F482711

General Info

Members Datasets Scaffolds Average Seq Length
832 256 815 81

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100059117|Ga0070714_1000591176
Length 88
Sequence MDSGQLTAVLIVGMIMMASIVRARYGYSRLGRFRRYRGDIGPPPEQNSENLRLRDEVKELKERIKVLERITVDKENSLANEIESLRDR

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
178 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
179 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
183 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
194 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
195 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
198 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
199 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
200 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
201 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
202 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
225 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
226 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
232 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
233 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
234 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
235 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
236 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
237 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
238 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
239 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
240 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
241 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
242 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
243 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
244 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
245 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
246 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
247 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
248 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
249 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
250 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
251 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
252 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.68
Rhizosphere 97.96
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1021267 3300001904 Bacteria 1017
2 JGI24741J21665_1003236 3300001915 Bacteria 3947
3 JGI24741J21665_1005189 3300001915 Bacteria 2766
4 JGI24741J21665_1033965 3300001915 Bacteria 759
5 JGI24741J21665_1035295 3300001915 Unclassified 743
6 JGI24740J21852_10006386 3300001979 Bacteria 4887
7 JGI24740J21852_10008822 3300001979 Bacteria 3996
8 JGI24740J21852_10010449 3300001979 Bacteria 3573
9 JGI24740J21852_10018367 3300001979 Unclassified 2482
10 JGI24739J22299_10000378 3300001989 Bacteria 15359
11 JGI24739J22299_10030758 3300001989 Bacteria 1860
12 JGI24739J22299_10031244 3300001989 Bacteria 1841
13 JGI24739J22299_10077429 3300001989 Bacteria 1025
14 JGI24737J22298_10000438 3300001990 Bacteria 14246
15 JGI24737J22298_10001931 3300001990 Bacteria 7414
16 JGI24737J22298_10024715 3300001990 Bacteria 1902
17 JGI24737J22298_10035882 3300001990 Bacteria 1533
18 JGI24737J22298_10266458 3300001990 Unclassified 507
19 JGI24735J21928_10000581 3300002067 Bacteria 12847
20 JGI24735J21928_10006779 3300002067 Bacteria 3755
21 JGI24735J21928_10069705 3300002067 Unclassified 1007
22 JGI24738J21930_10003426 3300002075 Bacteria 4002
23 JGI24738J21930_10012231 3300002075 Bacteria 1875
24 JGI24744J21845_10075494 3300002077 Unclassified 615
25 Ga0058861_10696430 3300004800 Bacteria 625
26 Ga0065712_10095813 3300005290 Bacteria 2190
27 Ga0065715_10429166 3300005293 Bacteria 849
28 Ga0065715_10826821 3300005293 Unclassified 600
29 Ga0070658_10003530 3300005327 Bacteria 12834
30 Ga0070658_10003538 3300005327 Bacteria 12823
31 Ga0070658_10004563 3300005327 Bacteria 11255
32 Ga0070658_10041796 3300005327 Bacteria 3698
33 Ga0070658_10068698 3300005327 Bacteria 2897
34 Ga0070658_10078114 3300005327 Bacteria 2716
35 Ga0070658_10137400 3300005327 Bacteria 2040
36 Ga0070658_10270541 3300005327 Bacteria 1445
37 Ga0070658_10419631 3300005327 Bacteria 1150
38 Ga0070658_10421098 3300005327 Bacteria 1148
39 Ga0070676_10005815 3300005328 Bacteria 6575
40 Ga0070676_10742058 3300005328 Bacteria 720
41 Ga0070676_11030101 3300005328 Archaea 619
42 Ga0070683_100005945 3300005329 Bacteria 10211
43 Ga0070683_100035499 3300005329 Bacteria 4557
44 Ga0070683_100180550 3300005329 Bacteria 2003
45 Ga0070683_100278105 3300005329 Bacteria 1592
46 Ga0070683_100294696 3300005329 Bacteria 1543
47 Ga0070683_100382418 3300005329 Bacteria 1341
48 Ga0070683_100729113 3300005329 Bacteria 949
49 Ga0070683_101400995 3300005329 Unclassified 672
50 Ga0070683_102194634 3300005329 Bacteria 530
51 Ga0070690_100158398 3300005330 Bacteria 1549
52 Ga0070690_100643257 3300005330 Bacteria 809
53 Ga0070670_100002725 3300005331 Bacteria 14599
54 Ga0070670_100034717 3300005331 Bacteria 4340
55 Ga0070670_101028748 3300005331 Bacteria 750
56 Ga0070677_10027587 3300005333 Bacteria 2139
57 Ga0070666_10000623 3300005335 Bacteria 21258
58 Ga0070666_10033780 3300005335 Bacteria 3387
59 Ga0070666_10410738 3300005335 Bacteria 974
60 Ga0070680_100031873 3300005336 Bacteria 4238
61 Ga0070680_100125730 3300005336 Bacteria 2142
62 Ga0070680_100482373 3300005336 Bacteria 1060
63 Ga0070680_100545601 3300005336 Bacteria 993
64 Ga0070680_100651464 3300005336 Bacteria 905
65 Ga0070680_100953154 3300005336 Bacteria 741
66 Ga0070680_101134350 3300005336 Bacteria 676
67 Ga0070680_101260833 3300005336 Unclassified 639
68 Ga0070682_100025859 3300005337 Bacteria 3507
69 Ga0070682_100068961 3300005337 Bacteria 2257
70 Ga0070682_100098702 3300005337 Bacteria 1924
71 Ga0070682_101628977 3300005337 Bacteria 559
72 Ga0068868_100006361 3300005338 Bacteria 8354
73 Ga0068868_100040249 3300005338 Bacteria 3637
74 Ga0068868_100243073 3300005338 Bacteria 1513
75 Ga0070660_100000560 3300005339 Bacteria 24966
76 Ga0070660_100013726 3300005339 Bacteria 5823
77 Ga0070660_100046154 3300005339 Bacteria 3338
78 Ga0070660_100052691 3300005339 Bacteria 3137
79 Ga0070660_100063778 3300005339 Bacteria 2864
80 Ga0070660_100095812 3300005339 Bacteria 2346
81 Ga0070660_100355773 3300005339 Bacteria 1206
82 Ga0070660_100375345 3300005339 Bacteria 1173
83 Ga0070691_11026623 3300005341 Bacteria 516
84 Ga0070687_100133740 3300005343 Bacteria 1435
85 Ga0070687_101087827 3300005343 Bacteria 584
86 Ga0070661_100000075 3300005344 Bacteria 79164
87 Ga0070661_100021031 3300005344 Bacteria 4658
88 Ga0070661_100028515 3300005344 Bacteria 4027
89 Ga0070661_100053915 3300005344 Bacteria 2945
90 Ga0070661_100089633 3300005344 Bacteria 2277
91 Ga0070661_100116973 3300005344 Bacteria 1994
92 Ga0070661_100119254 3300005344 Bacteria 1975
93 Ga0070661_100580567 3300005344 Bacteria 904
94 Ga0070661_100913717 3300005344 Bacteria 725
95 Ga0070661_101184247 3300005344 Bacteria 639
96 Ga0070661_101396765 3300005344 Bacteria 589
97 Ga0070692_10001797 3300005345 Bacteria 8019
98 Ga0070692_10017834 3300005345 Bacteria 3402
99 Ga0070692_10019568 3300005345 Bacteria 3269
100 Ga0070692_10058373 3300005345 Bacteria 2026
101 Ga0070692_10236840 3300005345 Bacteria 1086
102 Ga0070692_10781996 3300005345 Bacteria 650
103 Ga0070668_100269459 3300005347 Bacteria 1419
104 Ga0070668_100902174 3300005347 Bacteria 790
105 Ga0070669_100000565 3300005353 Bacteria 27565
106 Ga0070669_100038298 3300005353 Bacteria 3481
107 Ga0070669_100671160 3300005353 Bacteria 873
108 Ga0070675_100043992 3300005354 Bacteria 3652
109 Ga0070675_100090380 3300005354 Bacteria 2564
110 Ga0070671_100017555 3300005355 Bacteria 5798
111 Ga0070671_100031625 3300005355 Bacteria 4373
112 Ga0070671_100062925 3300005355 Bacteria 3089
113 Ga0070671_100221202 3300005355 Bacteria 1606
114 Ga0070674_100131349 3300005356 Bacteria 1867
115 Ga0070674_102118904 3300005356 Bacteria 513
116 Ga0070673_100010306 3300005364 Bacteria 6321
117 Ga0070673_100110296 3300005364 Unclassified 2281
118 Ga0070673_100892071 3300005364 Unclassified 824
119 Ga0070673_101251533 3300005364 Bacteria 696
120 Ga0070688_101767422 3300005365 Bacteria 507
121 Ga0070659_100004211 3300005366 Bacteria 10269
122 Ga0070659_100004345 3300005366 Bacteria 10118
123 Ga0070659_100008451 3300005366 Bacteria 7522
124 Ga0070659_100136344 3300005366 Bacteria 1996
125 Ga0070659_100170671 3300005366 Bacteria 1781
126 Ga0070659_100573642 3300005366 Unclassified 967
127 Ga0070659_100609879 3300005366 Bacteria 938
128 Ga0070659_101860591 3300005366 Bacteria 539
129 Ga0070667_100002091 3300005367 Bacteria 17620
130 Ga0070667_100091190 3300005367 Bacteria 2620
131 Ga0070667_100290332 3300005367 Bacteria 1470
132 Ga0070667_100296604 3300005367 Unclassified 1455
133 Ga0070667_100737056 3300005367 Bacteria 913
134 Ga0070709_10212295 3300005434 Bacteria 1376
135 Ga0070714_100030055 3300005435 Bacteria 4520
136 Ga0070714_100059117 3300005435 Bacteria 3286
137 Ga0070714_100137572 3300005435 Bacteria 2189
138 Ga0070714_100208154 3300005435 Bacteria 1792
139 Ga0070714_100482908 3300005435 Bacteria 1180
140 Ga0070714_100869998 3300005435 Bacteria 874
141 Ga0070713_100014227 3300005436 Bacteria 5899
142 Ga0070713_100147383 3300005436 Bacteria 2090
143 Ga0070713_100150026 3300005436 Bacteria 2073
144 Ga0070713_100892803 3300005436 Unclassified 855
145 Ga0070705_100615236 3300005440 Bacteria 842
146 Ga0070663_100004025 3300005455 Bacteria 8576
147 Ga0070663_100037038 3300005455 Bacteria 3393
148 Ga0070663_100055102 3300005455 Bacteria 2845
149 Ga0070663_100070717 3300005455 Bacteria 2538
150 Ga0070663_100108543 3300005455 Bacteria 2082
151 Ga0070663_100283832 3300005455 Bacteria 1320
152 Ga0070663_100361851 3300005455 Bacteria 1177
153 Ga0070663_100554416 3300005455 Bacteria 961
154 Ga0070678_100110897 3300005456 Bacteria 2146
155 Ga0070678_100649649 3300005456 Bacteria 946
156 Ga0070662_100003155 3300005457 Bacteria 10241
157 Ga0070662_100003479 3300005457 Bacteria 9817
158 Ga0070662_100044861 3300005457 Bacteria 3169
159 Ga0070662_100080831 3300005457 Bacteria 2420
160 Ga0070662_100615085 3300005457 Archaea 914
161 Ga0070662_100861092 3300005457 Bacteria 772
162 Ga0070662_100885873 3300005457 Bacteria 761
163 Ga0070662_101407110 3300005457 Bacteria 601
164 Ga0070681_10085866 3300005458 Bacteria 3100
165 Ga0070681_10165574 3300005458 Bacteria 2133
166 Ga0070681_10174024 3300005458 Bacteria 2074
167 Ga0070681_10416148 3300005458 Bacteria 1256
168 Ga0070681_10425709 3300005458 Bacteria 1239
169 Ga0070681_10443605 3300005458 Bacteria 1210
170 Ga0070681_10484390 3300005458 Bacteria 1150
171 Ga0070681_10599326 3300005458 Bacteria 1016
172 Ga0070681_11315271 3300005458 Bacteria 646
173 Ga0068867_100000818 3300005459 Bacteria 20994
174 Ga0068867_100008041 3300005459 Bacteria 7453
175 Ga0070679_100118741 3300005530 Bacteria 2629
176 Ga0070679_100231639 3300005530 Bacteria 1806
177 Ga0070679_100513010 3300005530 Bacteria 1143
178 Ga0070679_100815166 3300005530 Bacteria 876
179 Ga0070679_101346138 3300005530 Bacteria 660
180 Ga0070679_101765548 3300005530 Bacteria 567
181 Ga0070684_100097876 3300005535 Bacteria 2617
182 Ga0070684_100121257 3300005535 Bacteria 2352
183 Ga0070684_100133757 3300005535 Bacteria 2238
184 Ga0070684_100151766 3300005535 Bacteria 2099
185 Ga0070684_100254253 3300005535 Bacteria 1606
