F482754

General Info

Members Datasets Scaffolds Average Seq Length
833 305 832 81

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0321703|Ga0316584_0321703_10_306
Length 98
Sequence MSLRQSVPSKLEKGPHMQNIIEVVSIIGAAIAVSFGAIMPAFSEGRAIAAAMEAIARQPEAAGTLSRTLFVGLAMIETMAIYCLVIALLLLYANPFIG

Samples

Sample ID Description Type Environment
1 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
59 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
60 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
92 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
97 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
98 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
101 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
102 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
103 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
107 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
108 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
109 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
120 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
124 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
125 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
130 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
131 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
132 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
134 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
135 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
154 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
155 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
191 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
192 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
200 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
201 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
202 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
203 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
222 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
223 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
229 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
239 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
242 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
254 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
255 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
259 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
285 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
293 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
294 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
297 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
298 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
299 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
300 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
301 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
302 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
303 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
304 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
305 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.72
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.4
Nodule 0
Rhizoplane 0.24
Rhizosphere 93.04
Stem 0
Stem Tuber 0
Unclassified 4.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10012626 3300002067 Bacteria 2668
2 JGI25155J39150_1000040 3300002704 Bacteria 89420
3 JGI25156J39149_1000051 3300002705 Bacteria 89412
4 JGI25156J39149_1001045 3300002705 Bacteria 12797
5 JGI25154J39366_1000079 3300002738 Bacteria 89420
6 JGI25157J39369_1000168 3300002741 Bacteria 55097
7 JGI25165J46597_1002592 3300003214 Bacteria 5520
8 rootH2_10151561 3300003320 Bacteria 2425
9 rootH2_10152981 3300003320 Bacteria 3606
10 rootL2_10013062 3300003322 Bacteria 10926
11 rootL2_10019673 3300003322 Bacteria 3216
12 rootL2_10063881 3300003322 Bacteria 12767
13 Ga0055539_1023396 3300003752 Bacteria 726
14 Ga0055529_1002270 3300003763 Bacteria 3885
15 Ga0055526_1071029 3300003771 Bacteria 706
16 Ga0058692_1048516 3300003856 Bacteria 712
17 Ga0070658_11981165 3300005327 Bacteria 503
18 Ga0070680_100007605 3300005336 Bacteria 8266
19 Ga0068868_101125213 3300005338 Bacteria 723
20 Ga0070660_100325593 3300005339 Bacteria 1263
21 Ga0070688_100504606 3300005365 Bacteria 913
22 Ga0070709_10344587 3300005434 Bacteria 1099
23 Ga0070714_100344743 3300005435 Bacteria 1398
24 Ga0070714_101157494 3300005435 Unclassified 754
25 Ga0070714_102076289 3300005435 Bacteria 554
26 Ga0070713_100018664 3300005436 Bacteria 5273
27 Ga0070713_100119950 3300005436 Bacteria 2305
28 Ga0070713_100154223 3300005436 Bacteria 2046
29 Ga0070710_10155011 3300005437 Bacteria 1416
30 Ga0070710_10306891 3300005437 Bacteria 1037
31 Ga0070710_10369546 3300005437 Bacteria 954
32 Ga0070711_100023848 3300005439 Bacteria 3985
33 Ga0070711_100585681 3300005439 Bacteria 929
34 Ga0070711_100817750 3300005439 Bacteria 791
35 Ga0070705_101013910 3300005440 Bacteria 674
36 Ga0070708_101420871 3300005445 Bacteria 647
37 Ga0070681_10036498 3300005458 Bacteria 4936
38 Ga0070681_11537387 3300005458 Bacteria 590
39 Ga0070706_100702155 3300005467 Bacteria 938
40 Ga0070699_102067474 3300005518 Bacteria 520
41 Ga0070679_100649748 3300005530 Bacteria 997
42 Ga0070684_100666787 3300005535 Bacteria 969
43 Ga0070684_102025484 3300005535 Bacteria 543
44 Ga0070697_100144710 3300005536 Bacteria 2000
45 Ga0070695_100243631 3300005545 Bacteria 1305
46 Ga0068855_100213250 3300005563 Bacteria 2169
47 Ga0068855_100227539 3300005563 Bacteria 2089
48 Ga0068856_100023871 3300005614 Bacteria 5948
49 Ga0068856_100434985 3300005614 Bacteria 1332
50 Ga0068856_100575516 3300005614 Bacteria 1147
51 Ga0068860_102552979 3300005843 Bacteria 530
52 Ga0068862_102172716 3300005844 Bacteria 566
53 Ga0070717_10207675 3300006028 Bacteria 1718
54 Ga0070717_10278685 3300006028 Bacteria 1482
55 Ga0070717_11443074 3300006028 Bacteria 625
56 Ga0075364_10411390 3300006051 Bacteria 923
57 Ga0070716_100013267 3300006173 Bacteria 4196
58 Ga0070716_101462654 3300006173 Bacteria 557
59 Ga0070712_100007480 3300006175 Bacteria 6819
60 Ga0070712_100469692 3300006175 Bacteria 1050
61 Ga0070712_100729240 3300006175 Unclassified 847
62 Ga0070712_100784323 3300006175 Bacteria 817
63 Ga0070712_101271005 3300006175 Bacteria 641
64 Ga0075428_101225065 3300006844 Bacteria 791
65 Ga0075431_100394042 3300006847 Bacteria 1387
66 Ga0105240_10144408 3300009093 Bacteria 2841
67 Ga0105240_10529684 3300009093 Bacteria 1306
68 Ga0105240_11214853 3300009093 Bacteria 798
69 Ga0105240_11455662 3300009093 Bacteria 719
70 Ga0105247_10895132 3300009101 Bacteria 685
71 Ga0114129_11740347 3300009147 Bacteria 760
72 Ga0105238_11626792 3300009551 Bacteria 676
73 Ga0105239_10643211 3300010375 Bacteria 1211
74 Ga0157370_10344551 3300013104 Bacteria 1373
75 Ga0157369_10084062 3300013105 Bacteria 3403
76 Ga0157369_11480450 3300013105 Bacteria 691
77 Ga0157378_10022773 3300013297 Bacteria 5513
78 Ga0163162_12276555 3300013306 Bacteria 622
79 Ga0163163_10940542 3300014325 Bacteria 928
80 Ga0182008_10128327 3300014497 Bacteria 1263
81 Ga0182008_10447274 3300014497 Bacteria 702
82 Ga0157379_10611717 3300014968 Bacteria 1018
83 Ga0213872_10000453 3300021361 Bacteria 33422
84 Ga0213872_10076735 3300021361 Bacteria 1503
85 Ga0213872_10088542 3300021361 Bacteria 1386
86 Ga0213872_10272836 3300021361 Bacteria 708
87 Ga0213872_10390296 3300021361 Bacteria 566
88 Ga0213874_10111482 3300021377 Bacteria 920
89 Ga0213875_10077890 3300021388 Bacteria 1547
90 Ga0213871_10022734 3300021441 Bacteria 1574
91 Ga0213871_10062210 3300021441 Bacteria 1041
92 Ga0213871_10083144 3300021441 Bacteria 920
93 Ga0213871_10089856 3300021441 Bacteria 889
94 Ga0209435_100052 3300025206 Bacteria 89472
95 Ga0207427_103984 3300025231 Bacteria 2704
96 Ga0209646_1000163 3300025246 Bacteria 89472
97 Ga0209026_1000190 3300025250 Bacteria 89460
98 Ga0209677_100311 3300025253 Bacteria 31839
99 Ga0209759_1000002 3300025256 Bacteria 1027596
100 Ga0209759_1000213 3300025256 Bacteria 89473
101 Ga0209233_1002612 3300025261 Bacteria 6542
102 Ga0209455_1000458 3300025272 Bacteria 30970
103 Ga0209564_1009066 3300025295 Bacteria 4792
104 Ga0207692_10042656 3300025898 Bacteria 2253
105 Ga0207692_10053356 3300025898 Bacteria 2059
106 Ga0207647_10206137 3300025904 Bacteria 1136
107 Ga0207685_10257122 3300025905 Bacteria 847
108 Ga0207685_10607398 3300025905 Bacteria 587
109 Ga0207705_10997492 3300025909 Bacteria 647
110 Ga0207684_11427583 3300025910 Bacteria 566
111 Ga0207707_10063026 3300025912 Bacteria 3227
112 Ga0207695_10091960 3300025913 Bacteria 3046
113 Ga0207693_10014221 3300025915 Bacteria 6403
114 Ga0207693_10257545 3300025915 Bacteria 1368
115 Ga0207693_10719816 3300025915 Bacteria 772
116 Ga0207693_10737617 3300025915 Bacteria 761
117 Ga0207663_10425979 3300025916 Bacteria 1019
118 Ga0207663_10731728 3300025916 Bacteria 785
119 Ga0207652_10576304 3300025921 Bacteria 1010
120 Ga0207700_10062481 3300025928 Bacteria 2829
121 Ga0207700_10106927 3300025928 Bacteria 2244
122 Ga0207700_10136843 3300025928 Bacteria 2008
123 Ga0207700_10215680 3300025928 Bacteria 1624
124 Ga0207664_10016010 3300025929 Bacteria 5461
125 Ga0207664_10062113 3300025929 Bacteria 2983
126 Ga0207664_10171965 3300025929 Bacteria 1855
127 Ga0207665_10023328 3300025939 Bacteria 4076
128 Ga0207667_10123367 3300025949 Bacteria 2669
129 Ga0207667_10130724 3300025949 Bacteria 2586
130 Ga0207677_11023017 3300026023 Bacteria 750
131 Ga0207678_10602201 3300026067 Bacteria 963
132 Ga0207678_11465797 3300026067 Bacteria 603
133 Ga0207678_11915471 3300026067 Bacteria 517
134 Ga0207708_11194936 3300026075 Bacteria 665
135 Ga0207702_10118479 3300026078 Bacteria 2365
136 Ga0207702_10316901 3300026078 Bacteria 1484
137 Ga0207702_11293867 3300026078 Bacteria 723
138 Ga0207702_12056119 3300026078 Bacteria 561
139 Ga0207702_12271602 3300026078 Bacteria 531
140 Ga0207676_11272134 3300026095 Bacteria 730
141 Ga0209371_1008061 3300027312 Bacteria 3559
142 Ga0265356_1032084 3300028017 Bacteria 572
143 Ga0268266_10031306 3300028379 Bacteria 4517
144 Ga0268265_12687309 3300028380 Bacteria 503
145 Ga0265337_1000824 3300028556 Bacteria 16275
146 Ga0265337_1001289 3300028556 Bacteria 12550
147 Ga0265337_1002582 3300028556 Bacteria 8231
148 Ga0265326_10000639 3300028558 Bacteria 13053
149 Ga0265326_10006770 3300028558 Bacteria 3538
150 Ga0265319_1001628 3300028563 Bacteria 13086
151 Ga0265319_1004283 3300028563 Bacteria 7105
152 Ga0265334_10000208 3300028573 Bacteria 33833
153 Ga0265334_10000634 3300028573 Bacteria 17732
154 Ga0265334_10210781 3300028573 Bacteria 673
155 Ga0265318_10005840 3300028577 Bacteria 5735
156 Ga0265318_10011015 3300028577 Bacteria 3913
157 Ga0265323_10000074 3300028653 Bacteria 55925
158 Ga0265323_10000501 3300028653 Bacteria 21986
159 Ga0265322_10011962 3300028654 Bacteria 2510
160 Ga0265322_10015977 3300028654 Bacteria 2167
161 Ga0265336_10000108 3300028666 Bacteria 62876
162 Ga0265336_10000161 3300028666 Bacteria 47783
163 Ga0265336_10060823 3300028666 Bacteria 1133
164 Ga0265338_10000119 3300028800 Bacteria 146599
165 Ga0265338_10000994 3300028800 Bacteria 47798
166 Ga0265338_10040425 3300028800 Bacteria 4380
167 Ga0265338_10159348 3300028800 Bacteria 1745
168 Ga0265338_10258343 3300028800 Bacteria 1282
169 Ga0265338_10301965 3300028800 Bacteria 1163
170 Ga0265338_10559043 3300028800 Bacteria 800
171 Ga0265324_10001977 3300029957 Bacteria 10964
172 Ga0265324_10002357 3300029957 Bacteria 9747
173 Ga0265324_10003388 3300029957 Bacteria 7618
174 Ga0268256_1008346 3300030500 Bacteria 3559
175 Ga0307511_10001799 3300030521 Bacteria 22546
176 Ga0265762_1096431 3300030760 Bacteria 651
177 Ga0265762_1164593 3300030760 Bacteria 536
178 Ga0265770_1040967 3300030878 Bacteria 810
179 Ga0265760_10117592 3300031090 Bacteria 851
180 Ga0265330_10105097 3300031235 Bacteria 1208
181 Ga0265330_10304049 3300031235 Bacteria 672
