F482754
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 833 | 305 | 832 | 81 |
Family's Representative Sequence
| Representative Sequence | 3300036712|Ga0316584_0321703|Ga0316584_0321703_10_306 |
| Length | 98 |
| Sequence | MSLRQSVPSKLEKGPHMQNIIEVVSIIGAAIAVSFGAIMPAFSEGRAIAAAMEAIARQPEAAGTLSRTLFVGLAMIETMAIYCLVIALLLLYANPFIG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 39 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 54 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 56 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 57 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 58 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 59 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 60 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 62 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 63 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 65 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 92 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 93 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 94 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 95 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 96 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 97 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 98 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 99 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 101 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 102 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 103 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 107 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 109 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 110 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 111 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 112 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 113 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 114 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 115 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 116 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 117 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 118 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 119 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 120 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 121 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 123 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 124 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 125 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 126 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 127 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 128 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 129 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 130 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 131 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 132 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 134 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 135 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 136 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 137 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 138 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 139 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 140 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 141 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 142 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 143 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 144 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 145 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 146 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 147 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 148 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 149 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 150 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 151 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 152 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 154 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 155 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 156 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 158 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 159 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 160 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 161 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 162 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 163 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 164 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 165 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 166 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 167 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 168 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 169 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 170 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 171 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 172 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 173 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 174 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 175 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 252 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 253 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 254 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 255 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 256 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 257 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 258 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 297 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 298 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 299 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 300 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 301 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 302 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 303 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.16 |
| Metatranscriptomes | 0.72 |
| Isolates | 0.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.4 |
| Nodule | 0 |
| Rhizoplane | 0.24 |
| Rhizosphere | 93.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10012626 | 3300002067 | Bacteria | 2668 |
| 2 | JGI25155J39150_1000040 | 3300002704 | Bacteria | 89420 |
| 3 | JGI25156J39149_1000051 | 3300002705 | Bacteria | 89412 |
| 4 | JGI25156J39149_1001045 | 3300002705 | Bacteria | 12797 |
| 5 | JGI25154J39366_1000079 | 3300002738 | Bacteria | 89420 |
| 6 | JGI25157J39369_1000168 | 3300002741 | Bacteria | 55097 |
| 7 | JGI25165J46597_1002592 | 3300003214 | Bacteria | 5520 |
| 8 | rootH2_10151561 | 3300003320 | Bacteria | 2425 |
| 9 | rootH2_10152981 | 3300003320 | Bacteria | 3606 |
| 10 | rootL2_10013062 | 3300003322 | Bacteria | 10926 |
| 11 | rootL2_10019673 | 3300003322 | Bacteria | 3216 |
| 12 | rootL2_10063881 | 3300003322 | Bacteria | 12767 |
| 13 | Ga0055539_1023396 | 3300003752 | Bacteria | 726 |
| 14 | Ga0055529_1002270 | 3300003763 | Bacteria | 3885 |
| 15 | Ga0055526_1071029 | 3300003771 | Bacteria | 706 |
| 16 | Ga0058692_1048516 | 3300003856 | Bacteria | 712 |
| 17 | Ga0070658_11981165 | 3300005327 | Bacteria | 503 |
| 18 | Ga0070680_100007605 | 3300005336 | Bacteria | 8266 |
| 19 | Ga0068868_101125213 | 3300005338 | Bacteria | 723 |
| 20 | Ga0070660_100325593 | 3300005339 | Bacteria | 1263 |
| 21 | Ga0070688_100504606 | 3300005365 | Bacteria | 913 |
| 22 | Ga0070709_10344587 | 3300005434 | Bacteria | 1099 |
| 23 | Ga0070714_100344743 | 3300005435 | Bacteria | 1398 |
| 24 | Ga0070714_101157494 | 3300005435 | Unclassified | 754 |
| 25 | Ga0070714_102076289 | 3300005435 | Bacteria | 554 |
| 26 | Ga0070713_100018664 | 3300005436 | Bacteria | 5273 |
| 27 | Ga0070713_100119950 | 3300005436 | Bacteria | 2305 |
| 28 | Ga0070713_100154223 | 3300005436 | Bacteria | 2046 |
| 29 | Ga0070710_10155011 | 3300005437 | Bacteria | 1416 |
| 30 | Ga0070710_10306891 | 3300005437 | Bacteria | 1037 |
| 31 | Ga0070710_10369546 | 3300005437 | Bacteria | 954 |
| 32 | Ga0070711_100023848 | 3300005439 | Bacteria | 3985 |
| 33 | Ga0070711_100585681 | 3300005439 | Bacteria | 929 |
| 34 | Ga0070711_100817750 | 3300005439 | Bacteria | 791 |
| 35 | Ga0070705_101013910 | 3300005440 | Bacteria | 674 |
| 36 | Ga0070708_101420871 | 3300005445 | Bacteria | 647 |
| 37 | Ga0070681_10036498 | 3300005458 | Bacteria | 4936 |
| 38 | Ga0070681_11537387 | 3300005458 | Bacteria | 590 |
| 39 | Ga0070706_100702155 | 3300005467 | Bacteria | 938 |
| 40 | Ga0070699_102067474 | 3300005518 | Bacteria | 520 |
| 41 | Ga0070679_100649748 | 3300005530 | Bacteria | 997 |
| 42 | Ga0070684_100666787 | 3300005535 | Bacteria | 969 |
| 43 | Ga0070684_102025484 | 3300005535 | Bacteria | 543 |
| 44 | Ga0070697_100144710 | 3300005536 | Bacteria | 2000 |
| 45 | Ga0070695_100243631 | 3300005545 | Bacteria | 1305 |
| 46 | Ga0068855_100213250 | 3300005563 | Bacteria | 2169 |
| 47 | Ga0068855_100227539 | 3300005563 | Bacteria | 2089 |
| 48 | Ga0068856_100023871 | 3300005614 | Bacteria | 5948 |
| 49 | Ga0068856_100434985 | 3300005614 | Bacteria | 1332 |
| 50 | Ga0068856_100575516 | 3300005614 | Bacteria | 1147 |
| 51 | Ga0068860_102552979 | 3300005843 | Bacteria | 530 |
| 52 | Ga0068862_102172716 | 3300005844 | Bacteria | 566 |
| 53 | Ga0070717_10207675 | 3300006028 | Bacteria | 1718 |
| 54 | Ga0070717_10278685 | 3300006028 | Bacteria | 1482 |
| 55 | Ga0070717_11443074 | 3300006028 | Bacteria | 625 |
| 56 | Ga0075364_10411390 | 3300006051 | Bacteria | 923 |
| 57 | Ga0070716_100013267 | 3300006173 | Bacteria | 4196 |
| 58 | Ga0070716_101462654 | 3300006173 | Bacteria | 557 |
| 59 | Ga0070712_100007480 | 3300006175 | Bacteria | 6819 |
| 60 | Ga0070712_100469692 | 3300006175 | Bacteria | 1050 |
| 61 | Ga0070712_100729240 | 3300006175 | Unclassified | 847 |
| 62 | Ga0070712_100784323 | 3300006175 | Bacteria | 817 |
| 63 | Ga0070712_101271005 | 3300006175 | Bacteria | 641 |
| 64 | Ga0075428_101225065 | 3300006844 | Bacteria | 791 |
| 65 | Ga0075431_100394042 | 3300006847 | Bacteria | 1387 |
| 66 | Ga0105240_10144408 | 3300009093 | Bacteria | 2841 |
| 67 | Ga0105240_10529684 | 3300009093 | Bacteria | 1306 |
| 68 | Ga0105240_11214853 | 3300009093 | Bacteria | 798 |
| 69 | Ga0105240_11455662 | 3300009093 | Bacteria | 719 |
| 70 | Ga0105247_10895132 | 3300009101 | Bacteria | 685 |
| 71 | Ga0114129_11740347 | 3300009147 | Bacteria | 760 |
| 72 | Ga0105238_11626792 | 3300009551 | Bacteria | 676 |
| 73 | Ga0105239_10643211 | 3300010375 | Bacteria | 1211 |
| 74 | Ga0157370_10344551 | 3300013104 | Bacteria | 1373 |
| 75 | Ga0157369_10084062 | 3300013105 | Bacteria | 3403 |
| 76 | Ga0157369_11480450 | 3300013105 | Bacteria | 691 |
| 77 | Ga0157378_10022773 | 3300013297 | Bacteria | 5513 |
| 78 | Ga0163162_12276555 | 3300013306 | Bacteria | 622 |
| 79 | Ga0163163_10940542 | 3300014325 | Bacteria | 928 |
| 80 | Ga0182008_10128327 | 3300014497 | Bacteria | 1263 |
| 81 | Ga0182008_10447274 | 3300014497 | Bacteria | 702 |
| 82 | Ga0157379_10611717 | 3300014968 | Bacteria | 1018 |
| 83 | Ga0213872_10000453 | 3300021361 | Bacteria | 33422 |
| 84 | Ga0213872_10076735 | 3300021361 | Bacteria | 1503 |
| 85 | Ga0213872_10088542 | 3300021361 | Bacteria | 1386 |
| 86 | Ga0213872_10272836 | 3300021361 | Bacteria | 708 |
| 87 | Ga0213872_10390296 | 3300021361 | Bacteria | 566 |
| 88 | Ga0213874_10111482 | 3300021377 | Bacteria | 920 |
| 89 | Ga0213875_10077890 | 3300021388 | Bacteria | 1547 |
| 90 | Ga0213871_10022734 | 3300021441 | Bacteria | 1574 |
| 91 | Ga0213871_10062210 | 3300021441 | Bacteria | 1041 |
| 92 | Ga0213871_10083144 | 3300021441 | Bacteria | 920 |
| 93 | Ga0213871_10089856 | 3300021441 | Bacteria | 889 |
| 94 | Ga0209435_100052 | 3300025206 | Bacteria | 89472 |
| 95 | Ga0207427_103984 | 3300025231 | Bacteria | 2704 |
| 96 | Ga0209646_1000163 | 3300025246 | Bacteria | 89472 |
| 97 | Ga0209026_1000190 | 3300025250 | Bacteria | 89460 |
| 98 | Ga0209677_100311 | 3300025253 | Bacteria | 31839 |
| 99 | Ga0209759_1000002 | 3300025256 | Bacteria | 1027596 |
| 100 | Ga0209759_1000213 | 3300025256 | Bacteria | 89473 |
| 101 | Ga0209233_1002612 | 3300025261 | Bacteria | 6542 |
| 102 | Ga0209455_1000458 | 3300025272 | Bacteria | 30970 |
| 103 | Ga0209564_1009066 | 3300025295 | Bacteria | 4792 |
| 104 | Ga0207692_10042656 | 3300025898 | Bacteria | 2253 |
| 105 | Ga0207692_10053356 | 3300025898 | Bacteria | 2059 |
| 106 | Ga0207647_10206137 | 3300025904 | Bacteria | 1136 |
| 107 | Ga0207685_10257122 | 3300025905 | Bacteria | 847 |
| 108 | Ga0207685_10607398 | 3300025905 | Bacteria | 587 |
| 109 | Ga0207705_10997492 | 3300025909 | Bacteria | 647 |
| 110 | Ga0207684_11427583 | 3300025910 | Bacteria | 566 |
| 111 | Ga0207707_10063026 | 3300025912 | Bacteria | 3227 |
| 112 | Ga0207695_10091960 | 3300025913 | Bacteria | 3046 |
| 113 | Ga0207693_10014221 | 3300025915 | Bacteria | 6403 |
| 114 | Ga0207693_10257545 | 3300025915 | Bacteria | 1368 |
| 115 | Ga0207693_10719816 | 3300025915 | Bacteria | 772 |
| 116 | Ga0207693_10737617 | 3300025915 | Bacteria | 761 |
| 117 | Ga0207663_10425979 | 3300025916 | Bacteria | 1019 |
| 118 | Ga0207663_10731728 | 3300025916 | Bacteria | 785 |
| 119 | Ga0207652_10576304 | 3300025921 | Bacteria | 1010 |
| 120 | Ga0207700_10062481 | 3300025928 | Bacteria | 2829 |
| 121 | Ga0207700_10106927 | 3300025928 | Bacteria | 2244 |
| 122 | Ga0207700_10136843 | 3300025928 | Bacteria | 2008 |
| 123 | Ga0207700_10215680 | 3300025928 | Bacteria | 1624 |
| 124 | Ga0207664_10016010 | 3300025929 | Bacteria | 5461 |
| 125 | Ga0207664_10062113 | 3300025929 | Bacteria | 2983 |
| 126 | Ga0207664_10171965 | 3300025929 | Bacteria | 1855 |
| 127 | Ga0207665_10023328 | 3300025939 | Bacteria | 4076 |
| 128 | Ga0207667_10123367 | 3300025949 | Bacteria | 2669 |
| 129 | Ga0207667_10130724 | 3300025949 | Bacteria | 2586 |
| 130 | Ga0207677_11023017 | 3300026023 | Bacteria | 750 |
| 131 | Ga0207678_10602201 | 3300026067 | Bacteria | 963 |
| 132 | Ga0207678_11465797 | 3300026067 | Bacteria | 603 |
| 133 | Ga0207678_11915471 | 3300026067 | Bacteria | 517 |
| 134 | Ga0207708_11194936 | 3300026075 | Bacteria | 665 |
| 135 | Ga0207702_10118479 | 3300026078 | Bacteria | 2365 |
| 136 | Ga0207702_10316901 | 3300026078 | Bacteria | 1484 |
| 137 | Ga0207702_11293867 | 3300026078 | Bacteria | 723 |
| 138 | Ga0207702_12056119 | 3300026078 | Bacteria | 561 |
| 139 | Ga0207702_12271602 | 3300026078 | Bacteria | 531 |
| 140 | Ga0207676_11272134 | 3300026095 | Bacteria | 730 |
| 141 | Ga0209371_1008061 | 3300027312 | Bacteria | 3559 |
| 142 | Ga0265356_1032084 | 3300028017 | Bacteria | 572 |
| 143 | Ga0268266_10031306 | 3300028379 | Bacteria | 4517 |