186 Ga0068853_100006609 3300005539 Bacteria 9230
187 Ga0068853_100032999 3300005539 Bacteria 4389
188 Ga0068853_100070421 3300005539 Bacteria 3044
189 Ga0068853_100233721 3300005539 Bacteria 1682
190 Ga0068853_100563603 3300005539 Bacteria 1080
191 Ga0068853_101736394 3300005539 Unclassified 605
192 Ga0070672_100061279 3300005543 Bacteria 2965
193 Ga0070672_100273250 3300005543 Bacteria 1427
194 Ga0070672_100558772 3300005543 Bacteria 994
195 Ga0070696_100494503 3300005546 Bacteria 972
196 Ga0070696_101048197 3300005546 Bacteria 683
197 Ga0070693_100011908 3300005547 Bacteria 4389
198 Ga0070693_100182113 3300005547 Bacteria 1353
199 Ga0070693_100867735 3300005547 Unclassified 674
200 Ga0070665_100005836 3300005548 Bacteria 12629
201 Ga0070665_100027367 3300005548 Bacteria 5744
202 Ga0070665_100625686 3300005548 Bacteria 1089
203 Ga0068855_100002720 3300005563 Bacteria 21788
204 Ga0068855_100027178 3300005563 Bacteria 6846
205 Ga0068855_100396531 3300005563 Bacteria 1513
206 Ga0068855_100668067 3300005563 Bacteria 1114
207 Ga0068855_100710502 3300005563 Bacteria 1075
208 Ga0068855_100963859 3300005563 Bacteria 898
209 Ga0068855_101006428 3300005563 Bacteria 875
210 Ga0068855_101326837 3300005563 Bacteria 744
211 Ga0070664_100004841 3300005564 Bacteria 10784
212 Ga0070664_100012195 3300005564 Bacteria 6984
213 Ga0070664_100121711 3300005564 Bacteria 2285
214 Ga0070664_100134111 3300005564 Bacteria 2176
215 Ga0070664_100283199 3300005564 Bacteria 1495
216 Ga0070664_101901218 3300005564 Bacteria 565
217 Ga0068857_100011311 3300005577 Bacteria 7764
218 Ga0068857_100068787 3300005577 Bacteria 3152
219 Ga0068857_100071138 3300005577 Bacteria 3099
220 Ga0068857_100100522 3300005577 Bacteria 2594
221 Ga0068857_102285908 3300005577 Unclassified 531
222 Ga0068854_100028696 3300005578 Bacteria 3847
223 Ga0068854_100050057 3300005578 Bacteria 2987
224 Ga0068854_100299905 3300005578 Bacteria 1299
225 Ga0068854_100359927 3300005578 Bacteria 1193
226 Ga0068854_100422727 3300005578 Bacteria 1107
227 Ga0068854_101555886 3300005578 Bacteria 601
228 Ga0068856_100000538 3300005614 Bacteria 41802
229 Ga0068856_100050193 3300005614 Bacteria 4112
230 Ga0068856_100091229 3300005614 Bacteria 3031
231 Ga0068856_100333593 3300005614 Bacteria 1534
232 Ga0068856_100534488 3300005614 Bacteria 1193
233 Ga0068856_100658421 3300005614 Bacteria 1068
234 Ga0068856_101568595 3300005614 Bacteria 672
235 Ga0068852_100001259 3300005616 Bacteria 16883
236 Ga0068852_100053492 3300005616 Bacteria 3475
237 Ga0068852_100064099 3300005616 Bacteria 3202
238 Ga0068852_100105874 3300005616 Bacteria 2549
239 Ga0068852_100260972 3300005616 Bacteria 1663
240 Ga0068852_100363828 3300005616 Bacteria 1415
241 Ga0068852_100444124 3300005616 Bacteria 1283
242 Ga0068852_100475866 3300005616 Bacteria 1240
243 Ga0068852_100966714 3300005616 Bacteria 870
244 Ga0068852_101524601 3300005616 Bacteria 691
245 Ga0068852_102749533 3300005616 Bacteria 511
246 Ga0068859_100056627 3300005617 Bacteria 3947
247 Ga0068859_100060129 3300005617 Bacteria 3829
248 Ga0068859_101484528 3300005617 Unclassified 748
249 Ga0068859_101778780 3300005617 Bacteria 681
250 Ga0068864_100001241 3300005618 Bacteria 21225
251 Ga0068866_10055233 3300005718 Bacteria 2039
252 Ga0068861_100109047 3300005719 Bacteria 2215
253 Ga0068851_10009861 3300005834 Bacteria 4448
254 Ga0068851_10017033 3300005834 Bacteria 3485
255 Ga0068851_10033091 3300005834 Bacteria 2575
256 Ga0068851_10420087 3300005834 Bacteria 790
257 Ga0068870_10082254 3300005840 Bacteria 1783
258 Ga0068863_100006362 3300005841 Bacteria 11582
259 Ga0068863_100263529 3300005841 Unclassified 1667
260 Ga0068863_100294090 3300005841 Bacteria 1574
261 Ga0068858_100181733 3300005842 Bacteria 1986
262 Ga0068860_100032878 3300005843 Bacteria 4982
263 Ga0068860_100133731 3300005843 Bacteria 2381
264 Ga0068862_100290107 3300005844 Bacteria 1502
265 Ga0081540_1314932 3300005983 Bacteria 537
266 Ga0070717_10003857 3300006028 Bacteria 10783
267 Ga0070717_10651326 3300006028 Bacteria 956
268 Ga0070716_100248592 3300006173 Bacteria 1210
269 Ga0097621_100185722 3300006237 Bacteria 1798
270 Ga0068871_100067451 3300006358 Bacteria 2935
271 Ga0068871_100320483 3300006358 Bacteria 1365
272 Ga0068871_100611353 3300006358 Bacteria 992
273 Ga0075428_100465962 3300006844 Bacteria 1353
274 Ga0075430_101061152 3300006846 Bacteria 667
275 Ga0075434_102659960 3300006871 Unclassified 500
276 Ga0075429_100432455 3300006880 Bacteria 1153
277 Ga0068865_100047978 3300006881 Bacteria 2938
278 Ga0097620_100056627 3300006931 Bacteria 3947
279 Ga0097620_100060129 3300006931 Bacteria 3829
280 Ga0097620_101484289 3300006931 Unclassified 748
281 Ga0097620_101778722 3300006931 Bacteria 681
282 Ga0105250_10167012 3300009092 Bacteria 920
283 Ga0105240_10645616 3300009093 Bacteria 1160
284 Ga0105240_12115650 3300009093 Bacteria 584
285 Ga0105245_10000782 3300009098 Bacteria 28837
286 Ga0105245_10727190 3300009098 Bacteria 1027
287 Ga0105245_12182237 3300009098 Bacteria 608
288 Ga0105247_10484631 3300009101 Bacteria 898
289 Ga0105247_11537823 3300009101 Bacteria 544
290 Ga0105243_10042556 3300009148 Bacteria 3556
291 Ga0105242_11118682 3300009176 Bacteria 803
292 Ga0105248_10000443 3300009177 Bacteria 47083
293 Ga0105248_10003845 3300009177 Bacteria 16630
294 Ga0105248_10022307 3300009177 Bacteria 7019
295 Ga0105248_10101834 3300009177 Bacteria 3237
296 Ga0105248_10105445 3300009177 Bacteria 3178
297 Ga0105248_10184233 3300009177 Bacteria 2353
298 Ga0105248_10789544 3300009177 Bacteria 1072
299 Ga0105248_12859339 3300009177 Unclassified 550
300 Ga0105237_10614269 3300009545 Bacteria 1094
301 Ga0105238_10079835 3300009551 Bacteria 3261
302 Ga0105238_10178102 3300009551 Bacteria 2103
303 Ga0105238_10180190 3300009551 Bacteria 2090
304 Ga0105238_10235939 3300009551 Bacteria 1806
305 Ga0105238_10448863 3300009551 Bacteria 1286
306 Ga0105238_12209630 3300009551 Bacteria 585
307 Ga0105239_10020946 3300010375 Bacteria 7213
308 Ga0105239_10522398 3300010375 Bacteria 1351
309 Ga0105246_10007706 3300011119 Bacteria 6605
310 Ga0157373_10042424 3300013100 Bacteria 3251
311 Ga0157373_10049373 3300013100 Bacteria 2999
312 Ga0157373_10060575 3300013100 Bacteria 2681
313 Ga0157373_10089120 3300013100 Bacteria 2173
314 Ga0157373_10134542 3300013100 Bacteria 1738
315 Ga0157373_10163856 3300013100 Bacteria 1564
316 Ga0157373_10182542 3300013100 Bacteria 1478
317 Ga0157373_10452445 3300013100 Bacteria 924
318 Ga0157373_10475926 3300013100 Bacteria 901
319 Ga0157373_10602821 3300013100 Bacteria 800
320 Ga0157371_10008659 3300013102 Bacteria 8083
321 Ga0157371_10013469 3300013102 Bacteria 6208
322 Ga0157371_10016795 3300013102 Bacteria 5451
323 Ga0157371_10024128 3300013102 Bacteria 4443
324 Ga0157371_10063630 3300013102 Bacteria 2615
325 Ga0157371_10068813 3300013102 Bacteria 2506
326 Ga0157371_10265602 3300013102 Bacteria 1238
327 Ga0157371_10825992 3300013102 Bacteria 699
328 Ga0157371_10877615 3300013102 Bacteria 679
329 Ga0157370_10005413 3300013104 Bacteria 14323
330 Ga0157370_10028832 3300013104 Bacteria 5457
331 Ga0157370_10243965 3300013104 Bacteria 1662
332 Ga0157370_10480934 3300013104 Bacteria 1141
333 Ga0157370_10587628 3300013104 Unclassified 1020
334 Ga0157370_11006610 3300013104 Bacteria 754
335 Ga0157370_11234399 3300013104 Bacteria 674
336 Ga0157369_10073109 3300013105 Bacteria 3679
337 Ga0157369_10167848 3300013105 Bacteria 2313
338 Ga0157369_10170396 3300013105 Bacteria 2294
339 Ga0157369_10397308 3300013105 Bacteria 1430
340 Ga0157369_10879445 3300013105 Bacteria 919
341 Ga0157369_11038114 3300013105 Unclassified 839
342 Ga0157369_11267770 3300013105 Bacteria 751
343 Ga0157369_11482758 3300013105 Bacteria 690
344 Ga0157374_10121558 3300013296 Bacteria 2521
345 Ga0157374_12438754 3300013296 Bacteria 550
346 Ga0157378_10049574 3300013297 Bacteria 3735
347 Ga0157378_10464632 3300013297 Bacteria 1258
348 Ga0157378_11038595 3300013297 Unclassified 855
349 Ga0163162_10054638 3300013306 Bacteria 4018
350 Ga0163162_10114319 3300013306 Bacteria 2798
351 Ga0163162_10374461 3300013306 Bacteria 1557
352 Ga0163162_10462659 3300013306 Bacteria 1400
353 Ga0157372_10039580 3300013307 Bacteria 5203
354 Ga0157372_10441451 3300013307 Bacteria 1517
355 Ga0157372_10593956 3300013307 Bacteria 1290
356 Ga0157372_10913690 3300013307 Unclassified 1018
357 Ga0157372_10931968 3300013307 Bacteria 1007
358 Ga0157372_11331753 3300013307 Bacteria 828
359 Ga0157375_10115316 3300013308 Bacteria 2789
360 Ga0163163_10000058 3300014325 Bacteria 123478
361 Ga0157377_10072623 3300014745 Bacteria 1992
362 Ga0157379_10069392 3300014968 Bacteria 3152
363 Ga0157379_10575934 3300014968 Bacteria 1049
364 Ga0163161_10111939 3300017792 Bacteria 2042
365 Ga0206353_10988172 3300020082 Unclassified 615
366 Ga0154015_1390661 3300020610 Bacteria 684
367 Ga0213876_10367279 3300021384 Bacteria 765
368 Ga0207673_1009686 3300025290 Bacteria 1233
369 Ga0207697_10003187 3300025315 Bacteria 8160
370 Ga0207697_10082100 3300025315 Bacteria 1359
371 Ga0207656_10012905 3300025321 Bacteria 3182
372 Ga0207656_10014271 3300025321 Bacteria 3056
373 Ga0207682_10100264 3300025893 Bacteria 1265
374 Ga0207682_10387833 3300025893 Unclassified 660
375 Ga0207642_10106444 3300025899 Bacteria 1419
376 Ga0207710_10371880 3300025900 Bacteria 730
377 Ga0207688_10026749 3300025901 Bacteria 3174
378 Ga0207680_10012374 3300025903 Bacteria 4343
379 Ga0207680_10162970 3300025903 Unclassified 1497
380 Ga0207647_10000857 3300025904 Bacteria 23599
381 Ga0207647_10016767 3300025904 Bacteria 4991
382 Ga0207647_10047835 3300025904 Bacteria 2658
383 Ga0207647_10249439 3300025904 Bacteria 1018
384 Ga0207645_10015526 3300025907 Bacteria 5057
385 Ga0207705_10002347 3300025909 Bacteria 14636
386 Ga0207705_10009509 3300025909 Bacteria 7073
387 Ga0207705_10011926 3300025909 Bacteria 6280
388 Ga0207705_10014944 3300025909 Bacteria 5581
389 Ga0207705_10039426 3300025909 Bacteria 3385
390 Ga0207705_10072555 3300025909 Bacteria 2497
391 Ga0207705_10160590 3300025909 Bacteria 1688
392 Ga0207705_10431908 3300025909 Bacteria 1020
393 Ga0207707_10067055 3300025912 Bacteria 3126
394 Ga0207707_10140733 3300025912 Bacteria 2110
395 Ga0207707_10209958 3300025912 Bacteria 1696
396 Ga0207707_10318989 3300025912 Bacteria 1342
397 Ga0207707_10431581 3300025912 Bacteria 1128
398 Ga0207707_10473331 3300025912 Bacteria 1070
399 Ga0207707_10889166 3300025912 Bacteria 737
400 Ga0207707_11049000 3300025912 Bacteria 667
401 Ga0207695_10816517 3300025913 Bacteria 813
402 Ga0207695_11608841 3300025913 Unclassified 530
403 Ga0207671_10886083 3300025914 Bacteria 706
404 Ga0207660_10019708 3300025917 Bacteria 4514
405 Ga0207660_10105145 3300025917 Bacteria 2115
406 Ga0207660_10124970 3300025917 Bacteria 1953
407 Ga0207660_10143612 3300025917 Bacteria 1827
408 Ga0207660_10189111 3300025917 Bacteria 1602
409 Ga0207660_10517869 3300025917 Bacteria 968
410 Ga0207662_10148154 3300025918 Bacteria 1491
411 Ga0207657_10000126 3300025919 Bacteria 76430
412 Ga0207657_10003802 3300025919 Bacteria 16046
413 Ga0207657_10008325 3300025919 Bacteria 10552
414 Ga0207657_10032621 3300025919 Bacteria 4703
415 Ga0207657_10034671 3300025919 Bacteria 4535
416 Ga0207657_10051517 3300025919 Bacteria 3578
417 Ga0207657_10098040 3300025919 Bacteria 2436
418 Ga0207657_10153793 3300025919 Bacteria 1872
419 Ga0207657_10238189 3300025919 Bacteria 1453