182 Ga0265332_10148842 3300031238 Bacteria 980
183 Ga0265328_10002497 3300031239 Bacteria 8255
184 Ga0265328_10019367 3300031239 Bacteria 2615
185 Ga0265328_10132154 3300031239 Bacteria 934
186 Ga0265328_10222804 3300031239 Bacteria 718
187 Ga0265320_10006281 3300031240 Bacteria 7509
188 Ga0265320_10010158 3300031240 Bacteria 5624
189 Ga0265320_10011369 3300031240 Bacteria 5243
190 Ga0265325_10059274 3300031241 Bacteria 1947
191 Ga0265325_10080531 3300031241 Bacteria 1619
192 Ga0265325_10495541 3300031241 Bacteria 530
193 Ga0265329_10218165 3300031242 Bacteria 631
194 Ga0265329_10288390 3300031242 Bacteria 553
195 Ga0265340_10004409 3300031247 Bacteria 7874
196 Ga0265340_10112315 3300031247 Bacteria 1259
197 Ga0265340_10273545 3300031247 Bacteria 751
198 Ga0265340_10379040 3300031247 Bacteria 624
199 Ga0265339_10037362 3300031249 Bacteria 2715
200 Ga0265331_10000779 3300031250 Bacteria 26570
201 Ga0265331_10006770 3300031250 Bacteria 6717
202 Ga0265331_10061771 3300031250 Bacteria 1768
203 Ga0265331_10455757 3300031250 Bacteria 575
204 Ga0265331_10570592 3300031250 Bacteria 511
205 Ga0265327_10020348 3300031251 Bacteria 4047
206 Ga0265327_10030492 3300031251 Bacteria 3048
207 Ga0265327_10035788 3300031251 Bacteria 2739
208 Ga0265327_10043544 3300031251 Bacteria 2401
209 Ga0265327_10130869 3300031251 Bacteria 1181
210 Ga0265316_10146533 3300031344 Bacteria 1770
211 Ga0265316_10203631 3300031344 Bacteria 1466
212 Ga0265316_10255847 3300031344 Bacteria 1284
213 Ga0307509_10000197 3300031507 Bacteria 95722
214 Ga0265313_10000004 3300031595 Bacteria 188027
215 Ga0265313_10000307 3300031595 Bacteria 53087
216 Ga0265313_10085057 3300031595 Bacteria 1430
217 Ga0265313_10172310 3300031595 Bacteria 913
218 Ga0265313_10400954 3300031595 Bacteria 538
219 Ga0316575_10001481 3300031665 Bacteria 7576
220 Ga0316575_10173317 3300031665 Bacteria 895
221 Ga0316575_10203702 3300031665 Bacteria 824
222 Ga0316575_10211296 3300031665 Bacteria 809
223 Ga0316575_10220355 3300031665 Bacteria 792
224 Ga0316575_10265876 3300031665 Bacteria 721
225 Ga0316575_10276213 3300031665 Bacteria 708
226 Ga0316575_10455210 3300031665 Bacteria 552
227 Ga0316579_10010547 3300031691 Bacteria 3909
228 Ga0316579_10246238 3300031691 Bacteria 865
229 Ga0316579_10308127 3300031691 Bacteria 766
230 Ga0316579_10411020 3300031691 Bacteria 654
231 Ga0265314_10010615 3300031711 Bacteria 7664
232 Ga0265314_10027051 3300031711 Bacteria 4300
233 Ga0265314_10033190 3300031711 Bacteria 3789
234 Ga0265314_10347862 3300031711 Bacteria 816
235 Ga0265342_10002523 3300031712 Bacteria 15767
236 Ga0265342_10162048 3300031712 Bacteria 1236
237 Ga0265342_10572170 3300031712 Bacteria 572
238 Ga0316576_10010858 3300031727 Bacteria 5940
239 Ga0316576_10020270 3300031727 Bacteria 4572
240 Ga0316576_10078239 3300031727 Bacteria 2450
241 Ga0316576_10222472 3300031727 Bacteria 1420
242 Ga0316576_10223820 3300031727 Bacteria 1415
243 Ga0316576_10248710 3300031727 Bacteria 1335
244 Ga0316576_10734913 3300031727 Bacteria 713
245 Ga0316578_10005514 3300031728 Bacteria 6145
246 Ga0316578_10061192 3300031728 Bacteria 2218
247 Ga0316578_10098660 3300031728 Bacteria 1750
248 Ga0316578_10180290 3300031728 Bacteria 1273
249 Ga0316578_10194033 3300031728 Bacteria 1223
250 Ga0316578_10543015 3300031728 Bacteria 683
251 Ga0316578_10569945 3300031728 Bacteria 664
252 Ga0316577_10019089 3300031733 Bacteria 3793
253 Ga0316577_10136968 3300031733 Bacteria 1379
254 Ga0316577_10239353 3300031733 Bacteria 1026
255 Ga0316577_10783804 3300031733 Bacteria 541
256 Ga0307407_11256839 3300031903 Bacteria 580
257 Ga0307409_100288750 3300031995 Bacteria 1520
258 Ga0307416_103829589 3300032002 Bacteria 504
259 Ga0316583_10000388 3300032133 Bacteria 12748
260 Ga0316583_10006625 3300032133 Bacteria 4167
261 Ga0316583_10033634 3300032133 Bacteria 1821
262 Ga0316583_10096783 3300032133 Bacteria 1029
263 Ga0316583_10166319 3300032133 Bacteria 768
264 Ga0316585_10000265 3300032137 Bacteria 11347
265 Ga0316580_10000521 3300032139 Bacteria 8896
266 Ga0316593_10079627 3300032168 Bacteria 1142
267 Ga0316212_1019979 3300033547 Bacteria 941
268 Ga0373934_0487579 3300035086 Bacteria 518
269 Ga0373944_0106551 3300035089 Bacteria 953
270 Ga0373923_0009168 3300035111 Bacteria 3560
271 Ga0373923_0087458 3300035111 Bacteria 1359
272 Ga0373923_0234961 3300035111 Bacteria 855
273 Ga0373936_0024904 3300035113 Bacteria 2339
274 Ga0373936_0117819 3300035113 Bacteria 1132
275 Ga0373936_0532890 3300035113 Bacteria 548
276 Ga0373945_0156429 3300035116 Bacteria 927
277 Ga0373945_0471514 3300035116 Bacteria 557
278 Ga0373953_0013070 3300035117 Bacteria 2955
279 Ga0373953_0138850 3300035117 Bacteria 1039
280 Ga0373954_0009029 3300035118 Bacteria 4386
281 Ga0373954_0094035 3300035118 Bacteria 1442
282 Ga0373954_0197690 3300035118 Bacteria 988
283 Ga0373954_0225411 3300035118 Bacteria 922
284 Ga0373954_0325286 3300035118 Bacteria 759
285 Ga0373954_0590264 3300035118 Bacteria 551
286 Ga0373956_0071029 3300035119 Bacteria 1588
287 Ga0373956_0117285 3300035119 Bacteria 1242
288 Ga0373956_0156697 3300035119 Bacteria 1072
289 Ga0373956_0201869 3300035119 Bacteria 942
290 Ga0373956_0302913 3300035119 Bacteria 761
291 Ga0373956_0305252 3300035119 Bacteria 758
292 Ga0373957_0012849 3300035120 Bacteria 2828
293 Ga0373957_0031366 3300035120 Bacteria 1953
294 Ga0373943_0046938 3300035170 Bacteria 2110
295 Ga0373943_0395371 3300035170 Bacteria 797
296 Ga0373946_0070480 3300035171 Bacteria 1509
297 Ga0373946_0153898 3300035171 Bacteria 1075
298 Ga0373946_0248893 3300035171 Bacteria 866
299 Ga0373955_0103220 3300035172 Bacteria 1639
300 Ga0373955_0193954 3300035172 Bacteria 1208
301 Ga0373955_0467804 3300035172 Bacteria 769
302 Ga0373955_0963871 3300035172 Bacteria 525
303 Ga0373955_1010031 3300035172 Bacteria 512
304 Ga0316574_0000783 3300035398 Bacteria 13749
305 Ga0316574_0001746 3300035398 Bacteria 10522
306 Ga0316574_0035609 3300035398 Bacteria 3044
307 Ga0316574_0062287 3300035398 Bacteria 2344
308 Ga0316574_0094639 3300035398 Bacteria 1908
309 Ga0316574_0199617 3300035398 Bacteria 1285
310 Ga0316574_0508503 3300035398 Bacteria 751
311 Ga0373924_0009136 3300035410 Bacteria 3627
312 Ga0373924_0057883 3300035410 Bacteria 1617
313 Ga0373924_0123364 3300035410 Bacteria 1125
314 Ga0373935_0137957 3300035692 Bacteria 1645
315 Ga0373935_0160427 3300035692 Bacteria 1532
316 Ga0373935_0288933 3300035692 Bacteria 1156
317 Ga0373935_0319106 3300035692 Bacteria 1102
318 Ga0373927_0031570 3300035695 Bacteria 3452
319 Ga0373927_0055459 3300035695 Bacteria 2562
320 Ga0373927_0069006 3300035695 Bacteria 2288
321 Ga0373927_0119582 3300035695 Bacteria 1719
322 Ga0373927_0363663 3300035695 Bacteria 954
323 Ga0373927_1013880 3300035695 Bacteria 548
324 Ga0373933_0008329 3300035724 Bacteria 5662
325 Ga0373933_0023982 3300035724 Bacteria 3491
326 Ga0373933_0024422 3300035724 Bacteria 3460
327 Ga0373933_0062902 3300035724 Bacteria 2243
328 Ga0373933_0077880 3300035724 Bacteria 2027
329 Ga0373933_0351799 3300035724 Bacteria 957
330 Ga0373933_0353156 3300035724 Bacteria 955
331 Ga0373933_0711746 3300035724 Bacteria 660
332 Ga0373933_0798720 3300035724 Bacteria 621
333 Ga0373933_0870902 3300035724 Unclassified 593
334 Ga0373947_0038699 3300035725 Bacteria 2835
335 Ga0373947_0119891 3300035725 Bacteria 1670
336 Ga0373947_0148012 3300035725 Bacteria 1511
337 Ga0373947_0151364 3300035725 Bacteria 1495
338 Ga0373947_0257358 3300035725 Bacteria 1156
339 Ga0373937_0006092 3300036401 Bacteria 10385
340 Ga0373937_0031834 3300036401 Bacteria 4781
341 Ga0373937_0101263 3300036401 Bacteria 2673
342 Ga0373937_0123022 3300036401 Bacteria 2419
343 Ga0373937_0132856 3300036401 Bacteria 2325
344 Ga0373937_0169193 3300036401 Bacteria 2050
345 Ga0373937_0405101 3300036401 Bacteria 1294
346 Ga0373937_0728466 3300036401 Bacteria 939
347 Ga0373937_1378959 3300036401 Bacteria 653
348 Ga0373937_1870403 3300036401 Bacteria 546
349 Ga0372808_019356 3300036459 Bacteria 978
350 Ga0316582_0017390 3300036647 Bacteria 4159
351 Ga0316582_0029049 3300036647 Bacteria 3355
352 Ga0316582_0161381 3300036647 Bacteria 1519
353 Ga0316582_0278922 3300036647 Bacteria 1147
354 Ga0316582_0352919 3300036647 Bacteria 1012
355 Ga0316582_0982814 3300036647 Bacteria 576
356 Ga0316584_0004837 3300036712 Bacteria 8956
357 Ga0316584_0028739 3300036712 Bacteria 4103
358 Ga0316584_0088042 3300036712 Bacteria 2325
359 Ga0316584_0157349 3300036712 Bacteria 1689
360 Ga0316584_0164529 3300036712 Bacteria 1647
361 Ga0316584_0174049 3300036712 Bacteria 1595
362 Ga0316584_0321703 3300036712 Bacteria 1116
363 Ga0316584_0347192 3300036712 Bacteria 1066
364 Ga0373925_0023549 3300037068 Bacteria 4493
365 Ga0373925_0391984 3300037068 Bacteria 1132
366 Ga0373925_0473539 3300037068 Bacteria 1027
367 Ga0395899_0010671 3300037312 Bacteria 7039
368 Ga0395900_0245861 3300037418 Bacteria 1793
369 Ga0395898_0160704 3300037466 Bacteria 2148
370 Ga0395905_0093980 3300037471 Bacteria 2813
371 Ga0395905_1523401 3300037471 Bacteria 573
372 Ga0395905_1719761 3300037471 Bacteria 532
373 Ga0316581_0001594 3300037588 Bacteria 5167
374 Ga0436364_0927232 3300037853 Bacteria 3121
375 Ga0395901_0002803 3300038443 Bacteria 17591
376 Ga0395901_0866595 3300038443 Bacteria 887
377 Ga0436360_0144939 3300039438 Bacteria 5079
378 Ga0436360_0278009 3300039438 Bacteria 1125
379 Ga0436360_0542036 3300039438 Bacteria 3071
380 Ga0436360_0648306 3300039438 Bacteria 853
381 Ga0436360_0694448 3300039438 Bacteria 750
382 Ga0436360_0731534 3300039438 Bacteria 1040
383 Ga0436360_1278836 3300039438 Bacteria 983
384 Ga0436361_0031613 3300039447 Bacteria 1402
385 Ga0436361_0083953 3300039447 Bacteria 2429
386 Ga0436361_0623967 3300039447 Bacteria 931
387 Ga0436361_0736815 3300039447 Bacteria 2114
388 Ga0436361_0752321 3300039447 Bacteria 1806
389 Ga0436361_0834676 3300039447 Bacteria 718
390 Ga0436361_0837231 3300039447 Bacteria 44100
391 Ga0436361_0851527 3300039447 Bacteria 3511
392 Ga0436361_0904970 3300039447 Bacteria 566
393 Ga0436361_1197906 3300039447 Bacteria 540
394 Ga0436363_0190844 3300039450 Bacteria 644
395 Ga0436363_0964032 3300039450 Bacteria 1246
396 Ga0436362_0199972 3300039453 Bacteria 678
397 Ga0436362_0490283 3300039453 Bacteria 911
398 Ga0436362_0659311 3300039453 Archaea 530
399 Ga0436362_0732104 3300039453 Bacteria 818
400 Ga0436362_1305803 3300039453 Bacteria 552
401 Ga0439460_0080674 3300042461 Bacteria 1021
402 Ga0451577_0015231 3300042876 Bacteria 7155
403 Ga0451577_0106880 3300042876 Bacteria 2501
404 Ga0466966_0008834 3300044684 Bacteria 6671
405 Ga0466963_0459393 3300044694 Bacteria 899
406 Ga0453684_0040623 3300044712 Bacteria 6312
407 Ga0453684_0041407 3300044712 Bacteria 6231
408 Ga0453684_0104766 3300044712 Bacteria 3452
409 Ga0453684_0150574 3300044712 Bacteria 2765
410 Ga0466959_0179194 3300045049 Bacteria 1483
411 Ga0451576_0000808 3300045051 Bacteria 61356
412 Ga0451576_2219636 3300045051 Bacteria 563
413 Ga0495592_0064883 3300046454 Bacteria 2675
414 Ga0495592_0078329 3300046454 Bacteria 2394
415 Ga0495592_0112100 3300046454 Bacteria 1929
416 Ga0495592_0182319 3300046454 Bacteria 1429
417 Ga0495592_0183880 3300046454 Bacteria 1421
418 Ga0495592_0351286 3300046454 Bacteria 945
419 Ga0495603_0020696 3300046455 Bacteria 3985
420 Ga0495603_0060427 3300046455 Bacteria 2239
421 Ga0495603_0147520 3300046455 Bacteria 1367
422 Ga0495591_001164 3300046458 Bacteria 17184
423 Ga0495629_0000224 3300046459 Bacteria 50510
424 Ga0495629_0030963 3300046459 Bacteria 3790
425 Ga0495629_0044380 3300046459 Bacteria 3120
426 Ga0495629_0221762 3300046459 Bacteria 1304
427 Ga0495629_0270264 3300046459 Bacteria 1168
428 Ga0495629_0426294 3300046459 Bacteria 900
429 Ga0495629_0472995 3300046459 Bacteria 847
430 Ga0495629_0729243 3300046459 Bacteria 657
431 Ga0495641_0318551 3300046461 Bacteria 702
432 Ga0495651_0055901 3300046462 Bacteria 3032
433 Ga0495651_0065168 3300046462 Bacteria 2782
434 Ga0495651_0088503 3300046462 Bacteria 2327