| 144 | Ga0268265_12687309 | 3300028380 | Bacteria | 503 |
| 145 | Ga0265337_1000824 | 3300028556 | Bacteria | 16275 |
| 146 | Ga0265337_1001289 | 3300028556 | Bacteria | 12550 |
| 147 | Ga0265337_1002582 | 3300028556 | Bacteria | 8231 |
| 148 | Ga0265326_10000639 | 3300028558 | Bacteria | 13053 |
| 149 | Ga0265326_10006770 | 3300028558 | Bacteria | 3538 |
| 150 | Ga0265319_1001628 | 3300028563 | Bacteria | 13086 |
| 151 | Ga0265319_1004283 | 3300028563 | Bacteria | 7105 |
| 152 | Ga0265334_10000208 | 3300028573 | Bacteria | 33833 |
| 153 | Ga0265334_10000634 | 3300028573 | Bacteria | 17732 |
| 154 | Ga0265334_10210781 | 3300028573 | Bacteria | 673 |
| 155 | Ga0265318_10005840 | 3300028577 | Bacteria | 5735 |
| 156 | Ga0265318_10011015 | 3300028577 | Bacteria | 3913 |
| 157 | Ga0265323_10000074 | 3300028653 | Bacteria | 55925 |
| 158 | Ga0265323_10000501 | 3300028653 | Bacteria | 21986 |
| 159 | Ga0265322_10011962 | 3300028654 | Bacteria | 2510 |
| 160 | Ga0265322_10015977 | 3300028654 | Bacteria | 2167 |
| 161 | Ga0265336_10000108 | 3300028666 | Bacteria | 62876 |
| 162 | Ga0265336_10000161 | 3300028666 | Bacteria | 47783 |
| 163 | Ga0265336_10060823 | 3300028666 | Bacteria | 1133 |
| 164 | Ga0265338_10000119 | 3300028800 | Bacteria | 146599 |
| 165 | Ga0265338_10000994 | 3300028800 | Bacteria | 47798 |
| 166 | Ga0265338_10040425 | 3300028800 | Bacteria | 4380 |
| 167 | Ga0265338_10159348 | 3300028800 | Bacteria | 1745 |
| 168 | Ga0265338_10258343 | 3300028800 | Bacteria | 1282 |
| 169 | Ga0265338_10301965 | 3300028800 | Bacteria | 1163 |
| 170 | Ga0265338_10559043 | 3300028800 | Bacteria | 800 |
| 171 | Ga0265324_10001977 | 3300029957 | Bacteria | 10964 |
| 172 | Ga0265324_10002357 | 3300029957 | Bacteria | 9747 |
| 173 | Ga0265324_10003388 | 3300029957 | Bacteria | 7618 |
| 174 | Ga0268256_1008346 | 3300030500 | Bacteria | 3559 |
| 175 | Ga0307511_10001799 | 3300030521 | Bacteria | 22546 |
| 176 | Ga0265762_1096431 | 3300030760 | Bacteria | 651 |
| 177 | Ga0265762_1164593 | 3300030760 | Bacteria | 536 |
| 178 | Ga0265770_1040967 | 3300030878 | Bacteria | 810 |
| 179 | Ga0265760_10117592 | 3300031090 | Bacteria | 851 |
| 180 | Ga0265330_10105097 | 3300031235 | Bacteria | 1208 |
| 181 | Ga0265330_10304049 | 3300031235 | Bacteria | 672 |
| 182 | Ga0265332_10148842 | 3300031238 | Bacteria | 980 |
| 183 | Ga0265328_10002497 | 3300031239 | Bacteria | 8255 |
| 184 | Ga0265328_10019367 | 3300031239 | Bacteria | 2615 |
| 185 | Ga0265328_10132154 | 3300031239 | Bacteria | 934 |
| 186 | Ga0265328_10222804 | 3300031239 | Bacteria | 718 |
| 187 | Ga0265320_10006281 | 3300031240 | Bacteria | 7509 |
| 188 | Ga0265320_10010158 | 3300031240 | Bacteria | 5624 |
| 189 | Ga0265320_10011369 | 3300031240 | Bacteria | 5243 |
| 190 | Ga0265325_10059274 | 3300031241 | Bacteria | 1947 |
| 191 | Ga0265325_10080531 | 3300031241 | Bacteria | 1619 |
| 192 | Ga0265325_10495541 | 3300031241 | Bacteria | 530 |
| 193 | Ga0265329_10218165 | 3300031242 | Bacteria | 631 |
| 194 | Ga0265329_10288390 | 3300031242 | Bacteria | 553 |
| 195 | Ga0265340_10004409 | 3300031247 | Bacteria | 7874 |
| 196 | Ga0265340_10112315 | 3300031247 | Bacteria | 1259 |
| 197 | Ga0265340_10273545 | 3300031247 | Bacteria | 751 |
| 198 | Ga0265340_10379040 | 3300031247 | Bacteria | 624 |
| 199 | Ga0265339_10037362 | 3300031249 | Bacteria | 2715 |
| 200 | Ga0265331_10000779 | 3300031250 | Bacteria | 26570 |
| 201 | Ga0265331_10006770 | 3300031250 | Bacteria | 6717 |
| 202 | Ga0265331_10061771 | 3300031250 | Bacteria | 1768 |
| 203 | Ga0265331_10455757 | 3300031250 | Bacteria | 575 |
| 204 | Ga0265331_10570592 | 3300031250 | Bacteria | 511 |
| 205 | Ga0265327_10020348 | 3300031251 | Bacteria | 4047 |
| 206 | Ga0265327_10030492 | 3300031251 | Bacteria | 3048 |
| 207 | Ga0265327_10035788 | 3300031251 | Bacteria | 2739 |
| 208 | Ga0265327_10043544 | 3300031251 | Bacteria | 2401 |
| 209 | Ga0265327_10130869 | 3300031251 | Bacteria | 1181 |
| 210 | Ga0265316_10146533 | 3300031344 | Bacteria | 1770 |
| 211 | Ga0265316_10203631 | 3300031344 | Bacteria | 1466 |
| 212 | Ga0265316_10255847 | 3300031344 | Bacteria | 1284 |
| 213 | Ga0307509_10000197 | 3300031507 | Bacteria | 95722 |
| 214 | Ga0265313_10000004 | 3300031595 | Bacteria | 188027 |
| 215 | Ga0265313_10000307 | 3300031595 | Bacteria | 53087 |
| 216 | Ga0265313_10085057 | 3300031595 | Bacteria | 1430 |
| 217 | Ga0265313_10172310 | 3300031595 | Bacteria | 913 |
| 218 | Ga0265313_10400954 | 3300031595 | Bacteria | 538 |
| 219 | Ga0316575_10001481 | 3300031665 | Bacteria | 7576 |
| 220 | Ga0316575_10173317 | 3300031665 | Bacteria | 895 |
| 221 | Ga0316575_10203702 | 3300031665 | Bacteria | 824 |
| 222 | Ga0316575_10211296 | 3300031665 | Bacteria | 809 |
| 223 | Ga0316575_10220355 | 3300031665 | Bacteria | 792 |
| 224 | Ga0316575_10265876 | 3300031665 | Bacteria | 721 |
| 225 | Ga0316575_10276213 | 3300031665 | Bacteria | 708 |
| 226 | Ga0316575_10455210 | 3300031665 | Bacteria | 552 |
| 227 | Ga0316579_10010547 | 3300031691 | Bacteria | 3909 |
| 228 | Ga0316579_10246238 | 3300031691 | Bacteria | 865 |
| 229 | Ga0316579_10308127 | 3300031691 | Bacteria | 766 |
| 230 | Ga0316579_10411020 | 3300031691 | Bacteria | 654 |
| 231 | Ga0265314_10010615 | 3300031711 | Bacteria | 7664 |
| 232 | Ga0265314_10027051 | 3300031711 | Bacteria | 4300 |
| 233 | Ga0265314_10033190 | 3300031711 | Bacteria | 3789 |
| 234 | Ga0265314_10347862 | 3300031711 | Bacteria | 816 |
| 235 | Ga0265342_10002523 | 3300031712 | Bacteria | 15767 |
| 236 | Ga0265342_10162048 | 3300031712 | Bacteria | 1236 |
| 237 | Ga0265342_10572170 | 3300031712 | Bacteria | 572 |
| 238 | Ga0316576_10010858 | 3300031727 | Bacteria | 5940 |
| 239 | Ga0316576_10020270 | 3300031727 | Bacteria | 4572 |
| 240 | Ga0316576_10078239 | 3300031727 | Bacteria | 2450 |
| 241 | Ga0316576_10222472 | 3300031727 | Bacteria | 1420 |
| 242 | Ga0316576_10223820 | 3300031727 | Bacteria | 1415 |
| 243 | Ga0316576_10248710 | 3300031727 | Bacteria | 1335 |
| 244 | Ga0316576_10734913 | 3300031727 | Bacteria | 713 |
| 245 | Ga0316578_10005514 | 3300031728 | Bacteria | 6145 |
| 246 | Ga0316578_10061192 | 3300031728 | Bacteria | 2218 |
| 247 | Ga0316578_10098660 | 3300031728 | Bacteria | 1750 |
| 248 | Ga0316578_10180290 | 3300031728 | Bacteria | 1273 |
| 249 | Ga0316578_10194033 | 3300031728 | Bacteria | 1223 |
| 250 | Ga0316578_10543015 | 3300031728 | Bacteria | 683 |
| 251 | Ga0316578_10569945 | 3300031728 | Bacteria | 664 |
| 252 | Ga0316577_10019089 | 3300031733 | Bacteria | 3793 |
| 253 | Ga0316577_10136968 | 3300031733 | Bacteria | 1379 |
| 254 | Ga0316577_10239353 | 3300031733 | Bacteria | 1026 |
| 255 | Ga0316577_10783804 | 3300031733 | Bacteria | 541 |
| 256 | Ga0307407_11256839 | 3300031903 | Bacteria | 580 |
| 257 | Ga0307409_100288750 | 3300031995 | Bacteria | 1520 |
| 258 | Ga0307416_103829589 | 3300032002 | Bacteria | 504 |
| 259 | Ga0316583_10000388 | 3300032133 | Bacteria | 12748 |
| 260 | Ga0316583_10006625 | 3300032133 | Bacteria | 4167 |
| 261 | Ga0316583_10033634 | 3300032133 | Bacteria | 1821 |
| 262 | Ga0316583_10096783 | 3300032133 | Bacteria | 1029 |
| 263 | Ga0316583_10166319 | 3300032133 | Bacteria | 768 |
| 264 | Ga0316585_10000265 | 3300032137 | Bacteria | 11347 |
| 265 | Ga0316580_10000521 | 3300032139 | Bacteria | 8896 |
| 266 | Ga0316593_10079627 | 3300032168 | Bacteria | 1142 |
| 267 | Ga0316212_1019979 | 3300033547 | Bacteria | 941 |
| 268 | Ga0373934_0487579 | 3300035086 | Bacteria | 518 |
| 269 | Ga0373944_0106551 | 3300035089 | Bacteria | 953 |
| 270 | Ga0373923_0009168 | 3300035111 | Bacteria | 3560 |
| 271 | Ga0373923_0087458 | 3300035111 | Bacteria | 1359 |
| 272 | Ga0373923_0234961 | 3300035111 | Bacteria | 855 |
| 273 | Ga0373936_0024904 | 3300035113 | Bacteria | 2339 |
| 274 | Ga0373936_0117819 | 3300035113 | Bacteria | 1132 |
| 275 | Ga0373936_0532890 | 3300035113 | Bacteria | 548 |
| 276 | Ga0373945_0156429 | 3300035116 | Bacteria | 927 |
| 277 | Ga0373945_0471514 | 3300035116 | Bacteria | 557 |
| 278 | Ga0373953_0013070 | 3300035117 | Bacteria | 2955 |
| 279 | Ga0373953_0138850 | 3300035117 | Bacteria | 1039 |
| 280 | Ga0373954_0009029 | 3300035118 | Bacteria | 4386 |
| 281 | Ga0373954_0094035 | 3300035118 | Bacteria | 1442 |
| 282 | Ga0373954_0197690 | 3300035118 | Bacteria | 988 |
| 283 | Ga0373954_0225411 | 3300035118 | Bacteria | 922 |
| 284 | Ga0373954_0325286 | 3300035118 | Bacteria | 759 |
| 285 | Ga0373954_0590264 | 3300035118 | Bacteria | 551 |
| 286 | Ga0373956_0071029 | 3300035119 | Bacteria | 1588 |
| 287 | Ga0373956_0117285 | 3300035119 | Bacteria | 1242 |
| 288 | Ga0373956_0156697 | 3300035119 | Bacteria | 1072 |
| 289 | Ga0373956_0201869 | 3300035119 | Bacteria | 942 |
| 290 | Ga0373956_0302913 | 3300035119 | Bacteria | 761 |
| 291 | Ga0373956_0305252 | 3300035119 | Bacteria | 758 |
| 292 | Ga0373957_0012849 | 3300035120 | Bacteria | 2828 |
| 293 | Ga0373957_0031366 | 3300035120 | Bacteria | 1953 |
| 294 | Ga0373943_0046938 | 3300035170 | Bacteria | 2110 |
| 295 | Ga0373943_0395371 | 3300035170 | Bacteria | 797 |
| 296 | Ga0373946_0070480 | 3300035171 | Bacteria | 1509 |
| 297 | Ga0373946_0153898 | 3300035171 | Bacteria | 1075 |
| 298 | Ga0373946_0248893 | 3300035171 | Bacteria | 866 |
| 299 | Ga0373955_0103220 | 3300035172 | Bacteria | 1639 |
| 300 | Ga0373955_0193954 | 3300035172 | Bacteria | 1208 |
| 301 | Ga0373955_0467804 | 3300035172 | Bacteria | 769 |
| 302 | Ga0373955_0963871 | 3300035172 | Bacteria | 525 |
| 303 | Ga0373955_1010031 | 3300035172 | Bacteria | 512 |
| 304 | Ga0316574_0000783 | 3300035398 | Bacteria | 13749 |
| 305 | Ga0316574_0001746 | 3300035398 | Bacteria | 10522 |
| 306 | Ga0316574_0035609 | 3300035398 | Bacteria | 3044 |
| 307 | Ga0316574_0062287 | 3300035398 | Bacteria | 2344 |
| 308 | Ga0316574_0094639 | 3300035398 | Bacteria | 1908 |
| 309 | Ga0316574_0199617 | 3300035398 | Bacteria | 1285 |
| 310 | Ga0316574_0508503 | 3300035398 | Bacteria | 751 |
| 311 | Ga0373924_0009136 | 3300035410 | Bacteria | 3627 |
| 312 | Ga0373924_0057883 | 3300035410 | Bacteria | 1617 |
| 313 | Ga0373924_0123364 | 3300035410 | Bacteria | 1125 |
| 314 | Ga0373935_0137957 | 3300035692 | Bacteria | 1645 |
| 315 | Ga0373935_0160427 | 3300035692 | Bacteria | 1532 |
| 316 | Ga0373935_0288933 | 3300035692 | Bacteria | 1156 |
| 317 | Ga0373935_0319106 | 3300035692 | Bacteria | 1102 |
| 318 | Ga0373927_0031570 | 3300035695 | Bacteria | 3452 |
| 319 | Ga0373927_0055459 | 3300035695 | Bacteria | 2562 |
| 320 | Ga0373927_0069006 | 3300035695 | Bacteria | 2288 |
| 321 | Ga0373927_0119582 | 3300035695 | Bacteria | 1719 |
| 322 | Ga0373927_0363663 | 3300035695 | Bacteria | 954 |
| 323 | Ga0373927_1013880 | 3300035695 | Bacteria | 548 |
| 324 | Ga0373933_0008329 | 3300035724 | Bacteria | 5662 |
| 325 | Ga0373933_0023982 | 3300035724 | Bacteria | 3491 |
| 326 | Ga0373933_0024422 | 3300035724 | Bacteria | 3460 |
| 327 | Ga0373933_0062902 | 3300035724 | Bacteria | 2243 |
| 328 | Ga0373933_0077880 | 3300035724 | Bacteria | 2027 |
| 329 | Ga0373933_0351799 | 3300035724 | Bacteria | 957 |
| 330 | Ga0373933_0353156 | 3300035724 | Bacteria | 955 |
| 331 | Ga0373933_0711746 | 3300035724 | Bacteria | 660 |
| 332 | Ga0373933_0798720 | 3300035724 | Bacteria | 621 |
| 333 | Ga0373933_0870902 | 3300035724 | Unclassified | 593 |
| 334 | Ga0373947_0038699 | 3300035725 | Bacteria | 2835 |
| 335 | Ga0373947_0119891 | 3300035725 | Bacteria | 1670 |
| 336 | Ga0373947_0148012 | 3300035725 | Bacteria | 1511 |
| 337 | Ga0373947_0151364 | 3300035725 | Bacteria | 1495 |
| 338 | Ga0373947_0257358 | 3300035725 | Bacteria | 1156 |
| 339 | Ga0373937_0006092 | 3300036401 | Bacteria | 10385 |
| 340 | Ga0373937_0031834 | 3300036401 | Bacteria | 4781 |
| 341 | Ga0373937_0101263 | 3300036401 | Bacteria | 2673 |
| 342 | Ga0373937_0123022 | 3300036401 | Bacteria | 2419 |
| 343 | Ga0373937_0132856 | 3300036401 | Bacteria | 2325 |
| 344 | Ga0373937_0169193 | 3300036401 | Bacteria | 2050 |
| 345 | Ga0373937_0405101 | 3300036401 | Bacteria | 1294 |
| 346 | Ga0373937_0728466 | 3300036401 | Bacteria | 939 |
| 347 | Ga0373937_1378959 | 3300036401 | Bacteria | 653 |
| 348 | Ga0373937_1870403 | 3300036401 | Bacteria | 546 |
| 349 | Ga0372808_019356 | 3300036459 | Bacteria | 978 |
| 350 | Ga0316582_0017390 | 3300036647 | Bacteria | 4159 |
| 351 | Ga0316582_0029049 | 3300036647 | Bacteria | 3355 |
| 352 | Ga0316582_0161381 | 3300036647 | Bacteria | 1519 |
| 353 | Ga0316582_0278922 | 3300036647 | Bacteria | 1147 |
| 354 | Ga0316582_0352919 | 3300036647 | Bacteria | 1012 |
| 355 | Ga0316582_0982814 | 3300036647 | Bacteria | 576 |
| 356 | Ga0316584_0004837 | 3300036712 | Bacteria | 8956 |
| 357 | Ga0316584_0028739 | 3300036712 | Bacteria | 4103 |
| 358 | Ga0316584_0088042 | 3300036712 | Bacteria | 2325 |
| 359 | Ga0316584_0157349 | 3300036712 | Bacteria | 1689 |
| 360 | Ga0316584_0164529 | 3300036712 | Bacteria | 1647 |
| 361 | Ga0316584_0174049 | 3300036712 | Bacteria | 1595 |
| 362 | Ga0316584_0321703 | 3300036712 | Bacteria | 1116 |
| 363 | Ga0316584_0347192 | 3300036712 | Bacteria | 1066 |
| 364 | Ga0373925_0023549 | 3300037068 | Bacteria | 4493 |
| 365 | Ga0373925_0391984 | 3300037068 | Bacteria | 1132 |
| 366 | Ga0373925_0473539 | 3300037068 | Bacteria | 1027 |
| 367 | Ga0395899_0010671 | 3300037312 | Bacteria | 7039 |
| 368 | Ga0395900_0245861 | 3300037418 | Bacteria | 1793 |
| 369 | Ga0395898_0160704 | 3300037466 | Bacteria | 2148 |
| 370 | Ga0395905_0093980 | 3300037471 | Bacteria | 2813 |
| 371 | Ga0395905_1523401 | 3300037471 | Bacteria | 573 |
| 372 | Ga0395905_1719761 | 3300037471 | Bacteria | 532 |
| 373 | Ga0316581_0001594 | 3300037588 | Bacteria | 5167 |
| 374 | Ga0436364_0927232 | 3300037853 | Bacteria | 3121 |
| 375 | Ga0395901_0002803 | 3300038443 | Bacteria | 17591 |
| 376 | Ga0395901_0866595 | 3300038443 | Bacteria | 887 |
| 377 | Ga0436360_0144939 | 3300039438 | Bacteria | 5079 |
| 378 | Ga0436360_0278009 | 3300039438 | Bacteria | 1125 |
| 379 | Ga0436360_0542036 | 3300039438 | Bacteria | 3071 |
| 380 | Ga0436360_0648306 | 3300039438 | Bacteria | 853 |
| 381 | Ga0436360_0694448 | 3300039438 | Bacteria | 750 |
| 382 | Ga0436360_0731534 | 3300039438 | Bacteria | 1040 |
| 383 | Ga0436360_1278836 | 3300039438 | Bacteria | 983 |
| 384 | Ga0436361_0031613 | 3300039447 | Bacteria | 1402 |
| 385 | Ga0436361_0083953 | 3300039447 | Bacteria | 2429 |
| 386 | Ga0436361_0623967 | 3300039447 | Bacteria | 931 |
| 387 | Ga0436361_0736815 | 3300039447 | Bacteria | 2114 |
| 388 | Ga0436361_0752321 | 3300039447 | Bacteria | 1806 |
| 389 | Ga0436361_0834676 | 3300039447 | Bacteria | 718 |
| 390 | Ga0436361_0837231 | 3300039447 | Bacteria | 44100 |
| 391 | Ga0436361_0851527 | 3300039447 | Bacteria | 3511 |
| 392 | Ga0436361_0904970 | 3300039447 | Bacteria | 566 |
