 Ga0316584_0015783 3300036712 Bacteria 5407
353 Ga0316584_0050907 3300036712 Bacteria 3097
354 Ga0316584_0057831 3300036712 Bacteria 2903
355 Ga0316581_0001281 3300037588 Bacteria 5582
356 Ga0316581_0007531 3300037588 Bacteria 2926
357 Ga0316581_0013178 3300037588 Bacteria 2341
358 Ga0237819_01684 3300038705 Bacteria 5386
359 Ga0400484_17851 3300038725 Bacteria 9621
360 Ga0400490_31124 3300038726 Bacteria 15244
361 Ga0400483_033002 3300039062 Bacteria 14397
362 Ga0400483_272783 3300039062 Bacteria 2436
363 Ga0436365_0050989 3300039437 Bacteria 155528
364 Ga0436365_0218820 3300039437 Bacteria 38620
365 Ga0436365_0831887 3300039437 Bacteria 5372
366 Ga0436365_1755513 3300039437 Bacteria 3362
367 Ga0436363_0335382 3300039450 Bacteria 46141
368 Ga0436363_0416934 3300039450 Bacteria 10299
369 Ga0436363_0886746 3300039450 Bacteria 2403
370 Ga0436362_0635262 3300039453 Bacteria 12258
371 Ga0436362_1162152 3300039453 Bacteria 6862
372 Ga0439436_0000523 3300041404 Bacteria 10066
373 Ga0439438_001138 3300041405 Bacteria 11858
374 Ga0439438_007133 3300041405 Bacteria 3852
375 Ga0439447_000760 3300041407 Bacteria 11932
376 Ga0439466_0001576 3300041411 Bacteria 8911
377 Ga0439466_0007704 3300041411 Bacteria 4067
378 Ga0439466_0017129 3300041411 Bacteria 2612
379 Ga0439466_0038689 3300041411 Bacteria 1601
380 Ga0439431_0011266 3300041997 Bacteria 2041
381 Ga0439432_003747 3300042006 Bacteria 5611
382 Ga0439432_009558 3300042006 Bacteria 3378
383 Ga0439451_000530 3300042009 Bacteria 7252
384 Ga0439452_000223 3300042010 Bacteria 40174
385 Ga0439452_000459 3300042010 Bacteria 22949
386 Ga0439456_002263 3300042013 Bacteria 3873
387 Ga0439463_000465 3300042016 Bacteria 11270
388 Ga0450911_000054 3300042115 Bacteria 47325
389 Ga0450911_002268 3300042115 Bacteria 3860
390 Ga0450906_002233 3300042145 Bacteria 4233
391 Ga0450909_000438 3300042185 Bacteria 5382
392 Ga0439434_0000468 3300042435 Bacteria 11497
393 Ga0439464_0000184 3300042439 Bacteria 10818
394 Ga0451577_0000002 3300042876 Bacteria 1731375
395 Ga0451577_0013299 3300042876 Bacteria 7709
396 Ga0451577_0093641 3300042876 Bacteria 2683
397 Ga0451577_0232660 3300042876 Bacteria 1667
398 Ga0466969_0001310 3300044656 Bacteria 13409
399 Ga0466972_0007676 3300044658 Bacteria 5416
400 Ga0466972_0019672 3300044658 Bacteria 3375
401 Ga0466972_0042205 3300044658 Bacteria 2219
402 Ga0453683_0000003 3300044673 Bacteria 942572
403 Ga0453683_0002765 3300044673 Bacteria 13350
404 Ga0466965_0020518 3300044683 Bacteria 3177
405 Ga0466966_0000787 3300044684 Bacteria 20201
406 Ga0466964_0002550 3300044706 Bacteria 6492
407 Ga0453684_0000002 3300044712 Bacteria 1731375
408 Ga0453684_0000687 3300044712 Bacteria 120554
409 Ga0453684_0003666 3300044712 Bacteria 34081
410 Ga0466971_0033321 3300044719 Bacteria 2308
411 Ga0466968_0000057 3300044735 Bacteria 32835
412 Ga0466970_0000160 3300044765 Bacteria 32141
413 Ga0466970_0015922 3300044765 Bacteria 3872
414 Ga0466957_0005707 3300044842 Bacteria 6998
415 Ga0466960_0076157 3300044901 Bacteria 1680
416 Ga0466959_0048031 3300045049 Bacteria 3138
417 Ga0451576_0000004 3300045051 Bacteria 1312238
418 Ga0451576_0000427 3300045051 Bacteria 96966
419 Ga0451576_0000819 3300045051 Bacteria 60723
420 Ga0451576_0054354 3300045051 Bacteria 4193
421 Ga0466958_0002185 3300045836 Bacteria 9742
422 Ga0495617_000124 3300046452 Bacteria 50836
423 Ga0495627_000115 3300046453 Bacteria 99960
424 Ga0495627_001179 3300046453 Bacteria 16634
425 Ga0495627_001825 3300046453 Bacteria 11327
426 Ga0495591_000061 3300046458 Bacteria 126594
427 Ga0495591_000145 3300046458 Bacteria 75506
428 Ga0495591_000624 3300046458 Bacteria 26363
429 Ga0495591_004612 3300046458 Bacteria 6642
430 Ga0495591_010444 3300046458 Bacteria 3599
431 Ga0495653_0011786 3300046463 Bacteria 7139
432 Ga0495650_0002691 3300046471 Bacteria 13800
433 Ga0495605_0000079 3300046474 Bacteria 126756
434 Ga0495605_0000485 3300046474 Bacteria 34525
435 Ga0495605_0000504 3300046474 Bacteria 33500
436 Ga0495605_0005431 3300046474 Bacteria 7420
437 Ga0495639_0002183 3300046475 Bacteria 8619
438 Ga0495584_0092507 3300046491 Bacteria 1525
439 Ga0495585_0004733 3300046492 Bacteria 8763
440 Ga0495585_0008035 3300046492 Bacteria 6415
441 Ga0495594_0001003 3300046499 Bacteria 14698
442 Ga0495596_0000444 3300046500 Bacteria 26355
443 Ga0495596_0009162 3300046500 Bacteria 4366
444 Ga0495607_0000113 3300046501 Bacteria 84993
445 Ga0495607_0000257 3300046501 Bacteria 57042
446 Ga0495607_0001422 3300046501 Bacteria 21340
447 Ga0495607_0002895 3300046501 Bacteria 13555
448 Ga0495607_0011940 3300046501 Bacteria 5754
449 Ga0495607_0011965 3300046501 Bacteria 5744
450 Ga0495583_0000362 3300046506 Bacteria 71060
451 Ga0495583_0003277 3300046506 Bacteria 12571
452 Ga0495583_0014121 3300046506 Bacteria 4419
453 Ga0495606_0000139 3300046507 Bacteria 124493
454 Ga0495606_0000370 3300046507 Bacteria 76903
455 Ga0495606_0009708 3300046507 Bacteria 8098
456 Ga0495606_0052736 3300046507 Bacteria 2642
457 Ga0495610_0001897 3300046512 Bacteria 18058
458 Ga0495610_0005754 3300046512 Bacteria 8727
459 Ga0495620_0000044 3300046515 Bacteria 110431
460 Ga0495620_0001765 3300046515 Bacteria 12728
461 Ga0495620_0006874 3300046515 Bacteria 6217
462 Ga0495620_0016182 3300046515 Bacteria 3749
463 Ga0495620_0040048 3300046515 Bacteria 2065
464 Ga0495631_0000056 3300046518 Bacteria 69858
465 Ga0495632_0000687 3300046519 Bacteria 30881
466 Ga0495632_0003753 3300046519 Bacteria 10627
467 Ga0495637_0000066 3300046520 Bacteria 89139
468 Ga0495637_0000239 3300046520 Bacteria 42753
469 Ga0495637_0001701 3300046520 Bacteria 12706
470 Ga0495637_0007848 3300046520 Bacteria 5265
471 Ga0495643_0000928 3300046522 Bacteria 30666
472 Ga0495643_0002662 3300046522 Bacteria 13828
473 Ga0495644_0001190 3300046523 Bacteria 10671
474 Ga0495644_0004724 3300046523 Bacteria 5353
475 Ga0495648_0011002 3300046524 Bacteria 6856
476 Ga0495666_0013069 3300046526 Bacteria 4137
477 Ga0495642_0000290 3300046528 Bacteria 28374
478 Ga0495654_0000354 3300046530 Bacteria 39704
479 Ga0495654_0005735 3300046530 Bacteria 7152
480 Ga0495654_0031003 3300046530 Bacteria 2715
481 Ga0495609_0000098 3300046538 Bacteria 103106
482 Ga0495609_0000146 3300046538 Bacteria 73679
483 Ga0495609_0000471 3300046538 Bacteria 32562
484 Ga0495609_0001060 3300046538 Bacteria 19247
485 Ga0495597_0009627 3300046542 Bacteria 4764
486 Ga0495633_0000201 3300046558 Bacteria 76414
487 Ga0495633_0011921 3300046558 Bacteria 4652
488 Ga0495656_0003013 3300046615 Bacteria 5660
489 Ga0495668_0023527 3300046616 Bacteria 3511
490 Ga0495668_0029465 3300046616 Bacteria 3101
491 Ga0495611_0000456 3300046648 Bacteria 24506
492 Ga0495611_0000690 3300046648 Bacteria 19141
493 Ga0495625_0000113 3300046660 Bacteria 124185
494 Ga0495625_0001368 3300046660 Bacteria 29974
495 Ga0495635_0019852 3300046663 Bacteria 4682
496 Ga0495661_0000050 3300046665 Bacteria 143435
497 Ga0495661_0000112 3300046665 Bacteria 96840
498 Ga0495661_0000241 3300046665 Bacteria 63218
499 Ga0495661_0001174 3300046665 Bacteria 22811
500 Ga0495669_0000760 3300046684 Bacteria 13815
501 Ga0495649_0057067 3300046694 Bacteria 2106
502 Ga0495649_0080614 3300046694 Bacteria 1740
503 Ga0495672_0001326 3300047320 Bacteria 24594
504 Ga0495672_0001433 3300047320 Bacteria 23422
505 Ga0495672_0036483 3300047320 Bacteria 3018
506 Ga0495672_0121007 3300047320 Bacteria 1391
507 Ga0495676_0000032 3300047321 Bacteria 131215
508 Ga0495683_0000055 3300047323 Bacteria 119199
509 Ga0495683_0000141 3300047323 Bacteria 70994
510 Ga0495679_000116 3300047446 Bacteria 69977
511 Ga0495673_0004438 3300047469 Bacteria 8785
512 Ga0495673_0017465 3300047469 Bacteria 3642
513 Ga0495673_0033418 3300047469 Bacteria 2387
514 Ga0495626_0000024 3300048091 Bacteria 214179
515 Ga0495626_0006547 3300048091 Bacteria 6611
516 Ga0495626_0017873 3300048091 Bacteria 3574
517 Ga0496102_0001122 3300048905 Bacteria 24548
518 Ga0496102_0051838 3300048905 Bacteria 3738
519 Ga0496115_0002023 3300048918 Bacteria 14494
520 Ga0496115_0098471 3300048918 Bacteria 2395
521 Ga0496116_0000295 3300048919 Bacteria 84486
522 Ga0496116_0001666 3300048919 Bacteria 24407
523 Ga0496116_0012975 3300048919 Bacteria 6759
524 Ga0496117_0009429 3300048920 Bacteria 9084
525 Ga0496117_0017831 3300048920 Bacteria 5916
526 Ga0496118_0101386 3300048921 Bacteria 1944
527 Ga0496119_0000506 3300048922 Bacteria 53174
528 Ga0496120_0004624 3300048923 Bacteria 11406
529 Ga0496121_0003469 3300048924 Bacteria 22470
530 Ga0496122_0038403 3300048925 Bacteria 3837
531 Ga0496123_0002273 3300048926 Bacteria 24181
532 Ga0496124_0000279 3300048927 Bacteria 97488
533 Ga0496124_0010564 3300048927 Bacteria 9334
534 Ga0496125_0093176 3300048928 Bacteria 2249
535 Ga0496126_0099349 3300048929 Bacteria 2549
536 Ga0495678_000054 3300049459 Bacteria 153487
537 Ga0495678_000078 3300049459 Bacteria 123666
538 Ga0495678_021071 3300049459 Bacteria 2875
539 Ga0495682_0000073 3300049460 Bacteria 92060
540 Ga0501034_0000136 3300049571 Bacteria 136835
541 Ga0501034_0234468 3300049571 Bacteria 1783
542 Ga0501036_0192456 3300049572 Bacteria 1716
543 Ga0501037_0049658 3300049573 Bacteria 3072
544 Ga0501037_0106711 3300049573 Bacteria 2018
545 Ga0501038_0000890 3300049574 Bacteria 26458
546 Ga0501038_0036819 3300049574 Bacteria 4293
547 Ga0501039_0050631 3300049575 Bacteria 3214
548 Ga0501043_0181798 3300049579 Bacteria 1638
549 Ga0501070_0003247 3300049586 Bacteria 14130
550 Ga0501074_0007169 3300049590 Bacteria 8049
551 Ga0501075_0075576 3300049591 Bacteria 2548
552 Ga0501080_0013180 3300049742 Bacteria 7596
553 Ga0501044_0003858 3300049823 Bacteria 16796
554 Ga0501226_000008 3300049853 Bacteria 199119
555 nmdc:mga00v17_32784_c1 3300050491 Bacteria 3073
556 nmdc:mga06z11_3940_c1 3300050494 Bacteria 5793
557 nmdc:mga04h51_14019_c1 3300050495 Bacteria 2282
558 nmdc:mga07m45_59874_c1 3300050496 Bacteria 2155
559 nmdc:mga07m45_809_c1 3300050496 Bacteria 13486
560 Ga0495655_0000290 3300053083 Bacteria 9172
561 Ga0500650_0000162 3300053098 Bacteria 17604
562 Ga0500555_005401 3300053103 Bacteria 3624
563 Ga0500556_0011359 3300053104 Bacteria 2636
564 Ga0500562_013113 3300053108 Bacteria 2112
565 Ga0500595_030267 3300053119 Bacteria 1826
566 Ga0500559_0000035 3300053136 Bacteria 110851
567 Ga0500564_027145 3300053138 Bacteria 2634
568 Ga0500616_0006740 3300053153 Bacteria 7452
569 Ga0500616_0040990 3300053153 Bacteria 2487
570 Ga0500622_0000001 3300053156 Bacteria 657715
571 Ga0500645_013931 3300053730 Bacteria 2572
572 Ga0466962_0104815 3300061719 Bacteria 1359