435 Ga0495651_0168846 3300046462 Bacteria 1560
436 Ga0495651_0266874 3300046462 Bacteria 1162
437 Ga0495651_0285207 3300046462 Bacteria 1114
438 Ga0495651_0440528 3300046462 Bacteria 843
439 Ga0495651_0717537 3300046462 Bacteria 622
440 Ga0495651_0942236 3300046462 Bacteria 526
441 Ga0495653_0001276 3300046463 Bacteria 19478
442 Ga0495653_0016018 3300046463 Bacteria 6110
443 Ga0495653_0029496 3300046463 Bacteria 4379
444 Ga0495653_0047485 3300046463 Bacteria 3320
445 Ga0495653_0059105 3300046463 Bacteria 2911
446 Ga0495653_0170550 3300046463 Bacteria 1502
447 Ga0495653_0239645 3300046463 Bacteria 1210
448 Ga0495653_0248820 3300046463 Bacteria 1181
449 Ga0495653_0904265 3300046463 Bacteria 526
450 Ga0495580_0000135 3300046472 Bacteria 52036
451 Ga0495580_0000499 3300046472 Bacteria 32904
452 Ga0495580_0000504 3300046472 Bacteria 32829
453 Ga0495580_0001710 3300046472 Bacteria 19281
454 Ga0495580_0004368 3300046472 Bacteria 11871
455 Ga0495580_0005127 3300046472 Bacteria 10898
456 Ga0495580_0024320 3300046472 Bacteria 4437
457 Ga0495580_0303591 3300046472 Bacteria 1087
458 Ga0495580_0756394 3300046472 Bacteria 633
459 Ga0495582_0014651 3300046473 Bacteria 4308
460 Ga0495582_0476929 3300046473 Bacteria 721
461 Ga0495605_0116876 3300046474 Bacteria 1212
462 Ga0495605_0314502 3300046474 Bacteria 661
463 Ga0495605_0344199 3300046474 Bacteria 626
464 Ga0495639_0105852 3300046475 Bacteria 1332
465 Ga0495662_0141088 3300046476 Bacteria 1186
466 Ga0495662_0289594 3300046476 Bacteria 806
467 Ga0495664_0002427 3300046477 Bacteria 10018
468 Ga0495664_0028960 3300046477 Bacteria 3237
469 Ga0495664_0134784 3300046477 Bacteria 1496
470 Ga0495664_0461315 3300046477 Bacteria 760
471 Ga0495664_0477806 3300046477 Bacteria 745
472 Ga0495664_0855252 3300046477 Bacteria 533
473 Ga0495585_0027418 3300046492 Bacteria 3251
474 Ga0495594_0146123 3300046499 Bacteria 1342
475 Ga0495594_0328823 3300046499 Bacteria 870
476 Ga0495596_0003395 3300046500 Bacteria 8080
477 Ga0495596_0015530 3300046500 Bacteria 3186
478 Ga0495596_0042961 3300046500 Bacteria 1781
479 Ga0495596_0177463 3300046500 Bacteria 828
480 Ga0495607_0118417 3300046501 Bacteria 1394
481 Ga0495607_0271351 3300046501 Bacteria 808
482 Ga0495583_0001364 3300046506 Bacteria 25174
483 Ga0495583_0161809 3300046506 Bacteria 923
484 Ga0495606_0346496 3300046507 Bacteria 790
485 Ga0495606_0541018 3300046507 Bacteria 581
486 Ga0495608_0007305 3300046511 Bacteria 7809
487 Ga0495608_0089470 3300046511 Bacteria 1993
488 Ga0495608_0215809 3300046511 Bacteria 1205
489 Ga0495608_0337128 3300046511 Bacteria 930
490 Ga0495608_0400756 3300046511 Bacteria 839
491 Ga0495610_0283122 3300046512 Bacteria 645
492 Ga0495618_0034216 3300046514 Bacteria 3185
493 Ga0495618_0153640 3300046514 Bacteria 1470
494 Ga0495618_0188673 3300046514 Bacteria 1308
495 Ga0495618_0240994 3300046514 Bacteria 1137
496 Ga0495618_0522974 3300046514 Bacteria 713
497 Ga0495628_0000239 3300046516 Bacteria 48349
498 Ga0495628_0027720 3300046516 Bacteria 4604
499 Ga0495628_0036523 3300046516 Bacteria 3941
500 Ga0495628_0047333 3300046516 Bacteria 3412
501 Ga0495628_0049446 3300046516 Bacteria 3330
502 Ga0495628_0097145 3300046516 Bacteria 2275
503 Ga0495628_0140593 3300046516 Bacteria 1842
504 Ga0495628_0147194 3300046516 Bacteria 1795
505 Ga0495628_0184400 3300046516 Bacteria 1577
506 Ga0495628_0222089 3300046516 Bacteria 1419
507 Ga0495628_0551019 3300046516 Bacteria 828
508 Ga0495628_0609053 3300046516 Bacteria 779
509 Ga0495628_0810150 3300046516 Bacteria 655
510 Ga0495630_0017807 3300046517 Bacteria 5209
511 Ga0495630_0091976 3300046517 Bacteria 2292
512 Ga0495630_0102060 3300046517 Bacteria 2170
513 Ga0495630_0294538 3300046517 Bacteria 1240
514 Ga0495630_0351579 3300046517 Bacteria 1128
515 Ga0495630_0395624 3300046517 Bacteria 1058
516 Ga0495631_0222340 3300046518 Bacteria 806
517 Ga0495644_0173559 3300046523 Bacteria 828
518 Ga0495648_0001136 3300046524 Bacteria 26916
519 Ga0495648_0004401 3300046524 Bacteria 12045
520 Ga0495648_0148595 3300046524 Bacteria 1224
521 Ga0495666_0000487 3300046526 Bacteria 17627
522 Ga0495666_0016000 3300046526 Bacteria 3735
523 Ga0495642_0131984 3300046528 Bacteria 1075
524 Ga0495642_0344342 3300046528 Bacteria 655
525 Ga0495652_0038325 3300046529 Bacteria 4153
526 Ga0495652_0050070 3300046529 Bacteria 3574
527 Ga0495652_0188166 3300046529 Bacteria 1578
528 Ga0495652_0193913 3300046529 Bacteria 1548
529 Ga0495652_0328439 3300046529 Bacteria 1102
530 Ga0495652_0417073 3300046529 Bacteria 947
531 Ga0495652_0452091 3300046529 Bacteria 899
532 Ga0495652_0534217 3300046529 Bacteria 808
533 Ga0495652_1047039 3300046529 Bacteria 532
534 Ga0495665_0005475 3300046531 Bacteria 6838
535 Ga0495665_0006209 3300046531 Bacteria 6453
536 Ga0495665_0010943 3300046531 Bacteria 4909
537 Ga0495665_0064832 3300046531 Bacteria 1928
538 Ga0495665_0138740 3300046531 Bacteria 1271
539 Ga0495665_0253751 3300046531 Bacteria 905
540 Ga0495665_0477396 3300046531 Bacteria 629
541 Ga0495665_0515284 3300046531 Bacteria 602
542 Ga0495640_0011229 3300046533 Bacteria 6895
543 Ga0495640_0036999 3300046533 Bacteria 3446
544 Ga0495640_0173167 3300046533 Bacteria 1378
545 Ga0495640_0532254 3300046533 Bacteria 713
546 Ga0495640_0724839 3300046533 Bacteria 595
547 Ga0495640_0868146 3300046533 Bacteria 535
548 Ga0495587_0014987 3300046536 Bacteria 4848
549 Ga0495587_0018799 3300046536 Bacteria 4284
550 Ga0495587_0319087 3300046536 Bacteria 868
551 Ga0495587_0333747 3300046536 Bacteria 846
552 Ga0495598_0284671 3300046537 Bacteria 621
553 Ga0495645_0000754 3300046543 Bacteria 22147
554 Ga0495645_0205304 3300046543 Bacteria 1334
555 Ga0495645_0314352 3300046543 Bacteria 1019
556 Ga0495622_0302475 3300046557 Bacteria 697
557 Ga0495633_0181635 3300046558 Bacteria 968
558 Ga0495667_0039299 3300046559 Bacteria 3146
559 Ga0495667_0150969 3300046559 Bacteria 1496
560 Ga0495667_0183237 3300046559 Bacteria 1343
561 Ga0495656_0512478 3300046615 Bacteria 637
562 Ga0495634_0148341 3300046642 Bacteria 1485
563 Ga0495634_0445336 3300046642 Bacteria 765
564 Ga0495634_0457300 3300046642 Bacteria 752
565 Ga0495634_0546552 3300046642 Bacteria 676
566 Ga0495611_0146897 3300046648 Bacteria 1101
567 Ga0495611_0315904 3300046648 Bacteria 719
568 Ga0495635_0009807 3300046663 Bacteria 6695
569 Ga0495635_0021829 3300046663 Bacteria 4462
570 Ga0495635_0037898 3300046663 Bacteria 3338
571 Ga0495635_0193818 3300046663 Bacteria 1379
572 Ga0495635_0785931 3300046663 Bacteria 614
573 Ga0495661_0005589 3300046665 Bacteria 8919
574 Ga0495661_0293420 3300046665 Bacteria 816
575 Ga0495588_0026275 3300046674 Bacteria 2906
576 Ga0495588_0161979 3300046674 Bacteria 1183
577 Ga0495657_0032011 3300046675 Bacteria 3673
578 Ga0495657_0248856 3300046675 Bacteria 1071
579 Ga0495657_0351052 3300046675 Bacteria 873
580 Ga0495657_0482264 3300046675 Bacteria 724
581 Ga0495599_0054477 3300046678 Bacteria 2505
582 Ga0495599_0085779 3300046678 Bacteria 1966
583 Ga0495599_0096892 3300046678 Bacteria 1839
584 Ga0495599_0128394 3300046678 Bacteria 1575
585 Ga0495599_0135860 3300046678 Bacteria 1526
586 Ga0495599_0323710 3300046678 Bacteria 927
587 Ga0495599_0674125 3300046678 Bacteria 598
588 Ga0495599_0868877 3300046678 Bacteria 512
589 Ga0495623_0013273 3300046679 Bacteria 5343
590 Ga0495623_0014499 3300046679 Bacteria 5100
591 Ga0495623_0072737 3300046679 Bacteria 2137
592 Ga0495623_0134321 3300046679 Bacteria 1478
593 Ga0495623_0147517 3300046679 Bacteria 1394
594 Ga0495623_0169963 3300046679 Bacteria 1274
595 Ga0495623_0181535 3300046679 Bacteria 1222
596 Ga0495646_0000222 3300046680 Bacteria 28234
597 Ga0495646_0006608 3300046680 Bacteria 7357
598 Ga0495646_0079798 3300046680 Bacteria 1909
599 Ga0495646_0123859 3300046680 Bacteria 1461
600 Ga0495646_0238250 3300046680 Bacteria 978
601 Ga0495646_0239958 3300046680 Bacteria 974
602 Ga0495646_0245759 3300046680 Bacteria 960
603 Ga0495646_0408915 3300046680 Bacteria 705
604 Ga0495646_0428558 3300046680 Bacteria 685
605 Ga0495647_0297642 3300046681 Bacteria 727
606 Ga0495658_0513521 3300046683 Bacteria 767
607 Ga0495669_0015542 3300046684 Bacteria 3260
608 Ga0495669_0335005 3300046684 Bacteria 731
609 Ga0495613_0018488 3300046689 Bacteria 5195
610 Ga0495613_0140933 3300046689 Bacteria 1723
611 Ga0495613_0812280 3300046689 Bacteria 610
612 Ga0495624_0000059 3300046690 Bacteria 70115
613 Ga0495624_0000062 3300046690 Bacteria 67917
614 Ga0495624_0001465 3300046690 Bacteria 18349
615 Ga0495624_0057616 3300046690 Bacteria 2442
616 Ga0495624_0749776 3300046690 Bacteria 578
617 Ga0495624_0813887 3300046690 Bacteria 552
618 Ga0495649_0298907 3300046694 Bacteria 820
619 Ga0495589_0074052 3300046794 Bacteria 1661
620 Ga0495600_0001170 3300046809 Bacteria 14311
621 Ga0495600_0148994 3300046809 Bacteria 1516
622 Ga0495600_0167752 3300046809 Bacteria 1418
623 Ga0495600_0597403 3300046809 Bacteria 671
624 Ga0495600_0920796 3300046809 Bacteria 515
625 Ga0495581_0012606 3300047315 Bacteria 4899
626 Ga0495581_0035484 3300047315 Bacteria 2886
627 Ga0495581_0459631 3300047315 Bacteria 741
628 Ga0495604_0008864 3300047317 Bacteria 7949
629 Ga0495604_0010050 3300047317 Bacteria 7492
630 Ga0495604_0026749 3300047317 Bacteria 4592
631 Ga0495604_0041177 3300047317 Bacteria 3623
632 Ga0495604_0154744 3300047317 Bacteria 1625
633 Ga0495604_0164679 3300047317 Bacteria 1564
634 Ga0495604_0182137 3300047317 Bacteria 1469
635 Ga0495604_0379506 3300047317 Bacteria 934
636 Ga0495604_0462625 3300047317 Bacteria 827
637 Ga0495604_0479532 3300047317 Bacteria 809
638 Ga0495604_0827851 3300047317 Bacteria 582
639 Ga0495636_0185038 3300047318 Bacteria 946
640 Ga0495674_0000180 3300047319 Bacteria 49901
641 Ga0495674_0000653 3300047319 Bacteria 32528
642 Ga0495674_0010027 3300047319 Bacteria 8980
643 Ga0495674_0103919 3300047319 Bacteria 2415
644 Ga0495674_0136827 3300047319 Bacteria 2060
645 Ga0495674_0178131 3300047319 Bacteria 1771
646 Ga0495674_0181869 3300047319 Bacteria 1750
647 Ga0495674_0328620 3300047319 Bacteria 1244
648 Ga0495674_1297144 3300047319 Bacteria 546
649 Ga0495672_0017205 3300047320 Bacteria 4840
650 Ga0495676_0020488 3300047321 Bacteria 5799
651 Ga0495676_0352932 3300047321 Bacteria 983
652 Ga0495676_0357849 3300047321 Bacteria 975
653 Ga0495676_1030456 3300047321 Bacteria 524
654 Ga0495680_0004928 3300047322 Bacteria 12636
655 Ga0495680_0069315 3300047322 Bacteria 2691
656 Ga0495680_0174356 3300047322 Bacteria 1555
657 Ga0495680_0249699 3300047322 Bacteria 1258
658 Ga0495680_0282944 3300047322 Bacteria 1168
659 Ga0495680_0329167 3300047322 Bacteria 1068
660 Ga0495680_0984843 3300047322 Bacteria 540
661 Ga0495683_0010872 3300047323 Bacteria 4799
662 Ga0495683_0032629 3300047323 Bacteria 2652
663 Ga0495687_005781 3300047443 Bacteria 7764
664 Ga0495687_009680 3300047443 Bacteria 5361
665 Ga0495687_066266 3300047443 Bacteria 1467
666 Ga0495675_0003245 3300047444 Bacteria 9767
667 Ga0495675_0006619 3300047444 Bacteria 7093
668 Ga0495675_0016676 3300047444 Bacteria 4644
669 Ga0495675_0046564 3300047444 Bacteria 2760
670 Ga0495675_0056982 3300047444 Bacteria 2477
671 Ga0495675_0470242 3300047444 Bacteria 725
672 Ga0495675_0478648 3300047444 Bacteria 717
673 Ga0495679_006739 3300047446 Bacteria 4896
674 Ga0495679_058952 3300047446 Bacteria 1131
675 Ga0495673_0002923 3300047469 Bacteria 11557
676 Ga0495673_0025407 3300047469 Bacteria 2845
677 Ga0495673_0253560 3300047469 Bacteria 642
678 Ga0495684_0042281 3300047471 Bacteria 3491
679 Ga0495684_0178937 3300047471 Bacteria 1573
680 Ga0495684_0244006 3300047471 Bacteria 1309
681 Ga0495684_0363105 3300047471 Bacteria 1025
682 Ga0495684_0503455 3300047471 Bacteria 832
683 Ga0495684_0583347 3300047471 Bacteria 757
684 Ga0495686_0000499 3300047472 Bacteria 57475
685 Ga0495686_0000521 3300047472 Bacteria 55487
686 Ga0495593_0000061 3300047673 Bacteria 45310
687 Ga0495593_0002226 3300047673 Bacteria 11635
688 Ga0495593_0010081 3300047673 Bacteria 5470
689 Ga0495593_0024000 3300047673 Bacteria 3384
690 Ga0495593_0202778 3300047673 Bacteria 997
691 Ga0495593_0610198 3300047673 Bacteria 548
692 Ga0495593_0654726 3300047673 Bacteria 527
693 Ga0495602_0004522 3300048088 Bacteria 14510
694 Ga0495602_0030437 3300048088 Bacteria 5118
695 Ga0495602_0047951 3300048088 Bacteria 3844
696 Ga0495602_0070310 3300048088 Bacteria 2996
697 Ga0495602_0108218 3300048088 Bacteria 2264
698 Ga0495602_0145910 3300048088 Bacteria 1867
699 Ga0495602_0152847 3300048088 Bacteria 1811
700 Ga0495602_0231449 3300048088 Bacteria 1388
701 Ga0495602_0456647 3300048088 Bacteria 901
702 Ga0495602_0464546 3300048088 Bacteria 891
703 Ga0495602_0489849 3300048088 Bacteria 861
704 Ga0495614_0006086 3300048089 Bacteria 5425
705 Ga0495614_0081348 3300048089 Bacteria 1403
706 Ga0495614_0103336 3300048089 Bacteria 1247
707 Ga0495614_0309035 3300048089 Bacteria 732
708 Ga0495626_0077944 3300048091 Bacteria 1477
709 Ga0496105_1079200 3300048908 Bacteria 597
710 Ga0496108_1385693 3300048911 Bacteria 589
711 Ga0496117_0014666 3300048920 Bacteria 6736
712 Ga0496117_0103022 3300048920 Bacteria 1800
713 Ga0496117_0561659 3300048920 Bacteria 541
714 Ga0496118_0069118 3300048921 Bacteria 2560
715 Ga0496118_0090560 3300048921 Bacteria 2107
716 Ga0496119_0022311 3300048922 Bacteria 4538
717 Ga0496121_0046238 3300048924 Bacteria 3728
718 Ga0496122_0338411 3300048925 Bacteria 791
719 Ga0496124_0021718 3300048927 Bacteria 5908
720 Ga0496126_0001810 3300048929 Bacteria 31289
721 Ga0496126_0206489 3300048929 Bacteria 1656
722 Ga0495678_020627 3300049459 Bacteria 2914
723 Ga0495682_0015102 3300049460 Bacteria 2927
724 Ga0495682_0033898 3300049460 Bacteria 1884
725 Ga0495682_0072340 3300049460 Bacteria 1241
726 Ga0501031_0006639 3300049568 Bacteria 7550
727 Ga0501032_0017201 3300049569 Bacteria 5078
728 Ga0501032_0609756 3300049569 Bacteria 694
729 Ga0501033_0007595 3300049570 Bacteria 8431
730 Ga0501034_0025367 3300049571 Bacteria 6034
731 Ga0501034_0071034 3300049571 Bacteria 3492
732 Ga0501034_0768301 3300049571 Bacteria 858
733 Ga0501034_1577050 3300049571 Bacteria 530
734 Ga0501036_0003103 3300049572 Bacteria 13254
735 Ga0501036_0030488 3300049572 Bacteria 4555
736 Ga0501037_0015201 3300049573 Bacteria 5663
737 Ga0501037_0730838 3300049573 Bacteria 657
738 Ga0501037_1149111 3300049573 Bacteria 502
739 Ga0501038_0004358 3300049574 Bacteria 13170
740 Ga0501039_0022878 3300049575 Bacteria 4794
741 Ga0501040_0637135 3300049576 Bacteria 770
742 Ga0501041_1062730 3300049577 Bacteria 521
743 Ga0501042_0219059 3300049578 Bacteria 1373
744 Ga0501042_0715256 3300049578 Bacteria 728
745 Ga0501043_0010559 3300049579 Bacteria 7229
746 Ga0501043_0324680 3300049579 Bacteria 1173
747 Ga0501043_1064210 3300049579 Bacteria 573
748 Ga0501046_0186916 3300049580 Bacteria 1547
749 Ga0501047_0002578 3300049581 Bacteria 17283
750 Ga0501047_0010564 3300049581 Bacteria 8731
751 Ga0501047_0015643 3300049581 Bacteria 7229
752 Ga0501047_0567515 3300049581 Bacteria 958
753 Ga0501048_1157391 3300049582 Bacteria 556
754 Ga0501067_0262872 3300049583 Bacteria 961
755 Ga0501068_0452375 3300049584 Bacteria 831
756 Ga0501069_0004731 3300049585 Bacteria 7041
757 Ga0501070_0000004 3300049586 Bacteria 254956
758 Ga0501070_0122956 3300049586 Bacteria 2145
759 Ga0501071_1060476 3300049587 Bacteria 626
760 Ga0501072_0688467 3300049588 Bacteria 804
761 Ga0501073_0196131 3300049589 Bacteria 1396
762 Ga0501073_0266695 3300049589 Bacteria 1181
763 Ga0501073_1184817 3300049589 Bacteria 524
764 Ga0501074_0067888 3300049590 Bacteria 2563
765 Ga0501074_0168477 3300049590 Bacteria 1564
766 Ga0501076_0877874 3300049592 Bacteria 740
767 Ga0501076_1536079 3300049592 Bacteria 547
768 Ga0501079_0215173 3300049741 Bacteria 1501
769 Ga0501080_0035734 3300049742 Bacteria 4638
770 Ga0501080_0064466 3300049742 Bacteria 3408
771 Ga0501080_0284893 3300049742 Bacteria 1501
772 Ga0501080_1005796 3300049742 Bacteria 723
773 Ga0501080_1106492 3300049742 Bacteria 684
774 Ga0501080_1808928 3300049742 Bacteria 513
775 Ga0501083_0004207 3300049744 Bacteria 10133
776 Ga0501083_0055162 3300049744 Bacteria 2665
777 Ga0501083_0130912 3300049744 Bacteria 1644
778 Ga0501083_0756369 3300049744 Bacteria 632
779 Ga0501083_0920014 3300049744 Bacteria 569
780 Ga0501035_0001099 3300049822 Bacteria 28343
781 Ga0501035_0017403 3300049822 Bacteria 6628
782 Ga0501035_0244250 3300049822 Bacteria 1526
783 Ga0501044_0007760 3300049823 Bacteria 11797
784 Ga0501044_0052993 3300049823 Bacteria 4176
785 Ga0501044_0109453 3300049823 Bacteria 2772
786 Ga0501044_0529057 3300049823 Bacteria 1078
787 Ga0501045_0402347 3300049824 Bacteria 1019
788 nmdc:mga06r32_367815_c1 3300050510 Bacteria 1421
789 Ga0495601_0012200 3300053077 Bacteria 5152
790 Ga0495601_0012522 3300053077 Bacteria 5088
791 Ga0495601_0072314 3300053077 Bacteria 2203
792 Ga0495601_0368483 3300053077 Bacteria 933
793 Ga0495601_0895898 3300053077 Bacteria 561
794 Ga0495612_0026068 3300053078 Bacteria 2350
795 Ga0495612_0373922 3300053078 Bacteria 645
796 Ga0495612_0523782 3300053078 Unclassified 545
797 Ga0495655_0054883 3300053083 Bacteria 1067
798 Ga0495595_0025655 3300053084 Bacteria 2614
799 Ga0495595_0126940 3300053084 Bacteria 1245
800 Ga0495595_0194138 3300053084 Bacteria 1009
801 Ga0495595_0370794 3300053084 Bacteria 724
802 Ga0495595_0372853 3300053084 Bacteria 722
803 Ga0495619_0046991 3300053085 Bacteria 2841
804 Ga0495619_0146882 3300053085 Bacteria 1626
805 Ga0495619_0197525 3300053085 Bacteria 1393
806 Ga0495619_0413811 3300053085 Bacteria 930
807 Ga0495619_0467640 3300053085 Unclassified 868
808 Ga0495619_0642135 3300053085 Bacteria 724
809 Ga0500572_070805 3300053111 Bacteria 1077
810 Ga0500595_001486 3300053119 Bacteria 12462
811 Ga0500595_001857 3300053119 Bacteria 10930
812 Ga0500618_001681 3300053125 Bacteria 9486
813 Ga0500618_018374 3300053125 Bacteria 1730
814 Ga0500559_0373815 3300053136 Bacteria 665
815 Ga0500574_126183 3300053141 Bacteria 756
816 Ga0500638_085297 3300053162 Bacteria 1495
817 Ga0500636_0012159 3300053177 Bacteria 5041
818 Ga0500636_0516556 3300053177 Bacteria 524
819 Ga0501084_0508170 3300054114 Bacteria 1019
820 Ga0501084_0600090 3300054114 Bacteria 930
821 Ga0501084_0669243 3300054114 Bacteria 876
822 Ga0501084_0811074 3300054114 Bacteria 788
823 Ga0501084_1017458 3300054114 Bacteria 696
824 Ga0501084_1620411 3300054114 Bacteria 541
825 Ga0501082_0058567 3300060353 Bacteria 3319
826 Ga0501082_0142241 3300060353 Bacteria 2082
827 Ga0501082_0169092 3300060353 Bacteria 1900
828 Ga0501082_0481970 3300060353 Bacteria 1084
829 Ga0530510_0124248 3300061734 Bacteria 1896
830 Ga0530510_0153438 3300061734 Bacteria 1702
831 Ga0530510_0576473 3300061734 Bacteria 855
832 Ga0530510_0626163 3300061734 Bacteria 819

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_100007605 Ga0070680_1000076055 79
2 3300005435 Ga0070714_102076289 Ga0070714_1020762892 79
3 3300005458 Ga0070681_10036498 Ga0070681_100364985 79
4 3300005530 Ga0070679_100649748 Ga0070679_1006497482 79
5 3300005563 Ga0068855_100213250 Ga0068855_1002132502 79
6 3300009093 Ga0105240_10144408 Ga0105240_101444084 79
7 3300013105 Ga0157369_11480450 Ga0157369_114804502 79
8 3300021441 Ga0213871_10089856 Ga0213871_100898562 79
9 3300025912 Ga0207707_10063026 Ga0207707_100630264 79
10 3300025913 Ga0207695_10091960 Ga0207695_100919604 79
11 3300025921 Ga0207652_10576304 Ga0207652_105763042 79
12 3300025929 Ga0207664_10062113 Ga0207664_100621134 79
13 3300025949 Ga0207667_10123367 Ga0207667_101233676 79
14 3300030521 Ga0307511_10001799 Ga0307511_100017998 79
15 3300039438 Ga0436360_1278836 Ga0436360_1278836_299_538 79
16 3300045051 Ga0451576_2219636 Ga0451576_2219636_23_262 79
17 3300048925 Ga0496122_0338411 Ga0496122_0338411_11_250 79
18 iso_pu_bacteria 2854681122 2854681795 79
19 3300003763 Ga0055529_1002270 Ga0055529_10022702 80
20 3300005434 Ga0070709_10344587 Ga0070709_103445872 80
21 3300005435 Ga0070714_101157494 Ga0070714_1011574942 80
22 3300005436 Ga0070713_100119950 Ga0070713_1001199502 80
23 3300005437 Ga0070710_10306891 Ga0070710_103068912 80
24 3300005445 Ga0070708_101420871 Ga0070708_1014208712 80
25 3300005458 Ga0070681_11537387 Ga0070681_115373872 80
26 3300005535 Ga0070684_100666787 Ga0070684_1006667872 80
27 3300005545 Ga0070695_100243631 Ga0070695_1002436312 80
28 3300005563 Ga0068855_100227539 Ga0068855_1002275395 80
29 3300005614 Ga0068856_100023871 Ga0068856_1000238715 80
30 3300005614 Ga0068856_100434985 Ga0068856_1004349852 80
31 3300005614 Ga0068856_100575516 Ga0068856_1005755162 80
32 3300005843 Ga0068860_102552979 Ga0068860_1025529791 80
33 3300005844 Ga0068862_102172716 Ga0068862_1021727161 80
34 3300006051 Ga0075364_10411390 Ga0075364_104113902 80
35 3300006175 Ga0070712_100469692 Ga0070712_1004696921 80
36 3300006844 Ga0075428_101225065 Ga0075428_1012250652 80
37 3300009093 Ga0105240_10529684 Ga0105240_105296842 80
38 3300009147 Ga0114129_11740347 Ga0114129_117403472 80
39 3300013297 Ga0157378_10022773 Ga0157378_100227737 80
40 3300014325 Ga0163163_10940542 Ga0163163_109405422 80
41 3300014968 Ga0157379_10611717 Ga0157379_106117172 80
42 3300021361 Ga0213872_10272836 Ga0213872_102728362 80
43 3300021441 Ga0213871_10083144 Ga0213871_100831442 80
44 3300025272 Ga0209455_1000458 Ga0209455_100045811 80
45 3300025898 Ga0207692_10053356 Ga0207692_100533565 80
46 3300025909 Ga0207705_10997492 Ga0207705_109974922 80
47 3300025928 Ga0207700_10106927 Ga0207700_101069272 80
48 3300025928 Ga0207700_10215680 Ga0207700_102156802 80
49 3300025949 Ga0207667_10130724 Ga0207667_101307242 80
50 3300026067 Ga0207678_11915471 Ga0207678_119154712 80
51 3300026075 Ga0207708_11194936 Ga0207708_111949362 80
52 3300026078 Ga0207702_10118479 Ga0207702_101184792 80
53 3300026078 Ga0207702_10316901 Ga0207702_103169012 80
54 3300026078 Ga0207702_11293867 Ga0207702_112938672 80
55 3300026078 Ga0207702_12271602 Ga0207702_122716022 80
56 3300028379 Ga0268266_10031306 Ga0268266_100313064 80
57 3300028380 Ga0268265_12687309 Ga0268265_126873092 80
58 3300028556 Ga0265337_1001289 Ga0265337_10012898 80
59 3300028556 Ga0265337_1002582 Ga0265337_10025826 80
60 3300028558 Ga0265326_10000639 Ga0265326_1000063910 80
61 3300028563 Ga0265319_1004283 Ga0265319_10042833 80
62 3300028573 Ga0265334_10000634 Ga0265334_100006346 80
63 3300028573 Ga0265334_10210781 Ga0265334_102107812 80
64 3300028577 Ga0265318_10005840 Ga0265318_100058404 80
65 3300028653 Ga0265323_10000501 Ga0265323_1000050120 80
66 3300028654 Ga0265322_10011962 Ga0265322_100119623 80
67 3300028666 Ga0265336_10000161 Ga0265336_1000016120 80
68 3300028800 Ga0265338_10000994 Ga0265338_1000099420 80
69 3300028800 Ga0265338_10040425 Ga0265338_100404253 80
70 3300028800 Ga0265338_10159348 Ga0265338_101593482 80
71 3300028800 Ga0265338_10258343 Ga0265338_102583432 80
72 3300029957 Ga0265324_10001977 Ga0265324_100019777 80
73 3300031235 Ga0265330_10304049 Ga0265330_103040492 80
74 3300031239 Ga0265328_10132154 Ga0265328_101321542 80
75 3300031239 Ga0265328_10222804 Ga0265328_102228042 80
76 3300031240 Ga0265320_10006281 Ga0265320_100062812 80
77 3300031240 Ga0265320_10010158 Ga0265320_100101583 80
78 3300031240 Ga0265320_10011369 Ga0265320_100113692 80
79 3300031241 Ga0265325_10059274 Ga0265325_100592744 80
80 3300031241 Ga0265325_10495541 Ga0265325_104955412 80
81 3300031242 Ga0265329_10288390 Ga0265329_102883902 80
82 3300031247 Ga0265340_10004409 Ga0265340_100044097 80
83 3300031247 Ga0265340_10379040 Ga0265340_103790402 80
84 3300031250 Ga0265331_10061771 Ga0265331_100617713 80
85 3300031250 Ga0265331_10455757 Ga0265331_104557572 80
86 3300031251 Ga0265327_10020348 Ga0265327_100203482 80
87 3300031251 Ga0265327_10043544 Ga0265327_100435442 80
88 3300031251 Ga0265327_10130869 Ga0265327_101308692 80
89 3300031344 Ga0265316_10146533 Ga0265316_101465334 80
90 3300031507 Ga0307509_10000197 Ga0307509_1000019751 80
91 3300031595 Ga0265313_10172310 Ga0265313_101723102 80
92 3300031595 Ga0265313_10400954 Ga0265313_104009542 80
93 3300031665 Ga0316575_10001481 Ga0316575_100014815 80
94 3300031665 Ga0316575_10211296 Ga0316575_102112962 80
95 3300031665 Ga0316575_10276213 Ga0316575_102762132 80
96 3300031691 Ga0316579_10010547 Ga0316579_100105472 80
97 3300031711 Ga0265314_10010615 Ga0265314_100106154 80
98 3300031711 Ga0265314_10033190 Ga0265314_100331903 80
99 3300031711 Ga0265314_10347862 Ga0265314_103478622 80
100 3300031712 Ga0265342_10002523 Ga0265342_100025236 80
101 3300031727 Ga0316576_10078239 Ga0316576_100782396 80
102 3300031727 Ga0316576_10222472 Ga0316576_102224723 80
103 3300031727 Ga0316576_10223820 Ga0316576_102238202 80
104 3300031727 Ga0316576_10248710 Ga0316576_102487103 80
105 3300031728 Ga0316578_10005514 Ga0316578_100055146 80
106 3300031728 Ga0316578_10569945 Ga0316578_105699452 80
107 3300031733 Ga0316577_10019089 Ga0316577_100190892 80
108 3300031733 Ga0316577_10783804 Ga0316577_107838042 80
109 3300031903 Ga0307407_11256839 Ga0307407_112568392 80
110 3300031995 Ga0307409_100288750 Ga0307409_1002887503 80
111 3300032002 Ga0307416_103829589 Ga0307416_1038295892 80
112 3300032133 Ga0316583_10000388 Ga0316583_100003889 80
113 3300032137 Ga0316585_10000265 Ga0316585_100002655 80
114 3300032139 Ga0316580_10000521 Ga0316580_100005215 80
115 3300032168 Ga0316593_10079627 Ga0316593_100796272 80
116 3300035086 Ga0373934_0487579 Ga0373934_0487579_237_479 80
117 3300035111 Ga0373923_0234961 Ga0373923_0234961_211_453 80
118 3300035113 Ga0373936_0024904 Ga0373936_0024904_1230_1472 80
119 3300035117 Ga0373953_0013070 Ga0373953_0013070_1624_1866 80
120 3300035118 Ga0373954_0009029 Ga0373954_0009029_3242_3484 80
121 3300035118 Ga0373954_0197690 Ga0373954_0197690_312_554 80
122 3300035118 Ga0373954_0590264 Ga0373954_0590264_236_478 80
123 3300035119 Ga0373956_0071029 Ga0373956_0071029_784_1026 80
124 3300035119 Ga0373956_0117285 Ga0373956_0117285_399_641 80
125 3300035119 Ga0373956_0156697 Ga0373956_0156697_714_956 80
126 3300035119 Ga0373956_0302913 Ga0373956_0302913_439_687 80
127 3300035119 Ga0373956_0305252 Ga0373956_0305252_67_309 80
128 3300035120 Ga0373957_0031366 Ga0373957_0031366_1518_1760 80
129 3300035170 Ga0373943_0395371 Ga0373943_0395371_114_356 80
130 3300035172 Ga0373955_0103220 Ga0373955_0103220_1040_1282 80
131 3300035172 Ga0373955_0193954 Ga0373955_0193954_791_1033 80
132 3300035398 Ga0316574_0000783 Ga0316574_0000783_9838_10080 80
133 3300035398 Ga0316574_0035609 Ga0316574_0035609_1837_2079 80
134 3300035398 Ga0316574_0062287 Ga0316574_0062287_1008_1250 80
135 3300035398 Ga0316574_0199617 Ga0316574_0199617_589_831 80
136 3300035410 Ga0373924_0057883 Ga0373924_0057883_1336_1578 80
137 3300035724 Ga0373933_0008329 Ga0373933_0008329_5087_5329 80
138 3300035724 Ga0373933_0023982 Ga0373933_0023982_2499_2741 80
139 3300035724 Ga0373933_0077880 Ga0373933_0077880_1670_1912 80
140 3300035724 Ga0373933_0351799 Ga0373933_0351799_168_410 80
141 3300035724 Ga0373933_0798720 Ga0373933_0798720_268_510 80
142 3300035724 Ga0373933_0870902 Ga0373933_0870902_260_505 80
143 3300036401 Ga0373937_0006092 Ga0373937_0006092_8683_8925 80
144 3300036401 Ga0373937_0123022 Ga0373937_0123022_250_492 80
145 3300036401 Ga0373937_0132856 Ga0373937_0132856_1600_1842 80
146 3300036401 Ga0373937_0728466 Ga0373937_0728466_432_674 80
147 3300036401 Ga0373937_1378959 Ga0373937_1378959_92_340 80
148 3300036647 Ga0316582_0017390 Ga0316582_0017390_3108_3350 80
149 3300036712 Ga0316584_0004837 Ga0316584_0004837_5581_5823 80
150 3300036712 Ga0316584_0174049 Ga0316584_0174049_156_398 80
151 3300036712 Ga0316584_0347192 Ga0316584_0347192_16_258 80
152 3300037588 Ga0316581_0001594 Ga0316581_0001594_4811_5053 80
153 3300039438 Ga0436360_0278009 Ga0436360_0278009_486_728 80
154 3300039438 Ga0436360_0694448 Ga0436360_0694448_375_617 80
155 3300039447 Ga0436361_0031613 Ga0436361_0031613_863_1108 80
156 3300039447 Ga0436361_0083953 Ga0436361_0083953_1642_1884 80
157 3300039447 Ga0436361_0623967 Ga0436361_0623967_278_523 80
158 3300039447 Ga0436361_0834676 Ga0436361_0834676_431_673 80
159 3300039453 Ga0436362_0199972 Ga0436362_0199972_104_346 80
160 3300039453 Ga0436362_0490283 Ga0436362_0490283_273_518 80
161 3300039453 Ga0436362_0732104 Ga0436362_0732104_282_530 80
162 3300042461 Ga0439460_0080674 Ga0439460_0080674_298_540 80
163 3300044712 Ga0453684_0041407 Ga0453684_0041407_1596_1841 80
164 3300046454 Ga0495592_0351286 Ga0495592_0351286_223_465 80
165 3300046462 Ga0495651_0055901 Ga0495651_0055901_2098_2340 80
166 3300046462 Ga0495651_0088503 Ga0495651_0088503_329_571 80
167 3300046463 Ga0495653_0904265 Ga0495653_0904265_158_400 80
168 3300046474 Ga0495605_0314502 Ga0495605_0314502_174_422 80
169 3300046492 Ga0495585_0027418 Ga0495585_0027418_613_861 80
170 3300046500 Ga0495596_0177463 Ga0495596_0177463_171_419 80
171 3300046501 Ga0495607_0118417 Ga0495607_0118417_909_1157 80
172 3300046506 Ga0495583_0161809 Ga0495583_0161809_457_699 80
173 3300046511 Ga0495608_0089470 Ga0495608_0089470_1530_1772 80
174 3300046516 Ga0495628_0049446 Ga0495628_0049446_156_398 80
175 3300046516 Ga0495628_0609053 Ga0495628_0609053_346_588 80
176 3300046518 Ga0495631_0222340 Ga0495631_0222340_320_562 80
177 3300046523 Ga0495644_0173559 Ga0495644_0173559_33_281 80
178 3300046528 Ga0495642_0131984 Ga0495642_0131984_382_630 80
179 3300046533 Ga0495640_0036999 Ga0495640_0036999_389_631 80
180 3300046537 Ga0495598_0284671 Ga0495598_0284671_249_497 80
181 3300046558 Ga0495633_0181635 Ga0495633_0181635_126_374 80
182 3300046559 Ga0495667_0150969 Ga0495667_0150969_27_269 80
183 3300046615 Ga0495656_0512478 Ga0495656_0512478_319_567 80
184 3300046648 Ga0495611_0315904 Ga0495611_0315904_374_622 80
185 3300046663 Ga0495635_0785931 Ga0495635_0785931_205_447 80
186 3300046665 Ga0495661_0293420 Ga0495661_0293420_352_600 80
187 3300046678 Ga0495599_0128394 Ga0495599_0128394_746_988 80
188 3300046679 Ga0495623_0134321 Ga0495623_0134321_260_502 80
189 3300046809 Ga0495600_0148994 Ga0495600_0148994_420_662 80
190 3300046809 Ga0495600_0597403 Ga0495600_0597403_284_526 80
191 3300046809 Ga0495600_0920796 Ga0495600_0920796_96_338 80
192 3300047317 Ga0495604_0182137 Ga0495604_0182137_922_1164 80
193 3300047317 Ga0495604_0827851 Ga0495604_0827851_13_255 80
194 3300047318 Ga0495636_0185038 Ga0495636_0185038_103_351 80
195 3300047322 Ga0495680_0249699 Ga0495680_0249699_497_739 80
196 3300047322 Ga0495680_0329167 Ga0495680_0329167_662_904 80
197 3300047444 Ga0495675_0470242 Ga0495675_0470242_190_432 80
198 3300047444 Ga0495675_0478648 Ga0495675_0478648_46_288 80
199 3300048088 Ga0495602_0464546 Ga0495602_0464546_280_522 80
200 3300048088 Ga0495602_0489849 Ga0495602_0489849_608_850 80
201 3300048920 Ga0496117_0014666 Ga0496117_0014666_3244_3486 80
202 3300048921 Ga0496118_0069118 Ga0496118_0069118_298_540 80
203 3300048927 Ga0496124_0021718 Ga0496124_0021718_667_909 80
204 3300049459 Ga0495678_020627 Ga0495678_020627_585_827 80
205 3300049571 Ga0501034_0071034 Ga0501034_0071034_31_273 80
206 3300049573 Ga0501037_1149111 Ga0501037_1149111_72_314 80
207 3300049576 Ga0501040_0637135 Ga0501040_0637135_76_318 80
208 3300049577 Ga0501041_1062730 Ga0501041_1062730_201_443 80
209 3300049581 Ga0501047_0567515 Ga0501047_0567515_699_941 80
210 3300049585 Ga0501069_0004731 Ga0501069_0004731_2044_2286 80
211 3300049586 Ga0501070_0000004 Ga0501070_0000004_226840_227082 80
212 3300049587 Ga0501071_1060476 Ga0501071_1060476_124_366 80
213 3300049588 Ga0501072_0688467 Ga0501072_0688467_379_621 80
214 3300049589 Ga0501073_0196131 Ga0501073_0196131_181_423 80
215 3300049589 Ga0501073_0266695 Ga0501073_0266695_143_385 80
216 3300049589 Ga0501073_1184817 Ga0501073_1184817_81_323 80
217 3300049590 Ga0501074_0067888 Ga0501074_0067888_1388_1630 80
218 3300049592 Ga0501076_0877874 Ga0501076_0877874_236_478 80
219 3300049592 Ga0501076_1536079 Ga0501076_1536079_88_330 80
220 3300049742 Ga0501080_0035734 Ga0501080_0035734_3349_3591 80
221 3300049742 Ga0501080_0284893 Ga0501080_0284893_1161_1403 80
222 3300049742 Ga0501080_1106492 Ga0501080_1106492_143_385 80
223 3300049742 Ga0501080_1808928 Ga0501080_1808928_38_280 80
224 3300049744 Ga0501083_0055162 Ga0501083_0055162_2388_2630 80
225 3300049744 Ga0501083_0130912 Ga0501083_0130912_1387_1629 80
226 3300049744 Ga0501083_0920014 Ga0501083_0920014_42_284 80
227 3300053077 Ga0495601_0072314 Ga0495601_0072314_1599_1841 80
228 3300053078 Ga0495612_0523782 Ga0495612_0523782_64_309 80
229 3300053083 Ga0495655_0054883 Ga0495655_0054883_158_406 80
230 3300053084 Ga0495595_0194138 Ga0495595_0194138_180_422 80
231 3300053084 Ga0495595_0372853 Ga0495595_0372853_59_301 80
232 3300053085 Ga0495619_0467640 Ga0495619_0467640_573_815 80
233 3300053125 Ga0500618_001681 Ga0500618_001681_8801_9043 80
234 3300053136 Ga0500559_0373815 Ga0500559_0373815_88_330 80
235 3300054114 Ga0501084_0508170 Ga0501084_0508170_637_879 80
236 3300054114 Ga0501084_0669243 Ga0501084_0669243_393_635 80
237 3300054114 Ga0501084_1017458 Ga0501084_1017458_149_391 80
238 3300060353 Ga0501082_0169092 Ga0501082_0169092_187_429 80
239 3300061734 Ga0530510_0124248 Ga0530510_0124248_1251_1493 80
240 3300061734 Ga0530510_0153438 Ga0530510_0153438_172_414 80
241 3300061734 Ga0530510_0576473 Ga0530510_0576473_145_387 80
242 3300061734 Ga0530510_0626163 Ga0530510_0626163_302_544 80
243 3300002704 JGI25155J39150_1000040 JGI25155J39150_100004044 81
244 3300002705 JGI25156J39149_1000051 JGI25156J39149_100005150 81
245 3300002738 JGI25154J39366_1000079 JGI25154J39366_100007950 81
246 3300002741 JGI25157J39369_1000168 JGI25157J39369_100016810 81
247 3300003214 JGI25165J46597_1002592 JGI25165J46597_10025927 81
248 3300003320 rootH2_10151561 rootH2_101515613 81
249 3300003320 rootH2_10152981 rootH2_101529812 81
250 3300003322 rootL2_10013062 rootL2_100130629 81
251 3300003322 rootL2_10019673 rootL2_100196736 81
252 3300003322 rootL2_10063881 rootL2_1006388114 81
253 3300003752 Ga0055539_1023396 Ga0055539_10233962 81
254 3300003771 Ga0055526_1071029 Ga0055526_10710292 81
255 3300005338 Ga0068868_101125213 Ga0068868_1011252132 81
256 3300005365 Ga0070688_100504606 Ga0070688_1005046062 81
257 3300005435 Ga0070714_100344743 Ga0070714_1003447432 81
258 3300005436 Ga0070713_100018664 Ga0070713_1000186643 81
259 3300005436 Ga0070713_100154223 Ga0070713_1001542232 81
260 3300005437 Ga0070710_10155011 Ga0070710_101550112 81
261 3300005437 Ga0070710_10369546 Ga0070710_103695462 81
262 3300005439 Ga0070711_100023848 Ga0070711_1000238482 81
263 3300005439 Ga0070711_100585681 Ga0070711_1005856811 81
264 3300005439 Ga0070711_100817750 Ga0070711_1008177501 81
265 3300005440 Ga0070705_101013910 Ga0070705_1010139101 81
266 3300005467 Ga0070706_100702155 Ga0070706_1007021551 81
267 3300005518 Ga0070699_102067474 Ga0070699_1020674741 81
268 3300005535 Ga0070684_102025484 Ga0070684_1020254842 81
269 3300005536 Ga0070697_100144710 Ga0070697_1001447103 81
270 3300006028 Ga0070717_10207675 Ga0070717_102076752 81
271 3300006028 Ga0070717_10278685 Ga0070717_102786851 81
272 3300006028 Ga0070717_11443074 Ga0070717_114430742 81
273 3300006173 Ga0070716_100013267 Ga0070716_1000132676 81
274 3300006173 Ga0070716_101462654 Ga0070716_1014626542 81
275 3300006175 Ga0070712_100007480 Ga0070712_1000074807 81
276 3300006175 Ga0070712_100729240 Ga0070712_1007292402 81
277 3300006175 Ga0070712_100784323 Ga0070712_1007843232 81
278 3300006175 Ga0070712_101271005 Ga0070712_1012710052 81
279 3300006847 Ga0075431_100394042 Ga0075431_1003940423 81
280 3300009093 Ga0105240_11214853 Ga0105240_112148532 81
281 3300009093 Ga0105240_11455662 Ga0105240_114556622 81
282 3300009101 Ga0105247_10895132 Ga0105247_108951322 81
283 3300009551 Ga0105238_11626792 Ga0105238_116267922 81
284 3300010375 Ga0105239_10643211 Ga0105239_106432112 81
285 3300013104 Ga0157370_10344551 Ga0157370_103445512 81
286 3300013306 Ga0163162_12276555 Ga0163162_122765551 81
287 3300014497 Ga0182008_10128327 Ga0182008_101283272 81