| 393 | Ga0436361_1197906 | 3300039447 | Bacteria | 540 |
| 394 | Ga0436363_0190844 | 3300039450 | Bacteria | 644 |
| 395 | Ga0436363_0964032 | 3300039450 | Bacteria | 1246 |
| 396 | Ga0436362_0199972 | 3300039453 | Bacteria | 678 |
| 397 | Ga0436362_0490283 | 3300039453 | Bacteria | 911 |
| 398 | Ga0436362_0659311 | 3300039453 | Archaea | 530 |
| 399 | Ga0436362_0732104 | 3300039453 | Bacteria | 818 |
| 400 | Ga0436362_1305803 | 3300039453 | Bacteria | 552 |
| 401 | Ga0439460_0080674 | 3300042461 | Bacteria | 1021 |
| 402 | Ga0451577_0015231 | 3300042876 | Bacteria | 7155 |
| 403 | Ga0451577_0106880 | 3300042876 | Bacteria | 2501 |
| 404 | Ga0466966_0008834 | 3300044684 | Bacteria | 6671 |
| 405 | Ga0466963_0459393 | 3300044694 | Bacteria | 899 |
| 406 | Ga0453684_0040623 | 3300044712 | Bacteria | 6312 |
| 407 | Ga0453684_0041407 | 3300044712 | Bacteria | 6231 |
| 408 | Ga0453684_0104766 | 3300044712 | Bacteria | 3452 |
| 409 | Ga0453684_0150574 | 3300044712 | Bacteria | 2765 |
| 410 | Ga0466959_0179194 | 3300045049 | Bacteria | 1483 |
| 411 | Ga0451576_0000808 | 3300045051 | Bacteria | 61356 |
| 412 | Ga0451576_2219636 | 3300045051 | Bacteria | 563 |
| 413 | Ga0495592_0064883 | 3300046454 | Bacteria | 2675 |
| 414 | Ga0495592_0078329 | 3300046454 | Bacteria | 2394 |
| 415 | Ga0495592_0112100 | 3300046454 | Bacteria | 1929 |
| 416 | Ga0495592_0182319 | 3300046454 | Bacteria | 1429 |
| 417 | Ga0495592_0183880 | 3300046454 | Bacteria | 1421 |
| 418 | Ga0495592_0351286 | 3300046454 | Bacteria | 945 |
| 419 | Ga0495603_0020696 | 3300046455 | Bacteria | 3985 |
| 420 | Ga0495603_0060427 | 3300046455 | Bacteria | 2239 |
| 421 | Ga0495603_0147520 | 3300046455 | Bacteria | 1367 |
| 422 | Ga0495591_001164 | 3300046458 | Bacteria | 17184 |
| 423 | Ga0495629_0000224 | 3300046459 | Bacteria | 50510 |
| 424 | Ga0495629_0030963 | 3300046459 | Bacteria | 3790 |
| 425 | Ga0495629_0044380 | 3300046459 | Bacteria | 3120 |
| 426 | Ga0495629_0221762 | 3300046459 | Bacteria | 1304 |
| 427 | Ga0495629_0270264 | 3300046459 | Bacteria | 1168 |
| 428 | Ga0495629_0426294 | 3300046459 | Bacteria | 900 |
| 429 | Ga0495629_0472995 | 3300046459 | Bacteria | 847 |
| 430 | Ga0495629_0729243 | 3300046459 | Bacteria | 657 |
| 431 | Ga0495641_0318551 | 3300046461 | Bacteria | 702 |
| 432 | Ga0495651_0055901 | 3300046462 | Bacteria | 3032 |
| 433 | Ga0495651_0065168 | 3300046462 | Bacteria | 2782 |
| 434 | Ga0495651_0088503 | 3300046462 | Bacteria | 2327 |
| 435 | Ga0495651_0168846 | 3300046462 | Bacteria | 1560 |
| 436 | Ga0495651_0266874 | 3300046462 | Bacteria | 1162 |
| 437 | Ga0495651_0285207 | 3300046462 | Bacteria | 1114 |
| 438 | Ga0495651_0440528 | 3300046462 | Bacteria | 843 |
| 439 | Ga0495651_0717537 | 3300046462 | Bacteria | 622 |
| 440 | Ga0495651_0942236 | 3300046462 | Bacteria | 526 |
| 441 | Ga0495653_0001276 | 3300046463 | Bacteria | 19478 |
| 442 | Ga0495653_0016018 | 3300046463 | Bacteria | 6110 |
| 443 | Ga0495653_0029496 | 3300046463 | Bacteria | 4379 |
| 444 | Ga0495653_0047485 | 3300046463 | Bacteria | 3320 |
| 445 | Ga0495653_0059105 | 3300046463 | Bacteria | 2911 |
| 446 | Ga0495653_0170550 | 3300046463 | Bacteria | 1502 |
| 447 | Ga0495653_0239645 | 3300046463 | Bacteria | 1210 |
| 448 | Ga0495653_0248820 | 3300046463 | Bacteria | 1181 |
| 449 | Ga0495653_0904265 | 3300046463 | Bacteria | 526 |
| 450 | Ga0495580_0000135 | 3300046472 | Bacteria | 52036 |
| 451 | Ga0495580_0000499 | 3300046472 | Bacteria | 32904 |
| 452 | Ga0495580_0000504 | 3300046472 | Bacteria | 32829 |
| 453 | Ga0495580_0001710 | 3300046472 | Bacteria | 19281 |
| 454 | Ga0495580_0004368 | 3300046472 | Bacteria | 11871 |
| 455 | Ga0495580_0005127 | 3300046472 | Bacteria | 10898 |
| 456 | Ga0495580_0024320 | 3300046472 | Bacteria | 4437 |
| 457 | Ga0495580_0303591 | 3300046472 | Bacteria | 1087 |
| 458 | Ga0495580_0756394 | 3300046472 | Bacteria | 633 |
| 459 | Ga0495582_0014651 | 3300046473 | Bacteria | 4308 |
| 460 | Ga0495582_0476929 | 3300046473 | Bacteria | 721 |
| 461 | Ga0495605_0116876 | 3300046474 | Bacteria | 1212 |
| 462 | Ga0495605_0314502 | 3300046474 | Bacteria | 661 |
| 463 | Ga0495605_0344199 | 3300046474 | Bacteria | 626 |
| 464 | Ga0495639_0105852 | 3300046475 | Bacteria | 1332 |
| 465 | Ga0495662_0141088 | 3300046476 | Bacteria | 1186 |
| 466 | Ga0495662_0289594 | 3300046476 | Bacteria | 806 |
| 467 | Ga0495664_0002427 | 3300046477 | Bacteria | 10018 |
| 468 | Ga0495664_0028960 | 3300046477 | Bacteria | 3237 |
| 469 | Ga0495664_0134784 | 3300046477 | Bacteria | 1496 |
| 470 | Ga0495664_0461315 | 3300046477 | Bacteria | 760 |
| 471 | Ga0495664_0477806 | 3300046477 | Bacteria | 745 |
| 472 | Ga0495664_0855252 | 3300046477 | Bacteria | 533 |
| 473 | Ga0495585_0027418 | 3300046492 | Bacteria | 3251 |
| 474 | Ga0495594_0146123 | 3300046499 | Bacteria | 1342 |
| 475 | Ga0495594_0328823 | 3300046499 | Bacteria | 870 |
| 476 | Ga0495596_0003395 | 3300046500 | Bacteria | 8080 |
| 477 | Ga0495596_0015530 | 3300046500 | Bacteria | 3186 |
| 478 | Ga0495596_0042961 | 3300046500 | Bacteria | 1781 |
| 479 | Ga0495596_0177463 | 3300046500 | Bacteria | 828 |
| 480 | Ga0495607_0118417 | 3300046501 | Bacteria | 1394 |
| 481 | Ga0495607_0271351 | 3300046501 | Bacteria | 808 |
| 482 | Ga0495583_0001364 | 3300046506 | Bacteria | 25174 |
| 483 | Ga0495583_0161809 | 3300046506 | Bacteria | 923 |
| 484 | Ga0495606_0346496 | 3300046507 | Bacteria | 790 |
| 485 | Ga0495606_0541018 | 3300046507 | Bacteria | 581 |
| 486 | Ga0495608_0007305 | 3300046511 | Bacteria | 7809 |
| 487 | Ga0495608_0089470 | 3300046511 | Bacteria | 1993 |
| 488 | Ga0495608_0215809 | 3300046511 | Bacteria | 1205 |
| 489 | Ga0495608_0337128 | 3300046511 | Bacteria | 930 |
| 490 | Ga0495608_0400756 | 3300046511 | Bacteria | 839 |
| 491 | Ga0495610_0283122 | 3300046512 | Bacteria | 645 |
| 492 | Ga0495618_0034216 | 3300046514 | Bacteria | 3185 |
| 493 | Ga0495618_0153640 | 3300046514 | Bacteria | 1470 |
| 494 | Ga0495618_0188673 | 3300046514 | Bacteria | 1308 |
| 495 | Ga0495618_0240994 | 3300046514 | Bacteria | 1137 |
| 496 | Ga0495618_0522974 | 3300046514 | Bacteria | 713 |
| 497 | Ga0495628_0000239 | 3300046516 | Bacteria | 48349 |
| 498 | Ga0495628_0027720 | 3300046516 | Bacteria | 4604 |
| 499 | Ga0495628_0036523 | 3300046516 | Bacteria | 3941 |
| 500 | Ga0495628_0047333 | 3300046516 | Bacteria | 3412 |
| 501 | Ga0495628_0049446 | 3300046516 | Bacteria | 3330 |
| 502 | Ga0495628_0097145 | 3300046516 | Bacteria | 2275 |
| 503 | Ga0495628_0140593 | 3300046516 | Bacteria | 1842 |
| 504 | Ga0495628_0147194 | 3300046516 | Bacteria | 1795 |
| 505 | Ga0495628_0184400 | 3300046516 | Bacteria | 1577 |
| 506 | Ga0495628_0222089 | 3300046516 | Bacteria | 1419 |
| 507 | Ga0495628_0551019 | 3300046516 | Bacteria | 828 |
| 508 | Ga0495628_0609053 | 3300046516 | Bacteria | 779 |
| 509 | Ga0495628_0810150 | 3300046516 | Bacteria | 655 |
| 510 | Ga0495630_0017807 | 3300046517 | Bacteria | 5209 |
| 511 | Ga0495630_0091976 | 3300046517 | Bacteria | 2292 |
| 512 | Ga0495630_0102060 | 3300046517 | Bacteria | 2170 |
| 513 | Ga0495630_0294538 | 3300046517 | Bacteria | 1240 |
| 514 | Ga0495630_0351579 | 3300046517 | Bacteria | 1128 |
| 515 | Ga0495630_0395624 | 3300046517 | Bacteria | 1058 |
| 516 | Ga0495631_0222340 | 3300046518 | Bacteria | 806 |
| 517 | Ga0495644_0173559 | 3300046523 | Bacteria | 828 |
| 518 | Ga0495648_0001136 | 3300046524 | Bacteria | 26916 |
| 519 | Ga0495648_0004401 | 3300046524 | Bacteria | 12045 |
| 520 | Ga0495648_0148595 | 3300046524 | Bacteria | 1224 |
| 521 | Ga0495666_0000487 | 3300046526 | Bacteria | 17627 |
| 522 | Ga0495666_0016000 | 3300046526 | Bacteria | 3735 |
| 523 | Ga0495642_0131984 | 3300046528 | Bacteria | 1075 |
| 524 | Ga0495642_0344342 | 3300046528 | Bacteria | 655 |
| 525 | Ga0495652_0038325 | 3300046529 | Bacteria | 4153 |
| 526 | Ga0495652_0050070 | 3300046529 | Bacteria | 3574 |
| 527 | Ga0495652_0188166 | 3300046529 | Bacteria | 1578 |
| 528 | Ga0495652_0193913 | 3300046529 | Bacteria | 1548 |
| 529 | Ga0495652_0328439 | 3300046529 | Bacteria | 1102 |
| 530 | Ga0495652_0417073 | 3300046529 | Bacteria | 947 |
| 531 | Ga0495652_0452091 | 3300046529 | Bacteria | 899 |
| 532 | Ga0495652_0534217 | 3300046529 | Bacteria | 808 |
| 533 | Ga0495652_1047039 | 3300046529 | Bacteria | 532 |
| 534 | Ga0495665_0005475 | 3300046531 | Bacteria | 6838 |
| 535 | Ga0495665_0006209 | 3300046531 | Bacteria | 6453 |
| 536 | Ga0495665_0010943 | 3300046531 | Bacteria | 4909 |
| 537 | Ga0495665_0064832 | 3300046531 | Bacteria | 1928 |
| 538 | Ga0495665_0138740 | 3300046531 | Bacteria | 1271 |
| 539 | Ga0495665_0253751 | 3300046531 | Bacteria | 905 |
| 540 | Ga0495665_0477396 | 3300046531 | Bacteria | 629 |
| 541 | Ga0495665_0515284 | 3300046531 | Bacteria | 602 |
| 542 | Ga0495640_0011229 | 3300046533 | Bacteria | 6895 |
| 543 | Ga0495640_0036999 | 3300046533 | Bacteria | 3446 |
| 544 | Ga0495640_0173167 | 3300046533 | Bacteria | 1378 |
| 545 | Ga0495640_0532254 | 3300046533 | Bacteria | 713 |
| 546 | Ga0495640_0724839 | 3300046533 | Bacteria | 595 |
| 547 | Ga0495640_0868146 | 3300046533 | Bacteria | 535 |
| 548 | Ga0495587_0014987 | 3300046536 | Bacteria | 4848 |
| 549 | Ga0495587_0018799 | 3300046536 | Bacteria | 4284 |
| 550 | Ga0495587_0319087 | 3300046536 | Bacteria | 868 |
| 551 | Ga0495587_0333747 | 3300046536 | Bacteria | 846 |
| 552 | Ga0495598_0284671 | 3300046537 | Bacteria | 621 |
| 553 | Ga0495645_0000754 | 3300046543 | Bacteria | 22147 |
| 554 | Ga0495645_0205304 | 3300046543 | Bacteria | 1334 |
| 555 | Ga0495645_0314352 | 3300046543 | Bacteria | 1019 |
| 556 | Ga0495622_0302475 | 3300046557 | Bacteria | 697 |
| 557 | Ga0495633_0181635 | 3300046558 | Bacteria | 968 |
| 558 | Ga0495667_0039299 | 3300046559 | Bacteria | 3146 |
| 559 | Ga0495667_0150969 | 3300046559 | Bacteria | 1496 |
| 560 | Ga0495667_0183237 | 3300046559 | Bacteria | 1343 |
| 561 | Ga0495656_0512478 | 3300046615 | Bacteria | 637 |
| 562 | Ga0495634_0148341 | 3300046642 | Bacteria | 1485 |
| 563 | Ga0495634_0445336 | 3300046642 | Bacteria | 765 |
| 564 | Ga0495634_0457300 | 3300046642 | Bacteria | 752 |
| 565 | Ga0495634_0546552 | 3300046642 | Bacteria | 676 |
| 566 | Ga0495611_0146897 | 3300046648 | Bacteria | 1101 |
| 567 | Ga0495611_0315904 | 3300046648 | Bacteria | 719 |
| 568 | Ga0495635_0009807 | 3300046663 | Bacteria | 6695 |
| 569 | Ga0495635_0021829 | 3300046663 | Bacteria | 4462 |
| 570 | Ga0495635_0037898 | 3300046663 | Bacteria | 3338 |
| 571 | Ga0495635_0193818 | 3300046663 | Bacteria | 1379 |
| 572 | Ga0495635_0785931 | 3300046663 | Bacteria | 614 |
| 573 | Ga0495661_0005589 | 3300046665 | Bacteria | 8919 |
| 574 | Ga0495661_0293420 | 3300046665 | Bacteria | 816 |
| 575 | Ga0495588_0026275 | 3300046674 | Bacteria | 2906 |
| 576 | Ga0495588_0161979 | 3300046674 | Bacteria | 1183 |
| 577 | Ga0495657_0032011 | 3300046675 | Bacteria | 3673 |
| 578 | Ga0495657_0248856 | 3300046675 | Bacteria | 1071 |
| 579 | Ga0495657_0351052 | 3300046675 | Bacteria | 873 |
| 580 | Ga0495657_0482264 | 3300046675 | Bacteria | 724 |
| 581 | Ga0495599_0054477 | 3300046678 | Bacteria | 2505 |
| 582 | Ga0495599_0085779 | 3300046678 | Bacteria | 1966 |
| 583 | Ga0495599_0096892 | 3300046678 | Bacteria | 1839 |
| 584 | Ga0495599_0128394 | 3300046678 | Bacteria | 1575 |
| 585 | Ga0495599_0135860 | 3300046678 | Bacteria | 1526 |
| 586 | Ga0495599_0323710 | 3300046678 | Bacteria | 927 |
| 587 | Ga0495599_0674125 | 3300046678 | Bacteria | 598 |
| 588 | Ga0495599_0868877 | 3300046678 | Bacteria | 512 |
| 589 | Ga0495623_0013273 | 3300046679 | Bacteria | 5343 |
| 590 | Ga0495623_0014499 | 3300046679 | Bacteria | 5100 |
| 591 | Ga0495623_0072737 | 3300046679 | Bacteria | 2137 |
| 592 | Ga0495623_0134321 | 3300046679 | Bacteria | 1478 |
| 593 | Ga0495623_0147517 | 3300046679 | Bacteria | 1394 |
| 594 | Ga0495623_0169963 | 3300046679 | Bacteria | 1274 |
| 595 | Ga0495623_0181535 | 3300046679 | Bacteria | 1222 |
| 596 | Ga0495646_0000222 | 3300046680 | Bacteria | 28234 |
| 597 | Ga0495646_0006608 | 3300046680 | Bacteria | 7357 |
| 598 | Ga0495646_0079798 | 3300046680 | Bacteria | 1909 |
| 599 | Ga0495646_0123859 | 3300046680 | Bacteria | 1461 |
| 600 | Ga0495646_0238250 | 3300046680 | Bacteria | 978 |
| 601 | Ga0495646_0239958 | 3300046680 | Bacteria | 974 |
| 602 | Ga0495646_0245759 | 3300046680 | Bacteria | 960 |
| 603 | Ga0495646_0408915 | 3300046680 | Bacteria | 705 |
| 604 | Ga0495646_0428558 | 3300046680 | Bacteria | 685 |
| 605 | Ga0495647_0297642 | 3300046681 | Bacteria | 727 |
| 606 | Ga0495658_0513521 | 3300046683 | Bacteria | 767 |
| 607 | Ga0495669_0015542 | 3300046684 | Bacteria | 3260 |
| 608 | Ga0495669_0335005 | 3300046684 | Bacteria | 731 |
| 609 | Ga0495613_0018488 | 3300046689 | Bacteria | 5195 |
| 610 | Ga0495613_0140933 | 3300046689 | Bacteria | 1723 |
| 611 | Ga0495613_0812280 | 3300046689 | Bacteria | 610 |
| 612 | Ga0495624_0000059 | 3300046690 | Bacteria | 70115 |
| 613 | Ga0495624_0000062 | 3300046690 | Bacteria | 67917 |
| 614 | Ga0495624_0001465 | 3300046690 | Bacteria | 18349 |
| 615 | Ga0495624_0057616 | 3300046690 | Bacteria | 2442 |
| 616 | Ga0495624_0749776 | 3300046690 | Bacteria | 578 |
| 617 | Ga0495624_0813887 | 3300046690 | Bacteria | 552 |
| 618 | Ga0495649_0298907 | 3300046694 | Bacteria | 820 |
| 619 | Ga0495589_0074052 | 3300046794 | Bacteria | 1661 |
| 620 | Ga0495600_0001170 | 3300046809 | Bacteria | 14311 |
| 621 | Ga0495600_0148994 | 3300046809 | Bacteria | 1516 |
| 622 | Ga0495600_0167752 | 3300046809 | Bacteria | 1418 |
| 623 | Ga0495600_0597403 | 3300046809 | Bacteria | 671 |
| 624 | Ga0495600_0920796 | 3300046809 | Bacteria | 515 |
| 625 | Ga0495581_0012606 | 3300047315 | Bacteria | 4899 |
| 626 | Ga0495581_0035484 | 3300047315 | Bacteria | 2886 |
| 627 | Ga0495581_0459631 | 3300047315 | Bacteria | 741 |
| 628 | Ga0495604_0008864 | 3300047317 | Bacteria | 7949 |
| 629 | Ga0495604_0010050 | 3300047317 | Bacteria | 7492 |
| 630 | Ga0495604_0026749 | 3300047317 | Bacteria | 4592 |
| 631 | Ga0495604_0041177 | 3300047317 | Bacteria | 3623 |
| 632 | Ga0495604_0154744 | 3300047317 | Bacteria | 1625 |
| 633 | Ga0495604_0164679 | 3300047317 | Bacteria | 1564 |
| 634 | Ga0495604_0182137 | 3300047317 | Bacteria | 1469 |
| 635 | Ga0495604_0379506 | 3300047317 | Bacteria | 934 |
| 636 | Ga0495604_0462625 | 3300047317 | Bacteria | 827 |
| 637 | Ga0495604_0479532 | 3300047317 | Bacteria | 809 |
| 638 | Ga0495604_0827851 | 3300047317 | Bacteria | 582 |
| 639 | Ga0495636_0185038 | 3300047318 | Bacteria | 946 |
| 640 | Ga0495674_0000180 | 3300047319 | Bacteria | 49901 |
| 641 | Ga0495674_0000653 | 3300047319 | Bacteria | 32528 |
| 642 | Ga0495674_0010027 | 3300047319 | Bacteria | 8980 |
| 643 | Ga0495674_0103919 | 3300047319 | Bacteria | 2415 |