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050496 nmdc:mga07m45_59874_c1 nmdc:mga07m45_59874_c1_11_1243 402
2 3300061719 Ga0466962_0104815 Ga0466962_0104815_102_1322 404
3 3300048905 Ga0496102_0051838 Ga0496102_0051838_1509_2801 423
4 3300045051 Ga0451576_0000819 Ga0451576_0000819_10303_11649 426
5 3300049573 Ga0501037_0049658 Ga0501037_0049658_731_2050 428
6 3300049742 Ga0501080_0013180 Ga0501080_0013180_4435_5754 428
7 3300046616 Ga0495668_0029465 Ga0495668_0029465_1278_2627 429
8 3300044658 Ga0466972_0019672 Ga0466972_0019672_1746_3092 434
9 3300044901 Ga0466960_0076157 Ga0466960_0076157_70_1416 434
10 3300046463 Ga0495653_0011786 Ga0495653_0011786_2597_3901 434
11 3300053136 Ga0500559_0000035 Ga0500559_0000035_8365_9720 435
12 3300049590 Ga0501074_0007169 Ga0501074_0007169_189_1532 436
13 3300027378 Ga0209981_1000784 Ga0209981_10007841 437
14 3300027543 Ga0209999_1005240 Ga0209999_10052401 437
15 3300009553 Ga0105249_10003939 Ga0105249_100039394 438
16 3300005347 Ga0070668_100019840 Ga0070668_1000198404 439
17 3300005844 Ga0068862_100069896 Ga0068862_1000698964 439
18 3300009093 Ga0105240_10010977 Ga0105240_100109775 439
19 3300013100 Ga0157373_10158545 Ga0157373_101585452 439
20 3300021384 Ga0213876_10000129 Ga0213876_1000012967 439
21 3300025913 Ga0207695_10001655 Ga0207695_1000165537 439
22 3300025923 Ga0207681_10118515 Ga0207681_101185151 439
23 3300025972 Ga0207668_10016601 Ga0207668_100166014 439
24 3300039437 Ga0436365_0218820 Ga0436365_0218820_7566_8909 439
25 3300005366 Ga0070659_100006344 Ga0070659_1000063445 440
26 3300005843 Ga0068860_100000260 Ga0068860_10000026044 440
27 3300005844 Ga0068862_100004279 Ga0068862_1000042797 440
28 3300025304 Ga0209257_1000807 Ga0209257_100080713 440
29 3300025972 Ga0207668_10004508 Ga0207668_100045083 440
30 3300028380 Ga0268265_10002059 Ga0268265_1000205910 440
31 3300028381 Ga0268264_10000169 Ga0268264_1000016941 440
32 3300005563 Ga0068855_100064407 Ga0068855_1000644072 441
33 3300006051 Ga0075364_10039141 Ga0075364_100391414 441
34 3300006353 Ga0075370_10050119 Ga0075370_100501193 441
35 3300025913 Ga0207695_10039276 Ga0207695_100392764 441
36 3300027866 Ga0209813_10002464 Ga0209813_100024645 441
37 3300031456 Ga0307513_10006523 Ga0307513_1000652312 441
38 3300050491 nmdc:mga00v17_32784_c1 nmdc:mga00v17_32784_c1_326_1675 441
39 3300050494 nmdc:mga06z11_3940_c1 nmdc:mga06z11_3940_c1_1361_2710 441
40 3300050495 nmdc:mga04h51_14019_c1 nmdc:mga04h51_14019_c1_27_1376 441
41 3300050496 nmdc:mga07m45_809_c1 nmdc:mga07m45_809_c1_10783_12132 441
42 3300005539 Ga0068853_100109749 Ga0068853_1001097493 442
43 3300006028 Ga0070717_10001865 Ga0070717_100018654 442
44 3300006946 Ga0079104_1007624 Ga0079104_10076244 442
45 3300009093 Ga0105240_10007900 Ga0105240_1000790013 442
46 3300021384 Ga0213876_10013932 Ga0213876_100139324 442
47 3300025913 Ga0207695_10054590 Ga0207695_100545904 442
48 3300025928 Ga0207700_10023294 Ga0207700_100232943 442
49 3300026041 Ga0207639_10000006 Ga0207639_10000006387 442
50 3300031456 Ga0307513_10000856 Ga0307513_100008568 442
51 3300032002 Ga0307416_100255386 Ga0307416_1002553861 442
52 3300039437 Ga0436365_0831887 Ga0436365_0831887_490_1827 442
53 3300046558 Ga0495633_0011921 Ga0495633_0011921_2335_3687 442
54 3300048918 Ga0496115_0002023 Ga0496115_0002023_1261_2613 442
55 3300048918 Ga0496115_0098471 Ga0496115_0098471_155_1504 442
56 3300053083 Ga0495655_0000290 Ga0495655_0000290_6309_7643 442
57 3300053108 Ga0500562_013113 Ga0500562_013113_723_2072 442
58 3300005327 Ga0070658_10002968 Ga0070658_100029689 443
59 3300005327 Ga0070658_10029859 Ga0070658_100298595 443
60 3300005336 Ga0070680_100005647 Ga0070680_1000056476 443
61 3300005339 Ga0070660_100065481 Ga0070660_1000654813 443
62 3300005458 Ga0070681_10005272 Ga0070681_100052727 443
63 3300005530 Ga0070679_100021297 Ga0070679_1000212974 443
64 3300005548 Ga0070665_100000505 Ga0070665_10000050548 443
65 3300005563 Ga0068855_100026342 Ga0068855_1000263423 443
66 3300009551 Ga0105238_10141645 Ga0105238_101416452 443
67 3300025909 Ga0207705_10002011 Ga0207705_100020114 443
68 3300025912 Ga0207707_10009358 Ga0207707_100093583 443
69 3300025917 Ga0207660_10000450 Ga0207660_1000045012 443
70 3300025919 Ga0207657_10000753 Ga0207657_1000075310 443
71 3300025919 Ga0207657_10012142 Ga0207657_100121422 443
72 3300025921 Ga0207652_10002123 Ga0207652_100021237 443
73 3300025924 Ga0207694_10135439 Ga0207694_101354392 443
74 3300025949 Ga0207667_10004134 Ga0207667_100041347 443
75 3300028379 Ga0268266_10000355 Ga0268266_100003557 443
76 3300053103 Ga0500555_005401 Ga0500555_005401_145_1500 443
77 iso_pu_bacteria 2511231031 2511412560 444
78 iso_pu_bacteria 2713897148 2715749604 444
79 iso_pu_bacteria 2718217725 2718636839 444
80 iso_pu_bacteria 2738543025 2739312271 444
81 3300005347 Ga0070668_100004421 Ga0070668_1000044217 445
82 3300005353 Ga0070669_100005479 Ga0070669_1000054792 445
83 3300005355 Ga0070671_100001935 Ga0070671_1000019357 445
84 3300005548 Ga0070665_100065364 Ga0070665_1000653643 445
85 3300005617 Ga0068859_100000320 Ga0068859_10000032041 445
86 3300005841 Ga0068863_100016045 Ga0068863_1000160457 445
87 3300005842 Ga0068858_100003076 Ga0068858_1000030767 445
88 3300005843 Ga0068860_100049278 Ga0068860_1000492782 445
89 3300006931 Ga0097620_100000320 Ga0097620_10000032041 445
90 3300009177 Ga0105248_10130521 Ga0105248_101305213 445
91 3300014325 Ga0163163_10001645 Ga0163163_1000164513 445
92 3300014968 Ga0157379_10000787 Ga0157379_1000078712 445
93 3300025923 Ga0207681_10002370 Ga0207681_100023705 445
94 3300025931 Ga0207644_10001035 Ga0207644_1000103510 445
95 3300025941 Ga0207711_10036861 Ga0207711_100368612 445
96 3300025972 Ga0207668_10003520 Ga0207668_100035207 445
97 3300025986 Ga0207658_10011556 Ga0207658_100115564 445
98 3300026088 Ga0207641_10002563 Ga0207641_100025638 445
99 3300028381 Ga0268264_10004482 Ga0268264_100044824 445
100 3300028573 Ga0265334_10004093 Ga0265334_100040938 445
101 3300028800 Ga0265338_10038175 Ga0265338_100381756 445
102 3300053104 Ga0500556_0011359 Ga0500556_0011359_962_2305 445
103 3300053153 Ga0500616_0006740 Ga0500616_0006740_5042_6385 445
104 3300053730 Ga0500645_013931 Ga0500645_013931_1083_2426 445
105 3300005329 Ga0070683_100000009 Ga0070683_100000009239 446
106 3300005331 Ga0070670_100020516 Ga0070670_1000205164 446
107 3300005338 Ga0068868_100003057 Ga0068868_10000305711 446
108 3300005366 Ga0070659_100001997 Ga0070659_1000019972 446
109 3300005535 Ga0070684_100002860 Ga0070684_1000028601 446
110 3300014969 Ga0157376_10000011 Ga0157376_100000119 446
111 3300025932 Ga0207690_10001238 Ga0207690_100012381 446
112 3300025944 Ga0207661_10000007 Ga0207661_10000007208 446
113 3300026023 Ga0207677_10000195 Ga0207677_100001957 446
114 3300004801 Ga0058860_10937114 Ga0058860_109371143 447
115 3300005345 Ga0070692_10020839 Ga0070692_100208392 447
116 3300005471 Ga0070698_100100748 Ga0070698_1001007481 447
117 3300005530 Ga0070679_100011495 Ga0070679_1000114958 447
118 3300009098 Ga0105245_10000027 Ga0105245_1000002728 447
119 3300009551 Ga0105238_10000001 Ga0105238_100000011388 447
120 3300010375 Ga0105239_10048500 Ga0105239_100485004 447
121 3300013105 Ga0157369_10001715 Ga0157369_1000171518 447
122 3300013296 Ga0157374_10000005 Ga0157374_1000000552 447
123 3300013307 Ga0157372_10078690 Ga0157372_100786903 447
124 3300013308 Ga0157375_10000540 Ga0157375_100005407 447
125 3300014745 Ga0157377_10000001 Ga0157377_10000001521 447
126 3300020070 Ga0206356_11006182 Ga0206356_110061822 447
127 3300020075 Ga0206349_1381135 Ga0206349_13811352 447
128 3300020077 Ga0206351_10045381 Ga0206351_100453813 447
129 3300020078 Ga0206352_10556016 Ga0206352_105560162 447
130 3300020080 Ga0206350_10298777 Ga0206350_102987775 447
131 3300021358 Ga0213873_10002380 Ga0213873_100023802 447
132 3300021377 Ga0213874_10000063 Ga0213874_100000637 447