420 Ga0207657_11049289 3300025919 Unclassified 624
421 Ga0207649_10000937 3300025920 Bacteria 18258
422 Ga0207649_10063143 3300025920 Bacteria 2337
423 Ga0207649_10076316 3300025920 Bacteria 2156
424 Ga0207649_10127278 3300025920 Bacteria 1726
425 Ga0207649_10231538 3300025920 Bacteria 1321
426 Ga0207649_10728993 3300025920 Bacteria 770
427 Ga0207649_10744590 3300025920 Bacteria 762
428 Ga0207649_10940446 3300025920 Bacteria 679
429 Ga0207652_10011380 3300025921 Bacteria 7169
430 Ga0207652_10020733 3300025921 Bacteria 5416
431 Ga0207652_10167059 3300025921 Bacteria 1973
432 Ga0207652_10328008 3300025921 Bacteria 1382
433 Ga0207652_11020585 3300025921 Bacteria 726
434 Ga0207681_10010000 3300025923 Bacteria 5806
435 Ga0207681_10084130 3300025923 Bacteria 2254
436 Ga0207681_10490139 3300025923 Bacteria 1005
437 Ga0207694_10160837 3300025924 Bacteria 1814
438 Ga0207694_10200744 3300025924 Bacteria 1622
439 Ga0207650_10003655 3300025925 Bacteria 10522
440 Ga0207650_10032491 3300025925 Bacteria 3775
441 Ga0207650_11143361 3300025925 Bacteria 663
442 Ga0207659_10013454 3300025926 Bacteria 5241
443 Ga0207659_10817726 3300025926 Bacteria 801
444 Ga0207687_10013795 3300025927 Bacteria 5278
445 Ga0207687_10468131 3300025927 Bacteria 1047
446 Ga0207700_10299282 3300025928 Bacteria 1389
447 Ga0207700_10427408 3300025928 Bacteria 1164
448 Ga0207700_10431149 3300025928 Bacteria 1159
449 Ga0207700_10742058 3300025928 Bacteria 877
450 Ga0207664_10168872 3300025929 Bacteria 1871
451 Ga0207664_10297246 3300025929 Bacteria 1420
452 Ga0207664_10412321 3300025929 Bacteria 1202
453 Ga0207664_10735596 3300025929 Bacteria 887
454 Ga0207664_10741829 3300025929 Bacteria 883
455 Ga0207664_11037995 3300025929 Bacteria 734
456 Ga0207644_10012689 3300025931 Bacteria 5601
457 Ga0207644_10068554 3300025931 Bacteria 2588
458 Ga0207644_10140478 3300025931 Bacteria 1859
459 Ga0207644_10618069 3300025931 Viruses 900
460 Ga0207644_11782826 3300025931 Unclassified 515
461 Ga0207690_10000106 3300025932 Bacteria 67786
462 Ga0207690_10006739 3300025932 Bacteria 6808
463 Ga0207690_10007460 3300025932 Bacteria 6489
464 Ga0207690_10064602 3300025932 Bacteria 2499
465 Ga0207690_10079944 3300025932 Bacteria 2280
466 Ga0207690_10283280 3300025932 Unclassified 1291
467 Ga0207690_10617213 3300025932 Bacteria 886
468 Ga0207690_10761400 3300025932 Unclassified 799
469 Ga0207706_10000151 3300025933 Bacteria 76455
470 Ga0207706_10000967 3300025933 Bacteria 29354
471 Ga0207706_10005896 3300025933 Bacteria 11395
472 Ga0207706_10007738 3300025933 Bacteria 9919
473 Ga0207706_10034827 3300025933 Bacteria 4479
474 Ga0207706_10128684 3300025933 Bacteria 2227
475 Ga0207706_10152465 3300025933 Bacteria 2033
476 Ga0207706_10205907 3300025933 Bacteria 1725
477 Ga0207706_10680700 3300025933 Bacteria 880
478 Ga0207709_10030191 3300025935 Bacteria 3151
479 Ga0207670_11618039 3300025936 Bacteria 551
480 Ga0207669_10036289 3300025937 Bacteria 2815
481 Ga0207665_10108440 3300025939 Bacteria 1948
482 Ga0207691_10007770 3300025940 Bacteria 10327
483 Ga0207691_10138182 3300025940 Bacteria 2148
484 Ga0207711_10001912 3300025941 Bacteria 18916
485 Ga0207711_10004040 3300025941 Bacteria 12594
486 Ga0207711_10032103 3300025941 Bacteria 4439
487 Ga0207711_10119352 3300025941 Bacteria 2353
488 Ga0207711_10189157 3300025941 Bacteria 1875
489 Ga0207711_10780502 3300025941 Bacteria 890
490 Ga0207689_10000167 3300025942 Bacteria 57116
491 Ga0207661_10006497 3300025944 Bacteria 8265
492 Ga0207661_10072415 3300025944 Bacteria 2819
493 Ga0207661_10148673 3300025944 Bacteria 2023
494 Ga0207661_10558877 3300025944 Bacteria 1049
495 Ga0207661_11173481 3300025944 Unclassified 707
496 Ga0207661_11373800 3300025944 Bacteria 648
497 Ga0207679_10002382 3300025945 Bacteria 11568
498 Ga0207679_10015266 3300025945 Bacteria 5069
499 Ga0207679_10142961 3300025945 Bacteria 1936
500 Ga0207679_10191363 3300025945 Bacteria 1701
501 Ga0207679_10353971 3300025945 Bacteria 1281
502 Ga0207679_10430961 3300025945 Bacteria 1166
503 Ga0207679_11156104 3300025945 Bacteria 710
504 Ga0207667_10002108 3300025949 Bacteria 24944
505 Ga0207667_10113822 3300025949 Bacteria 2789
506 Ga0207667_10125942 3300025949 Bacteria 2638
507 Ga0207667_10321409 3300025949 Bacteria 1580
508 Ga0207667_10335467 3300025949 Bacteria 1543
509 Ga0207667_11128349 3300025949 Bacteria 766
510 Ga0207667_11142157 3300025949 Bacteria 761
511 Ga0207651_10001801 3300025960 Bacteria 9965
512 Ga0207651_11913224 3300025960 Bacteria 533
513 Ga0207668_10071748 3300025972 Bacteria 2475
514 Ga0207668_10273978 3300025972 Bacteria 1381
515 Ga0207668_12055678 3300025972 Bacteria 514
516 Ga0207640_10025143 3300025981 Bacteria 3601
517 Ga0207640_10035980 3300025981 Bacteria 3104
518 Ga0207640_10443572 3300025981 Bacteria 1068
519 Ga0207640_10445883 3300025981 Bacteria 1065
520 Ga0207640_10514616 3300025981 Bacteria 999
521 Ga0207640_10981708 3300025981 Bacteria 742
522 Ga0207640_11482216 3300025981 Bacteria 609
523 Ga0207658_10002624 3300025986 Bacteria 13051
524 Ga0207658_10029117 3300025986 Bacteria 3896
525 Ga0207658_10198918 3300025986 Unclassified 1671
526 Ga0207658_10456063 3300025986 Bacteria 1132
527 Ga0207658_10728071 3300025986 Bacteria 897
528 Ga0207658_10763824 3300025986 Unclassified 876
529 Ga0207677_10002698 3300026023 Bacteria 9360
530 Ga0207677_10048256 3300026023 Bacteria 2866
531 Ga0207677_10080035 3300026023 Bacteria 2339
532 Ga0207703_10045860 3300026035 Bacteria 3517
533 Ga0207703_10156311 3300026035 Bacteria 1993
534 Ga0207703_10503610 3300026035 Bacteria 1137
535 Ga0207639_10000573 3300026041 Bacteria 25324
536 Ga0207639_10002893 3300026041 Bacteria 11542
537 Ga0207639_10021423 3300026041 Bacteria 4642
538 Ga0207639_10047785 3300026041 Bacteria 3236
539 Ga0207639_10103686 3300026041 Bacteria 2305
540 Ga0207639_10241778 3300026041 Bacteria 1570
541 Ga0207678_10005637 3300026067 Bacteria 11192
542 Ga0207678_10006377 3300026067 Bacteria 10473
543 Ga0207678_10010888 3300026067 Bacteria 7992
544 Ga0207678_10017027 3300026067 Bacteria 6382
545 Ga0207678_10062122 3300026067 Bacteria 3212
546 Ga0207678_10079589 3300026067 Bacteria 2806
547 Ga0207678_10281897 3300026067 Bacteria 1426
548 Ga0207678_10342903 3300026067 Bacteria 1288
549 Ga0207678_10414955 3300026067 Bacteria 1167
550 Ga0207678_10775979 3300026067 Bacteria 846
551 Ga0207702_10001045 3300026078 Bacteria 28350
552 Ga0207702_10059499 3300026078 Bacteria 3254
553 Ga0207702_10073760 3300026078 Bacteria 2943
554 Ga0207702_10210531 3300026078 Bacteria 1807
555 Ga0207702_10442956 3300026078 Bacteria 1259
556 Ga0207702_11055672 3300026078 Bacteria 806
557 Ga0207702_12321854 3300026078 Unclassified 524
558 Ga0207641_10041868 3300026088 Bacteria 3840
559 Ga0207641_10080480 3300026088 Bacteria 2826
560 Ga0207641_10824529 3300026088 Bacteria 918
561 Ga0207648_10001222 3300026089 Bacteria 28812
562 Ga0207648_10016014 3300026089 Bacteria 6869
563 Ga0207676_10007892 3300026095 Bacteria 7571
564 Ga0207676_10016650 3300026095 Bacteria 5325
565 Ga0207676_11277125 3300026095 Bacteria 729
566 Ga0207674_10002073 3300026116 Bacteria 25416
567 Ga0207674_10038488 3300026116 Bacteria 4962
568 Ga0207674_10078939 3300026116 Bacteria 3297
569 Ga0207674_10415813 3300026116 Bacteria 1299
570 Ga0207675_100142165 3300026118 Bacteria 2280
571 Ga0207683_10109265 3300026121 Bacteria 2475
572 Ga0207683_10135548 3300026121 Bacteria 2216
573 Ga0207683_11036865 3300026121 Bacteria 761
574 Ga0207698_10002899 3300026142 Bacteria 10260
575 Ga0207698_10026332 3300026142 Bacteria 4113
576 Ga0207698_10086173 3300026142 Bacteria 2553
577 Ga0207698_10092160 3300026142 Bacteria 2483
578 Ga0207698_10350406 3300026142 Bacteria 1394
579 Ga0207698_11159418 3300026142 Bacteria 786
580 Ga0207698_11818686 3300026142 Unclassified 624
581 Ga0209974_10193327 3300027876 Bacteria 749
582 Ga0209974_10208034 3300027876 Bacteria 725
583 Ga0268266_10000950 3300028379 Bacteria 36937
584 Ga0268266_10017332 3300028379 Bacteria 6147
585 Ga0268266_10236407 3300028379 Bacteria 1684
586 Ga0268266_10635015 3300028379 Bacteria 1027
587 Ga0268264_10046189 3300028381 Bacteria 3616
588 Ga0268264_10065660 3300028381 Bacteria 3058
589 Ga0268264_10982377 3300028381 Bacteria 850
590 Ga0316182_1089068 3300030745 Bacteria 2201
591 Ga0307408_100023329 3300031548 Bacteria 4213
592 Ga0307408_100226711 3300031548 Bacteria 1528
593 Ga0307408_100562602 3300031548 Bacteria 1008
594 Ga0307408_101988587 3300031548 Bacteria 559
595 Ga0307405_10041065 3300031731 Bacteria 2806
596 Ga0307405_10044382 3300031731 Bacteria 2718
597 Ga0307405_10136727 3300031731 Bacteria 1702
598 Ga0307405_10245055 3300031731 Bacteria 1330
599 Ga0307405_11439762 3300031731 Bacteria 604
600 Ga0307413_10741880 3300031824 Bacteria 820
601 Ga0307413_11277243 3300031824 Unclassified 641
602 Ga0307410_10360238 3300031852 Bacteria 1164
603 Ga0307410_10426408 3300031852 Bacteria 1077
604 Ga0307410_10600990 3300031852 Bacteria 917
605 Ga0307410_10993435 3300031852 Bacteria 723
606 Ga0307406_10119008 3300031901 Bacteria 1832
607 Ga0307406_10211866 3300031901 Bacteria 1434
608 Ga0307406_10274880 3300031901 Bacteria 1282
609 Ga0307406_10392371 3300031901 Bacteria 1098
610 Ga0307406_11342070 3300031901 Bacteria 625
611 Ga0307406_11489023 3300031901 Bacteria 595
612 Ga0307407_10045075 3300031903 Bacteria 2489
613 Ga0307407_10472964 3300031903 Bacteria 914
614 Ga0307407_11632833 3300031903 Unclassified 512
615 Ga0307412_10041732 3300031911 Bacteria 2976
616 Ga0307412_10130979 3300031911 Bacteria 1821
617 Ga0307412_10150460 3300031911 Bacteria 1717
618 Ga0307412_10224331 3300031911 Bacteria 1442
619 Ga0307409_100012508 3300031995 Bacteria 5411
620 Ga0307409_100125321 3300031995 Bacteria 2183
621 Ga0307409_100227292 3300031995 Bacteria 1689
622 Ga0307409_100784373 3300031995 Bacteria 959
623 Ga0307416_100075543 3300032002 Bacteria 2820
624 Ga0307416_100082215 3300032002 Bacteria 2727
625 Ga0307416_100180772 3300032002 Bacteria 1976
626 Ga0307416_100581963 3300032002 Bacteria 1197
627 Ga0307416_100979418 3300032002 Bacteria 948
628 Ga0307416_101302833 3300032002 Bacteria 832
629 Ga0307414_10107930 3300032004 Bacteria 2110
630 Ga0307414_10217557 3300032004 Bacteria 1566
631 Ga0307414_10262243 3300032004 Bacteria 1442
632 Ga0307411_10045736 3300032005 Bacteria 2817
633 Ga0307411_10077747 3300032005 Bacteria 2272
634 Ga0307411_10187616 3300032005 Bacteria 1575
635 Ga0307411_11315312 3300032005 Bacteria 659
636 Ga0307411_11529998 3300032005 Bacteria 614
637 Ga0307411_11917588 3300032005 Bacteria 552
638 Ga0307415_100018291 3300032126 Bacteria 4227
639 Ga0307415_100069899 3300032126 Bacteria 2463
640 Ga0307415_100784442 3300032126 Unclassified 868
641 Ga0373959_0120497 3300034820 Bacteria 641
642 Ga0373939_0352234 3300035114 Bacteria 599
643 Ga0373960_0072439 3300035121 Bacteria 1068
644 Ga0373960_0156064 3300035121 Bacteria 783
645 Ga0373943_0007352 3300035170 Bacteria 4945
646 Ga0373946_0016959 3300035171 Bacteria 2781
647 Ga0373961_0109640 3300035241 Bacteria 903
648 Ga0373962_0078700 3300035242 Bacteria 997
649 Ga0373931_0127236 3300035691 Bacteria 1462
650 Ga0373931_0220302 3300035691 Bacteria 1142
651 Ga0373931_0753557 3300035691 Bacteria 646
652 Ga0373935_0009197 3300035692 Bacteria 5915
653 Ga0373947_0066567 3300035725 Bacteria 2199
654 Ga0395899_0000261 3300037312 Bacteria 69173
655 Ga0395899_0029113 3300037312 Bacteria 4153