288 3300014497 Ga0182008_10447274 Ga0182008_104472742 81
289 3300021361 Ga0213872_10000453 Ga0213872_1000045333 81
290 3300021361 Ga0213872_10076735 Ga0213872_100767352 81
291 3300021361 Ga0213872_10088542 Ga0213872_100885422 81
292 3300021361 Ga0213872_10390296 Ga0213872_103902961 81
293 3300021377 Ga0213874_10111482 Ga0213874_101114822 81
294 3300021388 Ga0213875_10077890 Ga0213875_100778904 81
295 3300021441 Ga0213871_10022734 Ga0213871_100227342 81
296 3300021441 Ga0213871_10062210 Ga0213871_100622102 81
297 3300025206 Ga0209435_100052 Ga0209435_10005241 81
298 3300025231 Ga0207427_103984 Ga0207427_1039845 81
299 3300025246 Ga0209646_1000163 Ga0209646_100016341 81
300 3300025250 Ga0209026_1000190 Ga0209026_100019041 81
301 3300025253 Ga0209677_100311 Ga0209677_10031130 81
302 3300025256 Ga0209759_1000213 Ga0209759_100021348 81
303 3300025261 Ga0209233_1002612 Ga0209233_10026127 81
304 3300025295 Ga0209564_1009066 Ga0209564_10090662 81
305 3300025898 Ga0207692_10042656 Ga0207692_100426563 81
306 3300025905 Ga0207685_10257122 Ga0207685_102571222 81
307 3300025905 Ga0207685_10607398 Ga0207685_106073982 81
308 3300025910 Ga0207684_11427583 Ga0207684_114275831 81
309 3300025915 Ga0207693_10014221 Ga0207693_100142213 81
310 3300025915 Ga0207693_10257545 Ga0207693_102575452 81
311 3300025915 Ga0207693_10719816 Ga0207693_107198162 81
312 3300025915 Ga0207693_10737617 Ga0207693_107376172 81
313 3300025916 Ga0207663_10425979 Ga0207663_104259792 81
314 3300025916 Ga0207663_10731728 Ga0207663_107317282 81
315 3300025928 Ga0207700_10062481 Ga0207700_100624812 81
316 3300025928 Ga0207700_10136843 Ga0207700_101368432 81
317 3300025929 Ga0207664_10016010 Ga0207664_100160103 81
318 3300025929 Ga0207664_10171965 Ga0207664_101719654 81
319 3300025939 Ga0207665_10023328 Ga0207665_100233286 81
320 3300026023 Ga0207677_11023017 Ga0207677_110230172 81
321 3300026067 Ga0207678_10602201 Ga0207678_106022012 81
322 3300026067 Ga0207678_11465797 Ga0207678_114657972 81
323 3300026078 Ga0207702_12056119 Ga0207702_120561191 81
324 3300026095 Ga0207676_11272134 Ga0207676_112721342 81
325 3300028017 Ga0265356_1032084 Ga0265356_10320842 81
326 3300028556 Ga0265337_1000824 Ga0265337_100082415 81
327 3300028558 Ga0265326_10006770 Ga0265326_100067706 81
328 3300028563 Ga0265319_1001628 Ga0265319_10016288 81
329 3300028573 Ga0265334_10000208 Ga0265334_1000020810 81
330 3300028577 Ga0265318_10011015 Ga0265318_100110155 81
331 3300028653 Ga0265323_10000074 Ga0265323_1000007426 81
332 3300028654 Ga0265322_10015977 Ga0265322_100159774 81
333 3300028666 Ga0265336_10000108 Ga0265336_1000010841 81
334 3300028666 Ga0265336_10060823 Ga0265336_100608232 81
335 3300028800 Ga0265338_10000119 Ga0265338_1000011992 81
336 3300028800 Ga0265338_10301965 Ga0265338_103019653 81
337 3300028800 Ga0265338_10559043 Ga0265338_105590432 81
338 3300029957 Ga0265324_10002357 Ga0265324_100023578 81
339 3300029957 Ga0265324_10003388 Ga0265324_100033884 81
340 3300030760 Ga0265762_1096431 Ga0265762_10964311 81
341 3300030760 Ga0265762_1164593 Ga0265762_11645931 81
342 3300030878 Ga0265770_1040967 Ga0265770_10409672 81
343 3300031090 Ga0265760_10117592 Ga0265760_101175922 81
344 3300031235 Ga0265330_10105097 Ga0265330_101050971 81
345 3300031238 Ga0265332_10148842 Ga0265332_101488422 81
346 3300031239 Ga0265328_10002497 Ga0265328_100024975 81
347 3300031239 Ga0265328_10019367 Ga0265328_100193673 81
348 3300031241 Ga0265325_10080531 Ga0265325_100805312 81
349 3300031242 Ga0265329_10218165 Ga0265329_102181652 81
350 3300031247 Ga0265340_10112315 Ga0265340_101123152 81
351 3300031247 Ga0265340_10273545 Ga0265340_102735452 81
352 3300031249 Ga0265339_10037362 Ga0265339_100373622 81
353 3300031250 Ga0265331_10000779 Ga0265331_100007798 81
354 3300031250 Ga0265331_10006770 Ga0265331_100067706 81
355 3300031250 Ga0265331_10570592 Ga0265331_105705922 81
356 3300031251 Ga0265327_10030492 Ga0265327_100304923 81
357 3300031251 Ga0265327_10035788 Ga0265327_100357882 81
358 3300031344 Ga0265316_10203631 Ga0265316_102036312 81
359 3300031344 Ga0265316_10255847 Ga0265316_102558472 81
360 3300031595 Ga0265313_10000004 Ga0265313_1000000415 81
361 3300031595 Ga0265313_10000307 Ga0265313_1000030739 81
362 3300031595 Ga0265313_10085057 Ga0265313_100850572 81
363 3300031665 Ga0316575_10173317 Ga0316575_101733172 81
364 3300031665 Ga0316575_10203702 Ga0316575_102037022 81
365 3300031665 Ga0316575_10220355 Ga0316575_102203552 81
366 3300031665 Ga0316575_10265876 Ga0316575_102658762 81
367 3300031665 Ga0316575_10455210 Ga0316575_104552102 81
368 3300031691 Ga0316579_10246238 Ga0316579_102462382 81
369 3300031691 Ga0316579_10308127 Ga0316579_103081272 81
370 3300031691 Ga0316579_10411020 Ga0316579_104110202 81
371 3300031711 Ga0265314_10027051 Ga0265314_100270516 81
372 3300031712 Ga0265342_10162048 Ga0265342_101620482 81
373 3300031712 Ga0265342_10572170 Ga0265342_105721702 81
374 3300031727 Ga0316576_10010858 Ga0316576_100108586 81
375 3300031727 Ga0316576_10020270 Ga0316576_100202703 81
376 3300031727 Ga0316576_10734913 Ga0316576_107349132 81
377 3300031728 Ga0316578_10061192 Ga0316578_100611923 81
378 3300031728 Ga0316578_10098660 Ga0316578_100986602 81
379 3300031728 Ga0316578_10180290 Ga0316578_101802903 81
380 3300031728 Ga0316578_10194033 Ga0316578_101940332 81
381 3300031728 Ga0316578_10543015 Ga0316578_105430152 81
382 3300031733 Ga0316577_10136968 Ga0316577_101369682 81
383 3300031733 Ga0316577_10239353 Ga0316577_102393532 81
384 3300032133 Ga0316583_10006625 Ga0316583_100066257 81
385 3300032133 Ga0316583_10033634 Ga0316583_100336342 81
386 3300032133 Ga0316583_10096783 Ga0316583_100967832 81
387 3300032133 Ga0316583_10166319 Ga0316583_101663192 81
388 3300033547 Ga0316212_1019979 Ga0316212_10199792 81
389 3300035089 Ga0373944_0106551 Ga0373944_0106551_367_612 81
390 3300035111 Ga0373923_0009168 Ga0373923_0009168_1502_1747 81
391 3300035111 Ga0373923_0087458 Ga0373923_0087458_506_751 81
392 3300035113 Ga0373936_0117819 Ga0373936_0117819_47_292 81
393 3300035113 Ga0373936_0532890 Ga0373936_0532890_141_386 81
394 3300035116 Ga0373945_0156429 Ga0373945_0156429_172_417 81
395 3300035116 Ga0373945_0471514 Ga0373945_0471514_110_355 81
396 3300035117 Ga0373953_0138850 Ga0373953_0138850_597_842 81
397 3300035118 Ga0373954_0094035 Ga0373954_0094035_498_743 81
398 3300035118 Ga0373954_0225411 Ga0373954_0225411_484_729 81
399 3300035118 Ga0373954_0325286 Ga0373954_0325286_376_621 81
400 3300035119 Ga0373956_0201869 Ga0373956_0201869_432_677 81
401 3300035120 Ga0373957_0012849 Ga0373957_0012849_1447_1692 81
402 3300035170 Ga0373943_0046938 Ga0373943_0046938_927_1172 81
403 3300035171 Ga0373946_0070480 Ga0373946_0070480_206_451 81
404 3300035171 Ga0373946_0153898 Ga0373946_0153898_262_507 81
405 3300035171 Ga0373946_0248893 Ga0373946_0248893_507_752 81
406 3300035172 Ga0373955_0467804 Ga0373955_0467804_79_324 81
407 3300035172 Ga0373955_0963871 Ga0373955_0963871_248_493 81
408 3300035172 Ga0373955_1010031 Ga0373955_1010031_136_381 81
409 3300035398 Ga0316574_0001746 Ga0316574_0001746_8205_8450 81
410 3300035398 Ga0316574_0094639 Ga0316574_0094639_1275_1520 81
411 3300035398 Ga0316574_0508503 Ga0316574_0508503_87_332 81
412 3300035410 Ga0373924_0009136 Ga0373924_0009136_231_476 81
413 3300035410 Ga0373924_0123364 Ga0373924_0123364_143_388 81
414 3300035692 Ga0373935_0137957 Ga0373935_0137957_566_811 81
415 3300035692 Ga0373935_0160427 Ga0373935_0160427_724_969 81
416 3300035692 Ga0373935_0288933 Ga0373935_0288933_647_892 81
417 3300035692 Ga0373935_0319106 Ga0373935_0319106_757_1002 81
418 3300035695 Ga0373927_0031570 Ga0373927_0031570_465_710 81
419 3300035695 Ga0373927_0055459 Ga0373927_0055459_627_872 81
420 3300035695 Ga0373927_0069006 Ga0373927_0069006_551_796 81
421 3300035695 Ga0373927_0119582 Ga0373927_0119582_174_419 81
422 3300035695 Ga0373927_0363663 Ga0373927_0363663_113_358 81
423 3300035695 Ga0373927_1013880 Ga0373927_1013880_88_333 81
424 3300035724 Ga0373933_0024422 Ga0373933_0024422_998_1243 81
425 3300035724 Ga0373933_0062902 Ga0373933_0062902_1209_1454 81
426 3300035724 Ga0373933_0353156 Ga0373933_0353156_605_850 81
427 3300035724 Ga0373933_0711746 Ga0373933_0711746_120_365 81
428 3300035725 Ga0373947_0038699 Ga0373947_0038699_820_1065 81
429 3300035725 Ga0373947_0119891 Ga0373947_0119891_433_678 81
430 3300035725 Ga0373947_0148012 Ga0373947_0148012_1047_1292 81
431 3300035725 Ga0373947_0151364 Ga0373947_0151364_786_1031 81
432 3300035725 Ga0373947_0257358 Ga0373947_0257358_101_346 81
433 3300036401 Ga0373937_0031834 Ga0373937_0031834_1528_1773 81
434 3300036401 Ga0373937_0101263 Ga0373937_0101263_2155_2400 81
435 3300036401 Ga0373937_0169193 Ga0373937_0169193_307_552 81
436 3300036401 Ga0373937_0405101 Ga0373937_0405101_326_571 81
437 3300036401 Ga0373937_1870403 Ga0373937_1870403_18_263 81
438 3300036459 Ga0372808_019356 Ga0372808_019356_510_755 81
439 3300036647 Ga0316582_0029049 Ga0316582_0029049_1020_1265 81
440 3300036647 Ga0316582_0161381 Ga0316582_0161381_1067_1321 81
441 3300036647 Ga0316582_0278922 Ga0316582_0278922_207_461 81
442 3300036647 Ga0316582_0352919 Ga0316582_0352919_215_460 81
443 3300036647 Ga0316582_0982814 Ga0316582_0982814_211_456 81
444 3300036712 Ga0316584_0028739 Ga0316584_0028739_3201_3446 81
445 3300036712 Ga0316584_0088042 Ga0316584_0088042_1973_2218 81
446 3300036712 Ga0316584_0157349 Ga0316584_0157349_915_1160 81
447 3300036712 Ga0316584_0164529 Ga0316584_0164529_634_879 81
448 3300037068 Ga0373925_0023549 Ga0373925_0023549_2247_2492 81
449 3300037068 Ga0373925_0391984 Ga0373925_0391984_783_1028 81
450 3300037068 Ga0373925_0473539 Ga0373925_0473539_161_406 81
451 3300037312 Ga0395899_0010671 Ga0395899_0010671_2858_3103 81
452 3300037418 Ga0395900_0245861 Ga0395900_0245861_379_624 81
453 3300037466 Ga0395898_0160704 Ga0395898_0160704_851_1096 81
454 3300037471 Ga0395905_0093980 Ga0395905_0093980_364_609 81
455 3300037471 Ga0395905_1523401 Ga0395905_1523401_209_454 81
456 3300037471 Ga0395905_1719761 Ga0395905_1719761_147_392 81
457 3300037853 Ga0436364_0927232 Ga0436364_0927232_2647_2892 81
458 3300038443 Ga0395901_0002803 Ga0395901_0002803_5749_5994 81
459 3300038443 Ga0395901_0866595 Ga0395901_0866595_124_369 81
460 3300039438 Ga0436360_0144939 Ga0436360_0144939_781_1026 81
461 3300039438 Ga0436360_0542036 Ga0436360_0542036_1661_1906 81
462 3300039438 Ga0436360_0648306 Ga0436360_0648306_23_268 81
463 3300039438 Ga0436360_0731534 Ga0436360_0731534_80_325 81
464 3300039447 Ga0436361_0736815 Ga0436361_0736815_943_1188 81
465 3300039447 Ga0436361_0752321 Ga0436361_0752321_262_507 81
466 3300039447 Ga0436361_0837231 Ga0436361_0837231_41195_41446 81
467 3300039447 Ga0436361_0851527 Ga0436361_0851527_1390_1635 81
468 3300039447 Ga0436361_0904970 Ga0436361_0904970_188_445 81
469 3300039447 Ga0436361_1197906 Ga0436361_1197906_217_462 81
470 3300039450 Ga0436363_0190844 Ga0436363_0190844_324_569 81
471 3300039450 Ga0436363_0964032 Ga0436363_0964032_485_730 81
472 3300039453 Ga0436362_0659311 Ga0436362_0659311_41_286 81
473 3300039453 Ga0436362_1305803 Ga0436362_1305803_149_394 81
474 3300042876 Ga0451577_0015231 Ga0451577_0015231_4136_4387 81
475 3300042876 Ga0451577_0106880 Ga0451577_0106880_153_404 81
476 3300044694 Ga0466963_0459393 Ga0466963_0459393_416_664 81
477 3300044712 Ga0453684_0040623 Ga0453684_0040623_4877_5128 81
478 3300044712 Ga0453684_0104766 Ga0453684_0104766_1166_1417 81
479 3300044712 Ga0453684_0150574 Ga0453684_0150574_1173_1427 81
480 3300045051 Ga0451576_0000808 Ga0451576_0000808_20268_20519 81
481 3300046454 Ga0495592_0078329 Ga0495592_0078329_218_463 81
482 3300046454 Ga0495592_0112100 Ga0495592_0112100_1142_1387 81
483 3300046454 Ga0495592_0182319 Ga0495592_0182319_916_1161 81
484 3300046455 Ga0495603_0060427 Ga0495603_0060427_1012_1257 81
485 3300046455 Ga0495603_0147520 Ga0495603_0147520_621_866 81
486 3300046459 Ga0495629_0221762 Ga0495629_0221762_867_1112 81