133 3300021384 Ga0213876_10000064 Ga0213876_1000006480 447
134 3300022467 Ga0224712_10005061 Ga0224712_100050613 447
135 3300025921 Ga0207652_10052993 Ga0207652_100529932 447
136 3300025924 Ga0207694_10000001 Ga0207694_100000012424 447
137 3300025927 Ga0207687_10000006 Ga0207687_10000006554 447
138 3300025981 Ga0207640_10000934 Ga0207640_100009349 447
139 3300026116 Ga0207674_10039659 Ga0207674_100396595 447
140 3300028800 Ga0265338_10073274 Ga0265338_100732742 447
141 3300030521 Ga0307511_10002730 Ga0307511_1000273011 447
142 3300031240 Ga0265320_10035888 Ga0265320_100358882 447
143 3300031727 Ga0316576_10005802 Ga0316576_100058024 447
144 3300035119 Ga0373956_0000111 Ga0373956_0000111_10779_12128 447
145 3300035695 Ga0373927_0000014 Ga0373927_0000014_107299_108648 447
146 3300035724 Ga0373933_0009530 Ga0373933_0009530_3845_5194 447
147 3300036712 Ga0316584_0015783 Ga0316584_0015783_2975_4324 447
148 3300039437 Ga0436365_0050989 Ga0436365_0050989_44333_45688 447
149 3300039437 Ga0436365_1755513 Ga0436365_1755513_432_1781 447
150 3300039450 Ga0436363_0335382 Ga0436363_0335382_30600_31949 447
151 3300039450 Ga0436363_0416934 Ga0436363_0416934_4088_5437 447
152 3300039450 Ga0436363_0886746 Ga0436363_0886746_635_1984 447
153 3300039453 Ga0436362_0635262 Ga0436362_0635262_1747_3102 447
154 3300039453 Ga0436362_1162152 Ga0436362_1162152_4248_5597 447
155 3300044656 Ga0466969_0001310 Ga0466969_0001310_10282_11631 447
156 3300044658 Ga0466972_0007676 Ga0466972_0007676_1556_2905 447
157 3300044658 Ga0466972_0042205 Ga0466972_0042205_417_1766 447
158 3300044683 Ga0466965_0020518 Ga0466965_0020518_53_1402 447
159 3300044684 Ga0466966_0000787 Ga0466966_0000787_1786_3135 447
160 3300044706 Ga0466964_0002550 Ga0466964_0002550_3344_4693 447
161 3300044719 Ga0466971_0033321 Ga0466971_0033321_249_1598 447
162 3300044735 Ga0466968_0000057 Ga0466968_0000057_17075_18424 447
163 3300044765 Ga0466970_0000160 Ga0466970_0000160_1739_3088 447
164 3300044765 Ga0466970_0015922 Ga0466970_0015922_86_1435 447
165 3300044842 Ga0466957_0005707 Ga0466957_0005707_2748_4097 447
166 3300045049 Ga0466959_0048031 Ga0466959_0048031_1735_3084 447
167 3300045051 Ga0451576_0054354 Ga0451576_0054354_362_1711 447
168 3300045836 Ga0466958_0002185 Ga0466958_0002185_1485_2834 447
169 3300049571 Ga0501034_0234468 Ga0501034_0234468_204_1553 447
170 3300049572 Ga0501036_0192456 Ga0501036_0192456_164_1513 447
171 3300049573 Ga0501037_0106711 Ga0501037_0106711_234_1583 447
172 3300049579 Ga0501043_0181798 Ga0501043_0181798_101_1450 447
173 3300049823 Ga0501044_0003858 Ga0501044_0003858_10286_11635 447
174 iso_pu_bacteria 8048406513 8048411890 447
175 3300005539 Ga0068853_100000102 Ga0068853_1000001028 448
176 3300013297 Ga0157378_10000818 Ga0157378_1000081811 448
177 3300013297 Ga0157378_10035068 Ga0157378_100350685 448
178 3300013308 Ga0157375_10000009 Ga0157375_10000009111 448
179 3300022467 Ga0224712_10007864 Ga0224712_100078643 448
180 3300025207 Ga0209760_100148 Ga0209760_10014832 448
181 3300025231 Ga0207427_100005 Ga0207427_100005554 448
182 3300025233 Ga0209437_100018 Ga0209437_100018464 448
183 3300025261 Ga0209233_1000021 Ga0209233_1000021554 448
184 3300025292 Ga0209676_1000271 Ga0209676_100027122 448
185 3300025298 Ga0209050_1000241 Ga0209050_100024131 448
186 3300025303 Ga0209051_1000203 Ga0209051_100020320 448
187 3300025925 Ga0207650_10000233 Ga0207650_1000023318 448
188 3300025935 Ga0207709_10000063 Ga0207709_1000006360 448
189 3300025942 Ga0207689_10008147 Ga0207689_100081478 448
190 3300042009 Ga0439451_000530 Ga0439451_000530_5872_7218 448
191 3300042185 Ga0450909_000438 Ga0450909_000438_34_1380 448
192 3300042876 Ga0451577_0232660 Ga0451577_0232660_223_1572 448
193 3300046491 Ga0495584_0092507 Ga0495584_0092507_12_1358 448
194 3300046506 Ga0495583_0014121 Ga0495583_0014121_50_1396 448
195 3300046507 Ga0495606_0009708 Ga0495606_0009708_6147_7493 448
196 3300046515 Ga0495620_0040048 Ga0495620_0040048_10_1356 448
197 3300046528 Ga0495642_0000290 Ga0495642_0000290_26993_28339 448
198 3300047320 Ga0495672_0121007 Ga0495672_0121007_19_1365 448
199 3300048919 Ga0496116_0001666 Ga0496116_0001666_23006_24352 448
200 3300035724 Ga0373933_0005911 Ga0373933_0005911_3597_4952 449
201 3300039062 Ga0400483_272783 Ga0400483_272783_273_1631 450
202 3300042876 Ga0451577_0013299 Ga0451577_0013299_1066_2427 450
203 3300031730 Ga0307516_10103020 Ga0307516_101030203 452
204 3300042876 Ga0451577_0093641 Ga0451577_0093641_985_2349 452
205 3300044673 Ga0453683_0002765 Ga0453683_0002765_5771_7135 452
206 3300044712 Ga0453684_0000687 Ga0453684_0000687_96936_98300 452
207 3300045051 Ga0451576_0000427 Ga0451576_0000427_490_1854 452
208 3300053153 Ga0500616_0040990 Ga0500616_0040990_459_1826 452
209 3300031251 Ga0265327_10002826 Ga0265327_100028264 457
210 3300047320 Ga0495672_0001326 Ga0495672_0001326_2499_3872 457
211 3300049586 Ga0501070_0003247 Ga0501070_0003247_16_1392 457
212 3300035398 Ga0316574_0090224 Ga0316574_0090224_130_1629 462
213 3300035092 Ga0373952_0000081 Ga0373952_0000081_10115_11533 464
214 3300044712 Ga0453684_0003666 Ga0453684_0003666_19305_20723 465
215 iso_pu_bacteria 2510065053 2510282705 467
216 iso_pu_bacteria 2510065055 2510295361 467
217 iso_pu_bacteria 2510065058 2510311015 467
218 iso_pu_bacteria 2511231004 2511253549 467
219 iso_pu_bacteria 2511231006 2511266475 467
220 iso_pu_bacteria 2511231007 2511269873 467
221 iso_pu_bacteria 2511231008 2511275836 467
222 iso_pu_bacteria 2511231010 2511289792 467
223 iso_pu_bacteria 2511231011 2511294293 467
224 iso_pu_bacteria 2511231012 2511300088 467
225 iso_pu_bacteria 2511231014 2511315388 467
226 iso_pu_bacteria 2511231015 2511318913 467
227 iso_pu_bacteria 2511231016 2511325154 467
228 iso_pu_bacteria 2511231017 2511332143 467
229 iso_pu_bacteria 2511231018 2511339249 467
230 iso_pu_bacteria 2511231019 2511343234 467
231 iso_pu_bacteria 2511231020 2511347919 467
232 iso_pu_bacteria 2511231021 2511355227 467
233 iso_pu_bacteria 2511231022 2511364334 467
234 iso_pu_bacteria 2511231023 2511367455 467
235 iso_pu_bacteria 2511231024 2511376979 467
236 iso_pu_bacteria 2511231156 2511827853 467
237 iso_pu_bacteria 2512047018 2512325412 467
238 iso_pu_bacteria 2554235132 2554818557 467
239 iso_pu_bacteria 2554235341 2555673063 467
240 iso_pu_bacteria 2582580891 2583795509 467
241 iso_pu_bacteria 2597489887 2597861107 467
242 iso_pu_bacteria 2597489888 2597866861 467
243 iso_pu_bacteria 2597489889 2597872700 467
244 iso_pu_bacteria 2599185155 2599327899 467
245 iso_pu_bacteria 2599185160 2599355731 467
246 iso_pu_bacteria 2599185161 2599362867 467
247 iso_pu_bacteria 2599185162 2599368827 467
248 iso_pu_bacteria 2599185163 2599375976 467
249 iso_pu_bacteria 2599185164 2599380837 467
250 iso_pu_bacteria 2599185165 2599387647 467
251 iso_pu_bacteria 2599185166 2599394834 467
252 iso_pu_bacteria 2599185167 2599401003 467
253 iso_pu_bacteria 2599185168 2599406599 467
254 iso_pu_bacteria 2599185179 2599449651 467
255 iso_pu_bacteria 2599185181 2599462565 467
256 iso_pu_bacteria 2599185182 2599468013 467
257 iso_pu_bacteria 2599185185 2599487230 467
258 iso_pu_bacteria 2599185186 2599491582 467
259 iso_pu_bacteria 2599185188 2599503685 467
260 iso_pu_bacteria 2599185189 2599505958 467
261 iso_pu_bacteria 2599185190 2599511723 467
262 iso_pu_bacteria 2599185191 2599516710 467
263 iso_pu_bacteria 2599185257 2599804424 467
264 iso_pu_bacteria 2599185288 2599879247 467
265 iso_pu_bacteria 2599185290 2599893226 467
266 iso_pu_bacteria 2599185300 2599933120 467
267 iso_pu_bacteria 2599185302 2599942134 467
268 iso_pu_bacteria 2599185303 2599948806 467
269 iso_pu_bacteria 2599185304 2599955115 467
270 iso_pu_bacteria 2599185307 2599975050 467
271 iso_pu_bacteria 2599185309 2599984492 467
272 iso_pu_bacteria 2599185310 2599990774 467
273 iso_pu_bacteria 2599185312 2600000695 467