656 Ga0395899_0064834 3300037312 Bacteria 2685
657 Ga0395899_0073077 3300037312 Bacteria 2508
658 Ga0395899_0129809 3300037312 Bacteria 1800
659 Ga0395899_0140771 3300037312 Bacteria 1716
660 Ga0395899_0143187 3300037312 Bacteria 1700
661 Ga0395899_0190188 3300037312 Bacteria 1436
662 Ga0395899_0264310 3300037312 Bacteria 1175
663 Ga0395899_0325442 3300037312 Bacteria 1034
664 Ga0395899_0427382 3300037312 Bacteria 872
665 Ga0395900_0000036 3300037418 Bacteria 250619
666 Ga0395900_0007204 3300037418 Bacteria 11524
667 Ga0395900_0015090 3300037418 Bacteria 7875
668 Ga0395900_0025107 3300037418 Bacteria 6100
669 Ga0395900_0027017 3300037418 Bacteria 5876
670 Ga0395900_0033836 3300037418 Bacteria 5259
671 Ga0395900_0034005 3300037418 Bacteria 5247
672 Ga0395900_0051163 3300037418 Bacteria 4256
673 Ga0395900_0072943 3300037418 Bacteria 3528
674 Ga0395900_0073120 3300037418 Bacteria 3524
675 Ga0395900_0089785 3300037418 Bacteria 3158
676 Ga0395900_0131992 3300037418 Bacteria 2559
677 Ga0395900_0347541 3300037418 Bacteria 1457
678 Ga0395900_1308199 3300037418 Bacteria 639
679 Ga0395900_1682146 3300037418 Unclassified 545
680 Ga0395898_0046153 3300037466 Bacteria 4279
681 Ga0395898_0077919 3300037466 Bacteria 3199
682 Ga0395898_0136702 3300037466 Bacteria 2347
683 Ga0395898_0156038 3300037466 Bacteria 2183
684 Ga0395898_0157111 3300037466 Bacteria 2175
685 Ga0395898_0157678 3300037466 Bacteria 2171
686 Ga0395898_0158678 3300037466 Bacteria 2163
687 Ga0395898_0196576 3300037466 Bacteria 1926
688 Ga0395898_0266292 3300037466 Bacteria 1634
689 Ga0395898_0328621 3300037466 Bacteria 1458
690 Ga0395898_0369176 3300037466 Bacteria 1368
691 Ga0395898_0585345 3300037466 Bacteria 1058
692 Ga0395898_0926413 3300037466 Bacteria 809
693 Ga0395898_0986484 3300037466 Bacteria 778
694 Ga0395898_1428388 3300037466 Bacteria 619
695 Ga0395898_1728762 3300037466 Bacteria 548
696 Ga0395905_0001816 3300037471 Bacteria 24696
697 Ga0395905_0010012 3300037471 Bacteria 9241
698 Ga0395905_0021292 3300037471 Bacteria 6134
699 Ga0395905_0021865 3300037471 Bacteria 6049
700 Ga0395905_0026041 3300037471 Bacteria 5515
701 Ga0395905_0034161 3300037471 Bacteria 4774
702 Ga0395905_0067932 3300037471 Bacteria 3339
703 Ga0395905_0088113 3300037471 Bacteria 2910
704 Ga0395905_0096392 3300037471 Bacteria 2777
705 Ga0395905_0166595 3300037471 Bacteria 2071
706 Ga0395905_0171558 3300037471 Bacteria 2037
707 Ga0395905_0173926 3300037471 Bacteria 2022
708 Ga0395905_0216916 3300037471 Bacteria 1791
709 Ga0395905_0218498 3300037471 Bacteria 1784
710 Ga0395905_0230665 3300037471 Bacteria 1731
711 Ga0395905_0267617 3300037471 Bacteria 1595
712 Ga0395905_0320919 3300037471 Bacteria 1438
713 Ga0395905_1194766 3300037471 Bacteria 664
714 Ga0395905_1663333 3300037471 Bacteria 543
715 Ga0395901_0000036 3300038443 Bacteria 214274
716 Ga0395901_0022395 3300038443 Bacteria 6475
717 Ga0395901_0043349 3300038443 Bacteria 4668
718 Ga0395901_0044592 3300038443 Bacteria 4599
719 Ga0395901_0048833 3300038443 Bacteria 4395
720 Ga0395901_0056121 3300038443 Bacteria 4097
721 Ga0395901_0078945 3300038443 Bacteria 3436
722 Ga0395901_0159150 3300038443 Bacteria 2371
723 Ga0395901_0160151 3300038443 Bacteria 2364
724 Ga0395901_0221686 3300038443 Bacteria 1976
725 Ga0395901_0318161 3300038443 Bacteria 1610
726 Ga0395901_0358286 3300038443 Bacteria 1504
727 Ga0395901_0499530 3300038443 Bacteria 1238
728 Ga0395901_0862990 3300038443 Bacteria 889
729 Ga0395901_1628611 3300038443 Bacteria 598
730 Ga0436365_1470013 3300039437 Bacteria 10663
731 Ga0439439_0086127 3300041406 Bacteria 854
732 Ga0439453_0124444 3300041408 Bacteria 594
733 Ga0439465_0036102 3300041413 Bacteria 1587
734 Ga0451853_1184346 3300041512 Bacteria 909
735 Ga0439448_0003366 3300042005 Bacteria 4429
736 Ga0439432_069814 3300042006 Bacteria 1072
737 Ga0439449_0047741 3300042007 Bacteria 1585
738 Ga0439455_0030288 3300042012 Bacteria 1342
739 Ga0450917_009951 3300042120 Bacteria 750
740 Ga0439458_0000154 3300042157 Bacteria 15118
741 Ga0466966_0102924 3300044684 Bacteria 1765
742 Ga0466961_0034709 3300044693 Bacteria 3238
743 Ga0466961_0063876 3300044693 Bacteria 2340
744 Ga0466963_0001670 3300044694 Bacteria 12091
745 Ga0466963_0011810 3300044694 Bacteria 5328
746 Ga0466963_0085151 3300044694 Bacteria 2145
747 Ga0466971_0027732 3300044719 Bacteria 2536
748 Ga0466957_0105978 3300044842 Bacteria 1777
749 Ga0466959_0142119 3300045049 Bacteria 1695
750 Ga0451576_2191213 3300045051 Bacteria 567
751 Ga0466958_0080210 3300045836 Bacteria 2007
752 Ga0466958_0153603 3300045836 Bacteria 1452
753 Ga0466958_0943243 3300045836 Bacteria 563
754 Ga0466958_1138175 3300045836 Unclassified 510
755 Ga0466967_0015138 3300045976 Bacteria 6037
756 Ga0466967_0034787 3300045976 Bacteria 4281
757 Ga0466967_0121799 3300045976 Bacteria 2411
758 Ga0466967_0155267 3300045976 Bacteria 2143
759 Ga0466967_1490516 3300045976 Bacteria 674
760 Ga0495642_0163347 3300046528 Bacteria 966
761 Ga0495642_0536828 3300046528 Bacteria 519
762 Ga0495669_0007514 3300046684 Bacteria 4573
763 Ga0495669_0089420 3300046684 Bacteria 1420
764 Ga0495669_0130306 3300046684 Bacteria 1183
765 Ga0495669_0179497 3300046684 Bacteria 1009
766 Ga0495669_0405076 3300046684 Bacteria 661
767 Ga0495677_0058880 3300047445 Bacteria 1422
768 Ga0495677_0279321 3300047445 Bacteria 655
769 Ga0496101_1136234 3300048904 Bacteria 613
770 Ga0496107_0690315 3300048910 Bacteria 751
771 Ga0496107_0853265 3300048910 Bacteria 665
772 Ga0496108_0000883 3300048911 Bacteria 23370
773 Ga0496109_0031681 3300048912 Bacteria 4748
774 Ga0496109_0240217 3300048912 Bacteria 1705
775 Ga0496109_0893697 3300048912 Bacteria 826
776 Ga0496110_0102725 3300048913 Bacteria 2564
777 Ga0496111_0537685 3300048914 Unclassified 858
778 Ga0496111_0810508 3300048914 Bacteria 677
779 Ga0496112_0015271 3300048915 Bacteria 7160
780 Ga0496112_0803508 3300048915 Unclassified 865
781 Ga0496113_0086138 3300048916 Bacteria 2414
782 Ga0496115_0497419 3300048918 Bacteria 980
783 Ga0501292_030873 3300049515 Bacteria 900
784 Ga0501296_023567 3300049519 Bacteria 798
785 Ga0501335_033951 3300049551 Bacteria 585
786 Ga0501067_0254396 3300049583 Bacteria 978
787 Ga0501068_0029686 3300049584 Bacteria 3240
788 Ga0501069_0448975 3300049585 Bacteria 766
789 Ga0501070_1412000 3300049586 Unclassified 529
790 Ga0501198_002666 3300049649 Bacteria 2412
791 Ga0501199_019343 3300049650 Bacteria 782
792 Ga0501216_040969 3300049660 Bacteria 886
793 Ga0501223_002563 3300049663 Bacteria 4019
794 Ga0501227_006974 3300049665 Bacteria 2420
795 Ga0501235_000839 3300049669 Bacteria 6308
796 Ga0501236_005573 3300049670 Bacteria 1524
797 Ga0501242_002577 3300049674 Bacteria 1913
798 Ga0501247_046328 3300049677 Bacteria 634
799 Ga0501252_002644 3300049682 Bacteria 1795
800 Ga0501258_026822 3300049687 Bacteria 708
801 Ga0501259_012244 3300049688 Bacteria 1429
802 Ga0501221_002834 3300049704 Bacteria 2855
803 Ga0501225_0005682 3300049705 Bacteria 3656
804 Ga0501229_055266 3300049706 Bacteria 594
805 Ga0501234_041584 3300049707 Bacteria 753
806 Ga0501262_000723 3300049759 Bacteria 3844
807 Ga0501268_014506 3300049765 Bacteria 1284
808 Ga0501270_003667 3300049767 Bacteria 1675
809 Ga0501272_004369 3300049769 Bacteria 1467
810 Ga0501273_036952 3300049770 Bacteria 712
811 Ga0501212_043151 3300049851 Bacteria 750
812 nmdc:mga09592_430071_c1 3300050508 Bacteria 1140
813 nmdc:mga0rr50_93274_c1 3300050513 Bacteria 2348
814 Ga0590077_099068 3300059426 Bacteria 681
815 Ga0466962_0008509 3300061719 Bacteria 4917

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013100 Ga0157373_10134542 Ga0157373_101345423 63
2 3300005336 Ga0070680_100545601 Ga0070680_1005456011 64
3 3300005336 Ga0070680_101260833 Ga0070680_1012608332 64
4 3300005355 Ga0070671_100017555 Ga0070671_1000175559 64
5 3300005530 Ga0070679_100815166 Ga0070679_1008151662 64
6 3300005577 Ga0068857_102285908 Ga0068857_1022859082 64
7 3300009177 Ga0105248_10184233 Ga0105248_101842333 64
8 3300025912 Ga0207707_10431581 Ga0207707_104315813 64
9 3300025917 Ga0207660_10143612 Ga0207660_101436124 64
10 3300025919 Ga0207657_10238189 Ga0207657_102381893 64
11 3300025919 Ga0207657_11049289 Ga0207657_110492891 64
12 3300025931 Ga0207644_10618069 Ga0207644_106180691 64
13 3300025932 Ga0207690_10761400 Ga0207690_107614003 64
14 3300025941 Ga0207711_10119352 Ga0207711_101193523 64
15 3300026078 Ga0207702_12321854 Ga0207702_123218542 64
16 3300031548 Ga0307408_101988587 Ga0307408_1019885871 64
17 3300048904 Ga0496101_1136234 Ga0496101_1136234_137_382 64
18 3300048912 Ga0496109_0031681 Ga0496109_0031681_1726_1971 64
19 3300048915 Ga0496112_0015271 Ga0496112_0015271_4041_4286 64
20 3300048916 Ga0496113_0086138 Ga0496113_0086138_1787_2032 64
21 3300001915 JGI24741J21665_1005189 JGI24741J21665_10051892 65
22 3300001979 JGI24740J21852_10010449 JGI24740J21852_100104493 65
23 3300001989 JGI24739J22299_10031244 JGI24739J22299_100312441 65
24 3300001990 JGI24737J22298_10024715 JGI24737J22298_100247155 65
25 3300002067 JGI24735J21928_10006779 JGI24735J21928_100067791 65
26 3300004800 Ga0058861_10696430 Ga0058861_106964301 65
27 3300005327 Ga0070658_10137400 Ga0070658_101374005 65
28 3300005329 Ga0070683_100035499 Ga0070683_1000354997 65
29 3300005329 Ga0070683_101400995 Ga0070683_1014009952 65
30 3300005336 Ga0070680_100125730 Ga0070680_1001257303 65
31 3300005337 Ga0070682_100025859 Ga0070682_1000258592 65
32 3300005339 Ga0070660_100355773 Ga0070660_1003557733 65
33 3300005341 Ga0070691_11026623 Ga0070691_110266232 65
34 3300005343 Ga0070687_101087827 Ga0070687_1010878272 65
35 3300005344 Ga0070661_100021031 Ga0070661_1000210318 65
36 3300005344 Ga0070661_101184247 Ga0070661_1011842472 65
37 3300005345 Ga0070692_10019568 Ga0070692_100195683 65
38 3300005347 Ga0070668_100902174 Ga0070668_1009021743 65
39 3300005353 Ga0070669_100038298 Ga0070669_1000382985 65
40 3300005354 Ga0070675_100090380 Ga0070675_1000903804 65
41 3300005364 Ga0070673_101251533 Ga0070673_1012515332 65
42 3300005366 Ga0070659_100170671 Ga0070659_1001706714 65
43 3300005366 Ga0070659_100609879 Ga0070659_1006098792 65
44 3300005367 Ga0070667_100290332 Ga0070667_1002903322 65
45 3300005455 Ga0070663_100037038 Ga0070663_1000370385 65
46 3300005457 Ga0070662_100080831 Ga0070662_1000808312 65
47 3300005458 Ga0070681_10174024 Ga0070681_101740243 65
48 3300005530 Ga0070679_100231639 Ga0070679_1002316392 65
49 3300005535 Ga0070684_100121257 Ga0070684_1001212576 65
50 3300005546 Ga0070696_100494503 Ga0070696_1004945032 65
51 3300005547 Ga0070693_100182113 Ga0070693_1001821132 65
52 3300005563 Ga0068855_100027178 Ga0068855_10002717811 65
53 3300005564 Ga0070664_100134111 Ga0070664_1001341113 65
54 3300005577 Ga0068857_100071138 Ga0068857_1000711387 65
55 3300005578 Ga0068854_101555886 Ga0068854_1015558862 65
56 3300005616 Ga0068852_100105874 Ga0068852_1001058745 65
57 3300005617 Ga0068859_101778780 Ga0068859_1017787801 65
58 3300005841 Ga0068863_100294090 Ga0068863_1002940903 65
59 3300006931 Ga0097620_101778722 Ga0097620_1017787221 65
60 3300009177 Ga0105248_10022307 Ga0105248_1002230712 65
61 3300013100 Ga0157373_10049373 Ga0157373_100493733 65
62 3300013102 Ga0157371_10024128 Ga0157371_100241283 65
63 3300013104 Ga0157370_11234399 Ga0157370_112343992 65
64 3300013307 Ga0157372_10039580 Ga0157372_100395807 65
65 3300025315 Ga0207697_10082100 Ga0207697_100821002 65
66 3300025909 Ga0207705_10009509 Ga0207705_100095093 65
67 3300025912 Ga0207707_10209958 Ga0207707_102099584 65
68 3300025917 Ga0207660_10019708 Ga0207660_100197087 65
69 3300025919 Ga0207657_10032621 Ga0207657_100326213 65
70 3300025920 Ga0207649_10063143 Ga0207649_100631433 65
71 3300025920 Ga0207649_10940446 Ga0207649_109404462 65
72 3300025921 Ga0207652_10011380 Ga0207652_100113803 65
73 3300025923 Ga0207681_10084130 Ga0207681_100841304 65
74 3300025926 Ga0207659_10013454 Ga0207659_100134548 65
75 3300025932 Ga0207690_10007460 Ga0207690_100074604 65
76 3300025932 Ga0207690_10064602 Ga0207690_100646024 65
77 3300025933 Ga0207706_10000967 Ga0207706_100009675 65
78 3300025941 Ga0207711_10032103 Ga0207711_100321033 65
79 3300025944 Ga0207661_10072415 Ga0207661_100724154 65
80 3300025944 Ga0207661_11173481 Ga0207661_111734812 65
81 3300025945 Ga0207679_10142961 Ga0207679_101429614 65
82 3300025945 Ga0207679_10191363 Ga0207679_101913633 65
83 3300025960 Ga0207651_11913224 Ga0207651_119132242 65
84 3300025972 Ga0207668_10273978 Ga0207668_102739783 65
85 3300025981 Ga0207640_10514616 Ga0207640_105146163 65
86 3300025986 Ga0207658_10456063 Ga0207658_104560633 65
87 3300026041 Ga0207639_10021423 Ga0207639_100214233 65
88 3300026067 Ga0207678_10017027 Ga0207678_100170274 65
89 3300026088 Ga0207641_10041868 Ga0207641_100418683 65
90 3300026116 Ga0207674_10038488 Ga0207674_100384883 65
91 3300026142 Ga0207698_10350406 Ga0207698_103504065 65
92 3300034820 Ga0373959_0120497 Ga0373959_0120497_107_352 65
93 3300035121 Ga0373960_0156064 Ga0373960_0156064_404_649 65
94 3300037312 Ga0395899_0325442 Ga0395899_0325442_651_911 65
95 3300037466 Ga0395898_0926413 Ga0395898_0926413_74_334 65
96 3300038443 Ga0395901_1628611 Ga0395901_1628611_41_304 65
97 3300045976 Ga0466967_1490516 Ga0466967_1490516_297_554 65
98 3300048910 Ga0496107_0853265 Ga0496107_0853265_47_301 65
99 3300005293 Ga0065715_10826821 Ga0065715_108268212 66
100 3300005336 Ga0070680_101134350 Ga0070680_1011343502 66
101 3300005366 Ga0070659_100573642 Ga0070659_1005736421 66
102 3300005458 Ga0070681_10165574 Ga0070681_101655747 66
103 3300005530 Ga0070679_101346138 Ga0070679_1013461382 66
104 3300013100 Ga0157373_10475926 Ga0157373_104759263 66
105 3300025921 Ga0207652_11020585 Ga0207652_110205852 66
106 3300025932 Ga0207690_10079944 Ga0207690_100799441 66
107 3300027876 Ga0209974_10193327 Ga0209974_101933272 66
108 3300044693 Ga0466961_0034709 Ga0466961_0034709_1807_2058 66
109 3300044694 Ga0466963_0001670 Ga0466963_0001670_2272_2523 66
110 3300044719 Ga0466971_0027732 Ga0466971_0027732_1018_1269 66
111 3300044842 Ga0466957_0105978 Ga0466957_0105978_547_798 66
112 3300045836 Ga0466958_0080210 Ga0466958_0080210_410_661 66
113 3300045976 Ga0466967_0155267 Ga0466967_0155267_432_683 66
114 3300061719 Ga0466962_0008509 Ga0466962_0008509_2599_2850 66
115 3300009098 Ga0105245_10727190 Ga0105245_107271902 67
116 3300025919 Ga0207657_10153793 Ga0207657_101537932 67
117 3300025927 Ga0207687_10468131 Ga0207687_104681312 67
118 3300025932 Ga0207690_10617213 Ga0207690_106172133 67
119 3300035691 Ga0373931_0753557 Ga0373931_0753557_162_413 67
120 3300037418 Ga0395900_0131992 Ga0395900_0131992_2138_2383 67
121 3300037471 Ga0395905_0010012 Ga0395905_0010012_5422_5667 67
122 3300038443 Ga0395901_0044592 Ga0395901_0044592_1890_2135 67
123 3300045051 Ga0451576_2191213 Ga0451576_2191213_115_369 68
124 3300005539 Ga0068853_101736394 Ga0068853_1017363941 69
125 3300005616 Ga0068852_102749533 Ga0068852_1027495332 69
126 3300013100 Ga0157373_10602821 Ga0157373_106028212 69
127 3300013104 Ga0157370_10480934 Ga0157370_104809343 69
128 3300013105 Ga0157369_10397308 Ga0157369_103973083 69
129 3300025949 Ga0207667_11142157 Ga0207667_111421572 69
130 3300026078 Ga0207702_11055672 Ga0207702_110556722 69
131 3300026142 Ga0207698_11159418 Ga0207698_111594182 69
132 3300037418 Ga0395900_0347541 Ga0395900_0347541_958_1215 69
133 3300037466 Ga0395898_0136702 Ga0395898_0136702_1010_1243 69
134 3300038443 Ga0395901_0022395 Ga0395901_0022395_951_1184 69
135 3300005329 Ga0070683_100294696 Ga0070683_1002946963 70
136 3300005344 Ga0070661_100119254 Ga0070661_1001192543 70
137 3300005367 Ga0070667_100296604 Ga0070667_1002966045 70
138 3300005435 Ga0070714_100869998 Ga0070714_1008699983 70
139 3300005436 Ga0070713_100892803 Ga0070713_1008928031 70
140 3300005458 Ga0070681_10443605 Ga0070681_104436052 70
141 3300005535 Ga0070684_100254253 Ga0070684_1002542532 70
142 3300005564 Ga0070664_101901218 Ga0070664_1019012181 70
143 3300005578 Ga0068854_100359927 Ga0068854_1003599274 70
144 3300005614 Ga0068856_100091229 Ga0068856_1000912294 70
145 3300005616 Ga0068852_100475866 Ga0068852_1004758662 70
146 3300005617 Ga0068859_100056627 Ga0068859_1000566276 70
147 3300005841 Ga0068863_100263529 Ga0068863_1002635292 70
148 3300006871 Ga0075434_102659960 Ga0075434_1026599602 70
149 3300006931 Ga0097620_100056627 Ga0097620_1000566276 70
150 3300009098 Ga0105245_12182237 Ga0105245_121822372 70
151 3300009101 Ga0105247_10484631 Ga0105247_104846312 70
152 3300009177 Ga0105248_10789544 Ga0105248_107895444 70
153 3300013102 Ga0157371_10825992 Ga0157371_108259922 70
154 3300013297 Ga0157378_10464632 Ga0157378_104646322 70
155 3300014968 Ga0157379_10575934 Ga0157379_105759342 70
156 3300025900 Ga0207710_10371880 Ga0207710_103718802 70
157 3300025904 Ga0207647_10249439 Ga0207647_102494393 70
158 3300025909 Ga0207705_10014944 Ga0207705_100149447 70
159 3300025912 Ga0207707_10318989 Ga0207707_103189894 70
160 3300025913 Ga0207695_10816517 Ga0207695_108165171 70
161 3300025914 Ga0207671_10886083 Ga0207671_108860832 70
162 3300025920 Ga0207649_10728993 Ga0207649_107289932 70
163 3300025929 Ga0207664_10735596 Ga0207664_107355962 70
164 3300025936 Ga0207670_11618039 Ga0207670_116180392 70
165 3300025944 Ga0207661_10558877 Ga0207661_105588773 70
166 3300025949 Ga0207667_10113822 Ga0207667_101138225 70
167 3300025981 Ga0207640_11482216 Ga0207640_114822162 70
168 3300026035 Ga0207703_10503610 Ga0207703_105036103 70
169 3300031731 Ga0307405_10136727 Ga0307405_101367274 70
170 3300031824 Ga0307413_10741880 Ga0307413_107418802 70
171 3300031852 Ga0307410_10360238 Ga0307410_103602383 70
172 3300031901 Ga0307406_10211866 Ga0307406_102118663 70
173 3300031911 Ga0307412_10130979 Ga0307412_101309795 70
174 3300031995 Ga0307409_100012508 Ga0307409_1000125083 70
175 3300032002 Ga0307416_100082215 Ga0307416_1000822154 70
176 3300032004 Ga0307414_10107930 Ga0307414_101079302 70
177 3300032005 Ga0307411_10187616 Ga0307411_101876164 70
178 3300032126 Ga0307415_100069899 Ga0307415_1000698994 70
179 3300037418 Ga0395900_0033836 Ga0395900_0033836_944_1195 70
180 3300037466 Ga0395898_1728762 Ga0395898_1728762_286_537 70
181 3300038443 Ga0395901_0043349 Ga0395901_0043349_2621_2872 70
182 3300005458 Ga0070681_10085866 Ga0070681_100858662 71
183 3300025912 Ga0207707_10067055 Ga0207707_100670552 71
184 3300027876 Ga0209974_10208034 Ga0209974_102080342 71
185 3300031731 Ga0307405_10245055 Ga0307405_102450554 71
186 3300031824 Ga0307413_11277243 Ga0307413_112772432 71
187 3300031901 Ga0307406_11342070 Ga0307406_113420702 71
188 3300031903 Ga0307407_11632833 Ga0307407_116328332 71
189 3300031911 Ga0307412_10150460 Ga0307412_101504603 71
190 3300031995 Ga0307409_100227292 Ga0307409_1002272924 71
191 3300032002 Ga0307416_101302833 Ga0307416_1013028332 71
192 3300032004 Ga0307414_10217557 Ga0307414_102175573 71
193 3300032005 Ga0307411_10045736 Ga0307411_100457364 71
194 3300032126 Ga0307415_100784442 Ga0307415_1007844422 71
195 3300005327 Ga0070658_10419631 Ga0070658_104196314 72
196 3300005329 Ga0070683_100729113 Ga0070683_1007291132 72
197 3300005345 Ga0070692_10058373 Ga0070692_100583735 72
198 3300005366 Ga0070659_100136344 Ga0070659_1001363445 72
199 3300005435 Ga0070714_100482908 Ga0070714_1004829082 72
200 3300005563 Ga0068855_100710502 Ga0068855_1007105022 72
201 3300005614 Ga0068856_100050193 Ga0068856_1000501939 72
202 3300013100 Ga0157373_10163856 Ga0157373_101638563 72
203 3300013102 Ga0157371_10016795 Ga0157371_1001679510 72
204 3300013105 Ga0157369_10073109 Ga0157369_100731093 72
205 3300013307 Ga0157372_10593956 Ga0157372_105939564 72
206 3300025909 Ga0207705_10431908 Ga0207705_104319082 72
207 3300025929 Ga0207664_10741829 Ga0207664_107418292 72
208 3300025932 Ga0207690_10283280 Ga0207690_102832802 72
209 3300025949 Ga0207667_10321409 Ga0207667_103214094 72
210 3300026078 Ga0207702_10059499 Ga0207702_100594995 72
211 3300037312 Ga0395899_0029113 Ga0395899_0029113_3893_4123 72
212 3300037312 Ga0395899_0190188 Ga0395899_0190188_36_266 72
213 3300037466 Ga0395898_0156038 Ga0395898_0156038_123_353 72
214 3300037471 Ga0395905_0021865 Ga0395905_0021865_1765_1995 72
215 3300038443 Ga0395901_0862990 Ga0395901_0862990_151_381 72
216 3300041406 Ga0439439_0086127 Ga0439439_0086127_111_350 72
217 3300042007 Ga0439449_0047741 Ga0439449_0047741_1088_1327 72
218 3300005290 Ga0065712_10095813 Ga0065712_100958132 73
219 3300005327 Ga0070658_10270541 Ga0070658_102705412 73
220 3300005330 Ga0070690_100158398 Ga0070690_1001583983 73
221 3300005333 Ga0070677_10027587 Ga0070677_100275876 73
222 3300005338 Ga0068868_100243073 Ga0068868_1002430734 73
223 3300005339 Ga0070660_100095812 Ga0070660_1000958121 73
224 3300005356 Ga0070674_100131349 Ga0070674_1001313495 73
225 3300005456 Ga0070678_100649649 Ga0070678_1006496492 73
226 3300005457 Ga0070662_100861092 Ga0070662_1008610922 73
227 3300005457 Ga0070662_101407110 Ga0070662_1014071102 73
228 3300005543 Ga0070672_100558772 Ga0070672_1005587722 73
229 3300005616 Ga0068852_100966714 Ga0068852_1009667143 73
230 3300009177 Ga0105248_10101834 Ga0105248_101018346 73
231 3300013100 Ga0157373_10060575 Ga0157373_100605756 73
232 3300013297 Ga0157378_11038595 Ga0157378_110385952 73
233 3300013306 Ga0163162_10462659 Ga0163162_104626594 73
234 3300021384 Ga0213876_10367279 Ga0213876_103672792 73
235 3300025893 Ga0207682_10100264 Ga0207682_101002641 73
236 3300025919 Ga0207657_10098040 Ga0207657_100980402 73
237 3300025931 Ga0207644_11782826 Ga0207644_117828262 73
238 3300025933 Ga0207706_10152465 Ga0207706_101524654 73
239 3300025933 Ga0207706_10680700 Ga0207706_106807002 73
240 3300025937 Ga0207669_10036289 Ga0207669_100362892 73
241 3300025941 Ga0207711_10004040 Ga0207711_1000404019 73
242 3300025981 Ga0207640_10981708 Ga0207640_109817081 73
243 3300025986 Ga0207658_10198918 Ga0207658_101989184 73
244 3300026023 Ga0207677_10080035 Ga0207677_100800354 73
245 3300026121 Ga0207683_11036865 Ga0207683_110368652 73
246 3300028381 Ga0268264_10982377 Ga0268264_109823772 73
247 3300030745 Ga0316182_1089068 Ga0316182_10890684 73
248 3300031901 Ga0307406_11489023 Ga0307406_114890232 73
249 3300032005 Ga0307411_11315312 Ga0307411_113153122 73
250 3300037471 Ga0395905_1663333 Ga0395905_1663333_52_294 73
251 3300039437 Ga0436365_1470013 Ga0436365_1470013_7197_7463 73
252 3300042120 Ga0450917_009951 Ga0450917_009951_319_558 73
253 3300045976 Ga0466967_0015138 Ga0466967_0015138_1712_1951 73
254 3300048910 Ga0496107_0690315 Ga0496107_0690315_11_271 73
255 3300048911 Ga0496108_0000883 Ga0496108_0000883_22030_22269 73
256 3300048912 Ga0496109_0893697 Ga0496109_0893697_363_602 73
257 3300048914 Ga0496111_0810508 Ga0496111_0810508_17_277 73
258 3300001915 JGI24741J21665_1035295 JGI24741J21665_10352951 74
259 3300001979 JGI24740J21852_10018367 JGI24740J21852_100183677 74