| 644 | Ga0495674_0136827 | 3300047319 | Bacteria | 2060 |
| 645 | Ga0495674_0178131 | 3300047319 | Bacteria | 1771 |
| 646 | Ga0495674_0181869 | 3300047319 | Bacteria | 1750 |
| 647 | Ga0495674_0328620 | 3300047319 | Bacteria | 1244 |
| 648 | Ga0495674_1297144 | 3300047319 | Bacteria | 546 |
| 649 | Ga0495672_0017205 | 3300047320 | Bacteria | 4840 |
| 650 | Ga0495676_0020488 | 3300047321 | Bacteria | 5799 |
| 651 | Ga0495676_0352932 | 3300047321 | Bacteria | 983 |
| 652 | Ga0495676_0357849 | 3300047321 | Bacteria | 975 |
| 653 | Ga0495676_1030456 | 3300047321 | Bacteria | 524 |
| 654 | Ga0495680_0004928 | 3300047322 | Bacteria | 12636 |
| 655 | Ga0495680_0069315 | 3300047322 | Bacteria | 2691 |
| 656 | Ga0495680_0174356 | 3300047322 | Bacteria | 1555 |
| 657 | Ga0495680_0249699 | 3300047322 | Bacteria | 1258 |
| 658 | Ga0495680_0282944 | 3300047322 | Bacteria | 1168 |
| 659 | Ga0495680_0329167 | 3300047322 | Bacteria | 1068 |
| 660 | Ga0495680_0984843 | 3300047322 | Bacteria | 540 |
| 661 | Ga0495683_0010872 | 3300047323 | Bacteria | 4799 |
| 662 | Ga0495683_0032629 | 3300047323 | Bacteria | 2652 |
| 663 | Ga0495687_005781 | 3300047443 | Bacteria | 7764 |
| 664 | Ga0495687_009680 | 3300047443 | Bacteria | 5361 |
| 665 | Ga0495687_066266 | 3300047443 | Bacteria | 1467 |
| 666 | Ga0495675_0003245 | 3300047444 | Bacteria | 9767 |
| 667 | Ga0495675_0006619 | 3300047444 | Bacteria | 7093 |
| 668 | Ga0495675_0016676 | 3300047444 | Bacteria | 4644 |
| 669 | Ga0495675_0046564 | 3300047444 | Bacteria | 2760 |
| 670 | Ga0495675_0056982 | 3300047444 | Bacteria | 2477 |
| 671 | Ga0495675_0470242 | 3300047444 | Bacteria | 725 |
| 672 | Ga0495675_0478648 | 3300047444 | Bacteria | 717 |
| 673 | Ga0495679_006739 | 3300047446 | Bacteria | 4896 |
| 674 | Ga0495679_058952 | 3300047446 | Bacteria | 1131 |
| 675 | Ga0495673_0002923 | 3300047469 | Bacteria | 11557 |
| 676 | Ga0495673_0025407 | 3300047469 | Bacteria | 2845 |
| 677 | Ga0495673_0253560 | 3300047469 | Bacteria | 642 |
| 678 | Ga0495684_0042281 | 3300047471 | Bacteria | 3491 |
| 679 | Ga0495684_0178937 | 3300047471 | Bacteria | 1573 |
| 680 | Ga0495684_0244006 | 3300047471 | Bacteria | 1309 |
| 681 | Ga0495684_0363105 | 3300047471 | Bacteria | 1025 |
| 682 | Ga0495684_0503455 | 3300047471 | Bacteria | 832 |
| 683 | Ga0495684_0583347 | 3300047471 | Bacteria | 757 |
| 684 | Ga0495686_0000499 | 3300047472 | Bacteria | 57475 |
| 685 | Ga0495686_0000521 | 3300047472 | Bacteria | 55487 |
| 686 | Ga0495593_0000061 | 3300047673 | Bacteria | 45310 |
| 687 | Ga0495593_0002226 | 3300047673 | Bacteria | 11635 |
| 688 | Ga0495593_0010081 | 3300047673 | Bacteria | 5470 |
| 689 | Ga0495593_0024000 | 3300047673 | Bacteria | 3384 |
| 690 | Ga0495593_0202778 | 3300047673 | Bacteria | 997 |
| 691 | Ga0495593_0610198 | 3300047673 | Bacteria | 548 |
| 692 | Ga0495593_0654726 | 3300047673 | Bacteria | 527 |
| 693 | Ga0495602_0004522 | 3300048088 | Bacteria | 14510 |
| 694 | Ga0495602_0030437 | 3300048088 | Bacteria | 5118 |
| 695 | Ga0495602_0047951 | 3300048088 | Bacteria | 3844 |
| 696 | Ga0495602_0070310 | 3300048088 | Bacteria | 2996 |
| 697 | Ga0495602_0108218 | 3300048088 | Bacteria | 2264 |
| 698 | Ga0495602_0145910 | 3300048088 | Bacteria | 1867 |
| 699 | Ga0495602_0152847 | 3300048088 | Bacteria | 1811 |
| 700 | Ga0495602_0231449 | 3300048088 | Bacteria | 1388 |
| 701 | Ga0495602_0456647 | 3300048088 | Bacteria | 901 |
| 702 | Ga0495602_0464546 | 3300048088 | Bacteria | 891 |
| 703 | Ga0495602_0489849 | 3300048088 | Bacteria | 861 |
| 704 | Ga0495614_0006086 | 3300048089 | Bacteria | 5425 |
| 705 | Ga0495614_0081348 | 3300048089 | Bacteria | 1403 |
| 706 | Ga0495614_0103336 | 3300048089 | Bacteria | 1247 |
| 707 | Ga0495614_0309035 | 3300048089 | Bacteria | 732 |
| 708 | Ga0495626_0077944 | 3300048091 | Bacteria | 1477 |
| 709 | Ga0496105_1079200 | 3300048908 | Bacteria | 597 |
| 710 | Ga0496108_1385693 | 3300048911 | Bacteria | 589 |
| 711 | Ga0496117_0014666 | 3300048920 | Bacteria | 6736 |
| 712 | Ga0496117_0103022 | 3300048920 | Bacteria | 1800 |
| 713 | Ga0496117_0561659 | 3300048920 | Bacteria | 541 |
| 714 | Ga0496118_0069118 | 3300048921 | Bacteria | 2560 |
| 715 | Ga0496118_0090560 | 3300048921 | Bacteria | 2107 |
| 716 | Ga0496119_0022311 | 3300048922 | Bacteria | 4538 |
| 717 | Ga0496121_0046238 | 3300048924 | Bacteria | 3728 |
| 718 | Ga0496122_0338411 | 3300048925 | Bacteria | 791 |
| 719 | Ga0496124_0021718 | 3300048927 | Bacteria | 5908 |
| 720 | Ga0496126_0001810 | 3300048929 | Bacteria | 31289 |
| 721 | Ga0496126_0206489 | 3300048929 | Bacteria | 1656 |
| 722 | Ga0495678_020627 | 3300049459 | Bacteria | 2914 |
| 723 | Ga0495682_0015102 | 3300049460 | Bacteria | 2927 |
| 724 | Ga0495682_0033898 | 3300049460 | Bacteria | 1884 |
| 725 | Ga0495682_0072340 | 3300049460 | Bacteria | 1241 |
| 726 | Ga0501031_0006639 | 3300049568 | Bacteria | 7550 |
| 727 | Ga0501032_0017201 | 3300049569 | Bacteria | 5078 |
| 728 | Ga0501032_0609756 | 3300049569 | Bacteria | 694 |
| 729 | Ga0501033_0007595 | 3300049570 | Bacteria | 8431 |
| 730 | Ga0501034_0025367 | 3300049571 | Bacteria | 6034 |
| 731 | Ga0501034_0071034 | 3300049571 | Bacteria | 3492 |
| 732 | Ga0501034_0768301 | 3300049571 | Bacteria | 858 |
| 733 | Ga0501034_1577050 | 3300049571 | Bacteria | 530 |
| 734 | Ga0501036_0003103 | 3300049572 | Bacteria | 13254 |
| 735 | Ga0501036_0030488 | 3300049572 | Bacteria | 4555 |
| 736 | Ga0501037_0015201 | 3300049573 | Bacteria | 5663 |
| 737 | Ga0501037_0730838 | 3300049573 | Bacteria | 657 |
| 738 | Ga0501037_1149111 | 3300049573 | Bacteria | 502 |
| 739 | Ga0501038_0004358 | 3300049574 | Bacteria | 13170 |
| 740 | Ga0501039_0022878 | 3300049575 | Bacteria | 4794 |
| 741 | Ga0501040_0637135 | 3300049576 | Bacteria | 770 |
| 742 | Ga0501041_1062730 | 3300049577 | Bacteria | 521 |
| 743 | Ga0501042_0219059 | 3300049578 | Bacteria | 1373 |
| 744 | Ga0501042_0715256 | 3300049578 | Bacteria | 728 |
| 745 | Ga0501043_0010559 | 3300049579 | Bacteria | 7229 |
| 746 | Ga0501043_0324680 | 3300049579 | Bacteria | 1173 |
| 747 | Ga0501043_1064210 | 3300049579 | Bacteria | 573 |
| 748 | Ga0501046_0186916 | 3300049580 | Bacteria | 1547 |
| 749 | Ga0501047_0002578 | 3300049581 | Bacteria | 17283 |
| 750 | Ga0501047_0010564 | 3300049581 | Bacteria | 8731 |
| 751 | Ga0501047_0015643 | 3300049581 | Bacteria | 7229 |
| 752 | Ga0501047_0567515 | 3300049581 | Bacteria | 958 |
| 753 | Ga0501048_1157391 | 3300049582 | Bacteria | 556 |
| 754 | Ga0501067_0262872 | 3300049583 | Bacteria | 961 |
| 755 | Ga0501068_0452375 | 3300049584 | Bacteria | 831 |
| 756 | Ga0501069_0004731 | 3300049585 | Bacteria | 7041 |
| 757 | Ga0501070_0000004 | 3300049586 | Bacteria | 254956 |
| 758 | Ga0501070_0122956 | 3300049586 | Bacteria | 2145 |
| 759 | Ga0501071_1060476 | 3300049587 | Bacteria | 626 |
| 760 | Ga0501072_0688467 | 3300049588 | Bacteria | 804 |
| 761 | Ga0501073_0196131 | 3300049589 | Bacteria | 1396 |
| 762 | Ga0501073_0266695 | 3300049589 | Bacteria | 1181 |
| 763 | Ga0501073_1184817 | 3300049589 | Bacteria | 524 |
| 764 | Ga0501074_0067888 | 3300049590 | Bacteria | 2563 |
| 765 | Ga0501074_0168477 | 3300049590 | Bacteria | 1564 |
| 766 | Ga0501076_0877874 | 3300049592 | Bacteria | 740 |
| 767 | Ga0501076_1536079 | 3300049592 | Bacteria | 547 |
| 768 | Ga0501079_0215173 | 3300049741 | Bacteria | 1501 |
| 769 | Ga0501080_0035734 | 3300049742 | Bacteria | 4638 |
| 770 | Ga0501080_0064466 | 3300049742 | Bacteria | 3408 |
| 771 | Ga0501080_0284893 | 3300049742 | Bacteria | 1501 |
| 772 | Ga0501080_1005796 | 3300049742 | Bacteria | 723 |
| 773 | Ga0501080_1106492 | 3300049742 | Bacteria | 684 |
| 774 | Ga0501080_1808928 | 3300049742 | Bacteria | 513 |
| 775 | Ga0501083_0004207 | 3300049744 | Bacteria | 10133 |
| 776 | Ga0501083_0055162 | 3300049744 | Bacteria | 2665 |
| 777 | Ga0501083_0130912 | 3300049744 | Bacteria | 1644 |
| 778 | Ga0501083_0756369 | 3300049744 | Bacteria | 632 |
| 779 | Ga0501083_0920014 | 3300049744 | Bacteria | 569 |
| 780 | Ga0501035_0001099 | 3300049822 | Bacteria | 28343 |
| 781 | Ga0501035_0017403 | 3300049822 | Bacteria | 6628 |
| 782 | Ga0501035_0244250 | 3300049822 | Bacteria | 1526 |
| 783 | Ga0501044_0007760 | 3300049823 | Bacteria | 11797 |
| 784 | Ga0501044_0052993 | 3300049823 | Bacteria | 4176 |
| 785 | Ga0501044_0109453 | 3300049823 | Bacteria | 2772 |
| 786 | Ga0501044_0529057 | 3300049823 | Bacteria | 1078 |
| 787 | Ga0501045_0402347 | 3300049824 | Bacteria | 1019 |
| 788 | nmdc:mga06r32_367815_c1 | 3300050510 | Bacteria | 1421 |
| 789 | Ga0495601_0012200 | 3300053077 | Bacteria | 5152 |
| 790 | Ga0495601_0012522 | 3300053077 | Bacteria | 5088 |
| 791 | Ga0495601_0072314 | 3300053077 | Bacteria | 2203 |
| 792 | Ga0495601_0368483 | 3300053077 | Bacteria | 933 |
| 793 | Ga0495601_0895898 | 3300053077 | Bacteria | 561 |
| 794 | Ga0495612_0026068 | 3300053078 | Bacteria | 2350 |
| 795 | Ga0495612_0373922 | 3300053078 | Bacteria | 645 |
| 796 | Ga0495612_0523782 | 3300053078 | Unclassified | 545 |
| 797 | Ga0495655_0054883 | 3300053083 | Bacteria | 1067 |
| 798 | Ga0495595_0025655 | 3300053084 | Bacteria | 2614 |
| 799 | Ga0495595_0126940 | 3300053084 | Bacteria | 1245 |
| 800 | Ga0495595_0194138 | 3300053084 | Bacteria | 1009 |
| 801 | Ga0495595_0370794 | 3300053084 | Bacteria | 724 |
| 802 | Ga0495595_0372853 | 3300053084 | Bacteria | 722 |
| 803 | Ga0495619_0046991 | 3300053085 | Bacteria | 2841 |
| 804 | Ga0495619_0146882 | 3300053085 | Bacteria | 1626 |
| 805 | Ga0495619_0197525 | 3300053085 | Bacteria | 1393 |
| 806 | Ga0495619_0413811 | 3300053085 | Bacteria | 930 |
| 807 | Ga0495619_0467640 | 3300053085 | Unclassified | 868 |
| 808 | Ga0495619_0642135 | 3300053085 | Bacteria | 724 |
| 809 | Ga0500572_070805 | 3300053111 | Bacteria | 1077 |
| 810 | Ga0500595_001486 | 3300053119 | Bacteria | 12462 |
| 811 | Ga0500595_001857 | 3300053119 | Bacteria | 10930 |
| 812 | Ga0500618_001681 | 3300053125 | Bacteria | 9486 |
| 813 | Ga0500618_018374 | 3300053125 | Bacteria | 1730 |
| 814 | Ga0500559_0373815 | 3300053136 | Bacteria | 665 |
| 815 | Ga0500574_126183 | 3300053141 | Bacteria | 756 |
| 816 | Ga0500638_085297 | 3300053162 | Bacteria | 1495 |
| 817 | Ga0500636_0012159 | 3300053177 | Bacteria | 5041 |
| 818 | Ga0500636_0516556 | 3300053177 | Bacteria | 524 |
| 819 | Ga0501084_0508170 | 3300054114 | Bacteria | 1019 |
| 820 | Ga0501084_0600090 | 3300054114 | Bacteria | 930 |
| 821 | Ga0501084_0669243 | 3300054114 | Bacteria | 876 |
| 822 | Ga0501084_0811074 | 3300054114 | Bacteria | 788 |
| 823 | Ga0501084_1017458 | 3300054114 | Bacteria | 696 |
| 824 | Ga0501084_1620411 | 3300054114 | Bacteria | 541 |
| 825 | Ga0501082_0058567 | 3300060353 | Bacteria | 3319 |
| 826 | Ga0501082_0142241 | 3300060353 | Bacteria | 2082 |
| 827 | Ga0501082_0169092 | 3300060353 | Bacteria | 1900 |
| 828 | Ga0501082_0481970 | 3300060353 | Bacteria | 1084 |
| 829 | Ga0530510_0124248 | 3300061734 | Bacteria | 1896 |
| 830 | Ga0530510_0153438 | 3300061734 | Bacteria | 1702 |
| 831 | Ga0530510_0576473 | 3300061734 | Bacteria | 855 |
| 832 | Ga0530510_0626163 | 3300061734 | Bacteria | 819 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005336 | Ga0070680_100007605 | Ga0070680_1000076055 | 79 |
| 2 | 3300005435 | Ga0070714_102076289 | Ga0070714_1020762892 | 79 |
| 3 | 3300005458 | Ga0070681_10036498 | Ga0070681_100364985 | 79 |
| 4 | 3300005530 | Ga0070679_100649748 | Ga0070679_1006497482 | 79 |
| 5 | 3300005563 | Ga0068855_100213250 | Ga0068855_1002132502 | 79 |
| 6 | 3300009093 | Ga0105240_10144408 | Ga0105240_101444084 | 79 |
| 7 | 3300013105 | Ga0157369_11480450 | Ga0157369_114804502 | 79 |
| 8 | 3300021441 | Ga0213871_10089856 | Ga0213871_100898562 | 79 |
| 9 | 3300025912 | Ga0207707_10063026 | Ga0207707_100630264 | 79 |
| 10 | 3300025913 | Ga0207695_10091960 | Ga0207695_100919604 | 79 |
| 11 | 3300025921 | Ga0207652_10576304 | Ga0207652_105763042 | 79 |
| 12 | 3300025929 | Ga0207664_10062113 | Ga0207664_100621134 | 79 |
| 13 | 3300025949 | Ga0207667_10123367 | Ga0207667_101233676 | 79 |
| 14 | 3300030521 | Ga0307511_10001799 | Ga0307511_100017998 | 79 |
| 15 | 3300039438 | Ga0436360_1278836 | Ga0436360_1278836_299_538 | 79 |
| 16 | 3300045051 | Ga0451576_2219636 | Ga0451576_2219636_23_262 | 79 |
| 17 | 3300048925 | Ga0496122_0338411 | Ga0496122_0338411_11_250 | 79 |
| 18 | iso_pu_bacteria | 2854681122 | 2854681795 | 79 |
| 19 | 3300003763 | Ga0055529_1002270 | Ga0055529_10022702 | 80 |
| 20 | 3300005434 | Ga0070709_10344587 | Ga0070709_103445872 | 80 |
| 21 | 3300005435 | Ga0070714_101157494 | Ga0070714_1011574942 | 80 |
| 22 | 3300005436 | Ga0070713_100119950 | Ga0070713_1001199502 | 80 |
| 23 | 3300005437 | Ga0070710_10306891 | Ga0070710_103068912 | 80 |
| 24 | 3300005445 | Ga0070708_101420871 | Ga0070708_1014208712 | 80 |
| 25 | 3300005458 | Ga0070681_11537387 | Ga0070681_115373872 | 80 |
| 26 | 3300005535 | Ga0070684_100666787 | Ga0070684_1006667872 | 80 |
| 27 | 3300005545 | Ga0070695_100243631 | Ga0070695_1002436312 | 80 |
| 28 | 3300005563 | Ga0068855_100227539 | Ga0068855_1002275395 | 80 |
| 29 | 3300005614 | Ga0068856_100023871 | Ga0068856_1000238715 | 80 |
| 30 | 3300005614 | Ga0068856_100434985 | Ga0068856_1004349852 | 80 |
| 31 | 3300005614 | Ga0068856_100575516 | Ga0068856_1005755162 | 80 |
| 32 | 3300005843 | Ga0068860_102552979 | Ga0068860_1025529791 | 80 |
| 33 | 3300005844 | Ga0068862_102172716 | Ga0068862_1021727161 | 80 |
| 34 | 3300006051 | Ga0075364_10411390 | Ga0075364_104113902 | 80 |
| 35 | 3300006175 | Ga0070712_100469692 | Ga0070712_1004696921 | 80 |
| 36 | 3300006844 | Ga0075428_101225065 | Ga0075428_1012250652 | 80 |
| 37 | 3300009093 | Ga0105240_10529684 | Ga0105240_105296842 | 80 |
| 38 | 3300009147 | Ga0114129_11740347 | Ga0114129_117403472 | 80 |
| 39 | 3300013297 | Ga0157378_10022773 | Ga0157378_100227737 | 80 |
| 40 | 3300014325 | Ga0163163_10940542 | Ga0163163_109405422 | 80 |
| 41 | 3300014968 | Ga0157379_10611717 | Ga0157379_106117172 | 80 |
| 42 | 3300021361 | Ga0213872_10272836 | Ga0213872_102728362 | 80 |
| 43 | 3300021441 | Ga0213871_10083144 | Ga0213871_100831442 | 80 |
| 44 | 3300025272 | Ga0209455_1000458 | Ga0209455_100045811 | 80 |
| 45 | 3300025898 | Ga0207692_10053356 | Ga0207692_100533565 | 80 |
| 46 | 3300025909 | Ga0207705_10997492 | Ga0207705_109974922 | 80 |
| 47 | 3300025928 | Ga0207700_10106927 | Ga0207700_101069272 | 80 |
| 48 | 3300025928 | Ga0207700_10215680 | Ga0207700_102156802 | 80 |
| 49 | 3300025949 | Ga0207667_10130724 | Ga0207667_101307242 | 80 |
| 50 | 3300026067 | Ga0207678_11915471 | Ga0207678_119154712 | 80 |
| 51 | 3300026075 | Ga0207708_11194936 | Ga0207708_111949362 | 80 |
| 52 | 3300026078 | Ga0207702_10118479 | Ga0207702_101184792 | 80 |
| 53 | 3300026078 | Ga0207702_10316901 | Ga0207702_103169012 | 80 |