274 iso_pu_bacteria 2599185320 2600049709 467
275 iso_pu_bacteria 2599185356 2600215189 467
276 iso_pu_bacteria 2600254931 2600363310 467
277 iso_pu_bacteria 2600254954 2600446266 467
278 iso_pu_bacteria 2600255283 2601627622 467
279 iso_pu_bacteria 2600255296 2601693206 467
280 iso_pu_bacteria 2600255313 2601775355 467
281 iso_pu_bacteria 2600255318 2601798326 467
282 iso_pu_bacteria 2600255389 2602012706 467
283 iso_pu_bacteria 2603880185 2606077220 467
284 iso_pu_bacteria 2603880199 2606129534 467
285 iso_pu_bacteria 2606217733 2608384222 467
286 iso_pu_bacteria 2619619299 2621296635 467
287 iso_pu_bacteria 2623620443 2624483640 467
288 iso_pu_bacteria 2623620446 2624495216 467
289 iso_pu_bacteria 2643221565 2643843272 467
290 iso_pu_bacteria 2643221571 2643873424 467
291 iso_pu_bacteria 2643221589 2643956127 467
292 iso_pu_bacteria 2643221602 2644020249 467
293 iso_pu_bacteria 2643221633 2644184258 467
294 iso_pu_bacteria 2643221650 2644282999 467
295 iso_pu_bacteria 2643221713 2644621261 467
296 iso_pu_bacteria 2667528171 2671099508 467
297 iso_pu_bacteria 2671180172 2671771432 467
298 iso_pu_bacteria 2675903420 2677900541 467
299 iso_pu_bacteria 2713897149 2715754615 467
300 iso_pu_bacteria 2721755607 2723251573 467
301 iso_pu_bacteria 2728369097 2729148416 467
302 iso_pu_bacteria 2738541265 2738673568 467
303 iso_pu_bacteria 2738541271 2738690524 467
304 iso_pu_bacteria 2738541282 2738751961 467
305 iso_pu_bacteria 2738541294 2738807464 467
306 iso_pu_bacteria 2738541303 2738861002 467
307 iso_pu_bacteria 2738541309 2738894824 467
308 iso_pu_bacteria 2738543004 2739201043 467
309 iso_pu_bacteria 2738543015 2739260592 467
310 iso_pu_bacteria 2738543016 2739266298 467
311 iso_pu_bacteria 2738543020 2739285869 467
312 iso_pu_bacteria 2738543021 2739291182 467
313 iso_pu_bacteria 2740892503 2743740646 467
314 iso_pu_bacteria 2765235841 2765586751 467
315 iso_pu_bacteria 2773857670 2774118129 467
316 iso_pu_bacteria 2773857672 2774129194 467
317 iso_pu_bacteria 2773857673 2774136419 467
318 iso_pu_bacteria 2784132063 2784261585 467
319 iso_pu_bacteria 2784132072 2784316897 467
320 iso_pu_bacteria 2791355520 2794598993 467
321 iso_pu_bacteria 2806310737 2807410947 467
322 iso_pu_bacteria 2806310745 2807459288 467
323 iso_pu_bacteria 2808606361 2808856631 467
324 iso_pu_bacteria 2808606373 2808906053 467
325 iso_pu_bacteria 2808606376 2808925835 467
326 iso_pu_bacteria 2808606377 2808928218 467
327 iso_pu_bacteria 2808606378 2808936597 467
328 iso_pu_bacteria 2808606379 2808940255 467
329 iso_pu_bacteria 2808606380 2808947924 467
330 iso_pu_bacteria 2808606381 2808950600 467
331 iso_pu_bacteria 2808606382 2808961411 467
332 iso_pu_bacteria 2808606383 2808965110 467
333 iso_pu_bacteria 2808606385 2808976365 467
334 iso_pu_bacteria 2808606388 2808994175 467
335 iso_pu_bacteria 2808606389 2809000002 467
336 iso_pu_bacteria 2808606445 2809217450 467
337 iso_pu_bacteria 2811994881 2812369883 467
338 iso_pu_bacteria 2816332298 2817494254 467
339 iso_pu_bacteria 2818991464 2819704654 467
340 iso_pu_bacteria 2823421272 2823421411 467
341 iso_pu_bacteria 2825651385 2825654850 467
342 iso_pu_bacteria 2826581358 2826581638 467
343 iso_pu_bacteria 2834028612 2834031159 467
344 iso_pu_bacteria 2842805378 2842807483 467
345 iso_pu_bacteria 2842815866 2842817179 467
346 iso_pu_bacteria 2842826826 2842828539 467
347 iso_pu_bacteria 2842832357 2842833686 467
348 iso_pu_bacteria 2842837860 2842838108 467
349 iso_pu_bacteria 2842843487 2842845919 467
350 iso_pu_bacteria 2842849001 2842851936 467
351 iso_pu_bacteria 2842854478 2842855846 467
352 iso_pu_bacteria 2844665904 2844667333 467
353 iso_pu_bacteria 2852612431 2852616560 467
354 iso_pu_bacteria 2852657418 2852660041 467
355 iso_pu_bacteria 2852667396 2852671528 467
356 iso_pu_bacteria 2860339153 2860341946 467
357 iso_pu_bacteria 2860867994 2860873232 467
358 iso_pu_bacteria 2878029506 2878029644 467
359 iso_pu_bacteria 2880230671 2880236225 467
360 iso_pu_bacteria 2904518522 2904518724 467
361 iso_pu_bacteria 2904550169 2904553340 467
362 iso_pu_bacteria 2908446538 2908452826 467
363 iso_pu_bacteria 2912963787 2912969068 467
364 iso_pu_bacteria 2913036834 2913042772 467
365 iso_pu_bacteria 2917070673 2917076963 467
366 iso_pu_bacteria 2917832318 2917833309 467
367 iso_pu_bacteria 2919063839 2919068152 467
368 iso_pu_bacteria 2919125081 2919126152 467
369 iso_pu_bacteria 2919155634 2919156056 467
370 iso_pu_bacteria 2919385768 2919388964 467
371 iso_pu_bacteria 2919456309 2919457799 467
372 iso_pu_bacteria 2919481497 2919487190 467
373 iso_pu_bacteria 2919487758 2919487895 467
374 iso_pu_bacteria 2919501602 2919503044 467
375 iso_pu_bacteria 2919697872 2919702506 467
376 iso_pu_bacteria 2923153595 2923159742 467
377 iso_pu_bacteria 2923519811 2923523969 467
378 iso_pu_bacteria 2923586266 2923589388 467
379 iso_pu_bacteria 2926063275 2926064717 467
380 iso_pu_bacteria 2929144301 2929150141 467
381 iso_pu_bacteria 2929189879 2929195360 467
382 iso_pu_bacteria 2931369376 2931372256 467
383 iso_pu_bacteria 2931390751 2931390872 467
384 iso_pu_bacteria 2931396565 2931398343 467
385 iso_pu_bacteria 2935353572 2935358068 467
386 iso_pu_bacteria 2939636861 2939640617 467
387 iso_pu_bacteria 2945928738 2945930706 467
388 iso_pu_bacteria 2945961074 2945967077 467
389 iso_pu_bacteria 2946006987 2946013046 467
390 iso_pu_bacteria 2946027586 2946028110 467
391 iso_pu_bacteria 2969304461 2969310444 467
392 iso_pu_bacteria 2974289157 2974293852 467
393 iso_pu_bacteria 2974298342 2974302369 467
394 iso_pu_bacteria 2984286254 2984286372 467
395 iso_pu_bacteria 2984499530 2984500078 467
396 iso_pu_bacteria 2984504281 2984506550 467
397 iso_pu_bacteria 2988728565 2988731707 467
398 iso_pu_bacteria 2990196909 2990199831 467
399 iso_pu_bacteria 2998139840 2998139975 467
400 iso_pu_bacteria 3007252601 3007254790 467
401 iso_pu_bacteria 3007315729 3007316331 467
402 iso_pu_bacteria 3007395558 3007399161 467
403 iso_pu_bacteria 3007511990 3007517400 467
404 iso_pu_bacteria 3007614139 3007619303 467
405 iso_pu_bacteria 3007619802 3007624128 467
406 iso_pu_bacteria 3007718800 3007723100 467
407 iso_pu_bacteria 3007803356 3007805269 467
408 iso_pu_bacteria 3007855910 3007859421 467
409 iso_pu_bacteria 3007861166 3007864870 467
410 iso_pu_bacteria 3007866637 3007871576 467
411 iso_pu_bacteria 3007872151 3007873150 467
412 iso_pu_bacteria 637000220 637323493 467
413 iso_pu_bacteria 8001522603 8001524872 467
414 iso_pu_bacteria 8011350971 8011356321 467
415 iso_pu_bacteria 8015687852 8015693834 467
416 iso_pu_bacteria 8016728285 8016731434 467
417 iso_pu_bacteria 8019769354 8019769552 467
418 iso_pu_bacteria 8019775933 8019779728 467
419 iso_pu_bacteria 8029995093 8029995278 467
420 iso_pu_bacteria 8034962539 8034964481 467
421 iso_pu_bacteria 8052494512 8052494675 467
422 iso_pu_bacteria 8054285046 8054290181 467
423 iso_pu_bacteria 8054347763 8054349377 467
424 iso_pu_bacteria 8054929484 8054929722 467
425 iso_pu_bacteria 8055770955 8055777098 467
426 iso_pu_bacteria 8055817908 8055824117 467
427 iso_pu_bacteria 8055878733 8055881710 467
428 iso_pu_bacteria 8056115690 8056116374 467
429 iso_pu_bacteria 8056120720 8056125857 467
430 iso_pu_bacteria 8056125926 8056126004 467
431 iso_pu_bacteria 8056131705 8056131818 467
432 iso_pu_bacteria 8056137416 8056142977 467
433 iso_pu_bacteria 8056143049 8056143175 467
434 iso_pu_bacteria 8056155041 8056159970 467
435 iso_pu_bacteria 8056166840 8056171076 467
436 iso_pu_bacteria 8056172158 8056177203 467
437 iso_pu_bacteria 8056177738 8056182288 467
438 iso_pu_bacteria 8057160832 8057161480 467
439 iso_pu_bacteria 8057798959 8057802157 467
440 3300041997 Ga0439431_0011266 Ga0439431_0011266_281_1690 469
441 2124908027 MRS2a_Contig_41 MRS2a_00299650 471
442 3300001915 JGI24741J21665_1003852 JGI24741J21665_10038522 471
443 3300003751 Ga0055538_1000012 Ga0055538_1000012177 471