260 3300001989 JGI24739J22299_10030758 JGI24739J22299_100307581 74
261 3300001990 JGI24737J22298_10001931 JGI24737J22298_100019316 74
262 3300001990 JGI24737J22298_10266458 JGI24737J22298_102664582 74
263 3300002067 JGI24735J21928_10069705 JGI24735J21928_100697052 74
264 3300002075 JGI24738J21930_10012231 JGI24738J21930_100122312 74
265 3300005327 Ga0070658_10003538 Ga0070658_1000353810 74
266 3300005327 Ga0070658_10078114 Ga0070658_100781143 74
267 3300005327 Ga0070658_10419631 Ga0070658_104196313 74
268 3300005328 Ga0070676_10742058 Ga0070676_107420582 74
269 3300005329 Ga0070683_100005945 Ga0070683_1000059455 74
270 3300005329 Ga0070683_100278105 Ga0070683_1002781055 74
271 3300005329 Ga0070683_100729113 Ga0070683_1007291131 74
272 3300005331 Ga0070670_100002725 Ga0070670_1000027251 74
273 3300005335 Ga0070666_10000623 Ga0070666_100006232 74
274 3300005336 Ga0070680_100482373 Ga0070680_1004823732 74
275 3300005336 Ga0070680_100651464 Ga0070680_1006514641 74
276 3300005337 Ga0070682_100098702 Ga0070682_1000987023 74
277 3300005337 Ga0070682_101628977 Ga0070682_1016289771 74
278 3300005339 Ga0070660_100000560 Ga0070660_10000056011 74
279 3300005339 Ga0070660_100052691 Ga0070660_1000526914 74
280 3300005344 Ga0070661_100000075 Ga0070661_10000007510 74
281 3300005344 Ga0070661_100028515 Ga0070661_1000285157 74
282 3300005345 Ga0070692_10236840 Ga0070692_102368403 74
283 3300005353 Ga0070669_100671160 Ga0070669_1006711602 74
284 3300005355 Ga0070671_100031625 Ga0070671_1000316254 74
285 3300005364 Ga0070673_100892071 Ga0070673_1008920712 74
286 3300005365 Ga0070688_101767422 Ga0070688_1017674222 74
287 3300005366 Ga0070659_100004345 Ga0070659_10000434513 74
288 3300005366 Ga0070659_100136344 Ga0070659_1001363444 74
289 3300005367 Ga0070667_100091190 Ga0070667_1000911907 74
290 3300005435 Ga0070714_100482908 Ga0070714_1004829083 74
291 3300005455 Ga0070663_100004025 Ga0070663_10000402511 74
292 3300005457 Ga0070662_100003155 Ga0070662_1000031555 74
293 3300005458 Ga0070681_10599326 Ga0070681_105993263 74
294 3300005458 Ga0070681_11315271 Ga0070681_113152712 74
295 3300005530 Ga0070679_100118741 Ga0070679_1001187416 74
296 3300005535 Ga0070684_100097876 Ga0070684_1000978766 74
297 3300005539 Ga0068853_100006609 Ga0068853_10000660911 74
298 3300005539 Ga0068853_100563603 Ga0068853_1005636033 74
299 3300005546 Ga0070696_101048197 Ga0070696_1010481972 74
300 3300005547 Ga0070693_100011908 Ga0070693_1000119085 74
301 3300005548 Ga0070665_100027367 Ga0070665_1000273677 74
302 3300005563 Ga0068855_100002720 Ga0068855_10000272024 74
303 3300005563 Ga0068855_100710502 Ga0068855_1007105021 74
304 3300005564 Ga0070664_100004841 Ga0070664_10000484113 74
305 3300005577 Ga0068857_100068787 Ga0068857_1000687874 74
306 3300005578 Ga0068854_100422727 Ga0068854_1004227273 74
307 3300005614 Ga0068856_100000538 Ga0068856_1000005385 74
308 3300005614 Ga0068856_100050193 Ga0068856_1000501938 74
309 3300005614 Ga0068856_101568595 Ga0068856_1015685952 74
310 3300005616 Ga0068852_100001259 Ga0068852_1000012595 74
311 3300005617 Ga0068859_101484528 Ga0068859_1014845282 74
312 3300005834 Ga0068851_10033091 Ga0068851_100330913 74
313 3300005842 Ga0068858_100181733 Ga0068858_1001817336 74
314 3300005844 Ga0068862_100290107 Ga0068862_1002901071 74
315 3300006237 Ga0097621_100185722 Ga0097621_1001857223 74
316 3300006358 Ga0068871_100067451 Ga0068871_1000674515 74
317 3300006931 Ga0097620_101484289 Ga0097620_1014842892 74
318 3300009177 Ga0105248_10000443 Ga0105248_1000044339 74
319 3300009551 Ga0105238_10235939 Ga0105238_102359393 74
320 3300013100 Ga0157373_10163856 Ga0157373_101638562 74
321 3300013102 Ga0157371_10008659 Ga0157371_100086595 74
322 3300013102 Ga0157371_10016795 Ga0157371_100167959 74
323 3300013102 Ga0157371_10068813 Ga0157371_100688133 74
324 3300013104 Ga0157370_10028832 Ga0157370_100288327 74
325 3300013104 Ga0157370_10587628 Ga0157370_105876282 74
326 3300013105 Ga0157369_10073109 Ga0157369_100731094 74
327 3300013105 Ga0157369_10167848 Ga0157369_101678485 74
328 3300013105 Ga0157369_11038114 Ga0157369_110381142 74
329 3300013296 Ga0157374_10121558 Ga0157374_101215584 74
330 3300013306 Ga0163162_10374461 Ga0163162_103744613 74
331 3300013307 Ga0157372_10593956 Ga0157372_105939563 74
332 3300013307 Ga0157372_11331753 Ga0157372_113317532 74
333 3300014325 Ga0163163_10000058 Ga0163163_1000005811 74
334 3300014968 Ga0157379_10069392 Ga0157379_100693924 74
335 3300020082 Ga0206353_10988172 Ga0206353_109881721 74
336 3300025321 Ga0207656_10014271 Ga0207656_100142716 74
337 3300025903 Ga0207680_10012374 Ga0207680_1001237410 74
338 3300025904 Ga0207647_10047835 Ga0207647_100478357 74
339 3300025909 Ga0207705_10002347 Ga0207705_1000234713 74
340 3300025909 Ga0207705_10011926 Ga0207705_100119266 74
341 3300025909 Ga0207705_10431908 Ga0207705_104319083 74
342 3300025912 Ga0207707_10889166 Ga0207707_108891662 74
343 3300025912 Ga0207707_11049000 Ga0207707_110490002 74
344 3300025917 Ga0207660_10124970 Ga0207660_101249703 74
345 3300025917 Ga0207660_10517869 Ga0207660_105178693 74
346 3300025919 Ga0207657_10000126 Ga0207657_100001265 74
347 3300025919 Ga0207657_10051517 Ga0207657_100515173 74
348 3300025920 Ga0207649_10000937 Ga0207649_100009375 74
349 3300025921 Ga0207652_10020733 Ga0207652_100207336 74
350 3300025923 Ga0207681_10490139 Ga0207681_104901392 74
351 3300025924 Ga0207694_10160837 Ga0207694_101608373 74
352 3300025925 Ga0207650_10003655 Ga0207650_100036551 74
353 3300025928 Ga0207700_10299282 Ga0207700_102992821 74
354 3300025931 Ga0207644_10012689 Ga0207644_1001268910 74
355 3300025932 Ga0207690_10000106 Ga0207690_1000010655 74
356 3300025932 Ga0207690_10283280 Ga0207690_102832803 74
357 3300025933 Ga0207706_10000151 Ga0207706_1000015174 74
358 3300025941 Ga0207711_10001912 Ga0207711_1000191212 74
359 3300025944 Ga0207661_10006497 Ga0207661_1000649710 74
360 3300025945 Ga0207679_10002382 Ga0207679_1000238213 74
361 3300025949 Ga0207667_10002108 Ga0207667_1000210824 74
362 3300025949 Ga0207667_10321409 Ga0207667_103214093 74
363 3300025981 Ga0207640_10035980 Ga0207640_100359807 74
364 3300025986 Ga0207658_10002624 Ga0207658_1000262417 74
365 3300026035 Ga0207703_10156311 Ga0207703_101563112 74
366 3300026041 Ga0207639_10000573 Ga0207639_1000057310 74
367 3300026041 Ga0207639_10047785 Ga0207639_100477856 74
368 3300026067 Ga0207678_10010888 Ga0207678_100108885 74
369 3300026078 Ga0207702_10001045 Ga0207702_1000104512 74
370 3300026078 Ga0207702_10059499 Ga0207702_100594994 74
371 3300026088 Ga0207641_10824529 Ga0207641_108245291 74
372 3300026095 Ga0207676_10007892 Ga0207676_1000789213 74
373 3300026116 Ga0207674_10415813 Ga0207674_104158132 74
374 3300026142 Ga0207698_10002899 Ga0207698_1000289910 74
375 3300028379 Ga0268266_10017332 Ga0268266_100173325 74
376 3300031852 Ga0307410_10426408 Ga0307410_104264082 74
377 3300031852 Ga0307410_10993435 Ga0307410_109934352 74
378 3300031903 Ga0307407_10472964 Ga0307407_104729642 74
379 3300031995 Ga0307409_100784373 Ga0307409_1007843733 74
380 3300032005 Ga0307411_11917588 Ga0307411_119175882 74
381 3300035114 Ga0373939_0352234 Ga0373939_0352234_302_547 74
382 3300035121 Ga0373960_0072439 Ga0373960_0072439_741_986 74
383 3300035241 Ga0373961_0109640 Ga0373961_0109640_540_785 74
384 3300035242 Ga0373962_0078700 Ga0373962_0078700_250_495 74
385 3300035691 Ga0373931_0127236 Ga0373931_0127236_398_643 74
386 3300037312 Ga0395899_0029113 Ga0395899_0029113_3631_3876 74
387 3300037312 Ga0395899_0064834 Ga0395899_0064834_1471_1716 74
388 3300037312 Ga0395899_0143187 Ga0395899_0143187_260_505 74
389 3300037418 Ga0395900_0007204 Ga0395900_0007204_4250_4495 74
390 3300037418 Ga0395900_0015090 Ga0395900_0015090_7063_7317 74
391 3300037418 Ga0395900_0034005 Ga0395900_0034005_4733_4978 74
392 3300037418 Ga0395900_0073120 Ga0395900_0073120_201_446 74
393 3300037418 Ga0395900_1308199 Ga0395900_1308199_33_284 74
394 3300037466 Ga0395898_0046153 Ga0395898_0046153_2827_3072 74
395 3300037466 Ga0395898_0156038 Ga0395898_0156038_370_615 74
396 3300037466 Ga0395898_0196576 Ga0395898_0196576_1096_1341 74
397 3300037466 Ga0395898_0328621 Ga0395898_0328621_1101_1346 74
398 3300037466 Ga0395898_0585345 Ga0395898_0585345_542_796 74
399 3300037471 Ga0395905_0001816 Ga0395905_0001816_23643_23888 74
400 3300037471 Ga0395905_0021865 Ga0395905_0021865_2012_2257 74
401 3300037471 Ga0395905_0026041 Ga0395905_0026041_1091_1345 74
402 3300037471 Ga0395905_0096392 Ga0395905_0096392_2064_2309 74
403 3300037471 Ga0395905_0267617 Ga0395905_0267617_1041_1292 74
404 3300037471 Ga0395905_0320919 Ga0395905_0320919_816_1061 74
405 3300038443 Ga0395901_0048833 Ga0395901_0048833_2685_2930 74
406 3300038443 Ga0395901_0078945 Ga0395901_0078945_2208_2462 74
407 3300038443 Ga0395901_0499530 Ga0395901_0499530_657_902 74
408 3300041512 Ga0451853_1184346 Ga0451853_1184346_591_830 74
409 3300044694 Ga0466963_0011810 Ga0466963_0011810_1315_1560 74
410 3300045976 Ga0466967_0034787 Ga0466967_0034787_2519_2764 74
411 3300046684 Ga0495669_0007514 Ga0495669_0007514_1383_1634 74
412 3300047445 Ga0495677_0279321 Ga0495677_0279321_177_428 74
413 3300048912 Ga0496109_0240217 Ga0496109_0240217_881_1126 74
414 3300048913 Ga0496110_0102725 Ga0496110_0102725_865_1110 74
415 3300048914 Ga0496111_0537685 Ga0496111_0537685_361_606 74
416 3300048915 Ga0496112_0803508 Ga0496112_0803508_307_552 74
417 3300059426 Ga0590077_099068 Ga0590077_099068_336_587 74
418 3300005327 Ga0070658_10003530 Ga0070658_100035304 75
419 3300005327 Ga0070658_10004563 Ga0070658_1000456314 75
420 3300005327 Ga0070658_10041796 Ga0070658_100417965 75
421 3300005327 Ga0070658_10421098 Ga0070658_104210981 75
422 3300005329 Ga0070683_100180550 Ga0070683_1001805503 75
423 3300005335 Ga0070666_10033780 Ga0070666_100337801 75
424 3300005336 Ga0070680_100953154 Ga0070680_1009531542 75
425 3300005338 Ga0068868_100040249 Ga0068868_1000402494 75
426 3300005339 Ga0070660_100013726 Ga0070660_1000137269 75
427 3300005339 Ga0070660_100046154 Ga0070660_1000461544 75
428 3300005339 Ga0070660_100375345 Ga0070660_1003753453 75
429 3300005344 Ga0070661_100116973 Ga0070661_1001169732 75
430 3300005344 Ga0070661_101396765 Ga0070661_1013967652 75
431 3300005345 Ga0070692_10001797 Ga0070692_100017976 75
432 3300005345 Ga0070692_10017834 Ga0070692_100178342 75
433 3300005345 Ga0070692_10781996 Ga0070692_107819962 75
434 3300005364 Ga0070673_100110296 Ga0070673_1001102964 75
435 3300005435 Ga0070714_100208154 Ga0070714_1002081545 75
436 3300005440 Ga0070705_100615236 Ga0070705_1006152362 75
437 3300005455 Ga0070663_100055102 Ga0070663_1000551028 75
438 3300005455 Ga0070663_100108543 Ga0070663_1001085434 75
439 3300005458 Ga0070681_10416148 Ga0070681_104161482 75
440 3300005530 Ga0070679_100513010 Ga0070679_1005130102 75
441 3300005530 Ga0070679_101765548 Ga0070679_1017655481 75
442 3300005535 Ga0070684_100151766 Ga0070684_1001517664 75
443 3300005563 Ga0068855_100963859 Ga0068855_1009638592 75
444 3300005563 Ga0068855_101326837 Ga0068855_1013268372 75
445 3300005614 Ga0068856_100333593 Ga0068856_1003335933 75
446 3300005616 Ga0068852_100064099 Ga0068852_1000640993 75
447 3300006844 Ga0075428_100465962 Ga0075428_1004659621 75
448 3300006846 Ga0075430_101061152 Ga0075430_1010611521 75
449 3300006880 Ga0075429_100432455 Ga0075429_1004324552 75
450 3300013100 Ga0157373_10089120 Ga0157373_100891203 75
451 3300013102 Ga0157371_10265602 Ga0157371_102656021 75