| 54 | 3300026078 | Ga0207702_11293867 | Ga0207702_112938672 | 80 |
| 55 | 3300026078 | Ga0207702_12271602 | Ga0207702_122716022 | 80 |
| 56 | 3300028379 | Ga0268266_10031306 | Ga0268266_100313064 | 80 |
| 57 | 3300028380 | Ga0268265_12687309 | Ga0268265_126873092 | 80 |
| 58 | 3300028556 | Ga0265337_1001289 | Ga0265337_10012898 | 80 |
| 59 | 3300028556 | Ga0265337_1002582 | Ga0265337_10025826 | 80 |
| 60 | 3300028558 | Ga0265326_10000639 | Ga0265326_1000063910 | 80 |
| 61 | 3300028563 | Ga0265319_1004283 | Ga0265319_10042833 | 80 |
| 62 | 3300028573 | Ga0265334_10000634 | Ga0265334_100006346 | 80 |
| 63 | 3300028573 | Ga0265334_10210781 | Ga0265334_102107812 | 80 |
| 64 | 3300028577 | Ga0265318_10005840 | Ga0265318_100058404 | 80 |
| 65 | 3300028653 | Ga0265323_10000501 | Ga0265323_1000050120 | 80 |
| 66 | 3300028654 | Ga0265322_10011962 | Ga0265322_100119623 | 80 |
| 67 | 3300028666 | Ga0265336_10000161 | Ga0265336_1000016120 | 80 |
| 68 | 3300028800 | Ga0265338_10000994 | Ga0265338_1000099420 | 80 |
| 69 | 3300028800 | Ga0265338_10040425 | Ga0265338_100404253 | 80 |
| 70 | 3300028800 | Ga0265338_10159348 | Ga0265338_101593482 | 80 |
| 71 | 3300028800 | Ga0265338_10258343 | Ga0265338_102583432 | 80 |
| 72 | 3300029957 | Ga0265324_10001977 | Ga0265324_100019777 | 80 |
| 73 | 3300031235 | Ga0265330_10304049 | Ga0265330_103040492 | 80 |
| 74 | 3300031239 | Ga0265328_10132154 | Ga0265328_101321542 | 80 |
| 75 | 3300031239 | Ga0265328_10222804 | Ga0265328_102228042 | 80 |
| 76 | 3300031240 | Ga0265320_10006281 | Ga0265320_100062812 | 80 |
| 77 | 3300031240 | Ga0265320_10010158 | Ga0265320_100101583 | 80 |
| 78 | 3300031240 | Ga0265320_10011369 | Ga0265320_100113692 | 80 |
| 79 | 3300031241 | Ga0265325_10059274 | Ga0265325_100592744 | 80 |
| 80 | 3300031241 | Ga0265325_10495541 | Ga0265325_104955412 | 80 |
| 81 | 3300031242 | Ga0265329_10288390 | Ga0265329_102883902 | 80 |
| 82 | 3300031247 | Ga0265340_10004409 | Ga0265340_100044097 | 80 |
| 83 | 3300031247 | Ga0265340_10379040 | Ga0265340_103790402 | 80 |
| 84 | 3300031250 | Ga0265331_10061771 | Ga0265331_100617713 | 80 |
| 85 | 3300031250 | Ga0265331_10455757 | Ga0265331_104557572 | 80 |
| 86 | 3300031251 | Ga0265327_10020348 | Ga0265327_100203482 | 80 |
| 87 | 3300031251 | Ga0265327_10043544 | Ga0265327_100435442 | 80 |
| 88 | 3300031251 | Ga0265327_10130869 | Ga0265327_101308692 | 80 |
| 89 | 3300031344 | Ga0265316_10146533 | Ga0265316_101465334 | 80 |
| 90 | 3300031507 | Ga0307509_10000197 | Ga0307509_1000019751 | 80 |
| 91 | 3300031595 | Ga0265313_10172310 | Ga0265313_101723102 | 80 |
| 92 | 3300031595 | Ga0265313_10400954 | Ga0265313_104009542 | 80 |
| 93 | 3300031665 | Ga0316575_10001481 | Ga0316575_100014815 | 80 |
| 94 | 3300031665 | Ga0316575_10211296 | Ga0316575_102112962 | 80 |
| 95 | 3300031665 | Ga0316575_10276213 | Ga0316575_102762132 | 80 |
| 96 | 3300031691 | Ga0316579_10010547 | Ga0316579_100105472 | 80 |
| 97 | 3300031711 | Ga0265314_10010615 | Ga0265314_100106154 | 80 |
| 98 | 3300031711 | Ga0265314_10033190 | Ga0265314_100331903 | 80 |
| 99 | 3300031711 | Ga0265314_10347862 | Ga0265314_103478622 | 80 |
| 100 | 3300031712 | Ga0265342_10002523 | Ga0265342_100025236 | 80 |
| 101 | 3300031727 | Ga0316576_10078239 | Ga0316576_100782396 | 80 |
| 102 | 3300031727 | Ga0316576_10222472 | Ga0316576_102224723 | 80 |
| 103 | 3300031727 | Ga0316576_10223820 | Ga0316576_102238202 | 80 |
| 104 | 3300031727 | Ga0316576_10248710 | Ga0316576_102487103 | 80 |
| 105 | 3300031728 | Ga0316578_10005514 | Ga0316578_100055146 | 80 |
| 106 | 3300031728 | Ga0316578_10569945 | Ga0316578_105699452 | 80 |
| 107 | 3300031733 | Ga0316577_10019089 | Ga0316577_100190892 | 80 |
| 108 | 3300031733 | Ga0316577_10783804 | Ga0316577_107838042 | 80 |
| 109 | 3300031903 | Ga0307407_11256839 | Ga0307407_112568392 | 80 |
| 110 | 3300031995 | Ga0307409_100288750 | Ga0307409_1002887503 | 80 |
| 111 | 3300032002 | Ga0307416_103829589 | Ga0307416_1038295892 | 80 |
| 112 | 3300032133 | Ga0316583_10000388 | Ga0316583_100003889 | 80 |
| 113 | 3300032137 | Ga0316585_10000265 | Ga0316585_100002655 | 80 |
| 114 | 3300032139 | Ga0316580_10000521 | Ga0316580_100005215 | 80 |
| 115 | 3300032168 | Ga0316593_10079627 | Ga0316593_100796272 | 80 |
| 116 | 3300035086 | Ga0373934_0487579 | Ga0373934_0487579_237_479 | 80 |
| 117 | 3300035111 | Ga0373923_0234961 | Ga0373923_0234961_211_453 | 80 |
| 118 | 3300035113 | Ga0373936_0024904 | Ga0373936_0024904_1230_1472 | 80 |
| 119 | 3300035117 | Ga0373953_0013070 | Ga0373953_0013070_1624_1866 | 80 |
| 120 | 3300035118 | Ga0373954_0009029 | Ga0373954_0009029_3242_3484 | 80 |
| 121 | 3300035118 | Ga0373954_0197690 | Ga0373954_0197690_312_554 | 80 |
| 122 | 3300035118 | Ga0373954_0590264 | Ga0373954_0590264_236_478 | 80 |
| 123 | 3300035119 | Ga0373956_0071029 | Ga0373956_0071029_784_1026 | 80 |
| 124 | 3300035119 | Ga0373956_0117285 | Ga0373956_0117285_399_641 | 80 |
| 125 | 3300035119 | Ga0373956_0156697 | Ga0373956_0156697_714_956 | 80 |
| 126 | 3300035119 | Ga0373956_0302913 | Ga0373956_0302913_439_687 | 80 |
| 127 | 3300035119 | Ga0373956_0305252 | Ga0373956_0305252_67_309 | 80 |
| 128 | 3300035120 | Ga0373957_0031366 | Ga0373957_0031366_1518_1760 | 80 |
| 129 | 3300035170 | Ga0373943_0395371 | Ga0373943_0395371_114_356 | 80 |
| 130 | 3300035172 | Ga0373955_0103220 | Ga0373955_0103220_1040_1282 | 80 |
| 131 | 3300035172 | Ga0373955_0193954 | Ga0373955_0193954_791_1033 | 80 |
| 132 | 3300035398 | Ga0316574_0000783 | Ga0316574_0000783_9838_10080 | 80 |
| 133 | 3300035398 | Ga0316574_0035609 | Ga0316574_0035609_1837_2079 | 80 |
| 134 | 3300035398 | Ga0316574_0062287 | Ga0316574_0062287_1008_1250 | 80 |
| 135 | 3300035398 | Ga0316574_0199617 | Ga0316574_0199617_589_831 | 80 |
| 136 | 3300035410 | Ga0373924_0057883 | Ga0373924_0057883_1336_1578 | 80 |
| 137 | 3300035724 | Ga0373933_0008329 | Ga0373933_0008329_5087_5329 | 80 |
| 138 | 3300035724 | Ga0373933_0023982 | Ga0373933_0023982_2499_2741 | 80 |
| 139 | 3300035724 | Ga0373933_0077880 | Ga0373933_0077880_1670_1912 | 80 |
| 140 | 3300035724 | Ga0373933_0351799 | Ga0373933_0351799_168_410 | 80 |
| 141 | 3300035724 | Ga0373933_0798720 | Ga0373933_0798720_268_510 | 80 |
| 142 | 3300035724 | Ga0373933_0870902 | Ga0373933_0870902_260_505 | 80 |
| 143 | 3300036401 | Ga0373937_0006092 | Ga0373937_0006092_8683_8925 | 80 |
| 144 | 3300036401 | Ga0373937_0123022 | Ga0373937_0123022_250_492 | 80 |
| 145 | 3300036401 | Ga0373937_0132856 | Ga0373937_0132856_1600_1842 | 80 |
| 146 | 3300036401 | Ga0373937_0728466 | Ga0373937_0728466_432_674 | 80 |
| 147 | 3300036401 | Ga0373937_1378959 | Ga0373937_1378959_92_340 | 80 |
| 148 | 3300036647 | Ga0316582_0017390 | Ga0316582_0017390_3108_3350 | 80 |
| 149 | 3300036712 | Ga0316584_0004837 | Ga0316584_0004837_5581_5823 | 80 |
| 150 | 3300036712 | Ga0316584_0174049 | Ga0316584_0174049_156_398 | 80 |
| 151 | 3300036712 | Ga0316584_0347192 | Ga0316584_0347192_16_258 | 80 |
| 152 | 3300037588 | Ga0316581_0001594 | Ga0316581_0001594_4811_5053 | 80 |
| 153 | 3300039438 | Ga0436360_0278009 | Ga0436360_0278009_486_728 | 80 |
| 154 | 3300039438 | Ga0436360_0694448 | Ga0436360_0694448_375_617 | 80 |
| 155 | 3300039447 | Ga0436361_0031613 | Ga0436361_0031613_863_1108 | 80 |
| 156 | 3300039447 | Ga0436361_0083953 | Ga0436361_0083953_1642_1884 | 80 |
| 157 | 3300039447 | Ga0436361_0623967 | Ga0436361_0623967_278_523 | 80 |
| 158 | 3300039447 | Ga0436361_0834676 | Ga0436361_0834676_431_673 | 80 |
| 159 | 3300039453 | Ga0436362_0199972 | Ga0436362_0199972_104_346 | 80 |
| 160 | 3300039453 | Ga0436362_0490283 | Ga0436362_0490283_273_518 | 80 |
| 161 | 3300039453 | Ga0436362_0732104 | Ga0436362_0732104_282_530 | 80 |
| 162 | 3300042461 | Ga0439460_0080674 | Ga0439460_0080674_298_540 | 80 |
| 163 | 3300044712 | Ga0453684_0041407 | Ga0453684_0041407_1596_1841 | 80 |
| 164 | 3300046454 | Ga0495592_0351286 | Ga0495592_0351286_223_465 | 80 |
| 165 | 3300046462 | Ga0495651_0055901 | Ga0495651_0055901_2098_2340 | 80 |
| 166 | 3300046462 | Ga0495651_0088503 | Ga0495651_0088503_329_571 | 80 |
| 167 | 3300046463 | Ga0495653_0904265 | Ga0495653_0904265_158_400 | 80 |
| 168 | 3300046474 | Ga0495605_0314502 | Ga0495605_0314502_174_422 | 80 |
| 169 | 3300046492 | Ga0495585_0027418 | Ga0495585_0027418_613_861 | 80 |
| 170 | 3300046500 | Ga0495596_0177463 | Ga0495596_0177463_171_419 | 80 |
| 171 | 3300046501 | Ga0495607_0118417 | Ga0495607_0118417_909_1157 | 80 |
| 172 | 3300046506 | Ga0495583_0161809 | Ga0495583_0161809_457_699 | 80 |
| 173 | 3300046511 | Ga0495608_0089470 | Ga0495608_0089470_1530_1772 | 80 |
| 174 | 3300046516 | Ga0495628_0049446 | Ga0495628_0049446_156_398 | 80 |
| 175 | 3300046516 | Ga0495628_0609053 | Ga0495628_0609053_346_588 | 80 |
| 176 | 3300046518 | Ga0495631_0222340 | Ga0495631_0222340_320_562 | 80 |
| 177 | 3300046523 | Ga0495644_0173559 | Ga0495644_0173559_33_281 | 80 |
| 178 | 3300046528 | Ga0495642_0131984 | Ga0495642_0131984_382_630 | 80 |
| 179 | 3300046533 | Ga0495640_0036999 | Ga0495640_0036999_389_631 | 80 |
| 180 | 3300046537 | Ga0495598_0284671 | Ga0495598_0284671_249_497 | 80 |
| 181 | 3300046558 | Ga0495633_0181635 | Ga0495633_0181635_126_374 | 80 |
| 182 | 3300046559 | Ga0495667_0150969 | Ga0495667_0150969_27_269 | 80 |
| 183 | 3300046615 | Ga0495656_0512478 | Ga0495656_0512478_319_567 | 80 |
| 184 | 3300046648 | Ga0495611_0315904 | Ga0495611_0315904_374_622 | 80 |
| 185 | 3300046663 | Ga0495635_0785931 | Ga0495635_0785931_205_447 | 80 |
| 186 | 3300046665 | Ga0495661_0293420 | Ga0495661_0293420_352_600 | 80 |
| 187 | 3300046678 | Ga0495599_0128394 | Ga0495599_0128394_746_988 | 80 |
| 188 | 3300046679 | Ga0495623_0134321 | Ga0495623_0134321_260_502 | 80 |
| 189 | 3300046809 | Ga0495600_0148994 | Ga0495600_0148994_420_662 | 80 |
| 190 | 3300046809 | Ga0495600_0597403 | Ga0495600_0597403_284_526 | 80 |
| 191 | 3300046809 | Ga0495600_0920796 | Ga0495600_0920796_96_338 | 80 |
| 192 | 3300047317 | Ga0495604_0182137 | Ga0495604_0182137_922_1164 | 80 |
| 193 | 3300047317 | Ga0495604_0827851 | Ga0495604_0827851_13_255 | 80 |
| 194 | 3300047318 | Ga0495636_0185038 | Ga0495636_0185038_103_351 | 80 |
| 195 | 3300047322 | Ga0495680_0249699 | Ga0495680_0249699_497_739 | 80 |
| 196 | 3300047322 | Ga0495680_0329167 | Ga0495680_0329167_662_904 | 80 |
| 197 | 3300047444 | Ga0495675_0470242 | Ga0495675_0470242_190_432 | 80 |
| 198 | 3300047444 | Ga0495675_0478648 | Ga0495675_0478648_46_288 | 80 |
| 199 | 3300048088 | Ga0495602_0464546 | Ga0495602_0464546_280_522 | 80 |
| 200 | 3300048088 | Ga0495602_0489849 | Ga0495602_0489849_608_850 | 80 |
| 201 | 3300048920 | Ga0496117_0014666 | Ga0496117_0014666_3244_3486 | 80 |
| 202 | 3300048921 | Ga0496118_0069118 | Ga0496118_0069118_298_540 | 80 |
| 203 | 3300048927 | Ga0496124_0021718 | Ga0496124_0021718_667_909 | 80 |
| 204 | 3300049459 | Ga0495678_020627 | Ga0495678_020627_585_827 | 80 |
| 205 | 3300049571 | Ga0501034_0071034 | Ga0501034_0071034_31_273 | 80 |
| 206 | 3300049573 | Ga0501037_1149111 | Ga0501037_1149111_72_314 | 80 |
| 207 | 3300049576 | Ga0501040_0637135 | Ga0501040_0637135_76_318 | 80 |
| 208 | 3300049577 | Ga0501041_1062730 | Ga0501041_1062730_201_443 | 80 |
| 209 | 3300049581 | Ga0501047_0567515 | Ga0501047_0567515_699_941 | 80 |
| 210 | 3300049585 | Ga0501069_0004731 | Ga0501069_0004731_2044_2286 | 80 |
| 211 | 3300049586 | Ga0501070_0000004 | Ga0501070_0000004_226840_227082 | 80 |
| 212 | 3300049587 | Ga0501071_1060476 | Ga0501071_1060476_124_366 | 80 |
| 213 | 3300049588 | Ga0501072_0688467 | Ga0501072_0688467_379_621 | 80 |
| 214 | 3300049589 | Ga0501073_0196131 | Ga0501073_0196131_181_423 | 80 |
| 215 | 3300049589 | Ga0501073_0266695 | Ga0501073_0266695_143_385 | 80 |
| 216 | 3300049589 | Ga0501073_1184817 | Ga0501073_1184817_81_323 | 80 |
| 217 | 3300049590 | Ga0501074_0067888 | Ga0501074_0067888_1388_1630 | 80 |
| 218 | 3300049592 | Ga0501076_0877874 | Ga0501076_0877874_236_478 | 80 |
| 219 | 3300049592 | Ga0501076_1536079 | Ga0501076_1536079_88_330 | 80 |
| 220 | 3300049742 | Ga0501080_0035734 | Ga0501080_0035734_3349_3591 | 80 |
| 221 | 3300049742 | Ga0501080_0284893 | Ga0501080_0284893_1161_1403 | 80 |
| 222 | 3300049742 | Ga0501080_1106492 | Ga0501080_1106492_143_385 | 80 |
| 223 | 3300049742 | Ga0501080_1808928 | Ga0501080_1808928_38_280 | 80 |
| 224 | 3300049744 | Ga0501083_0055162 | Ga0501083_0055162_2388_2630 | 80 |
| 225 | 3300049744 | Ga0501083_0130912 | Ga0501083_0130912_1387_1629 | 80 |
| 226 | 3300049744 | Ga0501083_0920014 | Ga0501083_0920014_42_284 | 80 |
| 227 | 3300053077 | Ga0495601_0072314 | Ga0495601_0072314_1599_1841 | 80 |
| 228 | 3300053078 | Ga0495612_0523782 | Ga0495612_0523782_64_309 | 80 |
| 229 | 3300053083 | Ga0495655_0054883 | Ga0495655_0054883_158_406 | 80 |
| 230 | 3300053084 | Ga0495595_0194138 | Ga0495595_0194138_180_422 | 80 |
| 231 | 3300053084 | Ga0495595_0372853 | Ga0495595_0372853_59_301 | 80 |
| 232 | 3300053085 | Ga0495619_0467640 | Ga0495619_0467640_573_815 | 80 |
| 233 | 3300053125 | Ga0500618_001681 | Ga0500618_001681_8801_9043 | 80 |
| 234 | 3300053136 | Ga0500559_0373815 | Ga0500559_0373815_88_330 | 80 |
| 235 | 3300054114 | Ga0501084_0508170 | Ga0501084_0508170_637_879 | 80 |
| 236 | 3300054114 | Ga0501084_0669243 | Ga0501084_0669243_393_635 | 80 |
| 237 | 3300054114 | Ga0501084_1017458 | Ga0501084_1017458_149_391 | 80 |
| 238 | 3300060353 | Ga0501082_0169092 | Ga0501082_0169092_187_429 | 80 |
| 239 | 3300061734 | Ga0530510_0124248 | Ga0530510_0124248_1251_1493 | 80 |
| 240 | 3300061734 | Ga0530510_0153438 | Ga0530510_0153438_172_414 | 80 |
| 241 | 3300061734 | Ga0530510_0576473 | Ga0530510_0576473_145_387 | 80 |
| 242 | 3300061734 | Ga0530510_0626163 | Ga0530510_0626163_302_544 | 80 |
| 243 | 3300002704 | JGI25155J39150_1000040 | JGI25155J39150_100004044 | 81 |
| 244 | 3300002705 | JGI25156J39149_1000051 | JGI25156J39149_100005150 | 81 |
| 245 | 3300002738 | JGI25154J39366_1000079 | JGI25154J39366_100007950 | 81 |
| 246 | 3300002741 | JGI25157J39369_1000168 | JGI25157J39369_100016810 | 81 |
| 247 | 3300003214 | JGI25165J46597_1002592 | JGI25165J46597_10025927 | 81 |
| 248 | 3300003320 | rootH2_10151561 | rootH2_101515613 | 81 |
| 249 | 3300003320 | rootH2_10152981 | rootH2_101529812 | 81 |
| 250 | 3300003322 | rootL2_10013062 | rootL2_100130629 | 81 |
| 251 | 3300003322 | rootL2_10019673 | rootL2_100196736 | 81 |
| 252 | 3300003322 | rootL2_10063881 | rootL2_1006388114 | 81 |
| 253 | 3300003752 | Ga0055539_1023396 | Ga0055539_10233962 | 81 |
| 254 | 3300003771 | Ga0055526_1071029 | Ga0055526_10710292 | 81 |
| 255 | 3300005338 | Ga0068868_101125213 | Ga0068868_1011252132 | 81 |
| 256 | 3300005365 | Ga0070688_100504606 | Ga0070688_1005046062 | 81 |
| 257 | 3300005435 | Ga0070714_100344743 | Ga0070714_1003447432 | 81 |
| 258 | 3300005436 | Ga0070713_100018664 | Ga0070713_1000186643 | 81 |