487 3300046459 Ga0495629_0270264 Ga0495629_0270264_169_414 81
488 3300046459 Ga0495629_0426294 Ga0495629_0426294_255_500 81
489 3300046459 Ga0495629_0472995 Ga0495629_0472995_523_768 81
490 3300046459 Ga0495629_0729243 Ga0495629_0729243_237_482 81
491 3300046461 Ga0495641_0318551 Ga0495641_0318551_354_599 81
492 3300046462 Ga0495651_0168846 Ga0495651_0168846_770_1015 81
493 3300046462 Ga0495651_0266874 Ga0495651_0266874_812_1057 81
494 3300046462 Ga0495651_0717537 Ga0495651_0717537_255_500 81
495 3300046462 Ga0495651_0942236 Ga0495651_0942236_249_494 81
496 3300046463 Ga0495653_0029496 Ga0495653_0029496_1564_1809 81
497 3300046463 Ga0495653_0239645 Ga0495653_0239645_903_1148 81
498 3300046472 Ga0495580_0000504 Ga0495580_0000504_6489_6734 81
499 3300046472 Ga0495580_0005127 Ga0495580_0005127_10505_10750 81
500 3300046472 Ga0495580_0303591 Ga0495580_0303591_548_793 81
501 3300046472 Ga0495580_0756394 Ga0495580_0756394_334_579 81
502 3300046473 Ga0495582_0476929 Ga0495582_0476929_369_614 81
503 3300046474 Ga0495605_0116876 Ga0495605_0116876_231_476 81
504 3300046475 Ga0495639_0105852 Ga0495639_0105852_55_300 81
505 3300046476 Ga0495662_0289594 Ga0495662_0289594_467_712 81
506 3300046477 Ga0495664_0002427 Ga0495664_0002427_8887_9132 81
507 3300046477 Ga0495664_0477806 Ga0495664_0477806_16_261 81
508 3300046499 Ga0495594_0146123 Ga0495594_0146123_35_280 81
509 3300046499 Ga0495594_0328823 Ga0495594_0328823_194_439 81
510 3300046500 Ga0495596_0042961 Ga0495596_0042961_1472_1720 81
511 3300046506 Ga0495583_0001364 Ga0495583_0001364_24334_24579 81
512 3300046507 Ga0495606_0541018 Ga0495606_0541018_47_295 81
513 3300046511 Ga0495608_0215809 Ga0495608_0215809_761_1006 81
514 3300046511 Ga0495608_0337128 Ga0495608_0337128_412_657 81
515 3300046514 Ga0495618_0153640 Ga0495618_0153640_687_932 81
516 3300046514 Ga0495618_0188673 Ga0495618_0188673_292_537 81
517 3300046516 Ga0495628_0097145 Ga0495628_0097145_763_1008 81
518 3300046516 Ga0495628_0147194 Ga0495628_0147194_949_1194 81
519 3300046516 Ga0495628_0222089 Ga0495628_0222089_447_692 81
520 3300046516 Ga0495628_0810150 Ga0495628_0810150_360_605 81
521 3300046517 Ga0495630_0102060 Ga0495630_0102060_1665_1910 81
522 3300046517 Ga0495630_0294538 Ga0495630_0294538_334_579 81
523 3300046517 Ga0495630_0351579 Ga0495630_0351579_500_745 81
524 3300046524 Ga0495648_0004401 Ga0495648_0004401_10722_10967 81
525 3300046529 Ga0495652_0188166 Ga0495652_0188166_948_1193 81
526 3300046529 Ga0495652_0452091 Ga0495652_0452091_568_813 81
527 3300046529 Ga0495652_1047039 Ga0495652_1047039_247_492 81
528 3300046531 Ga0495665_0064832 Ga0495665_0064832_510_755 81
529 3300046531 Ga0495665_0253751 Ga0495665_0253751_13_258 81
530 3300046531 Ga0495665_0477396 Ga0495665_0477396_247_492 81
531 3300046531 Ga0495665_0515284 Ga0495665_0515284_344_589 81
532 3300046533 Ga0495640_0173167 Ga0495640_0173167_715_960 81
533 3300046533 Ga0495640_0532254 Ga0495640_0532254_140_385 81
534 3300046533 Ga0495640_0724839 Ga0495640_0724839_274_519 81
535 3300046533 Ga0495640_0868146 Ga0495640_0868146_110_355 81
536 3300046536 Ga0495587_0018799 Ga0495587_0018799_319_564 81
537 3300046536 Ga0495587_0319087 Ga0495587_0319087_473_718 81
538 3300046536 Ga0495587_0333747 Ga0495587_0333747_503_748 81
539 3300046543 Ga0495645_0000754 Ga0495645_0000754_20351_20596 81
540 3300046557 Ga0495622_0302475 Ga0495622_0302475_262_507 81
541 3300046559 Ga0495667_0039299 Ga0495667_0039299_687_932 81
542 3300046559 Ga0495667_0183237 Ga0495667_0183237_591_836 81
543 3300046642 Ga0495634_0148341 Ga0495634_0148341_939_1184 81
544 3300046642 Ga0495634_0445336 Ga0495634_0445336_338_583 81
545 3300046642 Ga0495634_0457300 Ga0495634_0457300_434_679 81
546 3300046642 Ga0495634_0546552 Ga0495634_0546552_276_521 81
547 3300046648 Ga0495611_0146897 Ga0495611_0146897_272_517 81
548 3300046663 Ga0495635_0021829 Ga0495635_0021829_2393_2638 81
549 3300046663 Ga0495635_0037898 Ga0495635_0037898_631_876 81
550 3300046674 Ga0495588_0026275 Ga0495588_0026275_544_789 81
551 3300046674 Ga0495588_0161979 Ga0495588_0161979_468_713 81
552 3300046675 Ga0495657_0032011 Ga0495657_0032011_2624_2869 81
553 3300046675 Ga0495657_0351052 Ga0495657_0351052_519_764 81
554 3300046675 Ga0495657_0482264 Ga0495657_0482264_17_262 81
555 3300046678 Ga0495599_0135860 Ga0495599_0135860_417_662 81
556 3300046678 Ga0495599_0674125 Ga0495599_0674125_156_401 81
557 3300046678 Ga0495599_0868877 Ga0495599_0868877_26_271 81
558 3300046679 Ga0495623_0169963 Ga0495623_0169963_601_846 81
559 3300046679 Ga0495623_0181535 Ga0495623_0181535_841_1086 81
560 3300046680 Ga0495646_0006608 Ga0495646_0006608_2054_2299 81
561 3300046680 Ga0495646_0239958 Ga0495646_0239958_574_819 81
562 3300046681 Ga0495647_0297642 Ga0495647_0297642_469_714 81
563 3300046683 Ga0495658_0513521 Ga0495658_0513521_176_421 81
564 3300046684 Ga0495669_0015542 Ga0495669_0015542_2497_2742 81
565 3300046689 Ga0495613_0812280 Ga0495613_0812280_246_491 81
566 3300046690 Ga0495624_0813887 Ga0495624_0813887_155_400 81
567 3300046809 Ga0495600_0167752 Ga0495600_0167752_812_1057 81
568 3300047315 Ga0495581_0035484 Ga0495581_0035484_1259_1504 81
569 3300047315 Ga0495581_0459631 Ga0495581_0459631_150_395 81
570 3300047317 Ga0495604_0008864 Ga0495604_0008864_432_677 81
571 3300047317 Ga0495604_0379506 Ga0495604_0379506_162_407 81
572 3300047317 Ga0495604_0479532 Ga0495604_0479532_246_491 81
573 3300047319 Ga0495674_0010027 Ga0495674_0010027_6747_6992 81
574 3300047319 Ga0495674_0103919 Ga0495674_0103919_2002_2247 81
575 3300047319 Ga0495674_0136827 Ga0495674_0136827_1221_1466 81
576 3300047319 Ga0495674_0178131 Ga0495674_0178131_1322_1567 81
577 3300047319 Ga0495674_0328620 Ga0495674_0328620_444_689 81
578 3300047321 Ga0495676_0352932 Ga0495676_0352932_167_412 81
579 3300047321 Ga0495676_0357849 Ga0495676_0357849_658_903 81
580 3300047322 Ga0495680_0069315 Ga0495680_0069315_49_294 81
581 3300047322 Ga0495680_0984843 Ga0495680_0984843_182_427 81
582 3300047443 Ga0495687_005781 Ga0495687_005781_5396_5644 81
583 3300047443 Ga0495687_009680 Ga0495687_009680_2840_3085 81
584 3300047443 Ga0495687_066266 Ga0495687_066266_1030_1275 81
585 3300047444 Ga0495675_0046564 Ga0495675_0046564_2154_2399 81
586 3300047471 Ga0495684_0042281 Ga0495684_0042281_165_410 81
587 3300047471 Ga0495684_0178937 Ga0495684_0178937_893_1138 81
588 3300047471 Ga0495684_0244006 Ga0495684_0244006_713_958 81
589 3300047471 Ga0495684_0363105 Ga0495684_0363105_365_610 81
590 3300047471 Ga0495684_0583347 Ga0495684_0583347_88_333 81
591 3300047472 Ga0495686_0000499 Ga0495686_0000499_7746_7991 81
592 3300047673 Ga0495593_0202778 Ga0495593_0202778_138_383 81
593 3300047673 Ga0495593_0610198 Ga0495593_0610198_76_321 81
594 3300048088 Ga0495602_0070310 Ga0495602_0070310_2381_2626 81
595 3300048088 Ga0495602_0108218 Ga0495602_0108218_999_1244 81
596 3300048088 Ga0495602_0145910 Ga0495602_0145910_1415_1660 81
597 3300048089 Ga0495614_0309035 Ga0495614_0309035_408_653 81
598 3300048908 Ga0496105_1079200 Ga0496105_1079200_150_395 81
599 3300048911 Ga0496108_1385693 Ga0496108_1385693_142_387 81
600 3300048920 Ga0496117_0103022 Ga0496117_0103022_1101_1349 81
601 3300048921 Ga0496118_0090560 Ga0496118_0090560_1078_1326 81
602 3300048922 Ga0496119_0022311 Ga0496119_0022311_1829_2074 81
603 3300048924 Ga0496121_0046238 Ga0496121_0046238_274_519 81
604 3300048929 Ga0496126_0206489 Ga0496126_0206489_701_946 81
605 3300049460 Ga0495682_0015102 Ga0495682_0015102_880_1125 81
606 3300049460 Ga0495682_0033898 Ga0495682_0033898_810_1055 81
607 3300049568 Ga0501031_0006639 Ga0501031_0006639_3982_4227 81
608 3300049569 Ga0501032_0017201 Ga0501032_0017201_2306_2551 81
609 3300049569 Ga0501032_0609756 Ga0501032_0609756_243_491 81
610 3300049570 Ga0501033_0007595 Ga0501033_0007595_5371_5619 81
611 3300049571 Ga0501034_0025367 Ga0501034_0025367_4262_4507 81
612 3300049571 Ga0501034_0768301 Ga0501034_0768301_223_477 81
613 3300049572 Ga0501036_0003103 Ga0501036_0003103_5803_6048 81
614 3300049572 Ga0501036_0030488 Ga0501036_0030488_2052_2300 81
615 3300049573 Ga0501037_0015201 Ga0501037_0015201_1251_1496 81
616 3300049573 Ga0501037_0730838 Ga0501037_0730838_203_451 81
617 3300049574 Ga0501038_0004358 Ga0501038_0004358_5830_6075 81
618 3300049575 Ga0501039_0022878 Ga0501039_0022878_1548_1793 81
619 3300049578 Ga0501042_0219059 Ga0501042_0219059_51_299 81
620 3300049578 Ga0501042_0715256 Ga0501042_0715256_366_620 81
621 3300049579 Ga0501043_0010559 Ga0501043_0010559_2528_2773 81
622 3300049579 Ga0501043_0324680 Ga0501043_0324680_865_1113 81
623 3300049579 Ga0501043_1064210 Ga0501043_1064210_151_408 81
624 3300049580 Ga0501046_0186916 Ga0501046_0186916_1003_1251 81
625 3300049581 Ga0501047_0002578 Ga0501047_0002578_5830_6075 81
626 3300049581 Ga0501047_0010564 Ga0501047_0010564_5054_5302 81
627 3300049581 Ga0501047_0015643 Ga0501047_0015643_3864_4118 81
628 3300049582 Ga0501048_1157391 Ga0501048_1157391_143_388 81
629 3300049583 Ga0501067_0262872 Ga0501067_0262872_604_849 81
630 3300049584 Ga0501068_0452375 Ga0501068_0452375_402_650 81
631 3300049586 Ga0501070_0122956 Ga0501070_0122956_650_895 81
632 3300049590 Ga0501074_0168477 Ga0501074_0168477_41_295 81
633 3300049741 Ga0501079_0215173 Ga0501079_0215173_35_280 81
634 3300049742 Ga0501080_0064466 Ga0501080_0064466_632_886 81
635 3300049822 Ga0501035_0001099 Ga0501035_0001099_13758_14006 81
636 3300049822 Ga0501035_0017403 Ga0501035_0017403_3977_4222 81
637 3300049822 Ga0501035_0244250 Ga0501035_0244250_766_1020 81
638 3300049823 Ga0501044_0007760 Ga0501044_0007760_7096_7341 81
639 3300049823 Ga0501044_0052993 Ga0501044_0052993_3494_3748 81
640 3300049823 Ga0501044_0109453 Ga0501044_0109453_2078_2326 81
641 3300049823 Ga0501044_0529057 Ga0501044_0529057_158_412 81
642 3300049824 Ga0501045_0402347 Ga0501045_0402347_187_432 81
643 3300050510 nmdc:mga06r32_367815_c1 nmdc:mga06r32_367815_c1_1131_1382 81
644 3300053077 Ga0495601_0012200 Ga0495601_0012200_2547_2792 81
645 3300053077 Ga0495601_0012522 Ga0495601_0012522_1701_1946 81
646 3300053077 Ga0495601_0368483 Ga0495601_0368483_443_688 81
647 3300053077 Ga0495601_0895898 Ga0495601_0895898_214_459 81
648 3300053078 Ga0495612_0026068 Ga0495612_0026068_1527_1772 81
649 3300053078 Ga0495612_0373922 Ga0495612_0373922_387_632 81
650 3300053084 Ga0495595_0025655 Ga0495595_0025655_1877_2122 81
651 3300053084 Ga0495595_0126940 Ga0495595_0126940_630_875 81
652 3300053084 Ga0495595_0370794 Ga0495595_0370794_379_624 81
653 3300053085 Ga0495619_0046991 Ga0495619_0046991_1992_2237 81
654 3300053085 Ga0495619_0146882 Ga0495619_0146882_141_386 81
655 3300053085 Ga0495619_0197525 Ga0495619_0197525_828_1073 81
656 3300053085 Ga0495619_0413811 Ga0495619_0413811_198_443 81
657 3300053085 Ga0495619_0642135 Ga0495619_0642135_94_339 81
658 3300053111 Ga0500572_070805 Ga0500572_070805_387_632 81
659 3300053119 Ga0500595_001486 Ga0500595_001486_6581_6826 81
660 3300053119 Ga0500595_001857 Ga0500595_001857_8617_8862 81
661 3300053125 Ga0500618_018374 Ga0500618_018374_129_374 81
662 3300053141 Ga0500574_126183 Ga0500574_126183_488_742 81
663 3300053162 Ga0500638_085297 Ga0500638_085297_818_1063 81
664 3300053177 Ga0500636_0012159 Ga0500636_0012159_1254_1499 81
665 3300053177 Ga0500636_0516556 Ga0500636_0516556_84_329 81
666 3300054114 Ga0501084_0600090 Ga0501084_0600090_621_866 81
667 3300054114 Ga0501084_0811074 Ga0501084_0811074_490_735 81
668 3300060353 Ga0501082_0058567 Ga0501082_0058567_3020_3265 81
669 3300060353 Ga0501082_0481970 Ga0501082_0481970_683_928 81
670 3300002067 JGI24735J21928_10012626 JGI24735J21928_100126263 82
671 3300002705 JGI25156J39149_1001045 JGI25156J39149_10010456 82
672 3300003856 Ga0058692_1048516 Ga0058692_10485161 82
673 3300005327 Ga0070658_11981165 Ga0070658_119811652 82
674 3300005339 Ga0070660_100325593 Ga0070660_1003255932 82
675 3300013105 Ga0157369_10084062 Ga0157369_100840622 82
676 3300025256 Ga0209759_1000002 Ga0209759_1000002196 82