452 3300013102 Ga0157371_10877615 Ga0157371_108776152 75
453 3300013104 Ga0157370_10243965 Ga0157370_102439654 75
454 3300013105 Ga0157369_11267770 Ga0157369_112677702 75
455 3300013105 Ga0157369_11482758 Ga0157369_114827582 75
456 3300013296 Ga0157374_12438754 Ga0157374_124387542 75
457 3300013307 Ga0157372_10913690 Ga0157372_109136903 75
458 3300020610 Ga0154015_1390661 Ga0154015_13906612 75
459 3300025903 Ga0207680_10162970 Ga0207680_101629704 75
460 3300025909 Ga0207705_10039426 Ga0207705_100394267 75
461 3300025909 Ga0207705_10160590 Ga0207705_101605903 75
462 3300025912 Ga0207707_10140733 Ga0207707_101407332 75
463 3300025917 Ga0207660_10105145 Ga0207660_101051452 75
464 3300025919 Ga0207657_10003802 Ga0207657_1000380212 75
465 3300025919 Ga0207657_10034671 Ga0207657_100346714 75
466 3300025920 Ga0207649_10076316 Ga0207649_100763163 75
467 3300025921 Ga0207652_10328008 Ga0207652_103280083 75
468 3300025929 Ga0207664_10412321 Ga0207664_104123214 75
469 3300025944 Ga0207661_10148673 Ga0207661_101486734 75
470 3300025949 Ga0207667_10335467 Ga0207667_103354674 75
471 3300025949 Ga0207667_11128349 Ga0207667_111283492 75
472 3300025986 Ga0207658_10763824 Ga0207658_107638241 75
473 3300026023 Ga0207677_10048256 Ga0207677_100482564 75
474 3300026067 Ga0207678_10006377 Ga0207678_1000637715 75
475 3300026067 Ga0207678_10062122 Ga0207678_100621221 75
476 3300026067 Ga0207678_10079589 Ga0207678_100795892 75
477 3300026078 Ga0207702_10210531 Ga0207702_102105313 75
478 3300026142 Ga0207698_10092160 Ga0207698_100921602 75
479 3300031548 Ga0307408_100023329 Ga0307408_1000233295 75
480 3300031731 Ga0307405_10044382 Ga0307405_100443822 75
481 3300031852 Ga0307410_10600990 Ga0307410_106009902 75
482 3300031901 Ga0307406_10119008 Ga0307406_101190083 75
483 3300031903 Ga0307407_10045075 Ga0307407_100450753 75
484 3300031911 Ga0307412_10224331 Ga0307412_102243313 75
485 3300031995 Ga0307409_100125321 Ga0307409_1001253214 75
486 3300032002 Ga0307416_100180772 Ga0307416_1001807723 75
487 3300032004 Ga0307414_10262243 Ga0307414_102622433 75
488 3300032005 Ga0307411_10077747 Ga0307411_100777473 75
489 3300032005 Ga0307411_11529998 Ga0307411_115299981 75
490 3300032126 Ga0307415_100018291 Ga0307415_1000182914 75
491 3300035170 Ga0373943_0007352 Ga0373943_0007352_2660_2908 75
492 3300035171 Ga0373946_0016959 Ga0373946_0016959_1652_1900 75
493 3300035692 Ga0373935_0009197 Ga0373935_0009197_4872_5120 75
494 3300035725 Ga0373947_0066567 Ga0373947_0066567_777_1025 75
495 3300037312 Ga0395899_0000261 Ga0395899_0000261_62867_63121 75
496 3300037312 Ga0395899_0129809 Ga0395899_0129809_731_982 75
497 3300037312 Ga0395899_0264310 Ga0395899_0264310_387_638 75
498 3300037312 Ga0395899_0427382 Ga0395899_0427382_349_600 75
499 3300037418 Ga0395900_0000036 Ga0395900_0000036_91606_91860 75
500 3300037418 Ga0395900_0027017 Ga0395900_0027017_4798_5049 75
501 3300037418 Ga0395900_0072943 Ga0395900_0072943_1847_2098 75
502 3300037466 Ga0395898_0157111 Ga0395898_0157111_1474_1728 75
503 3300037466 Ga0395898_0266292 Ga0395898_0266292_323_574 75
504 3300037466 Ga0395898_0369176 Ga0395898_0369176_1047_1298 75
505 3300037466 Ga0395898_1428388 Ga0395898_1428388_128_382 75
506 3300037471 Ga0395905_0021292 Ga0395905_0021292_3952_4203 75
507 3300037471 Ga0395905_0173926 Ga0395905_0173926_538_792 75
508 3300037471 Ga0395905_0216916 Ga0395905_0216916_689_940 75
509 3300037471 Ga0395905_0218498 Ga0395905_0218498_445_696 75
510 3300037471 Ga0395905_0230665 Ga0395905_0230665_246_497 75
511 3300038443 Ga0395901_0000036 Ga0395901_0000036_128038_128292 75
512 3300038443 Ga0395901_0221686 Ga0395901_0221686_65_316 75
513 3300038443 Ga0395901_0318161 Ga0395901_0318161_323_574 75
514 3300041408 Ga0439453_0124444 Ga0439453_0124444_35_286 75
515 3300041413 Ga0439465_0036102 Ga0439465_0036102_856_1104 75
516 3300042005 Ga0439448_0003366 Ga0439448_0003366_3669_3920 75
517 3300042006 Ga0439432_069814 Ga0439432_069814_492_740 75
518 3300042012 Ga0439455_0030288 Ga0439455_0030288_476_727 75
519 3300042157 Ga0439458_0000154 Ga0439458_0000154_10746_10997 75
520 3300049515 Ga0501292_030873 Ga0501292_030873_79_327 75
521 3300049519 Ga0501296_023567 Ga0501296_023567_180_428 75
522 3300049551 Ga0501335_033951 Ga0501335_033951_273_521 75
523 3300049649 Ga0501198_002666 Ga0501198_002666_722_970 75
524 3300049650 Ga0501199_019343 Ga0501199_019343_380_628 75
525 3300049660 Ga0501216_040969 Ga0501216_040969_450_698 75
526 3300049663 Ga0501223_002563 Ga0501223_002563_2581_2829 75
527 3300049665 Ga0501227_006974 Ga0501227_006974_1766_2014 75
528 3300049669 Ga0501235_000839 Ga0501235_000839_100_348 75
529 3300049670 Ga0501236_005573 Ga0501236_005573_1101_1349 75
530 3300049674 Ga0501242_002577 Ga0501242_002577_96_344 75
531 3300049677 Ga0501247_046328 Ga0501247_046328_79_327 75
532 3300049682 Ga0501252_002644 Ga0501252_002644_1413_1661 75
533 3300049687 Ga0501258_026822 Ga0501258_026822_256_504 75
534 3300049688 Ga0501259_012244 Ga0501259_012244_403_651 75
535 3300049704 Ga0501221_002834 Ga0501221_002834_283_531 75
536 3300049705 Ga0501225_0005682 Ga0501225_0005682_283_531 75
537 3300049706 Ga0501229_055266 Ga0501229_055266_310_558 75
538 3300049707 Ga0501234_041584 Ga0501234_041584_339_587 75
539 3300049759 Ga0501262_000723 Ga0501262_000723_2024_2272 75
540 3300049765 Ga0501268_014506 Ga0501268_014506_705_953 75
541 3300049767 Ga0501270_003667 Ga0501270_003667_477_725 75
542 3300049769 Ga0501272_004369 Ga0501272_004369_370_618 75
543 3300049770 Ga0501273_036952 Ga0501273_036952_256_504 75
544 3300049851 Ga0501212_043151 Ga0501212_043151_256_504 75
545 3300050508 nmdc:mga09592_430071_c1 nmdc:mga09592_430071_c1_470_724 75
546 3300005434 Ga0070709_10212295 Ga0070709_102122952 76
547 3300005435 Ga0070714_100030055 Ga0070714_1000300559 76
548 3300005435 Ga0070714_100059117 Ga0070714_1000591176 76
549 3300005435 Ga0070714_100137572 Ga0070714_1001375721 76
550 3300005436 Ga0070713_100014227 Ga0070713_1000142274 76
551 3300005436 Ga0070713_100147383 Ga0070713_1001473832 76
552 3300005436 Ga0070713_100150026 Ga0070713_1001500264 76
553 3300006028 Ga0070717_10003857 Ga0070717_100038576 76
554 3300006028 Ga0070717_10651326 Ga0070717_106513262 76
555 3300006173 Ga0070716_100248592 Ga0070716_1002485922 76
556 3300009093 Ga0105240_10645616 Ga0105240_106456163 76
557 3300009545 Ga0105237_10614269 Ga0105237_106142692 76
558 3300009551 Ga0105238_12209630 Ga0105238_122096302 76
559 3300010375 Ga0105239_10522398 Ga0105239_105223984 76
560 3300013100 Ga0157373_10042424 Ga0157373_100424247 76
561 3300013104 Ga0157370_11006610 Ga0157370_110066103 76
562 3300013105 Ga0157369_10170396 Ga0157369_101703964 76
563 3300013307 Ga0157372_10441451 Ga0157372_104414514 76
564 3300025928 Ga0207700_10427408 Ga0207700_104274082 76
565 3300025928 Ga0207700_10431149 Ga0207700_104311494 76
566 3300025928 Ga0207700_10742058 Ga0207700_107420582 76
567 3300025929 Ga0207664_10168872 Ga0207664_101688723 76
568 3300025929 Ga0207664_10297246 Ga0207664_102972461 76
569 3300025929 Ga0207664_11037995 Ga0207664_110379952 76
570 3300025939 Ga0207665_10108440 Ga0207665_101084402 76
571 3300037312 Ga0395899_0140771 Ga0395899_0140771_216_470 76
572 3300037418 Ga0395900_0051163 Ga0395900_0051163_129_395 76
573 3300037418 Ga0395900_1682146 Ga0395900_1682146_244_498 76
574 3300037466 Ga0395898_0157678 Ga0395898_0157678_23_289 76
575 3300037466 Ga0395898_0986484 Ga0395898_0986484_168_422 76
576 3300037471 Ga0395905_0034161 Ga0395905_0034161_540_806 76
577 3300037471 Ga0395905_0166595 Ga0395905_0166595_839_1090 76
578 3300037471 Ga0395905_0171558 Ga0395905_0171558_1616_1870 76
579 3300037471 Ga0395905_1194766 Ga0395905_1194766_284_550 76
580 3300038443 Ga0395901_0056121 Ga0395901_0056121_295_561 76
581 3300038443 Ga0395901_0358286 Ga0395901_0358286_852_1106 76
582 3300044684 Ga0466966_0102924 Ga0466966_0102924_1109_1369 76
583 3300044694 Ga0466963_0085151 Ga0466963_0085151_1277_1540 76
584 3300045836 Ga0466958_0153603 Ga0466958_0153603_597_860 76
585 3300045976 Ga0466967_0121799 Ga0466967_0121799_91_354 76
586 3300050513 nmdc:mga0rr50_93274_c1 nmdc:mga0rr50_93274_c1_1181_1438 76
587 3300001915 JGI24741J21665_1033965 JGI24741J21665_10339652 77
588 3300001979 JGI24740J21852_10006386 JGI24740J21852_100063865 77
589 3300001989 JGI24739J22299_10000378 JGI24739J22299_1000037815 77
590 3300001990 JGI24737J22298_10000438 JGI24737J22298_1000043813 77
591 3300002075 JGI24738J21930_10003426 JGI24738J21930_100034266 77
592 3300002077 JGI24744J21845_10075494 JGI24744J21845_100754942 77
593 3300005293 Ga0065715_10429166 Ga0065715_104291663 77
594 3300005327 Ga0070658_10068698 Ga0070658_100686982 77
595 3300005328 Ga0070676_10005815 Ga0070676_100058157 77
596 3300005328 Ga0070676_11030101 Ga0070676_110301012 77
597 3300005329 Ga0070683_102194634 Ga0070683_1021946341 77
598 3300005330 Ga0070690_100643257 Ga0070690_1006432571 77
599 3300005331 Ga0070670_100034717 Ga0070670_1000347178 77
600 3300005331 Ga0070670_101028748 Ga0070670_1010287482 77
601 3300005335 Ga0070666_10410738 Ga0070666_104107383 77
602 3300005338 Ga0068868_100006361 Ga0068868_1000063618 77
603 3300005339 Ga0070660_100063778 Ga0070660_1000637785 77
604 3300005343 Ga0070687_100133740 Ga0070687_1001337405 77
605 3300005344 Ga0070661_100053915 Ga0070661_1000539159 77
606 3300005344 Ga0070661_100089633 Ga0070661_1000896334 77
607 3300005344 Ga0070661_100913717 Ga0070661_1009137172 77
608 3300005347 Ga0070668_100269459 Ga0070668_1002694593 77
609 3300005353 Ga0070669_100000565 Ga0070669_1000005655 77
610 3300005354 Ga0070675_100043992 Ga0070675_1000439929 77
611 3300005355 Ga0070671_100062925 Ga0070671_1000629253 77
612 3300005355 Ga0070671_100221202 Ga0070671_1002212024 77
613 3300005356 Ga0070674_102118904 Ga0070674_1021189041 77
614 3300005364 Ga0070673_100010306 Ga0070673_1000103065 77
615 3300005366 Ga0070659_100004211 Ga0070659_10000421114 77
616 3300005366 Ga0070659_100008451 Ga0070659_10000845112 77
617 3300005367 Ga0070667_100002091 Ga0070667_10000209116 77
618 3300005367 Ga0070667_100737056 Ga0070667_1007370561 77
619 3300005455 Ga0070663_100283832 Ga0070663_1002838323 77
620 3300005455 Ga0070663_100361851 Ga0070663_1003618513 77
621 3300005455 Ga0070663_100554416 Ga0070663_1005544162 77
622 3300005456 Ga0070678_100110897 Ga0070678_1001108973 77
623 3300005457 Ga0070662_100003479 Ga0070662_10000347910 77
624 3300005457 Ga0070662_100615085 Ga0070662_1006150853 77
625 3300005457 Ga0070662_100885873 Ga0070662_1008858732 77
626 3300005458 Ga0070681_10484390 Ga0070681_104843903 77
627 3300005459 Ga0068867_100000818 Ga0068867_1000008185 77
628 3300005459 Ga0068867_100008041 Ga0068867_1000080414 77
629 3300005539 Ga0068853_100032999 Ga0068853_1000329993 77
630 3300005539 Ga0068853_100233721 Ga0068853_1002337212 77
631 3300005543 Ga0070672_100061279 Ga0070672_1000612793 77
632 3300005543 Ga0070672_100273250 Ga0070672_1002732504 77
633 3300005547 Ga0070693_100867735 Ga0070693_1008677351 77
634 3300005548 Ga0070665_100005836 Ga0070665_10000583611 77
635 3300005548 Ga0070665_100625686 Ga0070665_1006256862 77
636 3300005563 Ga0068855_100396531 Ga0068855_1003965313 77
637 3300005563 Ga0068855_100668067 Ga0068855_1006680672 77
638 3300005564 Ga0070664_100012195 Ga0070664_1000121959 77
639 3300005564 Ga0070664_100283199 Ga0070664_1002831994 77
640 3300005577 Ga0068857_100011311 Ga0068857_10001131113 77