| 259 | 3300005436 | Ga0070713_100154223 | Ga0070713_1001542232 | 81 |
| 260 | 3300005437 | Ga0070710_10155011 | Ga0070710_101550112 | 81 |
| 261 | 3300005437 | Ga0070710_10369546 | Ga0070710_103695462 | 81 |
| 262 | 3300005439 | Ga0070711_100023848 | Ga0070711_1000238482 | 81 |
| 263 | 3300005439 | Ga0070711_100585681 | Ga0070711_1005856811 | 81 |
| 264 | 3300005439 | Ga0070711_100817750 | Ga0070711_1008177501 | 81 |
| 265 | 3300005440 | Ga0070705_101013910 | Ga0070705_1010139101 | 81 |
| 266 | 3300005467 | Ga0070706_100702155 | Ga0070706_1007021551 | 81 |
| 267 | 3300005518 | Ga0070699_102067474 | Ga0070699_1020674741 | 81 |
| 268 | 3300005535 | Ga0070684_102025484 | Ga0070684_1020254842 | 81 |
| 269 | 3300005536 | Ga0070697_100144710 | Ga0070697_1001447103 | 81 |
| 270 | 3300006028 | Ga0070717_10207675 | Ga0070717_102076752 | 81 |
| 271 | 3300006028 | Ga0070717_10278685 | Ga0070717_102786851 | 81 |
| 272 | 3300006028 | Ga0070717_11443074 | Ga0070717_114430742 | 81 |
| 273 | 3300006173 | Ga0070716_100013267 | Ga0070716_1000132676 | 81 |
| 274 | 3300006173 | Ga0070716_101462654 | Ga0070716_1014626542 | 81 |
| 275 | 3300006175 | Ga0070712_100007480 | Ga0070712_1000074807 | 81 |
| 276 | 3300006175 | Ga0070712_100729240 | Ga0070712_1007292402 | 81 |
| 277 | 3300006175 | Ga0070712_100784323 | Ga0070712_1007843232 | 81 |
| 278 | 3300006175 | Ga0070712_101271005 | Ga0070712_1012710052 | 81 |
| 279 | 3300006847 | Ga0075431_100394042 | Ga0075431_1003940423 | 81 |
| 280 | 3300009093 | Ga0105240_11214853 | Ga0105240_112148532 | 81 |
| 281 | 3300009093 | Ga0105240_11455662 | Ga0105240_114556622 | 81 |
| 282 | 3300009101 | Ga0105247_10895132 | Ga0105247_108951322 | 81 |
| 283 | 3300009551 | Ga0105238_11626792 | Ga0105238_116267922 | 81 |
| 284 | 3300010375 | Ga0105239_10643211 | Ga0105239_106432112 | 81 |
| 285 | 3300013104 | Ga0157370_10344551 | Ga0157370_103445512 | 81 |
| 286 | 3300013306 | Ga0163162_12276555 | Ga0163162_122765551 | 81 |
| 287 | 3300014497 | Ga0182008_10128327 | Ga0182008_101283272 | 81 |
| 288 | 3300014497 | Ga0182008_10447274 | Ga0182008_104472742 | 81 |
| 289 | 3300021361 | Ga0213872_10000453 | Ga0213872_1000045333 | 81 |
| 290 | 3300021361 | Ga0213872_10076735 | Ga0213872_100767352 | 81 |
| 291 | 3300021361 | Ga0213872_10088542 | Ga0213872_100885422 | 81 |
| 292 | 3300021361 | Ga0213872_10390296 | Ga0213872_103902961 | 81 |
| 293 | 3300021377 | Ga0213874_10111482 | Ga0213874_101114822 | 81 |
| 294 | 3300021388 | Ga0213875_10077890 | Ga0213875_100778904 | 81 |
| 295 | 3300021441 | Ga0213871_10022734 | Ga0213871_100227342 | 81 |
| 296 | 3300021441 | Ga0213871_10062210 | Ga0213871_100622102 | 81 |
| 297 | 3300025206 | Ga0209435_100052 | Ga0209435_10005241 | 81 |
| 298 | 3300025231 | Ga0207427_103984 | Ga0207427_1039845 | 81 |
| 299 | 3300025246 | Ga0209646_1000163 | Ga0209646_100016341 | 81 |
| 300 | 3300025250 | Ga0209026_1000190 | Ga0209026_100019041 | 81 |
| 301 | 3300025253 | Ga0209677_100311 | Ga0209677_10031130 | 81 |
| 302 | 3300025256 | Ga0209759_1000213 | Ga0209759_100021348 | 81 |
| 303 | 3300025261 | Ga0209233_1002612 | Ga0209233_10026127 | 81 |
| 304 | 3300025295 | Ga0209564_1009066 | Ga0209564_10090662 | 81 |
| 305 | 3300025898 | Ga0207692_10042656 | Ga0207692_100426563 | 81 |
| 306 | 3300025905 | Ga0207685_10257122 | Ga0207685_102571222 | 81 |
| 307 | 3300025905 | Ga0207685_10607398 | Ga0207685_106073982 | 81 |
| 308 | 3300025910 | Ga0207684_11427583 | Ga0207684_114275831 | 81 |
| 309 | 3300025915 | Ga0207693_10014221 | Ga0207693_100142213 | 81 |
| 310 | 3300025915 | Ga0207693_10257545 | Ga0207693_102575452 | 81 |
| 311 | 3300025915 | Ga0207693_10719816 | Ga0207693_107198162 | 81 |
| 312 | 3300025915 | Ga0207693_10737617 | Ga0207693_107376172 | 81 |
| 313 | 3300025916 | Ga0207663_10425979 | Ga0207663_104259792 | 81 |
| 314 | 3300025916 | Ga0207663_10731728 | Ga0207663_107317282 | 81 |
| 315 | 3300025928 | Ga0207700_10062481 | Ga0207700_100624812 | 81 |
| 316 | 3300025928 | Ga0207700_10136843 | Ga0207700_101368432 | 81 |
| 317 | 3300025929 | Ga0207664_10016010 | Ga0207664_100160103 | 81 |
| 318 | 3300025929 | Ga0207664_10171965 | Ga0207664_101719654 | 81 |
| 319 | 3300025939 | Ga0207665_10023328 | Ga0207665_100233286 | 81 |
| 320 | 3300026023 | Ga0207677_11023017 | Ga0207677_110230172 | 81 |
| 321 | 3300026067 | Ga0207678_10602201 | Ga0207678_106022012 | 81 |
| 322 | 3300026067 | Ga0207678_11465797 | Ga0207678_114657972 | 81 |
| 323 | 3300026078 | Ga0207702_12056119 | Ga0207702_120561191 | 81 |
| 324 | 3300026095 | Ga0207676_11272134 | Ga0207676_112721342 | 81 |
| 325 | 3300028017 | Ga0265356_1032084 | Ga0265356_10320842 | 81 |
| 326 | 3300028556 | Ga0265337_1000824 | Ga0265337_100082415 | 81 |
| 327 | 3300028558 | Ga0265326_10006770 | Ga0265326_100067706 | 81 |
| 328 | 3300028563 | Ga0265319_1001628 | Ga0265319_10016288 | 81 |
| 329 | 3300028573 | Ga0265334_10000208 | Ga0265334_1000020810 | 81 |
| 330 | 3300028577 | Ga0265318_10011015 | Ga0265318_100110155 | 81 |
| 331 | 3300028653 | Ga0265323_10000074 | Ga0265323_1000007426 | 81 |
| 332 | 3300028654 | Ga0265322_10015977 | Ga0265322_100159774 | 81 |
| 333 | 3300028666 | Ga0265336_10000108 | Ga0265336_1000010841 | 81 |
| 334 | 3300028666 | Ga0265336_10060823 | Ga0265336_100608232 | 81 |
| 335 | 3300028800 | Ga0265338_10000119 | Ga0265338_1000011992 | 81 |
| 336 | 3300028800 | Ga0265338_10301965 | Ga0265338_103019653 | 81 |
| 337 | 3300028800 | Ga0265338_10559043 | Ga0265338_105590432 | 81 |
| 338 | 3300029957 | Ga0265324_10002357 | Ga0265324_100023578 | 81 |
| 339 | 3300029957 | Ga0265324_10003388 | Ga0265324_100033884 | 81 |
| 340 | 3300030760 | Ga0265762_1096431 | Ga0265762_10964311 | 81 |
| 341 | 3300030760 | Ga0265762_1164593 | Ga0265762_11645931 | 81 |
| 342 | 3300030878 | Ga0265770_1040967 | Ga0265770_10409672 | 81 |
| 343 | 3300031090 | Ga0265760_10117592 | Ga0265760_101175922 | 81 |
| 344 | 3300031235 | Ga0265330_10105097 | Ga0265330_101050971 | 81 |
| 345 | 3300031238 | Ga0265332_10148842 | Ga0265332_101488422 | 81 |
| 346 | 3300031239 | Ga0265328_10002497 | Ga0265328_100024975 | 81 |
| 347 | 3300031239 | Ga0265328_10019367 | Ga0265328_100193673 | 81 |
| 348 | 3300031241 | Ga0265325_10080531 | Ga0265325_100805312 | 81 |
| 349 | 3300031242 | Ga0265329_10218165 | Ga0265329_102181652 | 81 |
| 350 | 3300031247 | Ga0265340_10112315 | Ga0265340_101123152 | 81 |
| 351 | 3300031247 | Ga0265340_10273545 | Ga0265340_102735452 | 81 |
| 352 | 3300031249 | Ga0265339_10037362 | Ga0265339_100373622 | 81 |
| 353 | 3300031250 | Ga0265331_10000779 | Ga0265331_100007798 | 81 |
| 354 | 3300031250 | Ga0265331_10006770 | Ga0265331_100067706 | 81 |
| 355 | 3300031250 | Ga0265331_10570592 | Ga0265331_105705922 | 81 |
| 356 | 3300031251 | Ga0265327_10030492 | Ga0265327_100304923 | 81 |
| 357 | 3300031251 | Ga0265327_10035788 | Ga0265327_100357882 | 81 |
| 358 | 3300031344 | Ga0265316_10203631 | Ga0265316_102036312 | 81 |
| 359 | 3300031344 | Ga0265316_10255847 | Ga0265316_102558472 | 81 |
| 360 | 3300031595 | Ga0265313_10000004 | Ga0265313_1000000415 | 81 |
| 361 | 3300031595 | Ga0265313_10000307 | Ga0265313_1000030739 | 81 |
| 362 | 3300031595 | Ga0265313_10085057 | Ga0265313_100850572 | 81 |
| 363 | 3300031665 | Ga0316575_10173317 | Ga0316575_101733172 | 81 |
| 364 | 3300031665 | Ga0316575_10203702 | Ga0316575_102037022 | 81 |
| 365 | 3300031665 | Ga0316575_10220355 | Ga0316575_102203552 | 81 |
| 366 | 3300031665 | Ga0316575_10265876 | Ga0316575_102658762 | 81 |
| 367 | 3300031665 | Ga0316575_10455210 | Ga0316575_104552102 | 81 |
| 368 | 3300031691 | Ga0316579_10246238 | Ga0316579_102462382 | 81 |
| 369 | 3300031691 | Ga0316579_10308127 | Ga0316579_103081272 | 81 |
| 370 | 3300031691 | Ga0316579_10411020 | Ga0316579_104110202 | 81 |
| 371 | 3300031711 | Ga0265314_10027051 | Ga0265314_100270516 | 81 |
| 372 | 3300031712 | Ga0265342_10162048 | Ga0265342_101620482 | 81 |
| 373 | 3300031712 | Ga0265342_10572170 | Ga0265342_105721702 | 81 |
| 374 | 3300031727 | Ga0316576_10010858 | Ga0316576_100108586 | 81 |
| 375 | 3300031727 | Ga0316576_10020270 | Ga0316576_100202703 | 81 |
| 376 | 3300031727 | Ga0316576_10734913 | Ga0316576_107349132 | 81 |
| 377 | 3300031728 | Ga0316578_10061192 | Ga0316578_100611923 | 81 |
| 378 | 3300031728 | Ga0316578_10098660 | Ga0316578_100986602 | 81 |
| 379 | 3300031728 | Ga0316578_10180290 | Ga0316578_101802903 | 81 |
| 380 | 3300031728 | Ga0316578_10194033 | Ga0316578_101940332 | 81 |
| 381 | 3300031728 | Ga0316578_10543015 | Ga0316578_105430152 | 81 |
| 382 | 3300031733 | Ga0316577_10136968 | Ga0316577_101369682 | 81 |
| 383 | 3300031733 | Ga0316577_10239353 | Ga0316577_102393532 | 81 |
| 384 | 3300032133 | Ga0316583_10006625 | Ga0316583_100066257 | 81 |
| 385 | 3300032133 | Ga0316583_10033634 | Ga0316583_100336342 | 81 |
| 386 | 3300032133 | Ga0316583_10096783 | Ga0316583_100967832 | 81 |
| 387 | 3300032133 | Ga0316583_10166319 | Ga0316583_101663192 | 81 |
| 388 | 3300033547 | Ga0316212_1019979 | Ga0316212_10199792 | 81 |
| 389 | 3300035089 | Ga0373944_0106551 | Ga0373944_0106551_367_612 | 81 |
| 390 | 3300035111 | Ga0373923_0009168 | Ga0373923_0009168_1502_1747 | 81 |
| 391 | 3300035111 | Ga0373923_0087458 | Ga0373923_0087458_506_751 | 81 |
| 392 | 3300035113 | Ga0373936_0117819 | Ga0373936_0117819_47_292 | 81 |
| 393 | 3300035113 | Ga0373936_0532890 | Ga0373936_0532890_141_386 | 81 |
| 394 | 3300035116 | Ga0373945_0156429 | Ga0373945_0156429_172_417 | 81 |
| 395 | 3300035116 | Ga0373945_0471514 | Ga0373945_0471514_110_355 | 81 |
| 396 | 3300035117 | Ga0373953_0138850 | Ga0373953_0138850_597_842 | 81 |
| 397 | 3300035118 | Ga0373954_0094035 | Ga0373954_0094035_498_743 | 81 |
| 398 | 3300035118 | Ga0373954_0225411 | Ga0373954_0225411_484_729 | 81 |
| 399 | 3300035118 | Ga0373954_0325286 | Ga0373954_0325286_376_621 | 81 |
| 400 | 3300035119 | Ga0373956_0201869 | Ga0373956_0201869_432_677 | 81 |
| 401 | 3300035120 | Ga0373957_0012849 | Ga0373957_0012849_1447_1692 | 81 |
| 402 | 3300035170 | Ga0373943_0046938 | Ga0373943_0046938_927_1172 | 81 |
| 403 | 3300035171 | Ga0373946_0070480 | Ga0373946_0070480_206_451 | 81 |
| 404 | 3300035171 | Ga0373946_0153898 | Ga0373946_0153898_262_507 | 81 |
| 405 | 3300035171 | Ga0373946_0248893 | Ga0373946_0248893_507_752 | 81 |
| 406 | 3300035172 | Ga0373955_0467804 | Ga0373955_0467804_79_324 | 81 |
| 407 | 3300035172 | Ga0373955_0963871 | Ga0373955_0963871_248_493 | 81 |
| 408 | 3300035172 | Ga0373955_1010031 | Ga0373955_1010031_136_381 | 81 |
| 409 | 3300035398 | Ga0316574_0001746 | Ga0316574_0001746_8205_8450 | 81 |
| 410 | 3300035398 | Ga0316574_0094639 | Ga0316574_0094639_1275_1520 | 81 |
| 411 | 3300035398 | Ga0316574_0508503 | Ga0316574_0508503_87_332 | 81 |
| 412 | 3300035410 | Ga0373924_0009136 | Ga0373924_0009136_231_476 | 81 |
| 413 | 3300035410 | Ga0373924_0123364 | Ga0373924_0123364_143_388 | 81 |
| 414 | 3300035692 | Ga0373935_0137957 | Ga0373935_0137957_566_811 | 81 |
| 415 | 3300035692 | Ga0373935_0160427 | Ga0373935_0160427_724_969 | 81 |
| 416 | 3300035692 | Ga0373935_0288933 | Ga0373935_0288933_647_892 | 81 |
| 417 | 3300035692 | Ga0373935_0319106 | Ga0373935_0319106_757_1002 | 81 |
| 418 | 3300035695 | Ga0373927_0031570 | Ga0373927_0031570_465_710 | 81 |
| 419 | 3300035695 | Ga0373927_0055459 | Ga0373927_0055459_627_872 | 81 |
| 420 | 3300035695 | Ga0373927_0069006 | Ga0373927_0069006_551_796 | 81 |
| 421 | 3300035695 | Ga0373927_0119582 | Ga0373927_0119582_174_419 | 81 |
| 422 | 3300035695 | Ga0373927_0363663 | Ga0373927_0363663_113_358 | 81 |
| 423 | 3300035695 | Ga0373927_1013880 | Ga0373927_1013880_88_333 | 81 |
| 424 | 3300035724 | Ga0373933_0024422 | Ga0373933_0024422_998_1243 | 81 |
| 425 | 3300035724 | Ga0373933_0062902 | Ga0373933_0062902_1209_1454 | 81 |
| 426 | 3300035724 | Ga0373933_0353156 | Ga0373933_0353156_605_850 | 81 |
| 427 | 3300035724 | Ga0373933_0711746 | Ga0373933_0711746_120_365 | 81 |
| 428 | 3300035725 | Ga0373947_0038699 | Ga0373947_0038699_820_1065 | 81 |
| 429 | 3300035725 | Ga0373947_0119891 | Ga0373947_0119891_433_678 | 81 |
| 430 | 3300035725 | Ga0373947_0148012 | Ga0373947_0148012_1047_1292 | 81 |
| 431 | 3300035725 | Ga0373947_0151364 | Ga0373947_0151364_786_1031 | 81 |
| 432 | 3300035725 | Ga0373947_0257358 | Ga0373947_0257358_101_346 | 81 |
| 433 | 3300036401 | Ga0373937_0031834 | Ga0373937_0031834_1528_1773 | 81 |
| 434 | 3300036401 | Ga0373937_0101263 | Ga0373937_0101263_2155_2400 | 81 |
| 435 | 3300036401 | Ga0373937_0169193 | Ga0373937_0169193_307_552 | 81 |
| 436 | 3300036401 | Ga0373937_0405101 | Ga0373937_0405101_326_571 | 81 |
| 437 | 3300036401 | Ga0373937_1870403 | Ga0373937_1870403_18_263 | 81 |
| 438 | 3300036459 | Ga0372808_019356 | Ga0372808_019356_510_755 | 81 |
| 439 | 3300036647 | Ga0316582_0029049 | Ga0316582_0029049_1020_1265 | 81 |
| 440 | 3300036647 | Ga0316582_0161381 | Ga0316582_0161381_1067_1321 | 81 |
| 441 | 3300036647 | Ga0316582_0278922 | Ga0316582_0278922_207_461 | 81 |
| 442 | 3300036647 | Ga0316582_0352919 | Ga0316582_0352919_215_460 | 81 |
| 443 | 3300036647 | Ga0316582_0982814 | Ga0316582_0982814_211_456 | 81 |
| 444 | 3300036712 | Ga0316584_0028739 | Ga0316584_0028739_3201_3446 | 81 |
| 445 | 3300036712 | Ga0316584_0088042 | Ga0316584_0088042_1973_2218 | 81 |
| 446 | 3300036712 | Ga0316584_0157349 | Ga0316584_0157349_915_1160 | 81 |
| 447 | 3300036712 | Ga0316584_0164529 | Ga0316584_0164529_634_879 | 81 |
| 448 | 3300037068 | Ga0373925_0023549 | Ga0373925_0023549_2247_2492 | 81 |
| 449 | 3300037068 | Ga0373925_0391984 | Ga0373925_0391984_783_1028 | 81 |
| 450 | 3300037068 | Ga0373925_0473539 | Ga0373925_0473539_161_406 | 81 |
| 451 | 3300037312 | Ga0395899_0010671 | Ga0395899_0010671_2858_3103 | 81 |
| 452 | 3300037418 | Ga0395900_0245861 | Ga0395900_0245861_379_624 | 81 |
| 453 | 3300037466 | Ga0395898_0160704 | Ga0395898_0160704_851_1096 | 81 |
| 454 | 3300037471 | Ga0395905_0093980 | Ga0395905_0093980_364_609 | 81 |
| 455 | 3300037471 | Ga0395905_1523401 | Ga0395905_1523401_209_454 | 81 |
| 456 | 3300037471 | Ga0395905_1719761 | Ga0395905_1719761_147_392 | 81 |
| 457 | 3300037853 | Ga0436364_0927232 | Ga0436364_0927232_2647_2892 | 81 |
| 458 | 3300038443 | Ga0395901_0002803 | Ga0395901_0002803_5749_5994 | 81 |
| 459 | 3300038443 | Ga0395901_0866595 | Ga0395901_0866595_124_369 | 81 |
| 460 | 3300039438 | Ga0436360_0144939 | Ga0436360_0144939_781_1026 | 81 |
| 461 | 3300039438 | Ga0436360_0542036 | Ga0436360_0542036_1661_1906 | 81 |
| 462 | 3300039438 | Ga0436360_0648306 | Ga0436360_0648306_23_268 | 81 |
| 463 | 3300039438 | Ga0436360_0731534 | Ga0436360_0731534_80_325 | 81 |
| 464 | 3300039447 | Ga0436361_0736815 | Ga0436361_0736815_943_1188 | 81 |
| 465 | 3300039447 | Ga0436361_0752321 | Ga0436361_0752321_262_507 | 81 |