677 3300025904 Ga0207647_10206137 Ga0207647_102061372 82
678 3300027312 Ga0209371_1008061 Ga0209371_10080613 82
679 3300030500 Ga0268256_1008346 Ga0268256_10083466 82
680 3300036712 Ga0316584_0321703 Ga0316584_0321703_10_306 82
681 3300044684 Ga0466966_0008834 Ga0466966_0008834_1354_1602 82
682 3300045049 Ga0466959_0179194 Ga0466959_0179194_1141_1389 82
683 3300046454 Ga0495592_0064883 Ga0495592_0064883_424_672 82
684 3300046454 Ga0495592_0183880 Ga0495592_0183880_572_820 82
685 3300046455 Ga0495603_0020696 Ga0495603_0020696_3313_3561 82
686 3300046458 Ga0495591_001164 Ga0495591_001164_5454_5702 82
687 3300046459 Ga0495629_0000224 Ga0495629_0000224_25371_25619 82
688 3300046459 Ga0495629_0030963 Ga0495629_0030963_2988_3236 82
689 3300046459 Ga0495629_0044380 Ga0495629_0044380_2485_2733 82
690 3300046462 Ga0495651_0065168 Ga0495651_0065168_595_843 82
691 3300046462 Ga0495651_0285207 Ga0495651_0285207_217_465 82
692 3300046462 Ga0495651_0440528 Ga0495651_0440528_159_407 82
693 3300046463 Ga0495653_0001276 Ga0495653_0001276_451_699 82
694 3300046463 Ga0495653_0016018 Ga0495653_0016018_1492_1740 82
695 3300046463 Ga0495653_0047485 Ga0495653_0047485_2227_2475 82
696 3300046463 Ga0495653_0059105 Ga0495653_0059105_1594_1842 82
697 3300046463 Ga0495653_0170550 Ga0495653_0170550_238_486 82
698 3300046463 Ga0495653_0248820 Ga0495653_0248820_241_489 82
699 3300046472 Ga0495580_0000135 Ga0495580_0000135_23003_23251 82
700 3300046472 Ga0495580_0000499 Ga0495580_0000499_7765_8013 82
701 3300046472 Ga0495580_0001710 Ga0495580_0001710_4212_4460 82
702 3300046472 Ga0495580_0004368 Ga0495580_0004368_4439_4687 82
703 3300046472 Ga0495580_0024320 Ga0495580_0024320_3217_3465 82
704 3300046473 Ga0495582_0014651 Ga0495582_0014651_3870_4118 82
705 3300046474 Ga0495605_0344199 Ga0495605_0344199_263_511 82
706 3300046476 Ga0495662_0141088 Ga0495662_0141088_374_622 82
707 3300046477 Ga0495664_0028960 Ga0495664_0028960_922_1170 82
708 3300046477 Ga0495664_0134784 Ga0495664_0134784_434_682 82
709 3300046477 Ga0495664_0461315 Ga0495664_0461315_50_298 82
710 3300046477 Ga0495664_0855252 Ga0495664_0855252_259_507 82
711 3300046500 Ga0495596_0003395 Ga0495596_0003395_7566_7814 82
712 3300046500 Ga0495596_0015530 Ga0495596_0015530_2627_2875 82
713 3300046501 Ga0495607_0271351 Ga0495607_0271351_287_535 82
714 3300046507 Ga0495606_0346496 Ga0495606_0346496_313_561 82
715 3300046511 Ga0495608_0007305 Ga0495608_0007305_1722_1970 82
716 3300046511 Ga0495608_0400756 Ga0495608_0400756_25_273 82
717 3300046512 Ga0495610_0283122 Ga0495610_0283122_107_355 82
718 3300046514 Ga0495618_0034216 Ga0495618_0034216_976_1224 82
719 3300046514 Ga0495618_0240994 Ga0495618_0240994_785_1033 82
720 3300046514 Ga0495618_0522974 Ga0495618_0522974_436_684 82
721 3300046516 Ga0495628_0000239 Ga0495628_0000239_23210_23458 82
722 3300046516 Ga0495628_0027720 Ga0495628_0027720_1412_1660 82
723 3300046516 Ga0495628_0036523 Ga0495628_0036523_975_1223 82
724 3300046516 Ga0495628_0047333 Ga0495628_0047333_730_978 82
725 3300046516 Ga0495628_0140593 Ga0495628_0140593_1492_1740 82
726 3300046516 Ga0495628_0184400 Ga0495628_0184400_85_333 82
727 3300046516 Ga0495628_0551019 Ga0495628_0551019_568_816 82
728 3300046517 Ga0495630_0017807 Ga0495630_0017807_1114_1362 82
729 3300046517 Ga0495630_0091976 Ga0495630_0091976_99_347 82
730 3300046517 Ga0495630_0395624 Ga0495630_0395624_591_839 82
731 3300046524 Ga0495648_0001136 Ga0495648_0001136_18719_18967 82
732 3300046524 Ga0495648_0148595 Ga0495648_0148595_524_772 82
733 3300046526 Ga0495666_0000487 Ga0495666_0000487_12941_13189 82
734 3300046526 Ga0495666_0016000 Ga0495666_0016000_2515_2763 82
735 3300046528 Ga0495642_0344342 Ga0495642_0344342_210_458 82
736 3300046529 Ga0495652_0038325 Ga0495652_0038325_478_726 82
737 3300046529 Ga0495652_0050070 Ga0495652_0050070_1083_1331 82
738 3300046529 Ga0495652_0193913 Ga0495652_0193913_244_492 82
739 3300046529 Ga0495652_0328439 Ga0495652_0328439_602_850 82
740 3300046529 Ga0495652_0417073 Ga0495652_0417073_177_425 82
741 3300046529 Ga0495652_0534217 Ga0495652_0534217_70_318 82
742 3300046531 Ga0495665_0005475 Ga0495665_0005475_499_747 82
743 3300046531 Ga0495665_0006209 Ga0495665_0006209_5791_6039 82
744 3300046531 Ga0495665_0010943 Ga0495665_0010943_3581_3829 82
745 3300046531 Ga0495665_0138740 Ga0495665_0138740_115_363 82
746 3300046533 Ga0495640_0011229 Ga0495640_0011229_801_1049 82
747 3300046536 Ga0495587_0014987 Ga0495587_0014987_159_407 82
748 3300046543 Ga0495645_0205304 Ga0495645_0205304_545_793 82
749 3300046543 Ga0495645_0314352 Ga0495645_0314352_579_827 82
750 3300046663 Ga0495635_0009807 Ga0495635_0009807_3729_3977 82
751 3300046663 Ga0495635_0193818 Ga0495635_0193818_582_830 82
752 3300046665 Ga0495661_0005589 Ga0495661_0005589_8573_8821 82
753 3300046675 Ga0495657_0248856 Ga0495657_0248856_310_558 82
754 3300046678 Ga0495599_0054477 Ga0495599_0054477_1507_1755 82
755 3300046678 Ga0495599_0085779 Ga0495599_0085779_1240_1488 82
756 3300046678 Ga0495599_0096892 Ga0495599_0096892_1043_1291 82
757 3300046678 Ga0495599_0323710 Ga0495599_0323710_98_346 82
758 3300046679 Ga0495623_0013273 Ga0495623_0013273_4279_4527 82
759 3300046679 Ga0495623_0014499 Ga0495623_0014499_3584_3832 82
760 3300046679 Ga0495623_0072737 Ga0495623_0072737_131_379 82
761 3300046679 Ga0495623_0147517 Ga0495623_0147517_669_917 82
762 3300046680 Ga0495646_0000222 Ga0495646_0000222_24887_25135 82
763 3300046680 Ga0495646_0079798 Ga0495646_0079798_468_716 82
764 3300046680 Ga0495646_0123859 Ga0495646_0123859_119_367 82
765 3300046680 Ga0495646_0238250 Ga0495646_0238250_184_432 82
766 3300046680 Ga0495646_0245759 Ga0495646_0245759_607_855 82
767 3300046680 Ga0495646_0408915 Ga0495646_0408915_65_313 82
768 3300046680 Ga0495646_0428558 Ga0495646_0428558_345_593 82
769 3300046684 Ga0495669_0335005 Ga0495669_0335005_246_494 82
770 3300046689 Ga0495613_0018488 Ga0495613_0018488_4390_4638 82
771 3300046689 Ga0495613_0140933 Ga0495613_0140933_450_698 82
772 3300046690 Ga0495624_0000059 Ga0495624_0000059_47625_47873 82
773 3300046690 Ga0495624_0000062 Ga0495624_0000062_42778_43026 82
774 3300046690 Ga0495624_0001465 Ga0495624_0001465_9329_9577 82
775 3300046690 Ga0495624_0057616 Ga0495624_0057616_601_849 82
776 3300046690 Ga0495624_0749776 Ga0495624_0749776_297_545 82
777 3300046694 Ga0495649_0298907 Ga0495649_0298907_213_461 82
778 3300046794 Ga0495589_0074052 Ga0495589_0074052_975_1223 82
779 3300046809 Ga0495600_0001170 Ga0495600_0001170_8538_8786 82
780 3300047315 Ga0495581_0012606 Ga0495581_0012606_532_780 82
781 3300047317 Ga0495604_0010050 Ga0495604_0010050_2421_2669 82
782 3300047317 Ga0495604_0026749 Ga0495604_0026749_3885_4133 82
783 3300047317 Ga0495604_0041177 Ga0495604_0041177_3116_3364 82
784 3300047317 Ga0495604_0154744 Ga0495604_0154744_271_519 82
785 3300047317 Ga0495604_0164679 Ga0495604_0164679_1226_1474 82
786 3300047317 Ga0495604_0462625 Ga0495604_0462625_139_387 82
787 3300047319 Ga0495674_0000180 Ga0495674_0000180_24892_25140 82
788 3300047319 Ga0495674_0000653 Ga0495674_0000653_19603_19851 82
789 3300047319 Ga0495674_0181869 Ga0495674_0181869_468_716 82
790 3300047319 Ga0495674_1297144 Ga0495674_1297144_236_484 82
791 3300047320 Ga0495672_0017205 Ga0495672_0017205_2804_3052 82
792 3300047321 Ga0495676_0020488 Ga0495676_0020488_5438_5686 82
793 3300047321 Ga0495676_1030456 Ga0495676_1030456_246_494 82
794 3300047322 Ga0495680_0004928 Ga0495680_0004928_5884_6132 82
795 3300047322 Ga0495680_0174356 Ga0495680_0174356_740_988 82
796 3300047322 Ga0495680_0282944 Ga0495680_0282944_674_922 82
797 3300047323 Ga0495683_0010872 Ga0495683_0010872_2526_2774 82
798 3300047323 Ga0495683_0032629 Ga0495683_0032629_2119_2367 82
799 3300047444 Ga0495675_0003245 Ga0495675_0003245_6927_7175 82
800 3300047444 Ga0495675_0006619 Ga0495675_0006619_637_885 82
801 3300047444 Ga0495675_0016676 Ga0495675_0016676_3391_3639 82
802 3300047444 Ga0495675_0056982 Ga0495675_0056982_1416_1664 82
803 3300047446 Ga0495679_006739 Ga0495679_006739_4071_4319 82
804 3300047446 Ga0495679_058952 Ga0495679_058952_622_870 82
805 3300047469 Ga0495673_0002923 Ga0495673_0002923_5813_6061 82
806 3300047469 Ga0495673_0025407 Ga0495673_0025407_364_612 82
807 3300047469 Ga0495673_0253560 Ga0495673_0253560_376_624 82
808 3300047471 Ga0495684_0503455 Ga0495684_0503455_90_338 82
809 3300047472 Ga0495686_0000521 Ga0495686_0000521_8683_8931 82
810 3300047673 Ga0495593_0000061 Ga0495593_0000061_20201_20449 82
811 3300047673 Ga0495593_0002226 Ga0495593_0002226_4391_4639 82
812 3300047673 Ga0495593_0010081 Ga0495593_0010081_504_752 82
813 3300047673 Ga0495593_0024000 Ga0495593_0024000_1208_1456 82
814 3300047673 Ga0495593_0654726 Ga0495593_0654726_236_484 82
815 3300048088 Ga0495602_0004522 Ga0495602_0004522_13989_14237 82
816 3300048088 Ga0495602_0030437 Ga0495602_0030437_853_1101 82
817 3300048088 Ga0495602_0047951 Ga0495602_0047951_2940_3188 82
818 3300048088 Ga0495602_0152847 Ga0495602_0152847_1471_1719 82
819 3300048088 Ga0495602_0231449 Ga0495602_0231449_840_1088 82
820 3300048088 Ga0495602_0456647 Ga0495602_0456647_595_843 82
821 3300048089 Ga0495614_0006086 Ga0495614_0006086_602_850 82
822 3300048089 Ga0495614_0081348 Ga0495614_0081348_642_890 82
823 3300048089 Ga0495614_0103336 Ga0495614_0103336_534_782 82
824 3300048091 Ga0495626_0077944 Ga0495626_0077944_862_1110 82
825 3300048920 Ga0496117_0561659 Ga0496117_0561659_282_530 82
826 3300048929 Ga0496126_0001810 Ga0496126_0001810_17071_17319 82
827 3300049460 Ga0495682_0072340 Ga0495682_0072340_660_908 82
828 3300049571 Ga0501034_1577050 Ga0501034_1577050_206_454 82
829 3300049742 Ga0501080_1005796 Ga0501080_1005796_137_385 82
830 3300049744 Ga0501083_0004207 Ga0501083_0004207_6926_7174 82
831 3300049744 Ga0501083_0756369 Ga0501083_0756369_329_577 82
832 3300054114 Ga0501084_1620411 Ga0501084_1620411_43_291 82
833 3300060353 Ga0501082_0142241 Ga0501082_0142241_878_1126 82

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00137

ATP-synt_C

ATP synthase subunit C

27

90

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tmk-assembly1.cif.gz_H1 cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, composite model 0.921 8 76
3zo6-assembly1.cif.gz_L crystal structure of bacillus pseudofirmus of4 mutant atp synthase c12 ring. 0.9035 13 75
6tmk-assembly1.cif.gz_I1 cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, composite model 0.9005 8 76
8ap6-assembly1.cif.gz_R1 trypanosoma brucei mitochondrial f1fo atp synthase dimer 0.9005 9 76
4cbk-assembly1.cif.gz_B the c-ring ion binding site of the atp synthase from bacillus pseudofirmus of4 is adapted to alkaliphilic cell physiology 0.8967 9 75
ID Description Score Start End Superfamily
af_Q54QG0_308_769_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9819 24 64 3.90.550.10
5jg7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9611 24 63 3.40.50.1980
2x2vA00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.9181 13 75 1.20.20.10
2x2vC00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.9174 13 75 1.20.20.10
2x2vB00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.916 13 75 1.20.20.10
ID Description Score Start End GO Terms
AF-A0A2V7YE35-F1-model_v4 ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) 0.9598 13 74 GO:0005886
GO:0008289
GO:0045263
GO:0046933
AF-A0A2E5G5R3-F1-model_v4 ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) 0.9439 9 74 GO:0005886
GO:0008289
GO:0045263
GO:0046933
AF-A0A5F1Z1U5-F1-model_v4 ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) 0.9403 6 74 GO:0005886
GO:0008289
GO:0045263
GO:0046933
AF-A0A7Y5BL28-F1-model_v4 ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) 0.9395 6 74 GO:0005886
GO:0008289
GO:0045263
GO:0046933
AF-V6HDU3-F1-model_v4 ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) 0.9351 6 74 GO:0005886
GO:0008289
GO:0045263
GO:0046933

Feature Viewer

pLDDT pTM Quality
91.36 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map