641 3300005578 Ga0068854_100028696 Ga0068854_1000286963 77
642 3300005578 Ga0068854_100299905 Ga0068854_1002999053 77
643 3300005614 Ga0068856_100658421 Ga0068856_1006584213 77
644 3300005616 Ga0068852_100053492 Ga0068852_1000534927 77
645 3300005616 Ga0068852_100260972 Ga0068852_1002609725 77
646 3300005616 Ga0068852_100444124 Ga0068852_1004441244 77
647 3300005616 Ga0068852_101524601 Ga0068852_1015246012 77
648 3300005617 Ga0068859_100060129 Ga0068859_1000601293 77
649 3300005618 Ga0068864_100001241 Ga0068864_10000124124 77
650 3300005718 Ga0068866_10055233 Ga0068866_100552332 77
651 3300005719 Ga0068861_100109047 Ga0068861_1001090473 77
652 3300005834 Ga0068851_10009861 Ga0068851_100098613 77
653 3300005834 Ga0068851_10420087 Ga0068851_104200872 77
654 3300005840 Ga0068870_10082254 Ga0068870_100822542 77
655 3300005841 Ga0068863_100006362 Ga0068863_10000636213 77
656 3300005843 Ga0068860_100032878 Ga0068860_1000328787 77
657 3300005843 Ga0068860_100133731 Ga0068860_1001337313 77
658 3300005983 Ga0081540_1314932 Ga0081540_13149322 77
659 3300006358 Ga0068871_100320483 Ga0068871_1003204832 77
660 3300006358 Ga0068871_100611353 Ga0068871_1006113533 77
661 3300006881 Ga0068865_100047978 Ga0068865_1000479783 77
662 3300006931 Ga0097620_100060129 Ga0097620_1000601293 77
663 3300009092 Ga0105250_10167012 Ga0105250_101670123 77
664 3300009093 Ga0105240_12115650 Ga0105240_121156502 77
665 3300009098 Ga0105245_10000782 Ga0105245_1000078230 77
666 3300009101 Ga0105247_11537823 Ga0105247_115378232 77
667 3300009148 Ga0105243_10042556 Ga0105243_100425564 77
668 3300009176 Ga0105242_11118682 Ga0105242_111186821 77
669 3300009177 Ga0105248_10003845 Ga0105248_100038452 77
670 3300009177 Ga0105248_10105445 Ga0105248_101054453 77
671 3300009177 Ga0105248_12859339 Ga0105248_128593392 77
672 3300009551 Ga0105238_10079835 Ga0105238_100798358 77
673 3300009551 Ga0105238_10178102 Ga0105238_101781023 77
674 3300009551 Ga0105238_10448863 Ga0105238_104488633 77
675 3300010375 Ga0105239_10020946 Ga0105239_1002094612 77
676 3300011119 Ga0105246_10007706 Ga0105246_100077066 77
677 3300013100 Ga0157373_10452445 Ga0157373_104524453 77
678 3300013102 Ga0157371_10013469 Ga0157371_100134699 77
679 3300013104 Ga0157370_10005413 Ga0157370_100054133 77
680 3300013297 Ga0157378_10049574 Ga0157378_100495744 77
681 3300013306 Ga0163162_10054638 Ga0163162_100546387 77
682 3300013306 Ga0163162_10114319 Ga0163162_101143193 77
683 3300013308 Ga0157375_10115316 Ga0157375_101153166 77
684 3300014745 Ga0157377_10072623 Ga0157377_100726231 77
685 3300017792 Ga0163161_10111939 Ga0163161_101119392 77
686 3300025290 Ga0207673_1009686 Ga0207673_10096863 77
687 3300025315 Ga0207697_10003187 Ga0207697_1000318714 77
688 3300025321 Ga0207656_10012905 Ga0207656_100129051 77
689 3300025893 Ga0207682_10387833 Ga0207682_103878331 77
690 3300025899 Ga0207642_10106444 Ga0207642_101064445 77
691 3300025901 Ga0207688_10026749 Ga0207688_100267496 77
692 3300025904 Ga0207647_10016767 Ga0207647_100167673 77
693 3300025907 Ga0207645_10015526 Ga0207645_100155265 77
694 3300025912 Ga0207707_10473331 Ga0207707_104733313 77
695 3300025913 Ga0207695_11608841 Ga0207695_116088412 77
696 3300025918 Ga0207662_10148154 Ga0207662_101481542 77
697 3300025920 Ga0207649_10127278 Ga0207649_101272782 77
698 3300025920 Ga0207649_10231538 Ga0207649_102315383 77
699 3300025923 Ga0207681_10010000 Ga0207681_100100004 77
700 3300025924 Ga0207694_10200744 Ga0207694_102007443 77
701 3300025925 Ga0207650_10032491 Ga0207650_100324913 77
702 3300025925 Ga0207650_11143361 Ga0207650_111433612 77
703 3300025926 Ga0207659_10817726 Ga0207659_108177262 77
704 3300025927 Ga0207687_10013795 Ga0207687_100137953 77
705 3300025931 Ga0207644_10068554 Ga0207644_100685547 77
706 3300025931 Ga0207644_10140478 Ga0207644_101404784 77
707 3300025932 Ga0207690_10006739 Ga0207690_100067399 77
708 3300025933 Ga0207706_10005896 Ga0207706_100058969 77
709 3300025933 Ga0207706_10034827 Ga0207706_100348274 77
710 3300025933 Ga0207706_10128684 Ga0207706_101286842 77
711 3300025933 Ga0207706_10205907 Ga0207706_102059072 77
712 3300025935 Ga0207709_10030191 Ga0207709_100301914 77
713 3300025940 Ga0207691_10007770 Ga0207691_1000777011 77
714 3300025940 Ga0207691_10138182 Ga0207691_101381824 77
715 3300025941 Ga0207711_10189157 Ga0207711_101891572 77
716 3300025941 Ga0207711_10780502 Ga0207711_107805022 77
717 3300025942 Ga0207689_10000167 Ga0207689_1000016748 77
718 3300025945 Ga0207679_10015266 Ga0207679_100152662 77
719 3300025945 Ga0207679_10353971 Ga0207679_103539712 77
720 3300025945 Ga0207679_10430961 Ga0207679_104309611 77
721 3300025949 Ga0207667_10125942 Ga0207667_101259425 77
722 3300025960 Ga0207651_10001801 Ga0207651_100018013 77
723 3300025972 Ga0207668_10071748 Ga0207668_100717486 77
724 3300025972 Ga0207668_12055678 Ga0207668_120556782 77
725 3300025981 Ga0207640_10025143 Ga0207640_100251436 77
726 3300025981 Ga0207640_10443572 Ga0207640_104435722 77
727 3300025986 Ga0207658_10029117 Ga0207658_1002911710 77
728 3300025986 Ga0207658_10728071 Ga0207658_107280711 77
729 3300026023 Ga0207677_10002698 Ga0207677_1000269810 77
730 3300026035 Ga0207703_10045860 Ga0207703_100458604 77
731 3300026041 Ga0207639_10002893 Ga0207639_1000289310 77
732 3300026041 Ga0207639_10103686 Ga0207639_101036862 77
733 3300026041 Ga0207639_10241778 Ga0207639_102417784 77
734 3300026067 Ga0207678_10281897 Ga0207678_102818973 77
735 3300026067 Ga0207678_10342903 Ga0207678_103429033 77
736 3300026067 Ga0207678_10414955 Ga0207678_104149552 77
737 3300026067 Ga0207678_10775979 Ga0207678_107759792 77
738 3300026078 Ga0207702_10442956 Ga0207702_104429562 77
739 3300026088 Ga0207641_10080480 Ga0207641_100804804 77
740 3300026089 Ga0207648_10001222 Ga0207648_100012229 77
741 3300026089 Ga0207648_10016014 Ga0207648_100160145 77
742 3300026095 Ga0207676_10016650 Ga0207676_100166505 77
743 3300026095 Ga0207676_11277125 Ga0207676_112771252 77
744 3300026116 Ga0207674_10002073 Ga0207674_1000207332 77
745 3300026118 Ga0207675_100142165 Ga0207675_1001421654 77
746 3300026121 Ga0207683_10109265 Ga0207683_101092653 77
747 3300026121 Ga0207683_10135548 Ga0207683_101355484 77
748 3300026142 Ga0207698_10026332 Ga0207698_100263329 77
749 3300026142 Ga0207698_11818686 Ga0207698_118186862 77
750 3300028379 Ga0268266_10000950 Ga0268266_100009508 77
751 3300028379 Ga0268266_10236407 Ga0268266_102364075 77
752 3300028379 Ga0268266_10635015 Ga0268266_106350151 77
753 3300028381 Ga0268264_10046189 Ga0268264_100461893 77
754 3300028381 Ga0268264_10065660 Ga0268264_100656604 77
755 3300031548 Ga0307408_100226711 Ga0307408_1002267113 77
756 3300031548 Ga0307408_100562602 Ga0307408_1005626023 77
757 3300031731 Ga0307405_10041065 Ga0307405_100410652 77
758 3300031731 Ga0307405_11439762 Ga0307405_114397622 77
759 3300031901 Ga0307406_10274880 Ga0307406_102748803 77
760 3300031901 Ga0307406_10392371 Ga0307406_103923713 77
761 3300031911 Ga0307412_10041732 Ga0307412_100417324 77
762 3300032002 Ga0307416_100075543 Ga0307416_1000755433 77
763 3300032002 Ga0307416_100581963 Ga0307416_1005819634 77
764 3300032002 Ga0307416_100979418 Ga0307416_1009794183 77
765 3300035691 Ga0373931_0220302 Ga0373931_0220302_763_1020 77
766 3300037312 Ga0395899_0073077 Ga0395899_0073077_293_553 77
767 3300037418 Ga0395900_0025107 Ga0395900_0025107_145_402 77
768 3300037418 Ga0395900_0089785 Ga0395900_0089785_437_697 77
769 3300037466 Ga0395898_0077919 Ga0395898_0077919_2732_2989 77
770 3300037466 Ga0395898_0158678 Ga0395898_0158678_266_526 77
771 3300037471 Ga0395905_0067932 Ga0395905_0067932_2302_2562 77
772 3300037471 Ga0395905_0088113 Ga0395905_0088113_1500_1760 77
773 3300038443 Ga0395901_0159150 Ga0395901_0159150_45_305 77
774 3300038443 Ga0395901_0160151 Ga0395901_0160151_559_816 77
775 3300044693 Ga0466961_0063876 Ga0466961_0063876_1708_1965 77
776 3300045049 Ga0466959_0142119 Ga0466959_0142119_647_904 77
777 3300045836 Ga0466958_0943243 Ga0466958_0943243_13_270 77
778 3300045836 Ga0466958_1138175 Ga0466958_1138175_223_480 77
779 3300046528 Ga0495642_0163347 Ga0495642_0163347_261_515 77
780 3300046528 Ga0495642_0536828 Ga0495642_0536828_181_432 77
781 3300046684 Ga0495669_0089420 Ga0495669_0089420_1028_1279 77
782 3300046684 Ga0495669_0130306 Ga0495669_0130306_441_692 77
783 3300046684 Ga0495669_0179497 Ga0495669_0179497_371_625 77
784 3300046684 Ga0495669_0405076 Ga0495669_0405076_123_383 77
785 3300047445 Ga0495677_0058880 Ga0495677_0058880_152_403 77
786 3300048918 Ga0496115_0497419 Ga0496115_0497419_38_292 77
787 3300049583 Ga0501067_0254396 Ga0501067_0254396_496_753 77
788 3300049584 Ga0501068_0029686 Ga0501068_0029686_913_1164 77
789 3300049585 Ga0501069_0448975 Ga0501069_0448975_476_727 77
790 3300049586 Ga0501070_1412000 Ga0501070_1412000_266_517 77
791 3300001904 JGI24736J21556_1021267 JGI24736J21556_10212672 79
792 3300001915 JGI24741J21665_1003236 JGI24741J21665_10032367 79
793 3300001979 JGI24740J21852_10008822 JGI24740J21852_100088223 79
794 3300001989 JGI24739J22299_10077429 JGI24739J22299_100774294 79
795 3300001990 JGI24737J22298_10035882 JGI24737J22298_100358822 79
796 3300002067 JGI24735J21928_10000581 JGI24735J21928_1000058115 79
797 3300005329 Ga0070683_100382418 Ga0070683_1003824183 79
798 3300005336 Ga0070680_100031873 Ga0070680_1000318736 79
799 3300005337 Ga0070682_100068961 Ga0070682_1000689613 79
800 3300005344 Ga0070661_100580567 Ga0070661_1005805671 79
801 3300005366 Ga0070659_101860591 Ga0070659_1018605912 79
802 3300005455 Ga0070663_100070717 Ga0070663_1000707177 79
803 3300005457 Ga0070662_100044861 Ga0070662_1000448612 79
804 3300005458 Ga0070681_10425709 Ga0070681_104257092 79
805 3300005535 Ga0070684_100133757 Ga0070684_1001337574 79
806 3300005539 Ga0068853_100070421 Ga0068853_1000704212 79
807 3300005563 Ga0068855_101006428 Ga0068855_1010064282 79
808 3300005564 Ga0070664_100121711 Ga0070664_1001217115 79
809 3300005577 Ga0068857_100100522 Ga0068857_1001005225 79
810 3300005578 Ga0068854_100050057 Ga0068854_1000500578 79
811 3300005614 Ga0068856_100534488 Ga0068856_1005344883 79
812 3300005616 Ga0068852_100363828 Ga0068852_1003638284 79
813 3300005834 Ga0068851_10017033 Ga0068851_100170332 79
814 3300009551 Ga0105238_10180190 Ga0105238_101801905 79
815 3300013100 Ga0157373_10182542 Ga0157373_101825423 79
816 3300013102 Ga0157371_10063630 Ga0157371_100636305 79
817 3300013105 Ga0157369_10879445 Ga0157369_108794453 79
818 3300013307 Ga0157372_10931968 Ga0157372_109319683 79
819 3300025904 Ga0207647_10000857 Ga0207647_100008578 79
820 3300025909 Ga0207705_10072555 Ga0207705_100725554 79
821 3300025917 Ga0207660_10189111 Ga0207660_101891113 79
822 3300025919 Ga0207657_10008325 Ga0207657_100083257 79
823 3300025920 Ga0207649_10744590 Ga0207649_107445902 79
824 3300025921 Ga0207652_10167059 Ga0207652_101670594 79
825 3300025933 Ga0207706_10007738 Ga0207706_100077389 79
826 3300025944 Ga0207661_11373800 Ga0207661_113738003 79
827 3300025945 Ga0207679_11156104 Ga0207679_111561042 79
828 3300025981 Ga0207640_10445883 Ga0207640_104458833 79
829 3300026067 Ga0207678_10005637 Ga0207678_1000563711 79
830 3300026078 Ga0207702_10073760 Ga0207702_100737606 79
831 3300026116 Ga0207674_10078939 Ga0207674_100789397 79
832 3300026142 Ga0207698_10086173 Ga0207698_100861732 79

Feature Viewer

pLDDT pTM Quality
71.73 0.31 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map