444 3300003752 Ga0055539_1000017 Ga0055539_1000017177 471
445 3300003756 Ga0055533_1000021 Ga0055533_1000021177 471
446 3300003758 Ga0055532_1000020 Ga0055532_100002065 471
447 3300003759 Ga0055525_1000078 Ga0055525_100007849 471
448 3300003781 Ga0055536_1000055 Ga0055536_100005578 471
449 3300003781 Ga0055536_1000476 Ga0055536_10004764 471
450 3300003781 Ga0055536_1000603 Ga0055536_10006034 471
451 3300003791 Ga0055530_10000077 Ga0055530_100000772 471
452 3300003792 Ga0055540_1009768 Ga0055540_10097682 471
453 3300003794 Ga0055531_10002092 Ga0055531_100020925 471
454 3300003841 Ga0055541_1000012 Ga0055541_1000012177 471
455 3300005288 Ga0065714_10000021 Ga0065714_100000219 471
456 3300005288 Ga0065714_10064711 Ga0065714_100647117 471
457 3300005331 Ga0070670_100000011 Ga0070670_100000011192 471
458 3300005335 Ga0070666_10038075 Ga0070666_100380752 471
459 3300005344 Ga0070661_100000080 Ga0070661_10000008042 471
460 3300005353 Ga0070669_100005454 Ga0070669_1000054547 471
461 3300005355 Ga0070671_100000073 Ga0070671_10000007344 471
462 3300005365 Ga0070688_100002352 Ga0070688_1000023527 471
463 3300005367 Ga0070667_100000092 Ga0070667_10000009240 471
464 3300005466 Ga0070685_10000035 Ga0070685_100000356 471
465 3300005518 Ga0070699_100077181 Ga0070699_1000771813 471
466 3300005548 Ga0070665_100026354 Ga0070665_1000263542 471
467 3300005548 Ga0070665_100262416 Ga0070665_1002624161 471
468 3300005578 Ga0068854_100005563 Ga0068854_1000055633 471
469 3300005617 Ga0068859_100015061 Ga0068859_1000150612 471
470 3300005618 Ga0068864_100000020 Ga0068864_10000002061 471
471 3300005834 Ga0068851_10000039 Ga0068851_1000003930 471
472 3300005842 Ga0068858_100075423 Ga0068858_1000754232 471
473 3300005843 Ga0068860_100007474 Ga0068860_1000074746 471
474 3300005844 Ga0068862_100019392 Ga0068862_1000193923 471
475 3300006931 Ga0097620_100015061 Ga0097620_1000150612 471
476 3300006944 Ga0099823_1000692 Ga0099823_100069213 471
477 3300006946 Ga0079104_1000189 Ga0079104_100018912 471
478 3300006946 Ga0079104_1000262 Ga0079104_100026218 471
479 3300006946 Ga0079104_1018491 Ga0079104_10184912 471
480 3300009011 Ga0105251_10000100 Ga0105251_1000010018 471
481 3300009011 Ga0105251_10000915 Ga0105251_100009154 471
482 3300009011 Ga0105251_10001857 Ga0105251_1000185716 471
483 3300009011 Ga0105251_10005123 Ga0105251_100051232 471
484 3300009011 Ga0105251_10011509 Ga0105251_100115092 471
485 3300009036 Ga0105244_10000073 Ga0105244_1000007350 471
486 3300009036 Ga0105244_10000534 Ga0105244_100005346 471
487 3300009036 Ga0105244_10019436 Ga0105244_100194363 471
488 3300009036 Ga0105244_10051692 Ga0105244_100516921 471
489 3300009036 Ga0105244_10077911 Ga0105244_100779111 471
490 3300009092 Ga0105250_10000138 Ga0105250_1000013835 471
491 3300009098 Ga0105245_10216271 Ga0105245_102162712 471
492 3300009148 Ga0105243_10000132 Ga0105243_1000013220 471
493 3300009148 Ga0105243_10005537 Ga0105243_100055374 471
494 3300009148 Ga0105243_10007452 Ga0105243_100074526 471
495 3300009176 Ga0105242_10000617 Ga0105242_1000061726 471
496 3300009177 Ga0105248_10263203 Ga0105248_102632032 471
497 3300013100 Ga0157373_10009007 Ga0157373_100090072 471
498 3300013100 Ga0157373_10157527 Ga0157373_101575271 471
499 3300013102 Ga0157371_10000109 Ga0157371_1000010983 471
500 3300013102 Ga0157371_10018042 Ga0157371_100180422 471
501 3300013102 Ga0157371_10033858 Ga0157371_100338583 471
502 3300013104 Ga0157370_10009649 Ga0157370_100096495 471
503 3300013105 Ga0157369_10004000 Ga0157369_100040006 471
504 3300013105 Ga0157369_10299626 Ga0157369_102996261 471
505 3300013306 Ga0163162_10000334 Ga0163162_1000033417 471
506 3300013307 Ga0157372_10011591 Ga0157372_100115916 471
507 3300013307 Ga0157372_10062727 Ga0157372_100627274 471
508 3300013307 Ga0157372_10077969 Ga0157372_100779692 471
509 3300014325 Ga0163163_10003882 Ga0163163_100038828 471
510 3300025206 Ga0209435_100365 Ga0209435_1003656 471
511 3300025207 Ga0209760_100020 Ga0209760_100020155 471
512 3300025224 Ga0209784_100007 Ga0209784_100007177 471
513 3300025225 Ga0209566_100009 Ga0209566_100009177 471
514 3300025226 Ga0209674_100021 Ga0209674_100021177 471
515 3300025229 Ga0209147_100009 Ga0209147_100009177 471
516 3300025230 Ga0209563_100018 Ga0209563_100018177 471
517 3300025231 Ga0207427_100006 Ga0207427_100006203 471
518 3300025233 Ga0209437_100013 Ga0209437_100013203 471
519 3300025242 Ga0209258_100321 Ga0209258_10032152 471
520 3300025246 Ga0209646_1000334 Ga0209646_100033422 471
521 3300025253 Ga0209677_100012 Ga0209677_100012177 471
522 3300025261 Ga0209233_1000022 Ga0209233_1000022203 471
523 3300025291 Ga0209675_1006633 Ga0209675_10066334 471
524 3300025292 Ga0209676_1000015 Ga0209676_1000015191 471
525 3300025292 Ga0209676_1000278 Ga0209676_100027847 471
526 3300025292 Ga0209676_1000765 Ga0209676_100076513 471
527 3300025298 Ga0209050_1000030 Ga0209050_1000030247 471
528 3300025298 Ga0209050_1000061 Ga0209050_100006179 471
529 3300025303 Ga0209051_1000012 Ga0209051_1000012488 471
530 3300025303 Ga0209051_1000088 Ga0209051_100008833 471
531 3300025304 Ga0209257_1000143 Ga0209257_1000143109 471
532 3300025321 Ga0207656_10000009 Ga0207656_10000009182 471
533 3300025711 Ga0207696_1000055 Ga0207696_100005574 471
534 3300025711 Ga0207696_1000078 Ga0207696_100007835 471
535 3300025711 Ga0207696_1000080 Ga0207696_1000080126 471
536 3300025711 Ga0207696_1000180 Ga0207696_100018058 471
537 3300025711 Ga0207696_1000184 Ga0207696_100018421 471
538 3300025711 Ga0207696_1002622 Ga0207696_10026226 471
539 3300025728 Ga0207655_1000033 Ga0207655_1000033287 471
540 3300025728 Ga0207655_1000116 Ga0207655_100011693 471
541 3300025728 Ga0207655_1000261 Ga0207655_100026123 471
542 3300025728 Ga0207655_1000663 Ga0207655_100066328 471
543 3300025728 Ga0207655_1000757 Ga0207655_100075726 471
544 3300025728 Ga0207655_1001803 Ga0207655_10018036 471
545 3300025728 Ga0207655_1002198 Ga0207655_10021986 471
546 3300025728 Ga0207655_1002508 Ga0207655_10025086 471
547 3300025728 Ga0207655_1004440 Ga0207655_10044404 471
548 3300025728 Ga0207655_1007840 Ga0207655_10078404 471
549 3300025728 Ga0207655_1022044 Ga0207655_10220442 471
550 3300025728 Ga0207655_1022423 Ga0207655_10224232 471
551 3300025728 Ga0207655_1033080 Ga0207655_10330802 471
552 3300025735 Ga0207713_1000010 Ga0207713_1000010470 471
553 3300025735 Ga0207713_1000188 Ga0207713_100018818 471
554 3300025735 Ga0207713_1001062 Ga0207713_100106214 471
555 3300025735 Ga0207713_1001543 Ga0207713_10015431 471
556 3300025735 Ga0207713_1002413 Ga0207713_10024133 471
557 3300025735 Ga0207713_1004194 Ga0207713_10041947 471
558 3300025735 Ga0207713_1005795 Ga0207713_10057957 471
559 3300025735 Ga0207713_1008678 Ga0207713_10086784 471
560 3300025735 Ga0207713_1013286 Ga0207713_10132865 471
561 3300025735 Ga0207713_1028154 Ga0207713_10281541 471
562 3300025735 Ga0207713_1045590 Ga0207713_10455902 471
563 3300025900 Ga0207710_10004718 Ga0207710_100047182 471
564 3300025903 Ga0207680_10007676 Ga0207680_100076763 471
565 3300025914 Ga0207671_10000027 Ga0207671_1000002798 471
566 3300025920 Ga0207649_10000007 Ga0207649_1000000776 471
567 3300025923 Ga0207681_10000059 Ga0207681_100000595 471
568 3300025923 Ga0207681_10001405 Ga0207681_100014053 471
569 3300025923 Ga0207681_10001723 Ga0207681_1000172311 471
570 3300025925 Ga0207650_10000025 Ga0207650_10000025192 471
571 3300025925 Ga0207650_10000044 Ga0207650_1000004466 471
572 3300025925 Ga0207650_10000089 Ga0207650_1000008969 471
573 3300025931 Ga0207644_10000104 Ga0207644_1000010444 471
574 3300025933 Ga0207706_10007306 Ga0207706_100073061 471
575 3300025934 Ga0207686_10000349 Ga0207686_1000034917 471
576 3300025935 Ga0207709_10000061 Ga0207709_1000006155 471
577 3300025935 Ga0207709_10003327 Ga0207709_100033277 471
578 3300025935 Ga0207709_10063043 Ga0207709_100630432 471
579 3300025935 Ga0207709_10073915 Ga0207709_100739152 471
580 3300025941 Ga0207711_10000773 Ga0207711_1000077310 471
581 3300025945 Ga0207679_10000013 Ga0207679_10000013228 471
582 3300025986 Ga0207658_10000008 Ga0207658_1000000862 471
583 3300026035 Ga0207703_10090161 Ga0207703_100901612 471
584 3300026041 Ga0207639_10000091 Ga0207639_1000009146 471
585 3300026088 Ga0207641_10018967 Ga0207641_100189674 471
586 3300026088 Ga0207641_10088251 Ga0207641_100882511 471
587 3300026095 Ga0207676_10000024 Ga0207676_10000024192 471
588 3300027111 Ga0209281_1000016 Ga0209281_1000016487 471
589 3300027111 Ga0209281_1000091 Ga0209281_100009112 471
590 3300027296 Ga0209389_1000036 Ga0209389_100003666 471
591 3300027312 Ga0209371_1000193 Ga0209371_100019356 471
592 3300027312 Ga0209371_1001364 Ga0209371_10013646 471
593 3300027665 Ga0209983_1001207 Ga0209983_10012072 471
594 3300027682 Ga0209971_1000638 Ga0209971_10006387 471
595 3300028379 Ga0268266_10002403 Ga0268266_100024037 471
596 3300028379 Ga0268266_10020535 Ga0268266_100205355 471
597 3300028380 Ga0268265_10000665 Ga0268265_100006656 471
598 3300028381 Ga0268264_10000472 Ga0268264_100004727 471
599 3300028800 Ga0265338_10104720 Ga0265338_101047202 471
600 3300029957 Ga0265324_10000112 Ga0265324_100001124 471
601 3300029957 Ga0265324_10004519 Ga0265324_100045195 471
602 3300030500 Ga0268256_1000137 Ga0268256_100013756 471
603 3300030500 Ga0268256_1001172 Ga0268256_100117210 471
604 3300030733 Ga0314311_1212095 Ga0314311_12120951 471
605 3300030744 Ga0316181_1029464 Ga0316181_10294644 471
606 3300031239 Ga0265328_10000042 Ga0265328_1000004254 471
607 3300031239 Ga0265328_10014886 Ga0265328_100148862 471
608 3300031241 Ga0265325_10017393 Ga0265325_100173933 471
609 3300031241 Ga0265325_10018926 Ga0265325_100189262 471
610 3300031250 Ga0265331_10000237 Ga0265331_1000023738 471
611 3300031250 Ga0265331_10002760 Ga0265331_100027606 471
612 3300031250 Ga0265331_10008832 Ga0265331_100088322 471
613 3300031250 Ga0265331_10043357 Ga0265331_100433572 471
614 3300031251 Ga0265327_10000458 Ga0265327_1000045817 471
615 3300031251 Ga0265327_10000517 Ga0265327_1000051734 471
616 3300031251 Ga0265327_10000797 Ga0265327_1000079731 471
617 3300031251 Ga0265327_10001071 Ga0265327_1000107117 471
618 3300031251 Ga0265327_10002323 Ga0265327_100023239 471
619 3300031251 Ga0265327_10006608 Ga0265327_100066084 471
620 3300031251 Ga0265327_10022916 Ga0265327_100229162 471
621 3300031548 Ga0307408_100000028 Ga0307408_100000028165 471
622 3300031691 Ga0316579_10002627 Ga0316579_100026275 471
623 3300031691 Ga0316579_10002969 Ga0316579_100029697 471
624 3300031691 Ga0316579_10005772 Ga0316579_100057726 471
625 3300031691 Ga0316579_10010773 Ga0316579_100107732 471
626 3300031691 Ga0316579_10047315 Ga0316579_100473152 471
627 3300031711 Ga0265314_10000101 Ga0265314_1000010174 471
628 3300031727 Ga0316576_10033496 Ga0316576_100334964 471
629 3300031727 Ga0316576_10051906 Ga0316576_100519063 471
630 3300031728 Ga0316578_10001370 Ga0316578_100013702 471
631 3300031728 Ga0316578_10007862 Ga0316578_100078622 471
632 3300031728 Ga0316578_10018077 Ga0316578_100180772 471
633 3300031728 Ga0316578_10044839 Ga0316578_100448392 471
634 3300031733 Ga0316577_10001334 Ga0316577_1000133411 471
635 3300031733 Ga0316577_10027660 Ga0316577_100276602 471
636 3300031733 Ga0316577_10028093 Ga0316577_100280932 471
637 3300032004 Ga0307414_10002499 Ga0307414_100024998 471
638 3300032004 Ga0307414_10074618 Ga0307414_100746182 471
639 3300032133 Ga0316583_10001482 Ga0316583_100014824 471
640 3300032133 Ga0316583_10004806 Ga0316583_100048062 471
641 3300032133 Ga0316583_10011726 Ga0316583_100117265 471
642 3300035398 Ga0316574_0000871 Ga0316574_0000871_8544_9962 471
643 3300035398 Ga0316574_0002338 Ga0316574_0002338_4319_5737 471
644 3300035398 Ga0316574_0002929 Ga0316574_0002929_808_2295 471
645 3300035398 Ga0316574_0012683 Ga0316574_0012683_3367_4785 471
646 3300035398 Ga0316574_0032935 Ga0316574_0032935_973_2391 471
647 3300035398 Ga0316574_0119965 Ga0316574_0119965_120_1538 471
648 3300036647 Ga0316582_0001537 Ga0316582_0001537_4507_5925 471
649 3300036647 Ga0316582_0012443 Ga0316582_0012443_153_1571 471
650 3300036647 Ga0316582_0017173 Ga0316582_0017173_522_1940 471
651 3300036647 Ga0316582_0026698 Ga0316582_0026698_2000_3418 471
652 3300036647 Ga0316582_0032083 Ga0316582_0032083_584_2002 471
653 3300036647 Ga0316582_0051849 Ga0316582_0051849_762_2180 471
654 3300036647 Ga0316582_0058687 Ga0316582_0058687_352_1839 471
655 3300036712 Ga0316584_0005374 Ga0316584_0005374_4926_6344 471
656 3300036712 Ga0316584_0005919 Ga0316584_0005919_5988_7406 471
657 3300036712 Ga0316584_0050907 Ga0316584_0050907_33_1451 471
658 3300036712 Ga0316584_0057831 Ga0316584_0057831_1381_2799 471
659 3300037588 Ga0316581_0001281 Ga0316581_0001281_1483_2901 471
660 3300037588 Ga0316581_0007531 Ga0316581_0007531_809_2227 471
661 3300037588 Ga0316581_0013178 Ga0316581_0013178_720_2138 471
662 3300038705 Ga0237819_01684 Ga0237819_01684_338_1753 471
663 3300038725 Ga0400484_17851 Ga0400484_17851_3358_4818 471
664 3300038726 Ga0400490_31124 Ga0400490_31124_7309_8727 471
665 3300039062 Ga0400483_033002 Ga0400483_033002_5536_6993 471
666 3300041404 Ga0439436_0000523 Ga0439436_0000523_8318_9751 471
667 3300041405 Ga0439438_001138 Ga0439438_001138_659_2092 471
668 3300041405 Ga0439438_007133 Ga0439438_007133_1047_2462 471
669 3300041407 Ga0439447_000760 Ga0439447_000760_9069_10502 471
670 3300041411 Ga0439466_0001576 Ga0439466_0001576_2980_4413 471
671 3300041411 Ga0439466_0007704 Ga0439466_0007704_121_1536 471
672 3300041411 Ga0439466_0017129 Ga0439466_0017129_1178_2593 471
673 3300041411 Ga0439466_0038689 Ga0439466_0038689_62_1477 471
674 3300042006 Ga0439432_003747 Ga0439432_003747_1530_2945 471
675 3300042006 Ga0439432_009558 Ga0439432_009558_1159_2592 471
676 3300042010 Ga0439452_000223 Ga0439452_000223_20_1435 471
677 3300042010 Ga0439452_000459 Ga0439452_000459_20997_22412 471
678 3300042013 Ga0439456_002263 Ga0439456_002263_1017_2432 471
679 3300042016 Ga0439463_000465 Ga0439463_000465_1286_2701 471
680 3300042115 Ga0450911_000054 Ga0450911_000054_22500_23915 471
681 3300042115 Ga0450911_002268 Ga0450911_002268_332_1747 471
682 3300042145 Ga0450906_002233 Ga0450906_002233_1533_2948 471
683 3300042435 Ga0439434_0000468 Ga0439434_0000468_671_2104 471
684 3300042439 Ga0439464_0000184 Ga0439464_0000184_2283_3725 471
685 3300042876 Ga0451577_0000002 Ga0451577_0000002_848595_850013 471
686 3300044673 Ga0453683_0000003 Ga0453683_0000003_848595_850013 471
687 3300044712 Ga0453684_0000002 Ga0453684_0000002_881363_882781 471
688 3300045051 Ga0451576_0000004 Ga0451576_0000004_508003_509421 471
689 3300046452 Ga0495617_000124 Ga0495617_000124_27_1442 471
690 3300046453 Ga0495627_000115 Ga0495627_000115_28956_30371 471
691 3300046453 Ga0495627_001179 Ga0495627_001179_1571_3013 471
692 3300046453 Ga0495627_001825 Ga0495627_001825_7505_8920 471
693 3300046458 Ga0495591_000061 Ga0495591_000061_38201_39694 471
694 3300046458 Ga0495591_000145 Ga0495591_000145_18067_19488 471
695 3300046458 Ga0495591_000624 Ga0495591_000624_20621_22036 471
696 3300046458 Ga0495591_004612 Ga0495591_004612_620_2041 471
697 3300046458 Ga0495591_010444 Ga0495591_010444_2054_3514 471
698 3300046471 Ga0495650_0002691 Ga0495650_0002691_6689_8110 471
699 3300046474 Ga0495605_0000079 Ga0495605_0000079_66362_67783 471
700 3300046474 Ga0495605_0000485 Ga0495605_0000485_11668_13083 471
701 3300046474 Ga0495605_0000504 Ga0495605_0000504_10908_12329 471
702 3300046474 Ga0495605_0005431 Ga0495605_0005431_2585_4006 471
703 3300046475 Ga0495639_0002183 Ga0495639_0002183_1110_2525 471
704 3300046492 Ga0495585_0004733 Ga0495585_0004733_6736_8151 471
705 3300046492 Ga0495585_0008035 Ga0495585_0008035_697_2118 471
706 3300046499 Ga0495594_0001003 Ga0495594_0001003_4096_5556 471
707 3300046500 Ga0495596_0000444 Ga0495596_0000444_4313_5728 471
708 3300046500 Ga0495596_0009162 Ga0495596_0009162_2131_3552 471
709 3300046501 Ga0495607_0000113 Ga0495607_0000113_45286_46701 471
710 3300046501 Ga0495607_0000257 Ga0495607_0000257_16229_17644 471
711 3300046501 Ga0495607_0001422 Ga0495607_0001422_17545_18966 471
712 3300046501 Ga0495607_0002895 Ga0495607_0002895_6481_7902 471
713 3300046501 Ga0495607_0011940 Ga0495607_0011940_3920_5341 471
714 3300046501 Ga0495607_0011965 Ga0495607_0011965_2614_4035 471
715 3300046506 Ga0495583_0000362 Ga0495583_0000362_58873_60333 471
716 3300046506 Ga0495583_0003277 Ga0495583_0003277_5557_6978 471
717 3300046507 Ga0495606_0000139 Ga0495606_0000139_54396_55817 471
718 3300046507 Ga0495606_0000370 Ga0495606_0000370_21013_22434 471
719 3300046507 Ga0495606_0052736 Ga0495606_0052736_858_2273 471
720 3300046512 Ga0495610_0001897 Ga0495610_0001897_11587_13047 471
721 3300046512 Ga0495610_0005754 Ga0495610_0005754_3412_4833 471
722 3300046515 Ga0495620_0000044 Ga0495620_0000044_58627_60087 471
723 3300046515 Ga0495620_0001765 Ga0495620_0001765_2293_3708 471
724 3300046515 Ga0495620_0006874 Ga0495620_0006874_2299_3714 471
725 3300046515 Ga0495620_0016182 Ga0495620_0016182_2241_3662 471
726 3300046518 Ga0495631_0000056 Ga0495631_0000056_68428_69843 471
727 3300046519 Ga0495632_0000687 Ga0495632_0000687_2075_3490 471
728 3300046519 Ga0495632_0003753 Ga0495632_0003753_5150_6571 471
729 3300046520 Ga0495637_0000066 Ga0495637_0000066_55437_56858 471
730 3300046520 Ga0495637_0000239 Ga0495637_0000239_7111_8532 471
731 3300046520 Ga0495637_0001701 Ga0495637_0001701_11006_12421 471
732 3300046520 Ga0495637_0007848 Ga0495637_0007848_50_1465 471
733 3300046522 Ga0495643_0000928 Ga0495643_0000928_17060_18475 471
734 3300046522 Ga0495643_0002662 Ga0495643_0002662_11843_13258 471
735 3300046523 Ga0495644_0001190 Ga0495644_0001190_4509_5930 471
736 3300046523 Ga0495644_0004724 Ga0495644_0004724_28_1443 471
737 3300046524 Ga0495648_0011002 Ga0495648_0011002_401_1816 471
738 3300046526 Ga0495666_0013069 Ga0495666_0013069_60_1475 471
739 3300046530 Ga0495654_0000354 Ga0495654_0000354_32700_34115 471
740 3300046530 Ga0495654_0005735 Ga0495654_0005735_5713_7128 471
741 3300046530 Ga0495654_0031003 Ga0495654_0031003_1218_2639 471
742 3300046538 Ga0495609_0000098 Ga0495609_0000098_31714_33174 471
743 3300046538 Ga0495609_0000146 Ga0495609_0000146_54634_56055 471
744 3300046538 Ga0495609_0000471 Ga0495609_0000471_8274_9689 471
745 3300046538 Ga0495609_0001060 Ga0495609_0001060_12140_13600 471
746 3300046542 Ga0495597_0009627 Ga0495597_0009627_3322_4737 471
747 3300046558 Ga0495633_0000201 Ga0495633_0000201_16178_17638 471
748 3300046615 Ga0495656_0003013 Ga0495656_0003013_908_2323 471
749 3300046616 Ga0495668_0023527 Ga0495668_0023527_232_1653 471
750 3300046648 Ga0495611_0000456 Ga0495611_0000456_22914_24329 471
751 3300046648 Ga0495611_0000690 Ga0495611_0000690_17615_19036 471
752 3300046660 Ga0495625_0000113 Ga0495625_0000113_68184_69605 471
753 3300046660 Ga0495625_0001368 Ga0495625_0001368_5611_7026 471
754 3300046663 Ga0495635_0019852 Ga0495635_0019852_344_1759 471
755 3300046665 Ga0495661_0000050 Ga0495661_0000050_63571_64986 471
756 3300046665 Ga0495661_0000112 Ga0495661_0000112_55426_56847 471
757 3300046665 Ga0495661_0000241 Ga0495661_0000241_59644_61059 471
758 3300046665 Ga0495661_0001174 Ga0495661_0001174_11566_13026 471
759 3300046684 Ga0495669_0000760 Ga0495669_0000760_8678_10093 471
760 3300046694 Ga0495649_0057067 Ga0495649_0057067_338_1753 471
761 3300046694 Ga0495649_0080614 Ga0495649_0080614_29_1450 471
762 3300047320 Ga0495672_0001433 Ga0495672_0001433_5573_6988 471
763 3300047320 Ga0495672_0036483 Ga0495672_0036483_1435_2856 471
764 3300047321 Ga0495676_0000032 Ga0495676_0000032_55514_56935 471
765 3300047323 Ga0495683_0000055 Ga0495683_0000055_15540_16955 471
766 3300047323 Ga0495683_0000141 Ga0495683_0000141_58796_60256 471
767 3300047446 Ga0495679_000116 Ga0495679_000116_54634_56055 471
768 3300047469 Ga0495673_0004438 Ga0495673_0004438_1418_2878 471
769 3300047469 Ga0495673_0017465 Ga0495673_0017465_321_1742 471
770 3300047469 Ga0495673_0033418 Ga0495673_0033418_269_1690 471
771 3300048091 Ga0495626_0000024 Ga0495626_0000024_54589_56010 471
772 3300048091 Ga0495626_0006547 Ga0495626_0006547_1482_2897 471
773 3300048091 Ga0495626_0017873 Ga0495626_0017873_81_1496 471
774 3300048905 Ga0496102_0001122 Ga0496102_0001122_1915_3330 471
775 3300048919 Ga0496116_0000295 Ga0496116_0000295_20840_22255 471
776 3300048919 Ga0496116_0012975 Ga0496116_0012975_1116_2531 471
777 3300048920 Ga0496117_0009429 Ga0496117_0009429_902_2317 471
778 3300048920 Ga0496117_0017831 Ga0496117_0017831_3582_4997 471
779 3300048921 Ga0496118_0101386 Ga0496118_0101386_507_1922 471
780 3300048922 Ga0496119_0000506 Ga0496119_0000506_27541_28956 471
781 3300048923 Ga0496120_0004624 Ga0496120_0004624_8469_9884 471
782 3300048924 Ga0496121_0003469 Ga0496121_0003469_20104_21525 471
783 3300048925 Ga0496122_0038403 Ga0496122_0038403_284_1699 471
784 3300048926 Ga0496123_0002273 Ga0496123_0002273_21642_23057 471
785 3300048927 Ga0496124_0000279 Ga0496124_0000279_56230_57645 471
786 3300048927 Ga0496124_0010564 Ga0496124_0010564_5626_7047 471
787 3300048928 Ga0496125_0093176 Ga0496125_0093176_25_1440 471
788 3300048929 Ga0496126_0099349 Ga0496126_0099349_475_1890 471
789 3300049459 Ga0495678_000054 Ga0495678_000054_59277_60737 471
790 3300049459 Ga0495678_000078 Ga0495678_000078_55984_57405 471
791 3300049459 Ga0495678_021071 Ga0495678_021071_1221_2642 471
792 3300049460 Ga0495682_0000073 Ga0495682_0000073_73417_74832 471
793 3300049571 Ga0501034_0000136 Ga0501034_0000136_79215_80630 471
794 3300049574 Ga0501038_0000890 Ga0501038_0000890_24492_25910 471
795 3300049574 Ga0501038_0036819 Ga0501038_0036819_98_1516 471
796 3300049575 Ga0501039_0050631 Ga0501039_0050631_277_1695 471
797 3300049591 Ga0501075_0075576 Ga0501075_0075576_78_1496 471
798 3300049853 Ga0501226_000008 Ga0501226_000008_178991_180406 471
799 3300053098 Ga0500650_0000162 Ga0500650_0000162_11403_12818 471
800 3300053119 Ga0500595_030267 Ga0500595_030267_115_1530 471
801 3300053138 Ga0500564_027145 Ga0500564_027145_363_1778 471
802 3300053156 Ga0500622_0000001 Ga0500622_0000001_308199_309617 471
803 iso_pu_bacteria 2554235231 2555246478 471
804 iso_pu_bacteria 2599185212 2599612737 471
805 iso_pu_bacteria 2599185248 2599767939 471
806 iso_pu_bacteria 2599185289 2599887756 471
807 iso_pu_bacteria 2599185291 2599899553 471
808 iso_pu_bacteria 2599185305 2599962203 471
809 iso_pu_bacteria 2599185306 2599966284 471
810 iso_pu_bacteria 2599185308 2599977133 471
811 iso_pu_bacteria 2599185311 2599995024 471
812 iso_pu_bacteria 2599185313 2600007106 471
813 iso_pu_bacteria 2599185314 2600011434 471
814 iso_pu_bacteria 2599185315 2600019575 471
815 iso_pu_bacteria 2599185316 2600024992 471
816 iso_pu_bacteria 2599185317 2600029380 471
817 iso_pu_bacteria 2599185318 2600038829 471
818 iso_pu_bacteria 2599185319 2600041118 471
819 iso_pu_bacteria 2599185321 2600054085 471
820 iso_pu_bacteria 2599185322 2600059749 471
821 iso_pu_bacteria 2599185323 2600065486 471
822 iso_pu_bacteria 2599185324 2600072119 471
823 iso_pu_bacteria 2599185325 2600079119 471
824 iso_pu_bacteria 2600254930 2600358936 471
825 iso_pu_bacteria 2651869719 2652545723 471
826 iso_pu_bacteria 2667528170 2671092057 471
827 iso_pu_bacteria 2667528176 2671129438 471
828 iso_pu_bacteria 2675903515 2678266364 471
829 iso_pu_bacteria 2744054620 2745007594 471
830 iso_pu_bacteria 2818991456 2819655360 471
831 iso_pu_bacteria 2939651529 2939654330 471
832 iso_pu_bacteria 3007419365 3007419499 471
833 iso_pu_bacteria 8054503363 8054503480 471
834 iso_pu_bacteria 8056148874 8056151286 471
835 iso_pu_bacteria 8056161164 8056163834 471
836 iso_pu_bacteria 8056569372 8056570697 471

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02785

Biotin_carb_C

Biotin carboxylase C-terminal domain

379

486

0.99

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

159

367

0.99

PF00289

Biotin_carb_N

Biotin carboxylase, N-terminal domain

46

154

0.98

PF02222

ATP-grasp

ATP-grasp domain

169

340

0.87

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

170

336

0.83

PF08443

RimK

RimK-like ATP-grasp domain

158

359

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g8d-assembly1.cif.gz_A crystal structure of the biotin carboxylase subunit, e296a mutant, of acetyl-coa carboxylase from escherichia coli 0.979 1 438
3jzf-assembly1.cif.gz_A crystal structure of biotin carboxylase from e. coli in complex with benzimidazoles series 0.976 1 443
1dv2-assembly2.cif.gz_B the structure of biotin carboxylase, mutant e288k, complexed with atp 0.9736 2 438
2vpq-assembly1.cif.gz_A crystal structure of biotin carboxylase from s. aureus complexed with amppnp 0.9717 3 442
3ouu-assembly1.cif.gz_A crystal structure of biotin carboxylase-beta-gamma-atp complex from campylobacter jejuni 0.9714 1 439
ID Description Score Start End Superfamily
2w6pB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9795 196 438 3.30.470.20
af_A0A2R8PV58_229_474_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9792 199 438 3.30.470.20
af_Q2G2C1_1_459_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9765 2 442 3.30.470.20
af_Q2FXX1_1_449_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9763 3 439 3.30.470.20
4hnuD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9727 201 442 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A7C7PGY8-F1-model_v4 Acetyl-CoA carboxylase biotin carboxylase subunit (EC 6.4.1.1) 0.9898 1 250 GO:0004736
GO:0005524
GO:0046872
AF-A0A3B0YPZ1-F1-model_v4 Pyruvate carboxylase subunit A (EC 6.4.1.1) 0.9892 45 380 GO:0004736
GO:0005524
GO:0046872
AF-A0A3D1B9R6-F1-model_v4 Acetyl-CoA carboxylase biotin carboxylase subunit (EC 6.4.1.1) 0.9889 1 114 GO:0004485
GO:0004736
GO:0005524
AF-A0A6N3UF27-F1-model_v4 deleted 0.9888 37 369
AF-A0A259D2R5-F1-model_v4 deleted 0.9883 1 259

Feature Viewer

pLDDT pTM Quality
93.47 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map