| 466 | 3300039447 | Ga0436361_0837231 | Ga0436361_0837231_41195_41446 | 81 |
| 467 | 3300039447 | Ga0436361_0851527 | Ga0436361_0851527_1390_1635 | 81 |
| 468 | 3300039447 | Ga0436361_0904970 | Ga0436361_0904970_188_445 | 81 |
| 469 | 3300039447 | Ga0436361_1197906 | Ga0436361_1197906_217_462 | 81 |
| 470 | 3300039450 | Ga0436363_0190844 | Ga0436363_0190844_324_569 | 81 |
| 471 | 3300039450 | Ga0436363_0964032 | Ga0436363_0964032_485_730 | 81 |
| 472 | 3300039453 | Ga0436362_0659311 | Ga0436362_0659311_41_286 | 81 |
| 473 | 3300039453 | Ga0436362_1305803 | Ga0436362_1305803_149_394 | 81 |
| 474 | 3300042876 | Ga0451577_0015231 | Ga0451577_0015231_4136_4387 | 81 |
| 475 | 3300042876 | Ga0451577_0106880 | Ga0451577_0106880_153_404 | 81 |
| 476 | 3300044694 | Ga0466963_0459393 | Ga0466963_0459393_416_664 | 81 |
| 477 | 3300044712 | Ga0453684_0040623 | Ga0453684_0040623_4877_5128 | 81 |
| 478 | 3300044712 | Ga0453684_0104766 | Ga0453684_0104766_1166_1417 | 81 |
| 479 | 3300044712 | Ga0453684_0150574 | Ga0453684_0150574_1173_1427 | 81 |
| 480 | 3300045051 | Ga0451576_0000808 | Ga0451576_0000808_20268_20519 | 81 |
| 481 | 3300046454 | Ga0495592_0078329 | Ga0495592_0078329_218_463 | 81 |
| 482 | 3300046454 | Ga0495592_0112100 | Ga0495592_0112100_1142_1387 | 81 |
| 483 | 3300046454 | Ga0495592_0182319 | Ga0495592_0182319_916_1161 | 81 |
| 484 | 3300046455 | Ga0495603_0060427 | Ga0495603_0060427_1012_1257 | 81 |
| 485 | 3300046455 | Ga0495603_0147520 | Ga0495603_0147520_621_866 | 81 |
| 486 | 3300046459 | Ga0495629_0221762 | Ga0495629_0221762_867_1112 | 81 |
| 487 | 3300046459 | Ga0495629_0270264 | Ga0495629_0270264_169_414 | 81 |
| 488 | 3300046459 | Ga0495629_0426294 | Ga0495629_0426294_255_500 | 81 |
| 489 | 3300046459 | Ga0495629_0472995 | Ga0495629_0472995_523_768 | 81 |
| 490 | 3300046459 | Ga0495629_0729243 | Ga0495629_0729243_237_482 | 81 |
| 491 | 3300046461 | Ga0495641_0318551 | Ga0495641_0318551_354_599 | 81 |
| 492 | 3300046462 | Ga0495651_0168846 | Ga0495651_0168846_770_1015 | 81 |
| 493 | 3300046462 | Ga0495651_0266874 | Ga0495651_0266874_812_1057 | 81 |
| 494 | 3300046462 | Ga0495651_0717537 | Ga0495651_0717537_255_500 | 81 |
| 495 | 3300046462 | Ga0495651_0942236 | Ga0495651_0942236_249_494 | 81 |
| 496 | 3300046463 | Ga0495653_0029496 | Ga0495653_0029496_1564_1809 | 81 |
| 497 | 3300046463 | Ga0495653_0239645 | Ga0495653_0239645_903_1148 | 81 |
| 498 | 3300046472 | Ga0495580_0000504 | Ga0495580_0000504_6489_6734 | 81 |
| 499 | 3300046472 | Ga0495580_0005127 | Ga0495580_0005127_10505_10750 | 81 |
| 500 | 3300046472 | Ga0495580_0303591 | Ga0495580_0303591_548_793 | 81 |
| 501 | 3300046472 | Ga0495580_0756394 | Ga0495580_0756394_334_579 | 81 |
| 502 | 3300046473 | Ga0495582_0476929 | Ga0495582_0476929_369_614 | 81 |
| 503 | 3300046474 | Ga0495605_0116876 | Ga0495605_0116876_231_476 | 81 |
| 504 | 3300046475 | Ga0495639_0105852 | Ga0495639_0105852_55_300 | 81 |
| 505 | 3300046476 | Ga0495662_0289594 | Ga0495662_0289594_467_712 | 81 |
| 506 | 3300046477 | Ga0495664_0002427 | Ga0495664_0002427_8887_9132 | 81 |
| 507 | 3300046477 | Ga0495664_0477806 | Ga0495664_0477806_16_261 | 81 |
| 508 | 3300046499 | Ga0495594_0146123 | Ga0495594_0146123_35_280 | 81 |
| 509 | 3300046499 | Ga0495594_0328823 | Ga0495594_0328823_194_439 | 81 |
| 510 | 3300046500 | Ga0495596_0042961 | Ga0495596_0042961_1472_1720 | 81 |
| 511 | 3300046506 | Ga0495583_0001364 | Ga0495583_0001364_24334_24579 | 81 |
| 512 | 3300046507 | Ga0495606_0541018 | Ga0495606_0541018_47_295 | 81 |
| 513 | 3300046511 | Ga0495608_0215809 | Ga0495608_0215809_761_1006 | 81 |
| 514 | 3300046511 | Ga0495608_0337128 | Ga0495608_0337128_412_657 | 81 |
| 515 | 3300046514 | Ga0495618_0153640 | Ga0495618_0153640_687_932 | 81 |
| 516 | 3300046514 | Ga0495618_0188673 | Ga0495618_0188673_292_537 | 81 |
| 517 | 3300046516 | Ga0495628_0097145 | Ga0495628_0097145_763_1008 | 81 |
| 518 | 3300046516 | Ga0495628_0147194 | Ga0495628_0147194_949_1194 | 81 |
| 519 | 3300046516 | Ga0495628_0222089 | Ga0495628_0222089_447_692 | 81 |
| 520 | 3300046516 | Ga0495628_0810150 | Ga0495628_0810150_360_605 | 81 |
| 521 | 3300046517 | Ga0495630_0102060 | Ga0495630_0102060_1665_1910 | 81 |
| 522 | 3300046517 | Ga0495630_0294538 | Ga0495630_0294538_334_579 | 81 |
| 523 | 3300046517 | Ga0495630_0351579 | Ga0495630_0351579_500_745 | 81 |
| 524 | 3300046524 | Ga0495648_0004401 | Ga0495648_0004401_10722_10967 | 81 |
| 525 | 3300046529 | Ga0495652_0188166 | Ga0495652_0188166_948_1193 | 81 |
| 526 | 3300046529 | Ga0495652_0452091 | Ga0495652_0452091_568_813 | 81 |
| 527 | 3300046529 | Ga0495652_1047039 | Ga0495652_1047039_247_492 | 81 |
| 528 | 3300046531 | Ga0495665_0064832 | Ga0495665_0064832_510_755 | 81 |
| 529 | 3300046531 | Ga0495665_0253751 | Ga0495665_0253751_13_258 | 81 |
| 530 | 3300046531 | Ga0495665_0477396 | Ga0495665_0477396_247_492 | 81 |
| 531 | 3300046531 | Ga0495665_0515284 | Ga0495665_0515284_344_589 | 81 |
| 532 | 3300046533 | Ga0495640_0173167 | Ga0495640_0173167_715_960 | 81 |
| 533 | 3300046533 | Ga0495640_0532254 | Ga0495640_0532254_140_385 | 81 |
| 534 | 3300046533 | Ga0495640_0724839 | Ga0495640_0724839_274_519 | 81 |
| 535 | 3300046533 | Ga0495640_0868146 | Ga0495640_0868146_110_355 | 81 |
| 536 | 3300046536 | Ga0495587_0018799 | Ga0495587_0018799_319_564 | 81 |
| 537 | 3300046536 | Ga0495587_0319087 | Ga0495587_0319087_473_718 | 81 |
| 538 | 3300046536 | Ga0495587_0333747 | Ga0495587_0333747_503_748 | 81 |
| 539 | 3300046543 | Ga0495645_0000754 | Ga0495645_0000754_20351_20596 | 81 |
| 540 | 3300046557 | Ga0495622_0302475 | Ga0495622_0302475_262_507 | 81 |
| 541 | 3300046559 | Ga0495667_0039299 | Ga0495667_0039299_687_932 | 81 |
| 542 | 3300046559 | Ga0495667_0183237 | Ga0495667_0183237_591_836 | 81 |
| 543 | 3300046642 | Ga0495634_0148341 | Ga0495634_0148341_939_1184 | 81 |
| 544 | 3300046642 | Ga0495634_0445336 | Ga0495634_0445336_338_583 | 81 |
| 545 | 3300046642 | Ga0495634_0457300 | Ga0495634_0457300_434_679 | 81 |
| 546 | 3300046642 | Ga0495634_0546552 | Ga0495634_0546552_276_521 | 81 |
| 547 | 3300046648 | Ga0495611_0146897 | Ga0495611_0146897_272_517 | 81 |
| 548 | 3300046663 | Ga0495635_0021829 | Ga0495635_0021829_2393_2638 | 81 |
| 549 | 3300046663 | Ga0495635_0037898 | Ga0495635_0037898_631_876 | 81 |
| 550 | 3300046674 | Ga0495588_0026275 | Ga0495588_0026275_544_789 | 81 |
| 551 | 3300046674 | Ga0495588_0161979 | Ga0495588_0161979_468_713 | 81 |
| 552 | 3300046675 | Ga0495657_0032011 | Ga0495657_0032011_2624_2869 | 81 |
| 553 | 3300046675 | Ga0495657_0351052 | Ga0495657_0351052_519_764 | 81 |
| 554 | 3300046675 | Ga0495657_0482264 | Ga0495657_0482264_17_262 | 81 |
| 555 | 3300046678 | Ga0495599_0135860 | Ga0495599_0135860_417_662 | 81 |
| 556 | 3300046678 | Ga0495599_0674125 | Ga0495599_0674125_156_401 | 81 |
| 557 | 3300046678 | Ga0495599_0868877 | Ga0495599_0868877_26_271 | 81 |
| 558 | 3300046679 | Ga0495623_0169963 | Ga0495623_0169963_601_846 | 81 |
| 559 | 3300046679 | Ga0495623_0181535 | Ga0495623_0181535_841_1086 | 81 |
| 560 | 3300046680 | Ga0495646_0006608 | Ga0495646_0006608_2054_2299 | 81 |
| 561 | 3300046680 | Ga0495646_0239958 | Ga0495646_0239958_574_819 | 81 |
| 562 | 3300046681 | Ga0495647_0297642 | Ga0495647_0297642_469_714 | 81 |
| 563 | 3300046683 | Ga0495658_0513521 | Ga0495658_0513521_176_421 | 81 |
| 564 | 3300046684 | Ga0495669_0015542 | Ga0495669_0015542_2497_2742 | 81 |
| 565 | 3300046689 | Ga0495613_0812280 | Ga0495613_0812280_246_491 | 81 |
| 566 | 3300046690 | Ga0495624_0813887 | Ga0495624_0813887_155_400 | 81 |
| 567 | 3300046809 | Ga0495600_0167752 | Ga0495600_0167752_812_1057 | 81 |
| 568 | 3300047315 | Ga0495581_0035484 | Ga0495581_0035484_1259_1504 | 81 |
| 569 | 3300047315 | Ga0495581_0459631 | Ga0495581_0459631_150_395 | 81 |
| 570 | 3300047317 | Ga0495604_0008864 | Ga0495604_0008864_432_677 | 81 |
| 571 | 3300047317 | Ga0495604_0379506 | Ga0495604_0379506_162_407 | 81 |
| 572 | 3300047317 | Ga0495604_0479532 | Ga0495604_0479532_246_491 | 81 |
| 573 | 3300047319 | Ga0495674_0010027 | Ga0495674_0010027_6747_6992 | 81 |
| 574 | 3300047319 | Ga0495674_0103919 | Ga0495674_0103919_2002_2247 | 81 |
| 575 | 3300047319 | Ga0495674_0136827 | Ga0495674_0136827_1221_1466 | 81 |
| 576 | 3300047319 | Ga0495674_0178131 | Ga0495674_0178131_1322_1567 | 81 |
| 577 | 3300047319 | Ga0495674_0328620 | Ga0495674_0328620_444_689 | 81 |
| 578 | 3300047321 | Ga0495676_0352932 | Ga0495676_0352932_167_412 | 81 |
| 579 | 3300047321 | Ga0495676_0357849 | Ga0495676_0357849_658_903 | 81 |
| 580 | 3300047322 | Ga0495680_0069315 | Ga0495680_0069315_49_294 | 81 |
| 581 | 3300047322 | Ga0495680_0984843 | Ga0495680_0984843_182_427 | 81 |
| 582 | 3300047443 | Ga0495687_005781 | Ga0495687_005781_5396_5644 | 81 |
| 583 | 3300047443 | Ga0495687_009680 | Ga0495687_009680_2840_3085 | 81 |
| 584 | 3300047443 | Ga0495687_066266 | Ga0495687_066266_1030_1275 | 81 |
| 585 | 3300047444 | Ga0495675_0046564 | Ga0495675_0046564_2154_2399 | 81 |
| 586 | 3300047471 | Ga0495684_0042281 | Ga0495684_0042281_165_410 | 81 |
| 587 | 3300047471 | Ga0495684_0178937 | Ga0495684_0178937_893_1138 | 81 |
| 588 | 3300047471 | Ga0495684_0244006 | Ga0495684_0244006_713_958 | 81 |
| 589 | 3300047471 | Ga0495684_0363105 | Ga0495684_0363105_365_610 | 81 |
| 590 | 3300047471 | Ga0495684_0583347 | Ga0495684_0583347_88_333 | 81 |
| 591 | 3300047472 | Ga0495686_0000499 | Ga0495686_0000499_7746_7991 | 81 |
| 592 | 3300047673 | Ga0495593_0202778 | Ga0495593_0202778_138_383 | 81 |
| 593 | 3300047673 | Ga0495593_0610198 | Ga0495593_0610198_76_321 | 81 |
| 594 | 3300048088 | Ga0495602_0070310 | Ga0495602_0070310_2381_2626 | 81 |
| 595 | 3300048088 | Ga0495602_0108218 | Ga0495602_0108218_999_1244 | 81 |
| 596 | 3300048088 | Ga0495602_0145910 | Ga0495602_0145910_1415_1660 | 81 |
| 597 | 3300048089 | Ga0495614_0309035 | Ga0495614_0309035_408_653 | 81 |
| 598 | 3300048908 | Ga0496105_1079200 | Ga0496105_1079200_150_395 | 81 |
| 599 | 3300048911 | Ga0496108_1385693 | Ga0496108_1385693_142_387 | 81 |
| 600 | 3300048920 | Ga0496117_0103022 | Ga0496117_0103022_1101_1349 | 81 |
| 601 | 3300048921 | Ga0496118_0090560 | Ga0496118_0090560_1078_1326 | 81 |
| 602 | 3300048922 | Ga0496119_0022311 | Ga0496119_0022311_1829_2074 | 81 |
| 603 | 3300048924 | Ga0496121_0046238 | Ga0496121_0046238_274_519 | 81 |
| 604 | 3300048929 | Ga0496126_0206489 | Ga0496126_0206489_701_946 | 81 |
| 605 | 3300049460 | Ga0495682_0015102 | Ga0495682_0015102_880_1125 | 81 |
| 606 | 3300049460 | Ga0495682_0033898 | Ga0495682_0033898_810_1055 | 81 |
| 607 | 3300049568 | Ga0501031_0006639 | Ga0501031_0006639_3982_4227 | 81 |
| 608 | 3300049569 | Ga0501032_0017201 | Ga0501032_0017201_2306_2551 | 81 |
| 609 | 3300049569 | Ga0501032_0609756 | Ga0501032_0609756_243_491 | 81 |
| 610 | 3300049570 | Ga0501033_0007595 | Ga0501033_0007595_5371_5619 | 81 |
| 611 | 3300049571 | Ga0501034_0025367 | Ga0501034_0025367_4262_4507 | 81 |
| 612 | 3300049571 | Ga0501034_0768301 | Ga0501034_0768301_223_477 | 81 |
| 613 | 3300049572 | Ga0501036_0003103 | Ga0501036_0003103_5803_6048 | 81 |
| 614 | 3300049572 | Ga0501036_0030488 | Ga0501036_0030488_2052_2300 | 81 |
| 615 | 3300049573 | Ga0501037_0015201 | Ga0501037_0015201_1251_1496 | 81 |
| 616 | 3300049573 | Ga0501037_0730838 | Ga0501037_0730838_203_451 | 81 |
| 617 | 3300049574 | Ga0501038_0004358 | Ga0501038_0004358_5830_6075 | 81 |
| 618 | 3300049575 | Ga0501039_0022878 | Ga0501039_0022878_1548_1793 | 81 |
| 619 | 3300049578 | Ga0501042_0219059 | Ga0501042_0219059_51_299 | 81 |
| 620 | 3300049578 | Ga0501042_0715256 | Ga0501042_0715256_366_620 | 81 |
| 621 | 3300049579 | Ga0501043_0010559 | Ga0501043_0010559_2528_2773 | 81 |
| 622 | 3300049579 | Ga0501043_0324680 | Ga0501043_0324680_865_1113 | 81 |
| 623 | 3300049579 | Ga0501043_1064210 | Ga0501043_1064210_151_408 | 81 |
| 624 | 3300049580 | Ga0501046_0186916 | Ga0501046_0186916_1003_1251 | 81 |
| 625 | 3300049581 | Ga0501047_0002578 | Ga0501047_0002578_5830_6075 | 81 |
| 626 | 3300049581 | Ga0501047_0010564 | Ga0501047_0010564_5054_5302 | 81 |
| 627 | 3300049581 | Ga0501047_0015643 | Ga0501047_0015643_3864_4118 | 81 |
| 628 | 3300049582 | Ga0501048_1157391 | Ga0501048_1157391_143_388 | 81 |
| 629 | 3300049583 | Ga0501067_0262872 | Ga0501067_0262872_604_849 | 81 |
| 630 | 3300049584 | Ga0501068_0452375 | Ga0501068_0452375_402_650 | 81 |
| 631 | 3300049586 | Ga0501070_0122956 | Ga0501070_0122956_650_895 | 81 |
| 632 | 3300049590 | Ga0501074_0168477 | Ga0501074_0168477_41_295 | 81 |
| 633 | 3300049741 | Ga0501079_0215173 | Ga0501079_0215173_35_280 | 81 |
| 634 | 3300049742 | Ga0501080_0064466 | Ga0501080_0064466_632_886 | 81 |
| 635 | 3300049822 | Ga0501035_0001099 | Ga0501035_0001099_13758_14006 | 81 |
| 636 | 3300049822 | Ga0501035_0017403 | Ga0501035_0017403_3977_4222 | 81 |
| 637 | 3300049822 | Ga0501035_0244250 | Ga0501035_0244250_766_1020 | 81 |
| 638 | 3300049823 | Ga0501044_0007760 | Ga0501044_0007760_7096_7341 | 81 |
| 639 | 3300049823 | Ga0501044_0052993 | Ga0501044_0052993_3494_3748 | 81 |
| 640 | 3300049823 | Ga0501044_0109453 | Ga0501044_0109453_2078_2326 | 81 |
| 641 | 3300049823 | Ga0501044_0529057 | Ga0501044_0529057_158_412 | 81 |
| 642 | 3300049824 | Ga0501045_0402347 | Ga0501045_0402347_187_432 | 81 |
| 643 | 3300050510 | nmdc:mga06r32_367815_c1 | nmdc:mga06r32_367815_c1_1131_1382 | 81 |
| 644 | 3300053077 | Ga0495601_0012200 | Ga0495601_0012200_2547_2792 | 81 |
| 645 | 3300053077 | Ga0495601_0012522 | Ga0495601_0012522_1701_1946 | 81 |
| 646 | 3300053077 | Ga0495601_0368483 | Ga0495601_0368483_443_688 | 81 |
| 647 | 3300053077 | Ga0495601_0895898 | Ga0495601_0895898_214_459 | 81 |
| 648 | 3300053078 | Ga0495612_0026068 | Ga0495612_0026068_1527_1772 | 81 |
| 649 | 3300053078 | Ga0495612_0373922 | Ga0495612_0373922_387_632 | 81 |
| 650 | 3300053084 | Ga0495595_0025655 | Ga0495595_0025655_1877_2122 | 81 |
| 651 | 3300053084 | Ga0495595_0126940 | Ga0495595_0126940_630_875 | 81 |
| 652 | 3300053084 | Ga0495595_0370794 | Ga0495595_0370794_379_624 | 81 |
| 653 | 3300053085 | Ga0495619_0046991 | Ga0495619_0046991_1992_2237 | 81 |
| 654 | 3300053085 | Ga0495619_0146882 | Ga0495619_0146882_141_386 | 81 |
| 655 | 3300053085 | Ga0495619_0197525 | Ga0495619_0197525_828_1073 | 81 |
| 656 | 3300053085 | Ga0495619_0413811 | Ga0495619_0413811_198_443 | 81 |
| 657 | 3300053085 | Ga0495619_0642135 | Ga0495619_0642135_94_339 | 81 |
| 658 | 3300053111 | Ga0500572_070805 | Ga0500572_070805_387_632 | 81 |
| 659 | 3300053119 | Ga0500595_001486 | Ga0500595_001486_6581_6826 | 81 |
| 660 | 3300053119 | Ga0500595_001857 | Ga0500595_001857_8617_8862 | 81 |
| 661 | 3300053125 | Ga0500618_018374 | Ga0500618_018374_129_374 | 81 |
| 662 | 3300053141 | Ga0500574_126183 | Ga0500574_126183_488_742 | 81 |
| 663 | 3300053162 | Ga0500638_085297 | Ga0500638_085297_818_1063 | 81 |
| 664 | 3300053177 | Ga0500636_0012159 | Ga0500636_0012159_1254_1499 | 81 |
| 665 | 3300053177 | Ga0500636_0516556 | Ga0500636_0516556_84_329 | 81 |
| 666 | 3300054114 | Ga0501084_0600090 | Ga0501084_0600090_621_866 | 81 |
| 667 | 3300054114 | Ga0501084_0811074 | Ga0501084_0811074_490_735 | 81 |
| 668 | 3300060353 | Ga0501082_0058567 | Ga0501082_0058567_3020_3265 | 81 |
| 669 | 3300060353 | Ga0501082_0481970 | Ga0501082_0481970_683_928 | 81 |
| 670 | 3300002067 | JGI24735J21928_10012626 | JGI24735J21928_100126263 | 82 |
| 671 | 3300002705 | JGI25156J39149_1001045 | JGI25156J39149_10010456 | 82 |
| 672 | 3300003856 | Ga0058692_1048516 | Ga0058692_10485161 | 82 |
| 673 | 3300005327 | Ga0070658_11981165 | Ga0070658_119811652 | 82 |
| 674 | 3300005339 | Ga0070660_100325593 | Ga0070660_1003255932 | 82 |
| 675 | 3300013105 | Ga0157369_10084062 | Ga0157369_100840622 | 82 |
| 676 | 3300025256 | Ga0209759_1000002 | Ga0209759_1000002196 | 82 |
| 677 | 3300025904 | Ga0207647_10206137 | Ga0207647_102061372 | 82 |
| 678 | 3300027312 | Ga0209371_1008061 | Ga0209371_10080613 | 82 |
| 679 | 3300030500 | Ga0268256_1008346 | Ga0268256_10083466 | 82 |
| 680 | 3300036712 | Ga0316584_0321703 | Ga0316584_0321703_10_306 | 82 |
| 681 | 3300044684 | Ga0466966_0008834 | Ga0466966_0008834_1354_1602 | 82 |
| 682 | 3300045049 | Ga0466959_0179194 | Ga0466959_0179194_1141_1389 | 82 |
| 683 | 3300046454 | Ga0495592_0064883 | Ga0495592_0064883_424_672 | 82 |
| 684 | 3300046454 | Ga0495592_0183880 | Ga0495592_0183880_572_820 | 82 |
| 685 | 3300046455 | Ga0495603_0020696 | Ga0495603_0020696_3313_3561 | 82 |
| 686 | 3300046458 | Ga0495591_001164 | Ga0495591_001164_5454_5702 | 82 |
| 687 | 3300046459 | Ga0495629_0000224 | Ga0495629_0000224_25371_25619 | 82 |
| 688 | 3300046459 | Ga0495629_0030963 | Ga0495629_0030963_2988_3236 | 82 |
| 689 | 3300046459 | Ga0495629_0044380 | Ga0495629_0044380_2485_2733 | 82 |
| 690 | 3300046462 | Ga0495651_0065168 | Ga0495651_0065168_595_843 | 82 |
| 691 | 3300046462 | Ga0495651_0285207 | Ga0495651_0285207_217_465 | 82 |
| 692 | 3300046462 | Ga0495651_0440528 | Ga0495651_0440528_159_407 | 82 |
| 693 | 3300046463 | Ga0495653_0001276 | Ga0495653_0001276_451_699 | 82 |
| 694 | 3300046463 | Ga0495653_0016018 | Ga0495653_0016018_1492_1740 | 82 |
| 695 | 3300046463 | Ga0495653_0047485 | Ga0495653_0047485_2227_2475 | 82 |
| 696 | 3300046463 | Ga0495653_0059105 | Ga0495653_0059105_1594_1842 | 82 |
| 697 | 3300046463 | Ga0495653_0170550 | Ga0495653_0170550_238_486 | 82 |
| 698 | 3300046463 | Ga0495653_0248820 | Ga0495653_0248820_241_489 | 82 |
| 699 | 3300046472 | Ga0495580_0000135 | Ga0495580_0000135_23003_23251 | 82 |
| 700 | 3300046472 | Ga0495580_0000499 | Ga0495580_0000499_7765_8013 | 82 |
| 701 | 3300046472 | Ga0495580_0001710 | Ga0495580_0001710_4212_4460 | 82 |
| 702 | 3300046472 | Ga0495580_0004368 | Ga0495580_0004368_4439_4687 | 82 |
| 703 | 3300046472 | Ga0495580_0024320 | Ga0495580_0024320_3217_3465 | 82 |
| 704 | 3300046473 | Ga0495582_0014651 | Ga0495582_0014651_3870_4118 | 82 |
| 705 | 3300046474 | Ga0495605_0344199 | Ga0495605_0344199_263_511 | 82 |
| 706 | 3300046476 | Ga0495662_0141088 | Ga0495662_0141088_374_622 | 82 |
| 707 | 3300046477 | Ga0495664_0028960 | Ga0495664_0028960_922_1170 | 82 |
| 708 | 3300046477 | Ga0495664_0134784 | Ga0495664_0134784_434_682 | 82 |
| 709 | 3300046477 | Ga0495664_0461315 | Ga0495664_0461315_50_298 | 82 |
| 710 | 3300046477 | Ga0495664_0855252 | Ga0495664_0855252_259_507 | 82 |
| 711 | 3300046500 | Ga0495596_0003395 | Ga0495596_0003395_7566_7814 | 82 |
| 712 | 3300046500 | Ga0495596_0015530 | Ga0495596_0015530_2627_2875 | 82 |
| 713 | 3300046501 | Ga0495607_0271351 | Ga0495607_0271351_287_535 | 82 |
| 714 | 3300046507 | Ga0495606_0346496 | Ga0495606_0346496_313_561 | 82 |
| 715 | 3300046511 | Ga0495608_0007305 | Ga0495608_0007305_1722_1970 | 82 |
| 716 | 3300046511 | Ga0495608_0400756 | Ga0495608_0400756_25_273 | 82 |
| 717 | 3300046512 | Ga0495610_0283122 | Ga0495610_0283122_107_355 | 82 |
| 718 | 3300046514 | Ga0495618_0034216 | Ga0495618_0034216_976_1224 | 82 |
| 719 | 3300046514 | Ga0495618_0240994 | Ga0495618_0240994_785_1033 | 82 |
| 720 | 3300046514 | Ga0495618_0522974 | Ga0495618_0522974_436_684 | 82 |
| 721 | 3300046516 | Ga0495628_0000239 | Ga0495628_0000239_23210_23458 | 82 |
| 722 | 3300046516 | Ga0495628_0027720 | Ga0495628_0027720_1412_1660 | 82 |
| 723 | 3300046516 | Ga0495628_0036523 | Ga0495628_0036523_975_1223 | 82 |
| 724 | 3300046516 | Ga0495628_0047333 | Ga0495628_0047333_730_978 | 82 |
| 725 | 3300046516 | Ga0495628_0140593 | Ga0495628_0140593_1492_1740 | 82 |
| 726 | 3300046516 | Ga0495628_0184400 | Ga0495628_0184400_85_333 | 82 |
| 727 | 3300046516 | Ga0495628_0551019 | Ga0495628_0551019_568_816 | 82 |
| 728 | 3300046517 | Ga0495630_0017807 | Ga0495630_0017807_1114_1362 | 82 |
| 729 | 3300046517 | Ga0495630_0091976 | Ga0495630_0091976_99_347 | 82 |
| 730 | 3300046517 | Ga0495630_0395624 | Ga0495630_0395624_591_839 | 82 |
| 731 | 3300046524 | Ga0495648_0001136 | Ga0495648_0001136_18719_18967 | 82 |
| 732 | 3300046524 | Ga0495648_0148595 | Ga0495648_0148595_524_772 | 82 |
| 733 | 3300046526 | Ga0495666_0000487 | Ga0495666_0000487_12941_13189 | 82 |
| 734 | 3300046526 | Ga0495666_0016000 | Ga0495666_0016000_2515_2763 | 82 |
| 735 | 3300046528 | Ga0495642_0344342 | Ga0495642_0344342_210_458 | 82 |
| 736 | 3300046529 | Ga0495652_0038325 | Ga0495652_0038325_478_726 | 82 |
| 737 | 3300046529 | Ga0495652_0050070 | Ga0495652_0050070_1083_1331 | 82 |
| 738 | 3300046529 | Ga0495652_0193913 | Ga0495652_0193913_244_492 | 82 |
| 739 | 3300046529 | Ga0495652_0328439 | Ga0495652_0328439_602_850 | 82 |
| 740 | 3300046529 | Ga0495652_0417073 | Ga0495652_0417073_177_425 | 82 |
| 741 | 3300046529 | Ga0495652_0534217 | Ga0495652_0534217_70_318 | 82 |
| 742 | 3300046531 | Ga0495665_0005475 | Ga0495665_0005475_499_747 | 82 |
| 743 | 3300046531 | Ga0495665_0006209 | Ga0495665_0006209_5791_6039 | 82 |
| 744 | 3300046531 | Ga0495665_0010943 | Ga0495665_0010943_3581_3829 | 82 |
| 745 | 3300046531 | Ga0495665_0138740 | Ga0495665_0138740_115_363 | 82 |
| 746 | 3300046533 | Ga0495640_0011229 | Ga0495640_0011229_801_1049 | 82 |
| 747 | 3300046536 | Ga0495587_0014987 | Ga0495587_0014987_159_407 | 82 |
| 748 | 3300046543 | Ga0495645_0205304 | Ga0495645_0205304_545_793 | 82 |
| 749 | 3300046543 | Ga0495645_0314352 | Ga0495645_0314352_579_827 | 82 |
| 750 | 3300046663 | Ga0495635_0009807 | Ga0495635_0009807_3729_3977 | 82 |
| 751 | 3300046663 | Ga0495635_0193818 | Ga0495635_0193818_582_830 | 82 |
| 752 | 3300046665 | Ga0495661_0005589 | Ga0495661_0005589_8573_8821 | 82 |
| 753 | 3300046675 | Ga0495657_0248856 | Ga0495657_0248856_310_558 | 82 |
| 754 | 3300046678 | Ga0495599_0054477 | Ga0495599_0054477_1507_1755 | 82 |
| 755 | 3300046678 | Ga0495599_0085779 | Ga0495599_0085779_1240_1488 | 82 |
| 756 | 3300046678 | Ga0495599_0096892 | Ga0495599_0096892_1043_1291 | 82 |
| 757 | 3300046678 | Ga0495599_0323710 | Ga0495599_0323710_98_346 | 82 |
| 758 | 3300046679 | Ga0495623_0013273 | Ga0495623_0013273_4279_4527 | 82 |
| 759 | 3300046679 | Ga0495623_0014499 | Ga0495623_0014499_3584_3832 | 82 |
| 760 | 3300046679 | Ga0495623_0072737 | Ga0495623_0072737_131_379 | 82 |
| 761 | 3300046679 | Ga0495623_0147517 | Ga0495623_0147517_669_917 | 82 |
| 762 | 3300046680 | Ga0495646_0000222 | Ga0495646_0000222_24887_25135 | 82 |
| 763 | 3300046680 | Ga0495646_0079798 | Ga0495646_0079798_468_716 | 82 |
| 764 | 3300046680 | Ga0495646_0123859 | Ga0495646_0123859_119_367 | 82 |
| 765 | 3300046680 | Ga0495646_0238250 | Ga0495646_0238250_184_432 | 82 |
| 766 | 3300046680 | Ga0495646_0245759 | Ga0495646_0245759_607_855 | 82 |
| 767 | 3300046680 | Ga0495646_0408915 | Ga0495646_0408915_65_313 | 82 |
| 768 | 3300046680 | Ga0495646_0428558 | Ga0495646_0428558_345_593 | 82 |
| 769 | 3300046684 | Ga0495669_0335005 | Ga0495669_0335005_246_494 | 82 |
| 770 | 3300046689 | Ga0495613_0018488 | Ga0495613_0018488_4390_4638 | 82 |
| 771 | 3300046689 | Ga0495613_0140933 | Ga0495613_0140933_450_698 | 82 |
| 772 | 3300046690 | Ga0495624_0000059 | Ga0495624_0000059_47625_47873 | 82 |
| 773 | 3300046690 | Ga0495624_0000062 | Ga0495624_0000062_42778_43026 | 82 |
| 774 | 3300046690 | Ga0495624_0001465 | Ga0495624_0001465_9329_9577 | 82 |
| 775 | 3300046690 | Ga0495624_0057616 | Ga0495624_0057616_601_849 | 82 |
| 776 | 3300046690 | Ga0495624_0749776 | Ga0495624_0749776_297_545 | 82 |
| 777 | 3300046694 | Ga0495649_0298907 | Ga0495649_0298907_213_461 | 82 |
| 778 | 3300046794 | Ga0495589_0074052 | Ga0495589_0074052_975_1223 | 82 |
| 779 | 3300046809 | Ga0495600_0001170 | Ga0495600_0001170_8538_8786 | 82 |
| 780 | 3300047315 | Ga0495581_0012606 | Ga0495581_0012606_532_780 | 82 |
| 781 | 3300047317 | Ga0495604_0010050 | Ga0495604_0010050_2421_2669 | 82 |
| 782 | 3300047317 | Ga0495604_0026749 | Ga0495604_0026749_3885_4133 | 82 |
| 783 | 3300047317 | Ga0495604_0041177 | Ga0495604_0041177_3116_3364 | 82 |
| 784 | 3300047317 | Ga0495604_0154744 | Ga0495604_0154744_271_519 | 82 |
| 785 | 3300047317 | Ga0495604_0164679 | Ga0495604_0164679_1226_1474 | 82 |
| 786 | 3300047317 | Ga0495604_0462625 | Ga0495604_0462625_139_387 | 82 |
| 787 | 3300047319 | Ga0495674_0000180 | Ga0495674_0000180_24892_25140 | 82 |
| 788 | 3300047319 | Ga0495674_0000653 | Ga0495674_0000653_19603_19851 | 82 |
| 789 | 3300047319 | Ga0495674_0181869 | Ga0495674_0181869_468_716 | 82 |
| 790 | 3300047319 | Ga0495674_1297144 | Ga0495674_1297144_236_484 | 82 |
| 791 | 3300047320 | Ga0495672_0017205 | Ga0495672_0017205_2804_3052 | 82 |
| 792 | 3300047321 | Ga0495676_0020488 | Ga0495676_0020488_5438_5686 | 82 |
| 793 | 3300047321 | Ga0495676_1030456 | Ga0495676_1030456_246_494 | 82 |
| 794 | 3300047322 | Ga0495680_0004928 | Ga0495680_0004928_5884_6132 | 82 |
| 795 | 3300047322 | Ga0495680_0174356 | Ga0495680_0174356_740_988 | 82 |
| 796 | 3300047322 | Ga0495680_0282944 | Ga0495680_0282944_674_922 | 82 |
| 797 | 3300047323 | Ga0495683_0010872 | Ga0495683_0010872_2526_2774 | 82 |
| 798 | 3300047323 | Ga0495683_0032629 | Ga0495683_0032629_2119_2367 | 82 |
| 799 | 3300047444 | Ga0495675_0003245 | Ga0495675_0003245_6927_7175 | 82 |
| 800 | 3300047444 | Ga0495675_0006619 | Ga0495675_0006619_637_885 | 82 |
| 801 | 3300047444 | Ga0495675_0016676 | Ga0495675_0016676_3391_3639 | 82 |
| 802 | 3300047444 | Ga0495675_0056982 | Ga0495675_0056982_1416_1664 | 82 |
| 803 | 3300047446 | Ga0495679_006739 | Ga0495679_006739_4071_4319 | 82 |
| 804 | 3300047446 | Ga0495679_058952 | Ga0495679_058952_622_870 | 82 |
| 805 | 3300047469 | Ga0495673_0002923 | Ga0495673_0002923_5813_6061 | 82 |
| 806 | 3300047469 | Ga0495673_0025407 | Ga0495673_0025407_364_612 | 82 |
| 807 | 3300047469 | Ga0495673_0253560 | Ga0495673_0253560_376_624 | 82 |
| 808 | 3300047471 | Ga0495684_0503455 | Ga0495684_0503455_90_338 | 82 |
| 809 | 3300047472 | Ga0495686_0000521 | Ga0495686_0000521_8683_8931 | 82 |
| 810 | 3300047673 | Ga0495593_0000061 | Ga0495593_0000061_20201_20449 | 82 |
| 811 | 3300047673 | Ga0495593_0002226 | Ga0495593_0002226_4391_4639 | 82 |
| 812 | 3300047673 | Ga0495593_0010081 | Ga0495593_0010081_504_752 | 82 |
| 813 | 3300047673 | Ga0495593_0024000 | Ga0495593_0024000_1208_1456 | 82 |
| 814 | 3300047673 | Ga0495593_0654726 | Ga0495593_0654726_236_484 | 82 |
| 815 | 3300048088 | Ga0495602_0004522 | Ga0495602_0004522_13989_14237 | 82 |
| 816 | 3300048088 | Ga0495602_0030437 | Ga0495602_0030437_853_1101 | 82 |
| 817 | 3300048088 | Ga0495602_0047951 | Ga0495602_0047951_2940_3188 | 82 |
| 818 | 3300048088 | Ga0495602_0152847 | Ga0495602_0152847_1471_1719 | 82 |
| 819 | 3300048088 | Ga0495602_0231449 | Ga0495602_0231449_840_1088 | 82 |
| 820 | 3300048088 | Ga0495602_0456647 | Ga0495602_0456647_595_843 | 82 |
| 821 | 3300048089 | Ga0495614_0006086 | Ga0495614_0006086_602_850 | 82 |
| 822 | 3300048089 | Ga0495614_0081348 | Ga0495614_0081348_642_890 | 82 |
| 823 | 3300048089 | Ga0495614_0103336 | Ga0495614_0103336_534_782 | 82 |
| 824 | 3300048091 | Ga0495626_0077944 | Ga0495626_0077944_862_1110 | 82 |
| 825 | 3300048920 | Ga0496117_0561659 | Ga0496117_0561659_282_530 | 82 |
| 826 | 3300048929 | Ga0496126_0001810 | Ga0496126_0001810_17071_17319 | 82 |
| 827 | 3300049460 | Ga0495682_0072340 | Ga0495682_0072340_660_908 | 82 |
| 828 | 3300049571 | Ga0501034_1577050 | Ga0501034_1577050_206_454 | 82 |
| 829 | 3300049742 | Ga0501080_1005796 | Ga0501080_1005796_137_385 | 82 |
| 830 | 3300049744 | Ga0501083_0004207 | Ga0501083_0004207_6926_7174 | 82 |
| 831 | 3300049744 | Ga0501083_0756369 | Ga0501083_0756369_329_577 | 82 |
| 832 | 3300054114 | Ga0501084_1620411 | Ga0501084_1620411_43_291 | 82 |
| 833 | 3300060353 | Ga0501082_0142241 | Ga0501082_0142241_878_1126 | 82 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6tmk-assembly1.cif.gz_H1 | cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, composite model | 0.921 | 8 | 76 |
| 3zo6-assembly1.cif.gz_L | crystal structure of bacillus pseudofirmus of4 mutant atp synthase c12 ring. | 0.9035 | 13 | 75 |
| 6tmk-assembly1.cif.gz_I1 | cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, composite model | 0.9005 | 8 | 76 |
| 8ap6-assembly1.cif.gz_R1 | trypanosoma brucei mitochondrial f1fo atp synthase dimer | 0.9005 | 9 | 76 |
| 4cbk-assembly1.cif.gz_B | the c-ring ion binding site of the atp synthase from bacillus pseudofirmus of4 is adapted to alkaliphilic cell physiology | 0.8967 | 9 | 75 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54QG0_308_769_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9819 | 24 | 64 | 3.90.550.10 |
| 5jg7B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9611 | 24 | 63 | 3.40.50.1980 |
| 2x2vA00 | Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C | 0.9181 | 13 | 75 | 1.20.20.10 |
| 2x2vC00 | Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C | 0.9174 | 13 | 75 | 1.20.20.10 |
| 2x2vB00 | Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C | 0.916 | 13 | 75 | 1.20.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7YE35-F1-model_v4 | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) | 0.9598 | 13 | 74 |
GO:0005886
GO:0008289 GO:0045263 GO:0046933 |
| AF-A0A2E5G5R3-F1-model_v4 | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) | 0.9439 | 9 | 74 |
GO:0005886
GO:0008289 GO:0045263 GO:0046933 |
| AF-A0A5F1Z1U5-F1-model_v4 | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) | 0.9403 | 6 | 74 |
GO:0005886
GO:0008289 GO:0045263 GO:0046933 |
| AF-A0A7Y5BL28-F1-model_v4 | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) | 0.9395 | 6 | 74 |
GO:0005886
GO:0008289 GO:0045263 GO:0046933 |
| AF-V6HDU3-F1-model_v4 | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) | 0.9351 | 6 | 74 |
GO:0005886
GO:0008289 GO:0045263 GO:0046933 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar