F482711
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 832 | 256 | 815 | 81 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100059117|Ga0070714_1000591176 |
| Length | 88 |
| Sequence | MDSGQLTAVLIVGMIMMASIVRARYGYSRLGRFRRYRGDIGPPPEQNSENLRLRDEVKELKERIKVLERITVDKENSLANEIESLRDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 106 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 165 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 175 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 179 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 193 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 194 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 195 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 196 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 197 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 198 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 199 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 200 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 201 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 202 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 203 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 204 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 205 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 206 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 207 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 208 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 209 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 210 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 211 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 212 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 217 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 220 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 221 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 222 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 223 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 224 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 225 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 226 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 232 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 233 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 234 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 235 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 236 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 237 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 238 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 239 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 240 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 241 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 242 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 243 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 244 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 245 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 246 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 247 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 248 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 249 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 250 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 251 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 252 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 253 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 256 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.52 |
| Metatranscriptomes | 0.48 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.68 |
| Rhizosphere | 97.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1021267 | 3300001904 | Bacteria | 1017 |
| 2 | JGI24741J21665_1003236 | 3300001915 | Bacteria | 3947 |
| 3 | JGI24741J21665_1005189 | 3300001915 | Bacteria | 2766 |
| 4 | JGI24741J21665_1033965 | 3300001915 | Bacteria | 759 |
| 5 | JGI24741J21665_1035295 | 3300001915 | Unclassified | 743 |
| 6 | JGI24740J21852_10006386 | 3300001979 | Bacteria | 4887 |
| 7 | JGI24740J21852_10008822 | 3300001979 | Bacteria | 3996 |
| 8 | JGI24740J21852_10010449 | 3300001979 | Bacteria | 3573 |
| 9 | JGI24740J21852_10018367 | 3300001979 | Unclassified | 2482 |
| 10 | JGI24739J22299_10000378 | 3300001989 | Bacteria | 15359 |
| 11 | JGI24739J22299_10030758 | 3300001989 | Bacteria | 1860 |
| 12 | JGI24739J22299_10031244 | 3300001989 | Bacteria | 1841 |
| 13 | JGI24739J22299_10077429 | 3300001989 | Bacteria | 1025 |
| 14 | JGI24737J22298_10000438 | 3300001990 | Bacteria | 14246 |
| 15 | JGI24737J22298_10001931 | 3300001990 | Bacteria | 7414 |
| 16 | JGI24737J22298_10024715 | 3300001990 | Bacteria | 1902 |
| 17 | JGI24737J22298_10035882 | 3300001990 | Bacteria | 1533 |
| 18 | JGI24737J22298_10266458 | 3300001990 | Unclassified | 507 |
| 19 | JGI24735J21928_10000581 | 3300002067 | Bacteria | 12847 |
| 20 | JGI24735J21928_10006779 | 3300002067 | Bacteria | 3755 |
| 21 | JGI24735J21928_10069705 | 3300002067 | Unclassified | 1007 |
| 22 | JGI24738J21930_10003426 | 3300002075 | Bacteria | 4002 |
| 23 | JGI24738J21930_10012231 | 3300002075 | Bacteria | 1875 |
| 24 | JGI24744J21845_10075494 | 3300002077 | Unclassified | 615 |
| 25 | Ga0058861_10696430 | 3300004800 | Bacteria | 625 |
| 26 | Ga0065712_10095813 | 3300005290 | Bacteria | 2190 |
| 27 | Ga0065715_10429166 | 3300005293 | Bacteria | 849 |
| 28 | Ga0065715_10826821 | 3300005293 | Unclassified | 600 |
| 29 | Ga0070658_10003530 | 3300005327 | Bacteria | 12834 |
| 30 | Ga0070658_10003538 | 3300005327 | Bacteria | 12823 |
| 31 | Ga0070658_10004563 | 3300005327 | Bacteria | 11255 |
| 32 | Ga0070658_10041796 | 3300005327 | Bacteria | 3698 |
| 33 | Ga0070658_10068698 | 3300005327 | Bacteria | 2897 |
| 34 | Ga0070658_10078114 | 3300005327 | Bacteria | 2716 |
| 35 | Ga0070658_10137400 | 3300005327 | Bacteria | 2040 |
| 36 | Ga0070658_10270541 | 3300005327 | Bacteria | 1445 |
| 37 | Ga0070658_10419631 | 3300005327 | Bacteria | 1150 |
| 38 | Ga0070658_10421098 | 3300005327 | Bacteria | 1148 |
| 39 | Ga0070676_10005815 | 3300005328 | Bacteria | 6575 |
| 40 | Ga0070676_10742058 | 3300005328 | Bacteria | 720 |
| 41 | Ga0070676_11030101 | 3300005328 | Archaea | 619 |
| 42 | Ga0070683_100005945 | 3300005329 | Bacteria | 10211 |
| 43 | Ga0070683_100035499 | 3300005329 | Bacteria | 4557 |
| 44 | Ga0070683_100180550 | 3300005329 | Bacteria | 2003 |
| 45 | Ga0070683_100278105 | 3300005329 | Bacteria | 1592 |
| 46 | Ga0070683_100294696 | 3300005329 | Bacteria | 1543 |
| 47 | Ga0070683_100382418 | 3300005329 | Bacteria | 1341 |
| 48 | Ga0070683_100729113 | 3300005329 | Bacteria | 949 |
| 49 | Ga0070683_101400995 | 3300005329 | Unclassified | 672 |
| 50 | Ga0070683_102194634 | 3300005329 | Bacteria | 530 |
| 51 | Ga0070690_100158398 | 3300005330 | Bacteria | 1549 |
| 52 | Ga0070690_100643257 | 3300005330 | Bacteria | 809 |
| 53 | Ga0070670_100002725 | 3300005331 | Bacteria | 14599 |
| 54 | Ga0070670_100034717 | 3300005331 | Bacteria | 4340 |
| 55 | Ga0070670_101028748 | 3300005331 | Bacteria | 750 |
| 56 | Ga0070677_10027587 | 3300005333 | Bacteria | 2139 |
| 57 | Ga0070666_10000623 | 3300005335 | Bacteria | 21258 |
| 58 | Ga0070666_10033780 | 3300005335 | Bacteria | 3387 |
| 59 | Ga0070666_10410738 | 3300005335 | Bacteria | 974 |
| 60 | Ga0070680_100031873 | 3300005336 | Bacteria | 4238 |
| 61 | Ga0070680_100125730 | 3300005336 | Bacteria | 2142 |
| 62 | Ga0070680_100482373 | 3300005336 | Bacteria | 1060 |
| 63 | Ga0070680_100545601 | 3300005336 | Bacteria | 993 |
| 64 | Ga0070680_100651464 | 3300005336 | Bacteria | 905 |
| 65 | Ga0070680_100953154 | 3300005336 | Bacteria | 741 |
| 66 | Ga0070680_101134350 | 3300005336 | Bacteria | 676 |
| 67 | Ga0070680_101260833 | 3300005336 | Unclassified | 639 |
| 68 | Ga0070682_100025859 | 3300005337 | Bacteria | 3507 |
| 69 | Ga0070682_100068961 | 3300005337 | Bacteria | 2257 |
| 70 | Ga0070682_100098702 | 3300005337 | Bacteria | 1924 |
| 71 | Ga0070682_101628977 | 3300005337 | Bacteria | 559 |
| 72 | Ga0068868_100006361 | 3300005338 | Bacteria | 8354 |
| 73 | Ga0068868_100040249 | 3300005338 | Bacteria | 3637 |
| 74 | Ga0068868_100243073 | 3300005338 | Bacteria | 1513 |
| 75 | Ga0070660_100000560 | 3300005339 | Bacteria | 24966 |
| 76 | Ga0070660_100013726 | 3300005339 | Bacteria | 5823 |
| 77 | Ga0070660_100046154 | 3300005339 | Bacteria | 3338 |
| 78 | Ga0070660_100052691 | 3300005339 | Bacteria | 3137 |
| 79 | Ga0070660_100063778 | 3300005339 | Bacteria | 2864 |
| 80 | Ga0070660_100095812 | 3300005339 | Bacteria | 2346 |
| 81 | Ga0070660_100355773 | 3300005339 | Bacteria | 1206 |
| 82 | Ga0070660_100375345 | 3300005339 | Bacteria | 1173 |
| 83 | Ga0070691_11026623 | 3300005341 | Bacteria | 516 |
| 84 | Ga0070687_100133740 | 3300005343 | Bacteria | 1435 |
| 85 | Ga0070687_101087827 | 3300005343 | Bacteria | 584 |
| 86 | Ga0070661_100000075 | 3300005344 | Bacteria | 79164 |
| 87 | Ga0070661_100021031 | 3300005344 | Bacteria | 4658 |
| 88 | Ga0070661_100028515 | 3300005344 | Bacteria | 4027 |
| 89 | Ga0070661_100053915 | 3300005344 | Bacteria | 2945 |
| 90 | Ga0070661_100089633 | 3300005344 | Bacteria | 2277 |
| 91 | Ga0070661_100116973 | 3300005344 | Bacteria | 1994 |
| 92 | Ga0070661_100119254 | 3300005344 | Bacteria | 1975 |
| 93 | Ga0070661_100580567 | 3300005344 | Bacteria | 904 |
| 94 | Ga0070661_100913717 | 3300005344 | Bacteria | 725 |
| 95 | Ga0070661_101184247 | 3300005344 | Bacteria | 639 |
| 96 | Ga0070661_101396765 | 3300005344 | Bacteria | 589 |
| 97 | Ga0070692_10001797 | 3300005345 | Bacteria | 8019 |
| 98 | Ga0070692_10017834 | 3300005345 | Bacteria | 3402 |
| 99 | Ga0070692_10019568 | 3300005345 | Bacteria | 3269 |
| 100 | Ga0070692_10058373 | 3300005345 | Bacteria | 2026 |
| 101 | Ga0070692_10236840 | 3300005345 | Bacteria | 1086 |
| 102 | Ga0070692_10781996 | 3300005345 | Bacteria | 650 |
| 103 | Ga0070668_100269459 | 3300005347 | Bacteria | 1419 |
| 104 | Ga0070668_100902174 | 3300005347 | Bacteria | 790 |
| 105 | Ga0070669_100000565 | 3300005353 | Bacteria | 27565 |
| 106 | Ga0070669_100038298 | 3300005353 | Bacteria | 3481 |
| 107 | Ga0070669_100671160 | 3300005353 | Bacteria | 873 |
| 108 | Ga0070675_100043992 | 3300005354 | Bacteria | 3652 |
| 109 | Ga0070675_100090380 | 3300005354 | Bacteria | 2564 |
| 110 | Ga0070671_100017555 | 3300005355 | Bacteria | 5798 |
| 111 | Ga0070671_100031625 | 3300005355 | Bacteria | 4373 |
| 112 | Ga0070671_100062925 | 3300005355 | Bacteria | 3089 |
| 113 | Ga0070671_100221202 | 3300005355 | Bacteria | 1606 |
| 114 | Ga0070674_100131349 | 3300005356 | Bacteria | 1867 |
| 115 | Ga0070674_102118904 | 3300005356 | Bacteria | 513 |
| 116 | Ga0070673_100010306 | 3300005364 | Bacteria | 6321 |
| 117 | Ga0070673_100110296 | 3300005364 | Unclassified | 2281 |
| 118 | Ga0070673_100892071 | 3300005364 | Unclassified | 824 |
| 119 | Ga0070673_101251533 | 3300005364 | Bacteria | 696 |
| 120 | Ga0070688_101767422 | 3300005365 | Bacteria | 507 |
| 121 | Ga0070659_100004211 | 3300005366 | Bacteria | 10269 |
| 122 | Ga0070659_100004345 | 3300005366 | Bacteria | 10118 |
| 123 | Ga0070659_100008451 | 3300005366 | Bacteria | 7522 |
| 124 | Ga0070659_100136344 | 3300005366 | Bacteria | 1996 |
| 125 | Ga0070659_100170671 | 3300005366 | Bacteria | 1781 |
| 126 | Ga0070659_100573642 | 3300005366 | Unclassified | 967 |
| 127 | Ga0070659_100609879 | 3300005366 | Bacteria | 938 |
| 128 | Ga0070659_101860591 | 3300005366 | Bacteria | 539 |
| 129 | Ga0070667_100002091 | 3300005367 | Bacteria | 17620 |
| 130 | Ga0070667_100091190 | 3300005367 | Bacteria | 2620 |
| 131 | Ga0070667_100290332 | 3300005367 | Bacteria | 1470 |
| 132 | Ga0070667_100296604 | 3300005367 | Unclassified | 1455 |
| 133 | Ga0070667_100737056 | 3300005367 | Bacteria | 913 |
| 134 | Ga0070709_10212295 | 3300005434 | Bacteria | 1376 |
| 135 | Ga0070714_100030055 | 3300005435 | Bacteria | 4520 |
| 136 | Ga0070714_100059117 | 3300005435 | Bacteria | 3286 |
| 137 | Ga0070714_100137572 | 3300005435 | Bacteria | 2189 |
| 138 | Ga0070714_100208154 | 3300005435 | Bacteria | 1792 |
| 139 | Ga0070714_100482908 | 3300005435 | Bacteria | 1180 |
| 140 | Ga0070714_100869998 | 3300005435 | Bacteria | 874 |
| 141 | Ga0070713_100014227 | 3300005436 | Bacteria | 5899 |
| 142 | Ga0070713_100147383 | 3300005436 | Bacteria | 2090 |
| 143 | Ga0070713_100150026 | 3300005436 | Bacteria | 2073 |
| 144 | Ga0070713_100892803 | 3300005436 | Unclassified | 855 |
| 145 | Ga0070705_100615236 | 3300005440 | Bacteria | 842 |
| 146 | Ga0070663_100004025 | 3300005455 | Bacteria | 8576 |
| 147 | Ga0070663_100037038 | 3300005455 | Bacteria | 3393 |
| 148 | Ga0070663_100055102 | 3300005455 | Bacteria | 2845 |
| 149 | Ga0070663_100070717 | 3300005455 | Bacteria | 2538 |
| 150 | Ga0070663_100108543 | 3300005455 | Bacteria | 2082 |
| 151 | Ga0070663_100283832 | 3300005455 | Bacteria | 1320 |
| 152 | Ga0070663_100361851 | 3300005455 | Bacteria | 1177 |
| 153 | Ga0070663_100554416 | 3300005455 | Bacteria | 961 |
| 154 | Ga0070678_100110897 | 3300005456 | Bacteria | 2146 |
| 155 | Ga0070678_100649649 | 3300005456 | Bacteria | 946 |
| 156 | Ga0070662_100003155 | 3300005457 | Bacteria | 10241 |
| 157 | Ga0070662_100003479 | 3300005457 | Bacteria | 9817 |
| 158 | Ga0070662_100044861 | 3300005457 | Bacteria | 3169 |
| 159 | Ga0070662_100080831 | 3300005457 | Bacteria | 2420 |
| 160 | Ga0070662_100615085 | 3300005457 | Archaea | 914 |
| 161 | Ga0070662_100861092 | 3300005457 | Bacteria | 772 |
| 162 | Ga0070662_100885873 | 3300005457 | Bacteria | 761 |
| 163 | Ga0070662_101407110 | 3300005457 | Bacteria | 601 |
| 164 | Ga0070681_10085866 | 3300005458 | Bacteria | 3100 |
| 165 | Ga0070681_10165574 | 3300005458 | Bacteria | 2133 |
| 166 | Ga0070681_10174024 | 3300005458 | Bacteria | 2074 |
| 167 | Ga0070681_10416148 | 3300005458 | Bacteria | 1256 |
| 168 | Ga0070681_10425709 | 3300005458 | Bacteria | 1239 |
| 169 | Ga0070681_10443605 | 3300005458 | Bacteria | 1210 |
| 170 | Ga0070681_10484390 | 3300005458 | Bacteria | 1150 |
| 171 | Ga0070681_10599326 | 3300005458 | Bacteria | 1016 |
| 172 | Ga0070681_11315271 | 3300005458 | Bacteria | 646 |
| 173 | Ga0068867_100000818 | 3300005459 | Bacteria | 20994 |
| 174 | Ga0068867_100008041 | 3300005459 | Bacteria | 7453 |
| 175 | Ga0070679_100118741 | 3300005530 | Bacteria | 2629 |
| 176 | Ga0070679_100231639 | 3300005530 | Bacteria | 1806 |
| 177 | Ga0070679_100513010 | 3300005530 | Bacteria | 1143 |
| 178 | Ga0070679_100815166 | 3300005530 | Bacteria | 876 |
| 179 | Ga0070679_101346138 | 3300005530 | Bacteria | 660 |
| 180 | Ga0070679_101765548 | 3300005530 | Bacteria | 567 |
| 181 | Ga0070684_100097876 | 3300005535 | Bacteria | 2617 |
| 182 | Ga0070684_100121257 | 3300005535 | Bacteria | 2352 |
| 183 | Ga0070684_100133757 | 3300005535 | Bacteria | 2238 |
| 184 | Ga0070684_100151766 | 3300005535 | Bacteria | 2099 |
| 185 | Ga0070684_100254253 | 3300005535 | Bacteria | 1606 |
| 186 | Ga0068853_100006609 | 3300005539 | Bacteria | 9230 |
| 187 | Ga0068853_100032999 | 3300005539 | Bacteria | 4389 |
| 188 | Ga0068853_100070421 | 3300005539 | Bacteria | 3044 |
| 189 | Ga0068853_100233721 | 3300005539 | Bacteria | 1682 |
| 190 | Ga0068853_100563603 | 3300005539 | Bacteria | 1080 |
| 191 | Ga0068853_101736394 | 3300005539 | Unclassified | 605 |
| 192 | Ga0070672_100061279 | 3300005543 | Bacteria | 2965 |
| 193 | Ga0070672_100273250 | 3300005543 | Bacteria | 1427 |
| 194 | Ga0070672_100558772 | 3300005543 | Bacteria | 994 |
| 195 | Ga0070696_100494503 | 3300005546 | Bacteria | 972 |
| 196 | Ga0070696_101048197 | 3300005546 | Bacteria | 683 |
| 197 | Ga0070693_100011908 | 3300005547 | Bacteria | 4389 |
| 198 | Ga0070693_100182113 | 3300005547 | Bacteria | 1353 |
| 199 | Ga0070693_100867735 | 3300005547 | Unclassified | 674 |
| 200 | Ga0070665_100005836 | 3300005548 | Bacteria | 12629 |
| 201 | Ga0070665_100027367 | 3300005548 | Bacteria | 5744 |
| 202 | Ga0070665_100625686 | 3300005548 | Bacteria | 1089 |
| 203 | Ga0068855_100002720 | 3300005563 | Bacteria | 21788 |
| 204 | Ga0068855_100027178 | 3300005563 | Bacteria | 6846 |
| 205 | Ga0068855_100396531 | 3300005563 | Bacteria | 1513 |
| 206 | Ga0068855_100668067 | 3300005563 | Bacteria | 1114 |
| 207 | Ga0068855_100710502 | 3300005563 | Bacteria | 1075 |
| 208 | Ga0068855_100963859 | 3300005563 | Bacteria | 898 |
| 209 | Ga0068855_101006428 | 3300005563 | Bacteria | 875 |
| 210 | Ga0068855_101326837 | 3300005563 | Bacteria | 744 |
| 211 | Ga0070664_100004841 | 3300005564 | Bacteria | 10784 |
| 212 | Ga0070664_100012195 | 3300005564 | Bacteria | 6984 |
| 213 | Ga0070664_100121711 | 3300005564 | Bacteria | 2285 |
| 214 | Ga0070664_100134111 | 3300005564 | Bacteria | 2176 |
| 215 | Ga0070664_100283199 | 3300005564 | Bacteria | 1495 |
| 216 | Ga0070664_101901218 | 3300005564 | Bacteria | 565 |
| 217 | Ga0068857_100011311 | 3300005577 | Bacteria | 7764 |
| 218 | Ga0068857_100068787 | 3300005577 | Bacteria | 3152 |
| 219 | Ga0068857_100071138 | 3300005577 | Bacteria | 3099 |
| 220 | Ga0068857_100100522 | 3300005577 | Bacteria | 2594 |
| 221 | Ga0068857_102285908 | 3300005577 | Unclassified | 531 |
| 222 | Ga0068854_100028696 | 3300005578 | Bacteria | 3847 |
| 223 | Ga0068854_100050057 | 3300005578 | Bacteria | 2987 |
| 224 | Ga0068854_100299905 | 3300005578 | Bacteria | 1299 |
| 225 | Ga0068854_100359927 | 3300005578 | Bacteria | 1193 |
| 226 | Ga0068854_100422727 | 3300005578 | Bacteria | 1107 |
| 227 | Ga0068854_101555886 | 3300005578 | Bacteria | 601 |
| 228 | Ga0068856_100000538 | 3300005614 | Bacteria | 41802 |
| 229 | Ga0068856_100050193 | 3300005614 | Bacteria | 4112 |
| 230 | Ga0068856_100091229 | 3300005614 | Bacteria | 3031 |
| 231 | Ga0068856_100333593 | 3300005614 | Bacteria | 1534 |
| 232 | Ga0068856_100534488 | 3300005614 | Bacteria | 1193 |
| 233 | Ga0068856_100658421 | 3300005614 | Bacteria | 1068 |
| 234 | Ga0068856_101568595 | 3300005614 | Bacteria | 672 |
| 235 | Ga0068852_100001259 | 3300005616 | Bacteria | 16883 |
| 236 | Ga0068852_100053492 | 3300005616 | Bacteria | 3475 |
| 237 | Ga0068852_100064099 | 3300005616 | Bacteria | 3202 |
| 238 | Ga0068852_100105874 | 3300005616 | Bacteria | 2549 |
| 239 | Ga0068852_100260972 | 3300005616 | Bacteria | 1663 |
| 240 | Ga0068852_100363828 | 3300005616 | Bacteria | 1415 |
| 241 | Ga0068852_100444124 | 3300005616 | Bacteria | 1283 |
| 242 | Ga0068852_100475866 | 3300005616 | Bacteria | 1240 |
| 243 | Ga0068852_100966714 | 3300005616 | Bacteria | 870 |
| 244 | Ga0068852_101524601 | 3300005616 | Bacteria | 691 |
| 245 | Ga0068852_102749533 | 3300005616 | Bacteria | 511 |
| 246 | Ga0068859_100056627 | 3300005617 | Bacteria | 3947 |
| 247 | Ga0068859_100060129 | 3300005617 | Bacteria | 3829 |
| 248 | Ga0068859_101484528 | 3300005617 | Unclassified | 748 |
| 249 | Ga0068859_101778780 | 3300005617 | Bacteria | 681 |
| 250 | Ga0068864_100001241 | 3300005618 | Bacteria | 21225 |
| 251 | Ga0068866_10055233 | 3300005718 | Bacteria | 2039 |
| 252 | Ga0068861_100109047 | 3300005719 | Bacteria | 2215 |
| 253 | Ga0068851_10009861 | 3300005834 | Bacteria | 4448 |
| 254 | Ga0068851_10017033 | 3300005834 | Bacteria | 3485 |
| 255 | Ga0068851_10033091 | 3300005834 | Bacteria | 2575 |
| 256 | Ga0068851_10420087 | 3300005834 | Bacteria | 790 |
| 257 | Ga0068870_10082254 | 3300005840 | Bacteria | 1783 |
| 258 | Ga0068863_100006362 | 3300005841 | Bacteria | 11582 |
| 259 | Ga0068863_100263529 | 3300005841 | Unclassified | 1667 |
| 260 | Ga0068863_100294090 | 3300005841 | Bacteria | 1574 |
| 261 | Ga0068858_100181733 | 3300005842 | Bacteria | 1986 |
| 262 | Ga0068860_100032878 | 3300005843 | Bacteria | 4982 |
| 263 | Ga0068860_100133731 | 3300005843 | Bacteria | 2381 |
| 264 | Ga0068862_100290107 | 3300005844 | Bacteria | 1502 |
| 265 | Ga0081540_1314932 | 3300005983 | Bacteria | 537 |
| 266 | Ga0070717_10003857 | 3300006028 | Bacteria | 10783 |
| 267 | Ga0070717_10651326 | 3300006028 | Bacteria | 956 |
| 268 | Ga0070716_100248592 | 3300006173 | Bacteria | 1210 |
| 269 | Ga0097621_100185722 | 3300006237 | Bacteria | 1798 |
| 270 | Ga0068871_100067451 | 3300006358 | Bacteria | 2935 |
| 271 | Ga0068871_100320483 | 3300006358 | Bacteria | 1365 |
| 272 | Ga0068871_100611353 | 3300006358 | Bacteria | 992 |
| 273 | Ga0075428_100465962 | 3300006844 | Bacteria | 1353 |
| 274 | Ga0075430_101061152 | 3300006846 | Bacteria | 667 |
| 275 | Ga0075434_102659960 | 3300006871 | Unclassified | 500 |
| 276 | Ga0075429_100432455 | 3300006880 | Bacteria | 1153 |
| 277 | Ga0068865_100047978 | 3300006881 | Bacteria | 2938 |
| 278 | Ga0097620_100056627 | 3300006931 | Bacteria | 3947 |
| 279 | Ga0097620_100060129 | 3300006931 | Bacteria | 3829 |
| 280 | Ga0097620_101484289 | 3300006931 | Unclassified | 748 |
| 281 | Ga0097620_101778722 | 3300006931 | Bacteria | 681 |
| 282 | Ga0105250_10167012 | 3300009092 | Bacteria | 920 |
| 283 | Ga0105240_10645616 | 3300009093 | Bacteria | 1160 |
| 284 | Ga0105240_12115650 | 3300009093 | Bacteria | 584 |
| 285 | Ga0105245_10000782 | 3300009098 | Bacteria | 28837 |
| 286 | Ga0105245_10727190 | 3300009098 | Bacteria | 1027 |
| 287 | Ga0105245_12182237 | 3300009098 | Bacteria | 608 |
| 288 | Ga0105247_10484631 | 3300009101 | Bacteria | 898 |
| 289 | Ga0105247_11537823 | 3300009101 | Bacteria | 544 |
| 290 | Ga0105243_10042556 | 3300009148 | Bacteria | 3556 |
| 291 | Ga0105242_11118682 | 3300009176 | Bacteria | 803 |
| 292 | Ga0105248_10000443 | 3300009177 | Bacteria | 47083 |
| 293 | Ga0105248_10003845 | 3300009177 | Bacteria | 16630 |
| 294 | Ga0105248_10022307 | 3300009177 | Bacteria | 7019 |
| 295 | Ga0105248_10101834 | 3300009177 | Bacteria | 3237 |
| 296 | Ga0105248_10105445 | 3300009177 | Bacteria | 3178 |
| 297 | Ga0105248_10184233 | 3300009177 | Bacteria | 2353 |
| 298 | Ga0105248_10789544 | 3300009177 | Bacteria | 1072 |
| 299 | Ga0105248_12859339 | 3300009177 | Unclassified | 550 |
| 300 | Ga0105237_10614269 | 3300009545 | Bacteria | 1094 |
| 301 | Ga0105238_10079835 | 3300009551 | Bacteria | 3261 |
| 302 | Ga0105238_10178102 | 3300009551 | Bacteria | 2103 |
| 303 | Ga0105238_10180190 | 3300009551 | Bacteria | 2090 |
| 304 | Ga0105238_10235939 | 3300009551 | Bacteria | 1806 |
| 305 | Ga0105238_10448863 | 3300009551 | Bacteria | 1286 |
| 306 | Ga0105238_12209630 | 3300009551 | Bacteria | 585 |
| 307 | Ga0105239_10020946 | 3300010375 | Bacteria | 7213 |
| 308 | Ga0105239_10522398 | 3300010375 | Bacteria | 1351 |
| 309 | Ga0105246_10007706 | 3300011119 | Bacteria | 6605 |
| 310 | Ga0157373_10042424 | 3300013100 | Bacteria | 3251 |
| 311 | Ga0157373_10049373 | 3300013100 | Bacteria | 2999 |
| 312 | Ga0157373_10060575 | 3300013100 | Bacteria | 2681 |
| 313 | Ga0157373_10089120 | 3300013100 | Bacteria | 2173 |
| 314 | Ga0157373_10134542 | 3300013100 | Bacteria | 1738 |
| 315 | Ga0157373_10163856 | 3300013100 | Bacteria | 1564 |
| 316 | Ga0157373_10182542 | 3300013100 | Bacteria | 1478 |
| 317 | Ga0157373_10452445 | 3300013100 | Bacteria | 924 |
| 318 | Ga0157373_10475926 | 3300013100 | Bacteria | 901 |
| 319 | Ga0157373_10602821 | 3300013100 | Bacteria | 800 |
| 320 | Ga0157371_10008659 | 3300013102 | Bacteria | 8083 |
| 321 | Ga0157371_10013469 | 3300013102 | Bacteria | 6208 |
| 322 | Ga0157371_10016795 | 3300013102 | Bacteria | 5451 |
| 323 | Ga0157371_10024128 | 3300013102 | Bacteria | 4443 |
| 324 | Ga0157371_10063630 | 3300013102 | Bacteria | 2615 |
| 325 | Ga0157371_10068813 | 3300013102 | Bacteria | 2506 |
| 326 | Ga0157371_10265602 | 3300013102 | Bacteria | 1238 |
| 327 | Ga0157371_10825992 | 3300013102 | Bacteria | 699 |
| 328 | Ga0157371_10877615 | 3300013102 | Bacteria | 679 |
| 329 | Ga0157370_10005413 | 3300013104 | Bacteria | 14323 |
| 330 | Ga0157370_10028832 | 3300013104 | Bacteria | 5457 |
| 331 | Ga0157370_10243965 | 3300013104 | Bacteria | 1662 |
| 332 | Ga0157370_10480934 | 3300013104 | Bacteria | 1141 |
| 333 | Ga0157370_10587628 | 3300013104 | Unclassified | 1020 |
| 334 | Ga0157370_11006610 | 3300013104 | Bacteria | 754 |
| 335 | Ga0157370_11234399 | 3300013104 | Bacteria | 674 |
| 336 | Ga0157369_10073109 | 3300013105 | Bacteria | 3679 |
| 337 | Ga0157369_10167848 | 3300013105 | Bacteria | 2313 |
| 338 | Ga0157369_10170396 | 3300013105 | Bacteria | 2294 |
| 339 | Ga0157369_10397308 | 3300013105 | Bacteria | 1430 |
| 340 | Ga0157369_10879445 | 3300013105 | Bacteria | 919 |
| 341 | Ga0157369_11038114 | 3300013105 | Unclassified | 839 |
| 342 | Ga0157369_11267770 | 3300013105 | Bacteria | 751 |
| 343 | Ga0157369_11482758 | 3300013105 | Bacteria | 690 |
| 344 | Ga0157374_10121558 | 3300013296 | Bacteria | 2521 |
| 345 | Ga0157374_12438754 | 3300013296 | Bacteria | 550 |
| 346 | Ga0157378_10049574 | 3300013297 | Bacteria | 3735 |
| 347 | Ga0157378_10464632 | 3300013297 | Bacteria | 1258 |
| 348 | Ga0157378_11038595 | 3300013297 | Unclassified | 855 |
| 349 | Ga0163162_10054638 | 3300013306 | Bacteria | 4018 |
| 350 | Ga0163162_10114319 | 3300013306 | Bacteria | 2798 |
| 351 | Ga0163162_10374461 | 3300013306 | Bacteria | 1557 |
| 352 | Ga0163162_10462659 | 3300013306 | Bacteria | 1400 |
| 353 | Ga0157372_10039580 | 3300013307 | Bacteria | 5203 |
| 354 | Ga0157372_10441451 | 3300013307 | Bacteria | 1517 |
| 355 | Ga0157372_10593956 | 3300013307 | Bacteria | 1290 |
| 356 | Ga0157372_10913690 | 3300013307 | Unclassified | 1018 |
| 357 | Ga0157372_10931968 | 3300013307 | Bacteria | 1007 |
| 358 | Ga0157372_11331753 | 3300013307 | Bacteria | 828 |
| 359 | Ga0157375_10115316 | 3300013308 | Bacteria | 2789 |
| 360 | Ga0163163_10000058 | 3300014325 | Bacteria | 123478 |
| 361 | Ga0157377_10072623 | 3300014745 | Bacteria | 1992 |
| 362 | Ga0157379_10069392 | 3300014968 | Bacteria | 3152 |
| 363 | Ga0157379_10575934 | 3300014968 | Bacteria | 1049 |
| 364 | Ga0163161_10111939 | 3300017792 | Bacteria | 2042 |
| 365 | Ga0206353_10988172 | 3300020082 | Unclassified | 615 |
| 366 | Ga0154015_1390661 | 3300020610 | Bacteria | 684 |
| 367 | Ga0213876_10367279 | 3300021384 | Bacteria | 765 |
| 368 | Ga0207673_1009686 | 3300025290 | Bacteria | 1233 |
| 369 | Ga0207697_10003187 | 3300025315 | Bacteria | 8160 |
| 370 | Ga0207697_10082100 | 3300025315 | Bacteria | 1359 |
| 371 | Ga0207656_10012905 | 3300025321 | Bacteria | 3182 |
| 372 | Ga0207656_10014271 | 3300025321 | Bacteria | 3056 |
| 373 | Ga0207682_10100264 | 3300025893 | Bacteria | 1265 |
| 374 | Ga0207682_10387833 | 3300025893 | Unclassified | 660 |
| 375 | Ga0207642_10106444 | 3300025899 | Bacteria | 1419 |
| 376 | Ga0207710_10371880 | 3300025900 | Bacteria | 730 |
| 377 | Ga0207688_10026749 | 3300025901 | Bacteria | 3174 |
| 378 | Ga0207680_10012374 | 3300025903 | Bacteria | 4343 |
| 379 | Ga0207680_10162970 | 3300025903 | Unclassified | 1497 |
| 380 | Ga0207647_10000857 | 3300025904 | Bacteria | 23599 |
| 381 | Ga0207647_10016767 | 3300025904 | Bacteria | 4991 |
| 382 | Ga0207647_10047835 | 3300025904 | Bacteria | 2658 |
| 383 | Ga0207647_10249439 | 3300025904 | Bacteria | 1018 |
| 384 | Ga0207645_10015526 | 3300025907 | Bacteria | 5057 |
| 385 | Ga0207705_10002347 | 3300025909 | Bacteria | 14636 |
| 386 | Ga0207705_10009509 | 3300025909 | Bacteria | 7073 |
| 387 | Ga0207705_10011926 | 3300025909 | Bacteria | 6280 |
| 388 | Ga0207705_10014944 | 3300025909 | Bacteria | 5581 |
| 389 | Ga0207705_10039426 | 3300025909 | Bacteria | 3385 |
| 390 | Ga0207705_10072555 | 3300025909 | Bacteria | 2497 |
| 391 | Ga0207705_10160590 | 3300025909 | Bacteria | 1688 |
| 392 | Ga0207705_10431908 | 3300025909 | Bacteria | 1020 |
| 393 | Ga0207707_10067055 | 3300025912 | Bacteria | 3126 |
| 394 | Ga0207707_10140733 | 3300025912 | Bacteria | 2110 |
| 395 | Ga0207707_10209958 | 3300025912 | Bacteria | 1696 |
| 396 | Ga0207707_10318989 | 3300025912 | Bacteria | 1342 |
| 397 | Ga0207707_10431581 | 3300025912 | Bacteria | 1128 |
| 398 | Ga0207707_10473331 | 3300025912 | Bacteria | 1070 |
| 399 | Ga0207707_10889166 | 3300025912 | Bacteria | 737 |
| 400 | Ga0207707_11049000 | 3300025912 | Bacteria | 667 |
| 401 | Ga0207695_10816517 | 3300025913 | Bacteria | 813 |
| 402 | Ga0207695_11608841 | 3300025913 | Unclassified | 530 |
| 403 | Ga0207671_10886083 | 3300025914 | Bacteria | 706 |
| 404 | Ga0207660_10019708 | 3300025917 | Bacteria | 4514 |
| 405 | Ga0207660_10105145 | 3300025917 | Bacteria | 2115 |
| 406 | Ga0207660_10124970 | 3300025917 | Bacteria | 1953 |
| 407 | Ga0207660_10143612 | 3300025917 | Bacteria | 1827 |
| 408 | Ga0207660_10189111 | 3300025917 | Bacteria | 1602 |
| 409 | Ga0207660_10517869 | 3300025917 | Bacteria | 968 |
| 410 | Ga0207662_10148154 | 3300025918 | Bacteria | 1491 |
| 411 | Ga0207657_10000126 | 3300025919 | Bacteria | 76430 |
| 412 | Ga0207657_10003802 | 3300025919 | Bacteria | 16046 |
| 413 | Ga0207657_10008325 | 3300025919 | Bacteria | 10552 |
| 414 | Ga0207657_10032621 | 3300025919 | Bacteria | 4703 |
| 415 | Ga0207657_10034671 | 3300025919 | Bacteria | 4535 |
| 416 | Ga0207657_10051517 | 3300025919 | Bacteria | 3578 |
| 417 | Ga0207657_10098040 | 3300025919 | Bacteria | 2436 |
| 418 | Ga0207657_10153793 | 3300025919 | Bacteria | 1872 |
| 419 | Ga0207657_10238189 | 3300025919 | Bacteria | 1453 |
| 420 | Ga0207657_11049289 | 3300025919 | Unclassified | 624 |
| 421 | Ga0207649_10000937 | 3300025920 | Bacteria | 18258 |
| 422 | Ga0207649_10063143 | 3300025920 | Bacteria | 2337 |
| 423 | Ga0207649_10076316 | 3300025920 | Bacteria | 2156 |
| 424 | Ga0207649_10127278 | 3300025920 | Bacteria | 1726 |
| 425 | Ga0207649_10231538 | 3300025920 | Bacteria | 1321 |
| 426 | Ga0207649_10728993 | 3300025920 | Bacteria | 770 |
| 427 | Ga0207649_10744590 | 3300025920 | Bacteria | 762 |
| 428 | Ga0207649_10940446 | 3300025920 | Bacteria | 679 |
| 429 | Ga0207652_10011380 | 3300025921 | Bacteria | 7169 |
| 430 | Ga0207652_10020733 | 3300025921 | Bacteria | 5416 |
| 431 | Ga0207652_10167059 | 3300025921 | Bacteria | 1973 |
| 432 | Ga0207652_10328008 | 3300025921 | Bacteria | 1382 |
| 433 | Ga0207652_11020585 | 3300025921 | Bacteria | 726 |
| 434 | Ga0207681_10010000 | 3300025923 | Bacteria | 5806 |
| 435 | Ga0207681_10084130 | 3300025923 | Bacteria | 2254 |
| 436 | Ga0207681_10490139 | 3300025923 | Bacteria | 1005 |
| 437 | Ga0207694_10160837 | 3300025924 | Bacteria | 1814 |
| 438 | Ga0207694_10200744 | 3300025924 | Bacteria | 1622 |
| 439 | Ga0207650_10003655 | 3300025925 | Bacteria | 10522 |
| 440 | Ga0207650_10032491 | 3300025925 | Bacteria | 3775 |
| 441 | Ga0207650_11143361 | 3300025925 | Bacteria | 663 |
| 442 | Ga0207659_10013454 | 3300025926 | Bacteria | 5241 |
| 443 | Ga0207659_10817726 | 3300025926 | Bacteria | 801 |
| 444 | Ga0207687_10013795 | 3300025927 | Bacteria | 5278 |
| 445 | Ga0207687_10468131 | 3300025927 | Bacteria | 1047 |
| 446 | Ga0207700_10299282 | 3300025928 | Bacteria | 1389 |
| 447 | Ga0207700_10427408 | 3300025928 | Bacteria | 1164 |
| 448 | Ga0207700_10431149 | 3300025928 | Bacteria | 1159 |
| 449 | Ga0207700_10742058 | 3300025928 | Bacteria | 877 |
| 450 | Ga0207664_10168872 | 3300025929 | Bacteria | 1871 |
| 451 | Ga0207664_10297246 | 3300025929 | Bacteria | 1420 |
| 452 | Ga0207664_10412321 | 3300025929 | Bacteria | 1202 |
| 453 | Ga0207664_10735596 | 3300025929 | Bacteria | 887 |
| 454 | Ga0207664_10741829 | 3300025929 | Bacteria | 883 |
| 455 | Ga0207664_11037995 | 3300025929 | Bacteria | 734 |
| 456 | Ga0207644_10012689 | 3300025931 | Bacteria | 5601 |
| 457 | Ga0207644_10068554 | 3300025931 | Bacteria | 2588 |
| 458 | Ga0207644_10140478 | 3300025931 | Bacteria | 1859 |
| 459 | Ga0207644_10618069 | 3300025931 | Viruses | 900 |
| 460 | Ga0207644_11782826 | 3300025931 | Unclassified | 515 |
| 461 | Ga0207690_10000106 | 3300025932 | Bacteria | 67786 |
| 462 | Ga0207690_10006739 | 3300025932 | Bacteria | 6808 |
| 463 | Ga0207690_10007460 | 3300025932 | Bacteria | 6489 |
| 464 | Ga0207690_10064602 | 3300025932 | Bacteria | 2499 |
| 465 | Ga0207690_10079944 | 3300025932 | Bacteria | 2280 |
| 466 | Ga0207690_10283280 | 3300025932 | Unclassified | 1291 |
| 467 | Ga0207690_10617213 | 3300025932 | Bacteria | 886 |
| 468 | Ga0207690_10761400 | 3300025932 | Unclassified | 799 |
| 469 | Ga0207706_10000151 | 3300025933 | Bacteria | 76455 |
| 470 | Ga0207706_10000967 | 3300025933 | Bacteria | 29354 |
| 471 | Ga0207706_10005896 | 3300025933 | Bacteria | 11395 |
| 472 | Ga0207706_10007738 | 3300025933 | Bacteria | 9919 |
| 473 | Ga0207706_10034827 | 3300025933 | Bacteria | 4479 |
| 474 | Ga0207706_10128684 | 3300025933 | Bacteria | 2227 |
| 475 | Ga0207706_10152465 | 3300025933 | Bacteria | 2033 |
| 476 | Ga0207706_10205907 | 3300025933 | Bacteria | 1725 |
| 477 | Ga0207706_10680700 | 3300025933 | Bacteria | 880 |
| 478 | Ga0207709_10030191 | 3300025935 | Bacteria | 3151 |
| 479 | Ga0207670_11618039 | 3300025936 | Bacteria | 551 |
| 480 | Ga0207669_10036289 | 3300025937 | Bacteria | 2815 |
| 481 | Ga0207665_10108440 | 3300025939 | Bacteria | 1948 |
| 482 | Ga0207691_10007770 | 3300025940 | Bacteria | 10327 |
| 483 | Ga0207691_10138182 | 3300025940 | Bacteria | 2148 |
| 484 | Ga0207711_10001912 | 3300025941 | Bacteria | 18916 |
| 485 | Ga0207711_10004040 | 3300025941 | Bacteria | 12594 |
| 486 | Ga0207711_10032103 | 3300025941 | Bacteria | 4439 |
| 487 | Ga0207711_10119352 | 3300025941 | Bacteria | 2353 |
| 488 | Ga0207711_10189157 | 3300025941 | Bacteria | 1875 |
| 489 | Ga0207711_10780502 | 3300025941 | Bacteria | 890 |
| 490 | Ga0207689_10000167 | 3300025942 | Bacteria | 57116 |
| 491 | Ga0207661_10006497 | 3300025944 | Bacteria | 8265 |
| 492 | Ga0207661_10072415 | 3300025944 | Bacteria | 2819 |
| 493 | Ga0207661_10148673 | 3300025944 | Bacteria | 2023 |
| 494 | Ga0207661_10558877 | 3300025944 | Bacteria | 1049 |
| 495 | Ga0207661_11173481 | 3300025944 | Unclassified | 707 |
| 496 | Ga0207661_11373800 | 3300025944 | Bacteria | 648 |
| 497 | Ga0207679_10002382 | 3300025945 | Bacteria | 11568 |
| 498 | Ga0207679_10015266 | 3300025945 | Bacteria | 5069 |
| 499 | Ga0207679_10142961 | 3300025945 | Bacteria | 1936 |
| 500 | Ga0207679_10191363 | 3300025945 | Bacteria | 1701 |
| 501 | Ga0207679_10353971 | 3300025945 | Bacteria | 1281 |
| 502 | Ga0207679_10430961 | 3300025945 | Bacteria | 1166 |
| 503 | Ga0207679_11156104 | 3300025945 | Bacteria | 710 |
| 504 | Ga0207667_10002108 | 3300025949 | Bacteria | 24944 |
| 505 | Ga0207667_10113822 | 3300025949 | Bacteria | 2789 |
| 506 | Ga0207667_10125942 | 3300025949 | Bacteria | 2638 |
| 507 | Ga0207667_10321409 | 3300025949 | Bacteria | 1580 |
| 508 | Ga0207667_10335467 | 3300025949 | Bacteria | 1543 |
| 509 | Ga0207667_11128349 | 3300025949 | Bacteria | 766 |
| 510 | Ga0207667_11142157 | 3300025949 | Bacteria | 761 |
| 511 | Ga0207651_10001801 | 3300025960 | Bacteria | 9965 |
| 512 | Ga0207651_11913224 | 3300025960 | Bacteria | 533 |
| 513 | Ga0207668_10071748 | 3300025972 | Bacteria | 2475 |
| 514 | Ga0207668_10273978 | 3300025972 | Bacteria | 1381 |
| 515 | Ga0207668_12055678 | 3300025972 | Bacteria | 514 |
| 516 | Ga0207640_10025143 | 3300025981 | Bacteria | 3601 |
| 517 | Ga0207640_10035980 | 3300025981 | Bacteria | 3104 |
| 518 | Ga0207640_10443572 | 3300025981 | Bacteria | 1068 |
| 519 | Ga0207640_10445883 | 3300025981 | Bacteria | 1065 |
| 520 | Ga0207640_10514616 | 3300025981 | Bacteria | 999 |
| 521 | Ga0207640_10981708 | 3300025981 | Bacteria | 742 |
| 522 | Ga0207640_11482216 | 3300025981 | Bacteria | 609 |
| 523 | Ga0207658_10002624 | 3300025986 | Bacteria | 13051 |
| 524 | Ga0207658_10029117 | 3300025986 | Bacteria | 3896 |
| 525 | Ga0207658_10198918 | 3300025986 | Unclassified | 1671 |
| 526 | Ga0207658_10456063 | 3300025986 | Bacteria | 1132 |
| 527 | Ga0207658_10728071 | 3300025986 | Bacteria | 897 |
| 528 | Ga0207658_10763824 | 3300025986 | Unclassified | 876 |
| 529 | Ga0207677_10002698 | 3300026023 | Bacteria | 9360 |
| 530 | Ga0207677_10048256 | 3300026023 | Bacteria | 2866 |
| 531 | Ga0207677_10080035 | 3300026023 | Bacteria | 2339 |
| 532 | Ga0207703_10045860 | 3300026035 | Bacteria | 3517 |
| 533 | Ga0207703_10156311 | 3300026035 | Bacteria | 1993 |
| 534 | Ga0207703_10503610 | 3300026035 | Bacteria | 1137 |
| 535 | Ga0207639_10000573 | 3300026041 | Bacteria | 25324 |
| 536 | Ga0207639_10002893 | 3300026041 | Bacteria | 11542 |
| 537 | Ga0207639_10021423 | 3300026041 | Bacteria | 4642 |
| 538 | Ga0207639_10047785 | 3300026041 | Bacteria | 3236 |
| 539 | Ga0207639_10103686 | 3300026041 | Bacteria | 2305 |
| 540 | Ga0207639_10241778 | 3300026041 | Bacteria | 1570 |
| 541 | Ga0207678_10005637 | 3300026067 | Bacteria | 11192 |
| 542 | Ga0207678_10006377 | 3300026067 | Bacteria | 10473 |
| 543 | Ga0207678_10010888 | 3300026067 | Bacteria | 7992 |
| 544 | Ga0207678_10017027 | 3300026067 | Bacteria | 6382 |
| 545 | Ga0207678_10062122 | 3300026067 | Bacteria | 3212 |
| 546 | Ga0207678_10079589 | 3300026067 | Bacteria | 2806 |
| 547 | Ga0207678_10281897 | 3300026067 | Bacteria | 1426 |
| 548 | Ga0207678_10342903 | 3300026067 | Bacteria | 1288 |
| 549 | Ga0207678_10414955 | 3300026067 | Bacteria | 1167 |
| 550 | Ga0207678_10775979 | 3300026067 | Bacteria | 846 |
| 551 | Ga0207702_10001045 | 3300026078 | Bacteria | 28350 |
| 552 | Ga0207702_10059499 | 3300026078 | Bacteria | 3254 |
| 553 | Ga0207702_10073760 | 3300026078 | Bacteria | 2943 |
| 554 | Ga0207702_10210531 | 3300026078 | Bacteria | 1807 |
| 555 | Ga0207702_10442956 | 3300026078 | Bacteria | 1259 |
| 556 | Ga0207702_11055672 | 3300026078 | Bacteria | 806 |
| 557 | Ga0207702_12321854 | 3300026078 | Unclassified | 524 |
| 558 | Ga0207641_10041868 | 3300026088 | Bacteria | 3840 |
| 559 | Ga0207641_10080480 | 3300026088 | Bacteria | 2826 |
| 560 | Ga0207641_10824529 | 3300026088 | Bacteria | 918 |
| 561 | Ga0207648_10001222 | 3300026089 | Bacteria | 28812 |
| 562 | Ga0207648_10016014 | 3300026089 | Bacteria | 6869 |
| 563 | Ga0207676_10007892 | 3300026095 | Bacteria | 7571 |
| 564 | Ga0207676_10016650 | 3300026095 | Bacteria | 5325 |
| 565 | Ga0207676_11277125 | 3300026095 | Bacteria | 729 |
| 566 | Ga0207674_10002073 | 3300026116 | Bacteria | 25416 |
| 567 | Ga0207674_10038488 | 3300026116 | Bacteria | 4962 |
| 568 | Ga0207674_10078939 | 3300026116 | Bacteria | 3297 |
| 569 | Ga0207674_10415813 | 3300026116 | Bacteria | 1299 |
| 570 | Ga0207675_100142165 | 3300026118 | Bacteria | 2280 |
| 571 | Ga0207683_10109265 | 3300026121 | Bacteria | 2475 |
| 572 | Ga0207683_10135548 | 3300026121 | Bacteria | 2216 |
| 573 | Ga0207683_11036865 | 3300026121 | Bacteria | 761 |
| 574 | Ga0207698_10002899 | 3300026142 | Bacteria | 10260 |
| 575 | Ga0207698_10026332 | 3300026142 | Bacteria | 4113 |
| 576 | Ga0207698_10086173 | 3300026142 | Bacteria | 2553 |
| 577 | Ga0207698_10092160 | 3300026142 | Bacteria | 2483 |
| 578 | Ga0207698_10350406 | 3300026142 | Bacteria | 1394 |
| 579 | Ga0207698_11159418 | 3300026142 | Bacteria | 786 |
| 580 | Ga0207698_11818686 | 3300026142 | Unclassified | 624 |
| 581 | Ga0209974_10193327 | 3300027876 | Bacteria | 749 |
| 582 | Ga0209974_10208034 | 3300027876 | Bacteria | 725 |
| 583 | Ga0268266_10000950 | 3300028379 | Bacteria | 36937 |
| 584 | Ga0268266_10017332 | 3300028379 | Bacteria | 6147 |
| 585 | Ga0268266_10236407 | 3300028379 | Bacteria | 1684 |
| 586 | Ga0268266_10635015 | 3300028379 | Bacteria | 1027 |
| 587 | Ga0268264_10046189 | 3300028381 | Bacteria | 3616 |
| 588 | Ga0268264_10065660 | 3300028381 | Bacteria | 3058 |
| 589 | Ga0268264_10982377 | 3300028381 | Bacteria | 850 |
| 590 | Ga0316182_1089068 | 3300030745 | Bacteria | 2201 |
| 591 | Ga0307408_100023329 | 3300031548 | Bacteria | 4213 |
| 592 | Ga0307408_100226711 | 3300031548 | Bacteria | 1528 |
| 593 | Ga0307408_100562602 | 3300031548 | Bacteria | 1008 |
| 594 | Ga0307408_101988587 | 3300031548 | Bacteria | 559 |
| 595 | Ga0307405_10041065 | 3300031731 | Bacteria | 2806 |
| 596 | Ga0307405_10044382 | 3300031731 | Bacteria | 2718 |
| 597 | Ga0307405_10136727 | 3300031731 | Bacteria | 1702 |
| 598 | Ga0307405_10245055 | 3300031731 | Bacteria | 1330 |
| 599 | Ga0307405_11439762 | 3300031731 | Bacteria | 604 |
| 600 | Ga0307413_10741880 | 3300031824 | Bacteria | 820 |
| 601 | Ga0307413_11277243 | 3300031824 | Unclassified | 641 |
| 602 | Ga0307410_10360238 | 3300031852 | Bacteria | 1164 |
| 603 | Ga0307410_10426408 | 3300031852 | Bacteria | 1077 |
| 604 | Ga0307410_10600990 | 3300031852 | Bacteria | 917 |
| 605 | Ga0307410_10993435 | 3300031852 | Bacteria | 723 |
| 606 | Ga0307406_10119008 | 3300031901 | Bacteria | 1832 |
| 607 | Ga0307406_10211866 | 3300031901 | Bacteria | 1434 |
| 608 | Ga0307406_10274880 | 3300031901 | Bacteria | 1282 |
| 609 | Ga0307406_10392371 | 3300031901 | Bacteria | 1098 |
| 610 | Ga0307406_11342070 | 3300031901 | Bacteria | 625 |
| 611 | Ga0307406_11489023 | 3300031901 | Bacteria | 595 |
| 612 | Ga0307407_10045075 | 3300031903 | Bacteria | 2489 |
| 613 | Ga0307407_10472964 | 3300031903 | Bacteria | 914 |
| 614 | Ga0307407_11632833 | 3300031903 | Unclassified | 512 |
| 615 | Ga0307412_10041732 | 3300031911 | Bacteria | 2976 |
| 616 | Ga0307412_10130979 | 3300031911 | Bacteria | 1821 |
| 617 | Ga0307412_10150460 | 3300031911 | Bacteria | 1717 |
| 618 | Ga0307412_10224331 | 3300031911 | Bacteria | 1442 |
| 619 | Ga0307409_100012508 | 3300031995 | Bacteria | 5411 |
| 620 | Ga0307409_100125321 | 3300031995 | Bacteria | 2183 |
| 621 | Ga0307409_100227292 | 3300031995 | Bacteria | 1689 |
| 622 | Ga0307409_100784373 | 3300031995 | Bacteria | 959 |
| 623 | Ga0307416_100075543 | 3300032002 | Bacteria | 2820 |
| 624 | Ga0307416_100082215 | 3300032002 | Bacteria | 2727 |
| 625 | Ga0307416_100180772 | 3300032002 | Bacteria | 1976 |
| 626 | Ga0307416_100581963 | 3300032002 | Bacteria | 1197 |
| 627 | Ga0307416_100979418 | 3300032002 | Bacteria | 948 |
| 628 | Ga0307416_101302833 | 3300032002 | Bacteria | 832 |
| 629 | Ga0307414_10107930 | 3300032004 | Bacteria | 2110 |
| 630 | Ga0307414_10217557 | 3300032004 | Bacteria | 1566 |
| 631 | Ga0307414_10262243 | 3300032004 | Bacteria | 1442 |
| 632 | Ga0307411_10045736 | 3300032005 | Bacteria | 2817 |
| 633 | Ga0307411_10077747 | 3300032005 | Bacteria | 2272 |
| 634 | Ga0307411_10187616 | 3300032005 | Bacteria | 1575 |
| 635 | Ga0307411_11315312 | 3300032005 | Bacteria | 659 |
| 636 | Ga0307411_11529998 | 3300032005 | Bacteria | 614 |
| 637 | Ga0307411_11917588 | 3300032005 | Bacteria | 552 |
| 638 | Ga0307415_100018291 | 3300032126 | Bacteria | 4227 |
| 639 | Ga0307415_100069899 | 3300032126 | Bacteria | 2463 |
| 640 | Ga0307415_100784442 | 3300032126 | Unclassified | 868 |
| 641 | Ga0373959_0120497 | 3300034820 | Bacteria | 641 |
| 642 | Ga0373939_0352234 | 3300035114 | Bacteria | 599 |
| 643 | Ga0373960_0072439 | 3300035121 | Bacteria | 1068 |
| 644 | Ga0373960_0156064 | 3300035121 | Bacteria | 783 |
| 645 | Ga0373943_0007352 | 3300035170 | Bacteria | 4945 |
| 646 | Ga0373946_0016959 | 3300035171 | Bacteria | 2781 |
| 647 | Ga0373961_0109640 | 3300035241 | Bacteria | 903 |
| 648 | Ga0373962_0078700 | 3300035242 | Bacteria | 997 |
| 649 | Ga0373931_0127236 | 3300035691 | Bacteria | 1462 |
| 650 | Ga0373931_0220302 | 3300035691 | Bacteria | 1142 |
| 651 | Ga0373931_0753557 | 3300035691 | Bacteria | 646 |
| 652 | Ga0373935_0009197 | 3300035692 | Bacteria | 5915 |
| 653 | Ga0373947_0066567 | 3300035725 | Bacteria | 2199 |
| 654 | Ga0395899_0000261 | 3300037312 | Bacteria | 69173 |
| 655 | Ga0395899_0029113 | 3300037312 | Bacteria | 4153 |
| 656 | Ga0395899_0064834 | 3300037312 | Bacteria | 2685 |
| 657 | Ga0395899_0073077 | 3300037312 | Bacteria | 2508 |
| 658 | Ga0395899_0129809 | 3300037312 | Bacteria | 1800 |
| 659 | Ga0395899_0140771 | 3300037312 | Bacteria | 1716 |
| 660 | Ga0395899_0143187 | 3300037312 | Bacteria | 1700 |
| 661 | Ga0395899_0190188 | 3300037312 | Bacteria | 1436 |
| 662 | Ga0395899_0264310 | 3300037312 | Bacteria | 1175 |
| 663 | Ga0395899_0325442 | 3300037312 | Bacteria | 1034 |
| 664 | Ga0395899_0427382 | 3300037312 | Bacteria | 872 |
| 665 | Ga0395900_0000036 | 3300037418 | Bacteria | 250619 |
| 666 | Ga0395900_0007204 | 3300037418 | Bacteria | 11524 |
| 667 | Ga0395900_0015090 | 3300037418 | Bacteria | 7875 |
| 668 | Ga0395900_0025107 | 3300037418 | Bacteria | 6100 |
| 669 | Ga0395900_0027017 | 3300037418 | Bacteria | 5876 |
| 670 | Ga0395900_0033836 | 3300037418 | Bacteria | 5259 |
| 671 | Ga0395900_0034005 | 3300037418 | Bacteria | 5247 |
| 672 | Ga0395900_0051163 | 3300037418 | Bacteria | 4256 |
| 673 | Ga0395900_0072943 | 3300037418 | Bacteria | 3528 |
| 674 | Ga0395900_0073120 | 3300037418 | Bacteria | 3524 |
| 675 | Ga0395900_0089785 | 3300037418 | Bacteria | 3158 |
| 676 | Ga0395900_0131992 | 3300037418 | Bacteria | 2559 |
| 677 | Ga0395900_0347541 | 3300037418 | Bacteria | 1457 |
| 678 | Ga0395900_1308199 | 3300037418 | Bacteria | 639 |
| 679 | Ga0395900_1682146 | 3300037418 | Unclassified | 545 |
| 680 | Ga0395898_0046153 | 3300037466 | Bacteria | 4279 |
| 681 | Ga0395898_0077919 | 3300037466 | Bacteria | 3199 |
| 682 | Ga0395898_0136702 | 3300037466 | Bacteria | 2347 |
| 683 | Ga0395898_0156038 | 3300037466 | Bacteria | 2183 |
| 684 | Ga0395898_0157111 | 3300037466 | Bacteria | 2175 |
| 685 | Ga0395898_0157678 | 3300037466 | Bacteria | 2171 |
| 686 | Ga0395898_0158678 | 3300037466 | Bacteria | 2163 |
| 687 | Ga0395898_0196576 | 3300037466 | Bacteria | 1926 |
| 688 | Ga0395898_0266292 | 3300037466 | Bacteria | 1634 |
| 689 | Ga0395898_0328621 | 3300037466 | Bacteria | 1458 |
| 690 | Ga0395898_0369176 | 3300037466 | Bacteria | 1368 |
| 691 | Ga0395898_0585345 | 3300037466 | Bacteria | 1058 |
| 692 | Ga0395898_0926413 | 3300037466 | Bacteria | 809 |
| 693 | Ga0395898_0986484 | 3300037466 | Bacteria | 778 |
| 694 | Ga0395898_1428388 | 3300037466 | Bacteria | 619 |
| 695 | Ga0395898_1728762 | 3300037466 | Bacteria | 548 |
| 696 | Ga0395905_0001816 | 3300037471 | Bacteria | 24696 |
| 697 | Ga0395905_0010012 | 3300037471 | Bacteria | 9241 |
| 698 | Ga0395905_0021292 | 3300037471 | Bacteria | 6134 |
| 699 | Ga0395905_0021865 | 3300037471 | Bacteria | 6049 |
| 700 | Ga0395905_0026041 | 3300037471 | Bacteria | 5515 |
| 701 | Ga0395905_0034161 | 3300037471 | Bacteria | 4774 |
| 702 | Ga0395905_0067932 | 3300037471 | Bacteria | 3339 |
| 703 | Ga0395905_0088113 | 3300037471 | Bacteria | 2910 |
| 704 | Ga0395905_0096392 | 3300037471 | Bacteria | 2777 |
| 705 | Ga0395905_0166595 | 3300037471 | Bacteria | 2071 |
| 706 | Ga0395905_0171558 | 3300037471 | Bacteria | 2037 |
| 707 | Ga0395905_0173926 | 3300037471 | Bacteria | 2022 |
| 708 | Ga0395905_0216916 | 3300037471 | Bacteria | 1791 |
| 709 | Ga0395905_0218498 | 3300037471 | Bacteria | 1784 |
| 710 | Ga0395905_0230665 | 3300037471 | Bacteria | 1731 |
| 711 | Ga0395905_0267617 | 3300037471 | Bacteria | 1595 |
| 712 | Ga0395905_0320919 | 3300037471 | Bacteria | 1438 |
| 713 | Ga0395905_1194766 | 3300037471 | Bacteria | 664 |
| 714 | Ga0395905_1663333 | 3300037471 | Bacteria | 543 |
| 715 | Ga0395901_0000036 | 3300038443 | Bacteria | 214274 |
| 716 | Ga0395901_0022395 | 3300038443 | Bacteria | 6475 |
| 717 | Ga0395901_0043349 | 3300038443 | Bacteria | 4668 |
| 718 | Ga0395901_0044592 | 3300038443 | Bacteria | 4599 |
| 719 | Ga0395901_0048833 | 3300038443 | Bacteria | 4395 |
| 720 | Ga0395901_0056121 | 3300038443 | Bacteria | 4097 |
| 721 | Ga0395901_0078945 | 3300038443 | Bacteria | 3436 |
| 722 | Ga0395901_0159150 | 3300038443 | Bacteria | 2371 |
| 723 | Ga0395901_0160151 | 3300038443 | Bacteria | 2364 |
| 724 | Ga0395901_0221686 | 3300038443 | Bacteria | 1976 |
| 725 | Ga0395901_0318161 | 3300038443 | Bacteria | 1610 |
| 726 | Ga0395901_0358286 | 3300038443 | Bacteria | 1504 |
| 727 | Ga0395901_0499530 | 3300038443 | Bacteria | 1238 |
| 728 | Ga0395901_0862990 | 3300038443 | Bacteria | 889 |
| 729 | Ga0395901_1628611 | 3300038443 | Bacteria | 598 |
| 730 | Ga0436365_1470013 | 3300039437 | Bacteria | 10663 |
| 731 | Ga0439439_0086127 | 3300041406 | Bacteria | 854 |
| 732 | Ga0439453_0124444 | 3300041408 | Bacteria | 594 |
| 733 | Ga0439465_0036102 | 3300041413 | Bacteria | 1587 |
| 734 | Ga0451853_1184346 | 3300041512 | Bacteria | 909 |
| 735 | Ga0439448_0003366 | 3300042005 | Bacteria | 4429 |
| 736 | Ga0439432_069814 | 3300042006 | Bacteria | 1072 |
| 737 | Ga0439449_0047741 | 3300042007 | Bacteria | 1585 |
| 738 | Ga0439455_0030288 | 3300042012 | Bacteria | 1342 |
| 739 | Ga0450917_009951 | 3300042120 | Bacteria | 750 |
| 740 | Ga0439458_0000154 | 3300042157 | Bacteria | 15118 |
| 741 | Ga0466966_0102924 | 3300044684 | Bacteria | 1765 |
| 742 | Ga0466961_0034709 | 3300044693 | Bacteria | 3238 |
| 743 | Ga0466961_0063876 | 3300044693 | Bacteria | 2340 |
| 744 | Ga0466963_0001670 | 3300044694 | Bacteria | 12091 |
| 745 | Ga0466963_0011810 | 3300044694 | Bacteria | 5328 |
| 746 | Ga0466963_0085151 | 3300044694 | Bacteria | 2145 |
| 747 | Ga0466971_0027732 | 3300044719 | Bacteria | 2536 |
| 748 | Ga0466957_0105978 | 3300044842 | Bacteria | 1777 |
| 749 | Ga0466959_0142119 | 3300045049 | Bacteria | 1695 |
| 750 | Ga0451576_2191213 | 3300045051 | Bacteria | 567 |
| 751 | Ga0466958_0080210 | 3300045836 | Bacteria | 2007 |
| 752 | Ga0466958_0153603 | 3300045836 | Bacteria | 1452 |
| 753 | Ga0466958_0943243 | 3300045836 | Bacteria | 563 |
| 754 | Ga0466958_1138175 | 3300045836 | Unclassified | 510 |
| 755 | Ga0466967_0015138 | 3300045976 | Bacteria | 6037 |
| 756 | Ga0466967_0034787 | 3300045976 | Bacteria | 4281 |
| 757 | Ga0466967_0121799 | 3300045976 | Bacteria | 2411 |
| 758 | Ga0466967_0155267 | 3300045976 | Bacteria | 2143 |
| 759 | Ga0466967_1490516 | 3300045976 | Bacteria | 674 |
| 760 | Ga0495642_0163347 | 3300046528 | Bacteria | 966 |
| 761 | Ga0495642_0536828 | 3300046528 | Bacteria | 519 |
| 762 | Ga0495669_0007514 | 3300046684 | Bacteria | 4573 |
| 763 | Ga0495669_0089420 | 3300046684 | Bacteria | 1420 |
| 764 | Ga0495669_0130306 | 3300046684 | Bacteria | 1183 |
| 765 | Ga0495669_0179497 | 3300046684 | Bacteria | 1009 |
| 766 | Ga0495669_0405076 | 3300046684 | Bacteria | 661 |
| 767 | Ga0495677_0058880 | 3300047445 | Bacteria | 1422 |
| 768 | Ga0495677_0279321 | 3300047445 | Bacteria | 655 |
| 769 | Ga0496101_1136234 | 3300048904 | Bacteria | 613 |
| 770 | Ga0496107_0690315 | 3300048910 | Bacteria | 751 |
| 771 | Ga0496107_0853265 | 3300048910 | Bacteria | 665 |
| 772 | Ga0496108_0000883 | 3300048911 | Bacteria | 23370 |
| 773 | Ga0496109_0031681 | 3300048912 | Bacteria | 4748 |
| 774 | Ga0496109_0240217 | 3300048912 | Bacteria | 1705 |
| 775 | Ga0496109_0893697 | 3300048912 | Bacteria | 826 |
| 776 | Ga0496110_0102725 | 3300048913 | Bacteria | 2564 |
| 777 | Ga0496111_0537685 | 3300048914 | Unclassified | 858 |
| 778 | Ga0496111_0810508 | 3300048914 | Bacteria | 677 |
| 779 | Ga0496112_0015271 | 3300048915 | Bacteria | 7160 |
| 780 | Ga0496112_0803508 | 3300048915 | Unclassified | 865 |
| 781 | Ga0496113_0086138 | 3300048916 | Bacteria | 2414 |
| 782 | Ga0496115_0497419 | 3300048918 | Bacteria | 980 |
| 783 | Ga0501292_030873 | 3300049515 | Bacteria | 900 |
| 784 | Ga0501296_023567 | 3300049519 | Bacteria | 798 |
| 785 | Ga0501335_033951 | 3300049551 | Bacteria | 585 |
| 786 | Ga0501067_0254396 | 3300049583 | Bacteria | 978 |
| 787 | Ga0501068_0029686 | 3300049584 | Bacteria | 3240 |
| 788 | Ga0501069_0448975 | 3300049585 | Bacteria | 766 |
| 789 | Ga0501070_1412000 | 3300049586 | Unclassified | 529 |
| 790 | Ga0501198_002666 | 3300049649 | Bacteria | 2412 |
| 791 | Ga0501199_019343 | 3300049650 | Bacteria | 782 |
| 792 | Ga0501216_040969 | 3300049660 | Bacteria | 886 |
| 793 | Ga0501223_002563 | 3300049663 | Bacteria | 4019 |
| 794 | Ga0501227_006974 | 3300049665 | Bacteria | 2420 |
| 795 | Ga0501235_000839 | 3300049669 | Bacteria | 6308 |
| 796 | Ga0501236_005573 | 3300049670 | Bacteria | 1524 |
| 797 | Ga0501242_002577 | 3300049674 | Bacteria | 1913 |
| 798 | Ga0501247_046328 | 3300049677 | Bacteria | 634 |
| 799 | Ga0501252_002644 | 3300049682 | Bacteria | 1795 |
| 800 | Ga0501258_026822 | 3300049687 | Bacteria | 708 |
| 801 | Ga0501259_012244 | 3300049688 | Bacteria | 1429 |
| 802 | Ga0501221_002834 | 3300049704 | Bacteria | 2855 |
| 803 | Ga0501225_0005682 | 3300049705 | Bacteria | 3656 |
| 804 | Ga0501229_055266 | 3300049706 | Bacteria | 594 |
| 805 | Ga0501234_041584 | 3300049707 | Bacteria | 753 |
| 806 | Ga0501262_000723 | 3300049759 | Bacteria | 3844 |
| 807 | Ga0501268_014506 | 3300049765 | Bacteria | 1284 |
| 808 | Ga0501270_003667 | 3300049767 | Bacteria | 1675 |
| 809 | Ga0501272_004369 | 3300049769 | Bacteria | 1467 |
| 810 | Ga0501273_036952 | 3300049770 | Bacteria | 712 |
| 811 | Ga0501212_043151 | 3300049851 | Bacteria | 750 |
| 812 | nmdc:mga09592_430071_c1 | 3300050508 | Bacteria | 1140 |
| 813 | nmdc:mga0rr50_93274_c1 | 3300050513 | Bacteria | 2348 |
| 814 | Ga0590077_099068 | 3300059426 | Bacteria | 681 |
| 815 | Ga0466962_0008509 | 3300061719 | Bacteria | 4917 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013100 | Ga0157373_10134542 | Ga0157373_101345423 | 63 |
| 2 | 3300005336 | Ga0070680_100545601 | Ga0070680_1005456011 | 64 |
| 3 | 3300005336 | Ga0070680_101260833 | Ga0070680_1012608332 | 64 |
| 4 | 3300005355 | Ga0070671_100017555 | Ga0070671_1000175559 | 64 |
| 5 | 3300005530 | Ga0070679_100815166 | Ga0070679_1008151662 | 64 |
| 6 | 3300005577 | Ga0068857_102285908 | Ga0068857_1022859082 | 64 |
| 7 | 3300009177 | Ga0105248_10184233 | Ga0105248_101842333 | 64 |
| 8 | 3300025912 | Ga0207707_10431581 | Ga0207707_104315813 | 64 |
| 9 | 3300025917 | Ga0207660_10143612 | Ga0207660_101436124 | 64 |
| 10 | 3300025919 | Ga0207657_10238189 | Ga0207657_102381893 | 64 |
| 11 | 3300025919 | Ga0207657_11049289 | Ga0207657_110492891 | 64 |
| 12 | 3300025931 | Ga0207644_10618069 | Ga0207644_106180691 | 64 |
| 13 | 3300025932 | Ga0207690_10761400 | Ga0207690_107614003 | 64 |
| 14 | 3300025941 | Ga0207711_10119352 | Ga0207711_101193523 | 64 |
| 15 | 3300026078 | Ga0207702_12321854 | Ga0207702_123218542 | 64 |
| 16 | 3300031548 | Ga0307408_101988587 | Ga0307408_1019885871 | 64 |
| 17 | 3300048904 | Ga0496101_1136234 | Ga0496101_1136234_137_382 | 64 |
| 18 | 3300048912 | Ga0496109_0031681 | Ga0496109_0031681_1726_1971 | 64 |
| 19 | 3300048915 | Ga0496112_0015271 | Ga0496112_0015271_4041_4286 | 64 |
| 20 | 3300048916 | Ga0496113_0086138 | Ga0496113_0086138_1787_2032 | 64 |
| 21 | 3300001915 | JGI24741J21665_1005189 | JGI24741J21665_10051892 | 65 |
| 22 | 3300001979 | JGI24740J21852_10010449 | JGI24740J21852_100104493 | 65 |
| 23 | 3300001989 | JGI24739J22299_10031244 | JGI24739J22299_100312441 | 65 |
| 24 | 3300001990 | JGI24737J22298_10024715 | JGI24737J22298_100247155 | 65 |
| 25 | 3300002067 | JGI24735J21928_10006779 | JGI24735J21928_100067791 | 65 |
| 26 | 3300004800 | Ga0058861_10696430 | Ga0058861_106964301 | 65 |
| 27 | 3300005327 | Ga0070658_10137400 | Ga0070658_101374005 | 65 |
| 28 | 3300005329 | Ga0070683_100035499 | Ga0070683_1000354997 | 65 |
| 29 | 3300005329 | Ga0070683_101400995 | Ga0070683_1014009952 | 65 |
| 30 | 3300005336 | Ga0070680_100125730 | Ga0070680_1001257303 | 65 |
| 31 | 3300005337 | Ga0070682_100025859 | Ga0070682_1000258592 | 65 |
| 32 | 3300005339 | Ga0070660_100355773 | Ga0070660_1003557733 | 65 |
| 33 | 3300005341 | Ga0070691_11026623 | Ga0070691_110266232 | 65 |
| 34 | 3300005343 | Ga0070687_101087827 | Ga0070687_1010878272 | 65 |
| 35 | 3300005344 | Ga0070661_100021031 | Ga0070661_1000210318 | 65 |
| 36 | 3300005344 | Ga0070661_101184247 | Ga0070661_1011842472 | 65 |
| 37 | 3300005345 | Ga0070692_10019568 | Ga0070692_100195683 | 65 |
| 38 | 3300005347 | Ga0070668_100902174 | Ga0070668_1009021743 | 65 |
| 39 | 3300005353 | Ga0070669_100038298 | Ga0070669_1000382985 | 65 |
| 40 | 3300005354 | Ga0070675_100090380 | Ga0070675_1000903804 | 65 |
| 41 | 3300005364 | Ga0070673_101251533 | Ga0070673_1012515332 | 65 |
| 42 | 3300005366 | Ga0070659_100170671 | Ga0070659_1001706714 | 65 |
| 43 | 3300005366 | Ga0070659_100609879 | Ga0070659_1006098792 | 65 |
| 44 | 3300005367 | Ga0070667_100290332 | Ga0070667_1002903322 | 65 |
| 45 | 3300005455 | Ga0070663_100037038 | Ga0070663_1000370385 | 65 |
| 46 | 3300005457 | Ga0070662_100080831 | Ga0070662_1000808312 | 65 |
| 47 | 3300005458 | Ga0070681_10174024 | Ga0070681_101740243 | 65 |
| 48 | 3300005530 | Ga0070679_100231639 | Ga0070679_1002316392 | 65 |
| 49 | 3300005535 | Ga0070684_100121257 | Ga0070684_1001212576 | 65 |
| 50 | 3300005546 | Ga0070696_100494503 | Ga0070696_1004945032 | 65 |
| 51 | 3300005547 | Ga0070693_100182113 | Ga0070693_1001821132 | 65 |
| 52 | 3300005563 | Ga0068855_100027178 | Ga0068855_10002717811 | 65 |
| 53 | 3300005564 | Ga0070664_100134111 | Ga0070664_1001341113 | 65 |
| 54 | 3300005577 | Ga0068857_100071138 | Ga0068857_1000711387 | 65 |
| 55 | 3300005578 | Ga0068854_101555886 | Ga0068854_1015558862 | 65 |
| 56 | 3300005616 | Ga0068852_100105874 | Ga0068852_1001058745 | 65 |
| 57 | 3300005617 | Ga0068859_101778780 | Ga0068859_1017787801 | 65 |
| 58 | 3300005841 | Ga0068863_100294090 | Ga0068863_1002940903 | 65 |
| 59 | 3300006931 | Ga0097620_101778722 | Ga0097620_1017787221 | 65 |
| 60 | 3300009177 | Ga0105248_10022307 | Ga0105248_1002230712 | 65 |
| 61 | 3300013100 | Ga0157373_10049373 | Ga0157373_100493733 | 65 |
| 62 | 3300013102 | Ga0157371_10024128 | Ga0157371_100241283 | 65 |
| 63 | 3300013104 | Ga0157370_11234399 | Ga0157370_112343992 | 65 |
| 64 | 3300013307 | Ga0157372_10039580 | Ga0157372_100395807 | 65 |
| 65 | 3300025315 | Ga0207697_10082100 | Ga0207697_100821002 | 65 |
| 66 | 3300025909 | Ga0207705_10009509 | Ga0207705_100095093 | 65 |
| 67 | 3300025912 | Ga0207707_10209958 | Ga0207707_102099584 | 65 |
| 68 | 3300025917 | Ga0207660_10019708 | Ga0207660_100197087 | 65 |
| 69 | 3300025919 | Ga0207657_10032621 | Ga0207657_100326213 | 65 |
| 70 | 3300025920 | Ga0207649_10063143 | Ga0207649_100631433 | 65 |
| 71 | 3300025920 | Ga0207649_10940446 | Ga0207649_109404462 | 65 |
| 72 | 3300025921 | Ga0207652_10011380 | Ga0207652_100113803 | 65 |
| 73 | 3300025923 | Ga0207681_10084130 | Ga0207681_100841304 | 65 |
| 74 | 3300025926 | Ga0207659_10013454 | Ga0207659_100134548 | 65 |
| 75 | 3300025932 | Ga0207690_10007460 | Ga0207690_100074604 | 65 |
| 76 | 3300025932 | Ga0207690_10064602 | Ga0207690_100646024 | 65 |
| 77 | 3300025933 | Ga0207706_10000967 | Ga0207706_100009675 | 65 |
| 78 | 3300025941 | Ga0207711_10032103 | Ga0207711_100321033 | 65 |
| 79 | 3300025944 | Ga0207661_10072415 | Ga0207661_100724154 | 65 |
| 80 | 3300025944 | Ga0207661_11173481 | Ga0207661_111734812 | 65 |
| 81 | 3300025945 | Ga0207679_10142961 | Ga0207679_101429614 | 65 |
| 82 | 3300025945 | Ga0207679_10191363 | Ga0207679_101913633 | 65 |
| 83 | 3300025960 | Ga0207651_11913224 | Ga0207651_119132242 | 65 |
| 84 | 3300025972 | Ga0207668_10273978 | Ga0207668_102739783 | 65 |
| 85 | 3300025981 | Ga0207640_10514616 | Ga0207640_105146163 | 65 |
| 86 | 3300025986 | Ga0207658_10456063 | Ga0207658_104560633 | 65 |
| 87 | 3300026041 | Ga0207639_10021423 | Ga0207639_100214233 | 65 |
| 88 | 3300026067 | Ga0207678_10017027 | Ga0207678_100170274 | 65 |
| 89 | 3300026088 | Ga0207641_10041868 | Ga0207641_100418683 | 65 |
| 90 | 3300026116 | Ga0207674_10038488 | Ga0207674_100384883 | 65 |
| 91 | 3300026142 | Ga0207698_10350406 | Ga0207698_103504065 | 65 |
| 92 | 3300034820 | Ga0373959_0120497 | Ga0373959_0120497_107_352 | 65 |
| 93 | 3300035121 | Ga0373960_0156064 | Ga0373960_0156064_404_649 | 65 |
| 94 | 3300037312 | Ga0395899_0325442 | Ga0395899_0325442_651_911 | 65 |
| 95 | 3300037466 | Ga0395898_0926413 | Ga0395898_0926413_74_334 | 65 |
| 96 | 3300038443 | Ga0395901_1628611 | Ga0395901_1628611_41_304 | 65 |
| 97 | 3300045976 | Ga0466967_1490516 | Ga0466967_1490516_297_554 | 65 |
| 98 | 3300048910 | Ga0496107_0853265 | Ga0496107_0853265_47_301 | 65 |
| 99 | 3300005293 | Ga0065715_10826821 | Ga0065715_108268212 | 66 |
| 100 | 3300005336 | Ga0070680_101134350 | Ga0070680_1011343502 | 66 |
| 101 | 3300005366 | Ga0070659_100573642 | Ga0070659_1005736421 | 66 |
| 102 | 3300005458 | Ga0070681_10165574 | Ga0070681_101655747 | 66 |
| 103 | 3300005530 | Ga0070679_101346138 | Ga0070679_1013461382 | 66 |
| 104 | 3300013100 | Ga0157373_10475926 | Ga0157373_104759263 | 66 |
| 105 | 3300025921 | Ga0207652_11020585 | Ga0207652_110205852 | 66 |
| 106 | 3300025932 | Ga0207690_10079944 | Ga0207690_100799441 | 66 |
| 107 | 3300027876 | Ga0209974_10193327 | Ga0209974_101933272 | 66 |
| 108 | 3300044693 | Ga0466961_0034709 | Ga0466961_0034709_1807_2058 | 66 |
| 109 | 3300044694 | Ga0466963_0001670 | Ga0466963_0001670_2272_2523 | 66 |
| 110 | 3300044719 | Ga0466971_0027732 | Ga0466971_0027732_1018_1269 | 66 |
| 111 | 3300044842 | Ga0466957_0105978 | Ga0466957_0105978_547_798 | 66 |
| 112 | 3300045836 | Ga0466958_0080210 | Ga0466958_0080210_410_661 | 66 |
| 113 | 3300045976 | Ga0466967_0155267 | Ga0466967_0155267_432_683 | 66 |
| 114 | 3300061719 | Ga0466962_0008509 | Ga0466962_0008509_2599_2850 | 66 |
| 115 | 3300009098 | Ga0105245_10727190 | Ga0105245_107271902 | 67 |
| 116 | 3300025919 | Ga0207657_10153793 | Ga0207657_101537932 | 67 |
| 117 | 3300025927 | Ga0207687_10468131 | Ga0207687_104681312 | 67 |
| 118 | 3300025932 | Ga0207690_10617213 | Ga0207690_106172133 | 67 |
| 119 | 3300035691 | Ga0373931_0753557 | Ga0373931_0753557_162_413 | 67 |
| 120 | 3300037418 | Ga0395900_0131992 | Ga0395900_0131992_2138_2383 | 67 |
| 121 | 3300037471 | Ga0395905_0010012 | Ga0395905_0010012_5422_5667 | 67 |
| 122 | 3300038443 | Ga0395901_0044592 | Ga0395901_0044592_1890_2135 | 67 |
| 123 | 3300045051 | Ga0451576_2191213 | Ga0451576_2191213_115_369 | 68 |
| 124 | 3300005539 | Ga0068853_101736394 | Ga0068853_1017363941 | 69 |
| 125 | 3300005616 | Ga0068852_102749533 | Ga0068852_1027495332 | 69 |
| 126 | 3300013100 | Ga0157373_10602821 | Ga0157373_106028212 | 69 |
| 127 | 3300013104 | Ga0157370_10480934 | Ga0157370_104809343 | 69 |
| 128 | 3300013105 | Ga0157369_10397308 | Ga0157369_103973083 | 69 |
| 129 | 3300025949 | Ga0207667_11142157 | Ga0207667_111421572 | 69 |
| 130 | 3300026078 | Ga0207702_11055672 | Ga0207702_110556722 | 69 |
| 131 | 3300026142 | Ga0207698_11159418 | Ga0207698_111594182 | 69 |
| 132 | 3300037418 | Ga0395900_0347541 | Ga0395900_0347541_958_1215 | 69 |
| 133 | 3300037466 | Ga0395898_0136702 | Ga0395898_0136702_1010_1243 | 69 |
| 134 | 3300038443 | Ga0395901_0022395 | Ga0395901_0022395_951_1184 | 69 |
| 135 | 3300005329 | Ga0070683_100294696 | Ga0070683_1002946963 | 70 |
| 136 | 3300005344 | Ga0070661_100119254 | Ga0070661_1001192543 | 70 |
| 137 | 3300005367 | Ga0070667_100296604 | Ga0070667_1002966045 | 70 |
| 138 | 3300005435 | Ga0070714_100869998 | Ga0070714_1008699983 | 70 |
| 139 | 3300005436 | Ga0070713_100892803 | Ga0070713_1008928031 | 70 |
| 140 | 3300005458 | Ga0070681_10443605 | Ga0070681_104436052 | 70 |
| 141 | 3300005535 | Ga0070684_100254253 | Ga0070684_1002542532 | 70 |
| 142 | 3300005564 | Ga0070664_101901218 | Ga0070664_1019012181 | 70 |
| 143 | 3300005578 | Ga0068854_100359927 | Ga0068854_1003599274 | 70 |
| 144 | 3300005614 | Ga0068856_100091229 | Ga0068856_1000912294 | 70 |
| 145 | 3300005616 | Ga0068852_100475866 | Ga0068852_1004758662 | 70 |
| 146 | 3300005617 | Ga0068859_100056627 | Ga0068859_1000566276 | 70 |
| 147 | 3300005841 | Ga0068863_100263529 | Ga0068863_1002635292 | 70 |
| 148 | 3300006871 | Ga0075434_102659960 | Ga0075434_1026599602 | 70 |
| 149 | 3300006931 | Ga0097620_100056627 | Ga0097620_1000566276 | 70 |
| 150 | 3300009098 | Ga0105245_12182237 | Ga0105245_121822372 | 70 |
| 151 | 3300009101 | Ga0105247_10484631 | Ga0105247_104846312 | 70 |
| 152 | 3300009177 | Ga0105248_10789544 | Ga0105248_107895444 | 70 |
| 153 | 3300013102 | Ga0157371_10825992 | Ga0157371_108259922 | 70 |
| 154 | 3300013297 | Ga0157378_10464632 | Ga0157378_104646322 | 70 |
| 155 | 3300014968 | Ga0157379_10575934 | Ga0157379_105759342 | 70 |
| 156 | 3300025900 | Ga0207710_10371880 | Ga0207710_103718802 | 70 |
| 157 | 3300025904 | Ga0207647_10249439 | Ga0207647_102494393 | 70 |
| 158 | 3300025909 | Ga0207705_10014944 | Ga0207705_100149447 | 70 |
| 159 | 3300025912 | Ga0207707_10318989 | Ga0207707_103189894 | 70 |
| 160 | 3300025913 | Ga0207695_10816517 | Ga0207695_108165171 | 70 |
| 161 | 3300025914 | Ga0207671_10886083 | Ga0207671_108860832 | 70 |
| 162 | 3300025920 | Ga0207649_10728993 | Ga0207649_107289932 | 70 |
| 163 | 3300025929 | Ga0207664_10735596 | Ga0207664_107355962 | 70 |
| 164 | 3300025936 | Ga0207670_11618039 | Ga0207670_116180392 | 70 |
| 165 | 3300025944 | Ga0207661_10558877 | Ga0207661_105588773 | 70 |
| 166 | 3300025949 | Ga0207667_10113822 | Ga0207667_101138225 | 70 |
| 167 | 3300025981 | Ga0207640_11482216 | Ga0207640_114822162 | 70 |
| 168 | 3300026035 | Ga0207703_10503610 | Ga0207703_105036103 | 70 |
| 169 | 3300031731 | Ga0307405_10136727 | Ga0307405_101367274 | 70 |
| 170 | 3300031824 | Ga0307413_10741880 | Ga0307413_107418802 | 70 |
| 171 | 3300031852 | Ga0307410_10360238 | Ga0307410_103602383 | 70 |
| 172 | 3300031901 | Ga0307406_10211866 | Ga0307406_102118663 | 70 |
| 173 | 3300031911 | Ga0307412_10130979 | Ga0307412_101309795 | 70 |
| 174 | 3300031995 | Ga0307409_100012508 | Ga0307409_1000125083 | 70 |
| 175 | 3300032002 | Ga0307416_100082215 | Ga0307416_1000822154 | 70 |
| 176 | 3300032004 | Ga0307414_10107930 | Ga0307414_101079302 | 70 |
| 177 | 3300032005 | Ga0307411_10187616 | Ga0307411_101876164 | 70 |
| 178 | 3300032126 | Ga0307415_100069899 | Ga0307415_1000698994 | 70 |
| 179 | 3300037418 | Ga0395900_0033836 | Ga0395900_0033836_944_1195 | 70 |
| 180 | 3300037466 | Ga0395898_1728762 | Ga0395898_1728762_286_537 | 70 |
| 181 | 3300038443 | Ga0395901_0043349 | Ga0395901_0043349_2621_2872 | 70 |
| 182 | 3300005458 | Ga0070681_10085866 | Ga0070681_100858662 | 71 |
| 183 | 3300025912 | Ga0207707_10067055 | Ga0207707_100670552 | 71 |
| 184 | 3300027876 | Ga0209974_10208034 | Ga0209974_102080342 | 71 |
| 185 | 3300031731 | Ga0307405_10245055 | Ga0307405_102450554 | 71 |
| 186 | 3300031824 | Ga0307413_11277243 | Ga0307413_112772432 | 71 |
| 187 | 3300031901 | Ga0307406_11342070 | Ga0307406_113420702 | 71 |
| 188 | 3300031903 | Ga0307407_11632833 | Ga0307407_116328332 | 71 |
| 189 | 3300031911 | Ga0307412_10150460 | Ga0307412_101504603 | 71 |
| 190 | 3300031995 | Ga0307409_100227292 | Ga0307409_1002272924 | 71 |
| 191 | 3300032002 | Ga0307416_101302833 | Ga0307416_1013028332 | 71 |
| 192 | 3300032004 | Ga0307414_10217557 | Ga0307414_102175573 | 71 |
| 193 | 3300032005 | Ga0307411_10045736 | Ga0307411_100457364 | 71 |
| 194 | 3300032126 | Ga0307415_100784442 | Ga0307415_1007844422 | 71 |
| 195 | 3300005327 | Ga0070658_10419631 | Ga0070658_104196314 | 72 |
| 196 | 3300005329 | Ga0070683_100729113 | Ga0070683_1007291132 | 72 |
| 197 | 3300005345 | Ga0070692_10058373 | Ga0070692_100583735 | 72 |
| 198 | 3300005366 | Ga0070659_100136344 | Ga0070659_1001363445 | 72 |
| 199 | 3300005435 | Ga0070714_100482908 | Ga0070714_1004829082 | 72 |
| 200 | 3300005563 | Ga0068855_100710502 | Ga0068855_1007105022 | 72 |
| 201 | 3300005614 | Ga0068856_100050193 | Ga0068856_1000501939 | 72 |
| 202 | 3300013100 | Ga0157373_10163856 | Ga0157373_101638563 | 72 |
| 203 | 3300013102 | Ga0157371_10016795 | Ga0157371_1001679510 | 72 |
| 204 | 3300013105 | Ga0157369_10073109 | Ga0157369_100731093 | 72 |
| 205 | 3300013307 | Ga0157372_10593956 | Ga0157372_105939564 | 72 |
| 206 | 3300025909 | Ga0207705_10431908 | Ga0207705_104319082 | 72 |
| 207 | 3300025929 | Ga0207664_10741829 | Ga0207664_107418292 | 72 |
| 208 | 3300025932 | Ga0207690_10283280 | Ga0207690_102832802 | 72 |
| 209 | 3300025949 | Ga0207667_10321409 | Ga0207667_103214094 | 72 |
| 210 | 3300026078 | Ga0207702_10059499 | Ga0207702_100594995 | 72 |
| 211 | 3300037312 | Ga0395899_0029113 | Ga0395899_0029113_3893_4123 | 72 |
| 212 | 3300037312 | Ga0395899_0190188 | Ga0395899_0190188_36_266 | 72 |
| 213 | 3300037466 | Ga0395898_0156038 | Ga0395898_0156038_123_353 | 72 |
| 214 | 3300037471 | Ga0395905_0021865 | Ga0395905_0021865_1765_1995 | 72 |
| 215 | 3300038443 | Ga0395901_0862990 | Ga0395901_0862990_151_381 | 72 |
| 216 | 3300041406 | Ga0439439_0086127 | Ga0439439_0086127_111_350 | 72 |
| 217 | 3300042007 | Ga0439449_0047741 | Ga0439449_0047741_1088_1327 | 72 |
| 218 | 3300005290 | Ga0065712_10095813 | Ga0065712_100958132 | 73 |
| 219 | 3300005327 | Ga0070658_10270541 | Ga0070658_102705412 | 73 |
| 220 | 3300005330 | Ga0070690_100158398 | Ga0070690_1001583983 | 73 |
| 221 | 3300005333 | Ga0070677_10027587 | Ga0070677_100275876 | 73 |
| 222 | 3300005338 | Ga0068868_100243073 | Ga0068868_1002430734 | 73 |
| 223 | 3300005339 | Ga0070660_100095812 | Ga0070660_1000958121 | 73 |
| 224 | 3300005356 | Ga0070674_100131349 | Ga0070674_1001313495 | 73 |
| 225 | 3300005456 | Ga0070678_100649649 | Ga0070678_1006496492 | 73 |
| 226 | 3300005457 | Ga0070662_100861092 | Ga0070662_1008610922 | 73 |
| 227 | 3300005457 | Ga0070662_101407110 | Ga0070662_1014071102 | 73 |
| 228 | 3300005543 | Ga0070672_100558772 | Ga0070672_1005587722 | 73 |
| 229 | 3300005616 | Ga0068852_100966714 | Ga0068852_1009667143 | 73 |
| 230 | 3300009177 | Ga0105248_10101834 | Ga0105248_101018346 | 73 |
| 231 | 3300013100 | Ga0157373_10060575 | Ga0157373_100605756 | 73 |
| 232 | 3300013297 | Ga0157378_11038595 | Ga0157378_110385952 | 73 |
| 233 | 3300013306 | Ga0163162_10462659 | Ga0163162_104626594 | 73 |
| 234 | 3300021384 | Ga0213876_10367279 | Ga0213876_103672792 | 73 |
| 235 | 3300025893 | Ga0207682_10100264 | Ga0207682_101002641 | 73 |
| 236 | 3300025919 | Ga0207657_10098040 | Ga0207657_100980402 | 73 |
| 237 | 3300025931 | Ga0207644_11782826 | Ga0207644_117828262 | 73 |
| 238 | 3300025933 | Ga0207706_10152465 | Ga0207706_101524654 | 73 |
| 239 | 3300025933 | Ga0207706_10680700 | Ga0207706_106807002 | 73 |
| 240 | 3300025937 | Ga0207669_10036289 | Ga0207669_100362892 | 73 |
| 241 | 3300025941 | Ga0207711_10004040 | Ga0207711_1000404019 | 73 |
| 242 | 3300025981 | Ga0207640_10981708 | Ga0207640_109817081 | 73 |
| 243 | 3300025986 | Ga0207658_10198918 | Ga0207658_101989184 | 73 |
| 244 | 3300026023 | Ga0207677_10080035 | Ga0207677_100800354 | 73 |
| 245 | 3300026121 | Ga0207683_11036865 | Ga0207683_110368652 | 73 |
| 246 | 3300028381 | Ga0268264_10982377 | Ga0268264_109823772 | 73 |
| 247 | 3300030745 | Ga0316182_1089068 | Ga0316182_10890684 | 73 |
| 248 | 3300031901 | Ga0307406_11489023 | Ga0307406_114890232 | 73 |
| 249 | 3300032005 | Ga0307411_11315312 | Ga0307411_113153122 | 73 |
| 250 | 3300037471 | Ga0395905_1663333 | Ga0395905_1663333_52_294 | 73 |
| 251 | 3300039437 | Ga0436365_1470013 | Ga0436365_1470013_7197_7463 | 73 |
| 252 | 3300042120 | Ga0450917_009951 | Ga0450917_009951_319_558 | 73 |
| 253 | 3300045976 | Ga0466967_0015138 | Ga0466967_0015138_1712_1951 | 73 |
| 254 | 3300048910 | Ga0496107_0690315 | Ga0496107_0690315_11_271 | 73 |
| 255 | 3300048911 | Ga0496108_0000883 | Ga0496108_0000883_22030_22269 | 73 |
| 256 | 3300048912 | Ga0496109_0893697 | Ga0496109_0893697_363_602 | 73 |
| 257 | 3300048914 | Ga0496111_0810508 | Ga0496111_0810508_17_277 | 73 |
| 258 | 3300001915 | JGI24741J21665_1035295 | JGI24741J21665_10352951 | 74 |
| 259 | 3300001979 | JGI24740J21852_10018367 | JGI24740J21852_100183677 | 74 |
| 260 | 3300001989 | JGI24739J22299_10030758 | JGI24739J22299_100307581 | 74 |
| 261 | 3300001990 | JGI24737J22298_10001931 | JGI24737J22298_100019316 | 74 |
| 262 | 3300001990 | JGI24737J22298_10266458 | JGI24737J22298_102664582 | 74 |
| 263 | 3300002067 | JGI24735J21928_10069705 | JGI24735J21928_100697052 | 74 |
| 264 | 3300002075 | JGI24738J21930_10012231 | JGI24738J21930_100122312 | 74 |
| 265 | 3300005327 | Ga0070658_10003538 | Ga0070658_1000353810 | 74 |
| 266 | 3300005327 | Ga0070658_10078114 | Ga0070658_100781143 | 74 |
| 267 | 3300005327 | Ga0070658_10419631 | Ga0070658_104196313 | 74 |
| 268 | 3300005328 | Ga0070676_10742058 | Ga0070676_107420582 | 74 |
| 269 | 3300005329 | Ga0070683_100005945 | Ga0070683_1000059455 | 74 |
| 270 | 3300005329 | Ga0070683_100278105 | Ga0070683_1002781055 | 74 |
| 271 | 3300005329 | Ga0070683_100729113 | Ga0070683_1007291131 | 74 |
| 272 | 3300005331 | Ga0070670_100002725 | Ga0070670_1000027251 | 74 |
| 273 | 3300005335 | Ga0070666_10000623 | Ga0070666_100006232 | 74 |
| 274 | 3300005336 | Ga0070680_100482373 | Ga0070680_1004823732 | 74 |
| 275 | 3300005336 | Ga0070680_100651464 | Ga0070680_1006514641 | 74 |
| 276 | 3300005337 | Ga0070682_100098702 | Ga0070682_1000987023 | 74 |
| 277 | 3300005337 | Ga0070682_101628977 | Ga0070682_1016289771 | 74 |
| 278 | 3300005339 | Ga0070660_100000560 | Ga0070660_10000056011 | 74 |
| 279 | 3300005339 | Ga0070660_100052691 | Ga0070660_1000526914 | 74 |
| 280 | 3300005344 | Ga0070661_100000075 | Ga0070661_10000007510 | 74 |
| 281 | 3300005344 | Ga0070661_100028515 | Ga0070661_1000285157 | 74 |
| 282 | 3300005345 | Ga0070692_10236840 | Ga0070692_102368403 | 74 |
| 283 | 3300005353 | Ga0070669_100671160 | Ga0070669_1006711602 | 74 |
| 284 | 3300005355 | Ga0070671_100031625 | Ga0070671_1000316254 | 74 |
| 285 | 3300005364 | Ga0070673_100892071 | Ga0070673_1008920712 | 74 |
| 286 | 3300005365 | Ga0070688_101767422 | Ga0070688_1017674222 | 74 |
| 287 | 3300005366 | Ga0070659_100004345 | Ga0070659_10000434513 | 74 |
| 288 | 3300005366 | Ga0070659_100136344 | Ga0070659_1001363444 | 74 |
| 289 | 3300005367 | Ga0070667_100091190 | Ga0070667_1000911907 | 74 |
| 290 | 3300005435 | Ga0070714_100482908 | Ga0070714_1004829083 | 74 |
| 291 | 3300005455 | Ga0070663_100004025 | Ga0070663_10000402511 | 74 |
| 292 | 3300005457 | Ga0070662_100003155 | Ga0070662_1000031555 | 74 |
| 293 | 3300005458 | Ga0070681_10599326 | Ga0070681_105993263 | 74 |
| 294 | 3300005458 | Ga0070681_11315271 | Ga0070681_113152712 | 74 |
| 295 | 3300005530 | Ga0070679_100118741 | Ga0070679_1001187416 | 74 |
| 296 | 3300005535 | Ga0070684_100097876 | Ga0070684_1000978766 | 74 |
| 297 | 3300005539 | Ga0068853_100006609 | Ga0068853_10000660911 | 74 |
| 298 | 3300005539 | Ga0068853_100563603 | Ga0068853_1005636033 | 74 |
| 299 | 3300005546 | Ga0070696_101048197 | Ga0070696_1010481972 | 74 |
| 300 | 3300005547 | Ga0070693_100011908 | Ga0070693_1000119085 | 74 |
| 301 | 3300005548 | Ga0070665_100027367 | Ga0070665_1000273677 | 74 |
| 302 | 3300005563 | Ga0068855_100002720 | Ga0068855_10000272024 | 74 |
| 303 | 3300005563 | Ga0068855_100710502 | Ga0068855_1007105021 | 74 |
| 304 | 3300005564 | Ga0070664_100004841 | Ga0070664_10000484113 | 74 |
| 305 | 3300005577 | Ga0068857_100068787 | Ga0068857_1000687874 | 74 |
| 306 | 3300005578 | Ga0068854_100422727 | Ga0068854_1004227273 | 74 |
| 307 | 3300005614 | Ga0068856_100000538 | Ga0068856_1000005385 | 74 |
| 308 | 3300005614 | Ga0068856_100050193 | Ga0068856_1000501938 | 74 |
| 309 | 3300005614 | Ga0068856_101568595 | Ga0068856_1015685952 | 74 |
| 310 | 3300005616 | Ga0068852_100001259 | Ga0068852_1000012595 | 74 |
| 311 | 3300005617 | Ga0068859_101484528 | Ga0068859_1014845282 | 74 |
| 312 | 3300005834 | Ga0068851_10033091 | Ga0068851_100330913 | 74 |
| 313 | 3300005842 | Ga0068858_100181733 | Ga0068858_1001817336 | 74 |
| 314 | 3300005844 | Ga0068862_100290107 | Ga0068862_1002901071 | 74 |
| 315 | 3300006237 | Ga0097621_100185722 | Ga0097621_1001857223 | 74 |
| 316 | 3300006358 | Ga0068871_100067451 | Ga0068871_1000674515 | 74 |
| 317 | 3300006931 | Ga0097620_101484289 | Ga0097620_1014842892 | 74 |
| 318 | 3300009177 | Ga0105248_10000443 | Ga0105248_1000044339 | 74 |
| 319 | 3300009551 | Ga0105238_10235939 | Ga0105238_102359393 | 74 |
| 320 | 3300013100 | Ga0157373_10163856 | Ga0157373_101638562 | 74 |
| 321 | 3300013102 | Ga0157371_10008659 | Ga0157371_100086595 | 74 |
| 322 | 3300013102 | Ga0157371_10016795 | Ga0157371_100167959 | 74 |
| 323 | 3300013102 | Ga0157371_10068813 | Ga0157371_100688133 | 74 |
| 324 | 3300013104 | Ga0157370_10028832 | Ga0157370_100288327 | 74 |
| 325 | 3300013104 | Ga0157370_10587628 | Ga0157370_105876282 | 74 |
| 326 | 3300013105 | Ga0157369_10073109 | Ga0157369_100731094 | 74 |
| 327 | 3300013105 | Ga0157369_10167848 | Ga0157369_101678485 | 74 |
| 328 | 3300013105 | Ga0157369_11038114 | Ga0157369_110381142 | 74 |
| 329 | 3300013296 | Ga0157374_10121558 | Ga0157374_101215584 | 74 |
| 330 | 3300013306 | Ga0163162_10374461 | Ga0163162_103744613 | 74 |
| 331 | 3300013307 | Ga0157372_10593956 | Ga0157372_105939563 | 74 |
| 332 | 3300013307 | Ga0157372_11331753 | Ga0157372_113317532 | 74 |
| 333 | 3300014325 | Ga0163163_10000058 | Ga0163163_1000005811 | 74 |
| 334 | 3300014968 | Ga0157379_10069392 | Ga0157379_100693924 | 74 |
| 335 | 3300020082 | Ga0206353_10988172 | Ga0206353_109881721 | 74 |
| 336 | 3300025321 | Ga0207656_10014271 | Ga0207656_100142716 | 74 |
| 337 | 3300025903 | Ga0207680_10012374 | Ga0207680_1001237410 | 74 |
| 338 | 3300025904 | Ga0207647_10047835 | Ga0207647_100478357 | 74 |
| 339 | 3300025909 | Ga0207705_10002347 | Ga0207705_1000234713 | 74 |
| 340 | 3300025909 | Ga0207705_10011926 | Ga0207705_100119266 | 74 |
| 341 | 3300025909 | Ga0207705_10431908 | Ga0207705_104319083 | 74 |
| 342 | 3300025912 | Ga0207707_10889166 | Ga0207707_108891662 | 74 |
| 343 | 3300025912 | Ga0207707_11049000 | Ga0207707_110490002 | 74 |
| 344 | 3300025917 | Ga0207660_10124970 | Ga0207660_101249703 | 74 |
| 345 | 3300025917 | Ga0207660_10517869 | Ga0207660_105178693 | 74 |
| 346 | 3300025919 | Ga0207657_10000126 | Ga0207657_100001265 | 74 |
| 347 | 3300025919 | Ga0207657_10051517 | Ga0207657_100515173 | 74 |
| 348 | 3300025920 | Ga0207649_10000937 | Ga0207649_100009375 | 74 |
| 349 | 3300025921 | Ga0207652_10020733 | Ga0207652_100207336 | 74 |
| 350 | 3300025923 | Ga0207681_10490139 | Ga0207681_104901392 | 74 |
| 351 | 3300025924 | Ga0207694_10160837 | Ga0207694_101608373 | 74 |
| 352 | 3300025925 | Ga0207650_10003655 | Ga0207650_100036551 | 74 |
| 353 | 3300025928 | Ga0207700_10299282 | Ga0207700_102992821 | 74 |
| 354 | 3300025931 | Ga0207644_10012689 | Ga0207644_1001268910 | 74 |
| 355 | 3300025932 | Ga0207690_10000106 | Ga0207690_1000010655 | 74 |
| 356 | 3300025932 | Ga0207690_10283280 | Ga0207690_102832803 | 74 |
| 357 | 3300025933 | Ga0207706_10000151 | Ga0207706_1000015174 | 74 |
| 358 | 3300025941 | Ga0207711_10001912 | Ga0207711_1000191212 | 74 |
| 359 | 3300025944 | Ga0207661_10006497 | Ga0207661_1000649710 | 74 |
| 360 | 3300025945 | Ga0207679_10002382 | Ga0207679_1000238213 | 74 |
| 361 | 3300025949 | Ga0207667_10002108 | Ga0207667_1000210824 | 74 |
| 362 | 3300025949 | Ga0207667_10321409 | Ga0207667_103214093 | 74 |
| 363 | 3300025981 | Ga0207640_10035980 | Ga0207640_100359807 | 74 |
| 364 | 3300025986 | Ga0207658_10002624 | Ga0207658_1000262417 | 74 |
| 365 | 3300026035 | Ga0207703_10156311 | Ga0207703_101563112 | 74 |
| 366 | 3300026041 | Ga0207639_10000573 | Ga0207639_1000057310 | 74 |
| 367 | 3300026041 | Ga0207639_10047785 | Ga0207639_100477856 | 74 |
| 368 | 3300026067 | Ga0207678_10010888 | Ga0207678_100108885 | 74 |
| 369 | 3300026078 | Ga0207702_10001045 | Ga0207702_1000104512 | 74 |
| 370 | 3300026078 | Ga0207702_10059499 | Ga0207702_100594994 | 74 |
| 371 | 3300026088 | Ga0207641_10824529 | Ga0207641_108245291 | 74 |
| 372 | 3300026095 | Ga0207676_10007892 | Ga0207676_1000789213 | 74 |
| 373 | 3300026116 | Ga0207674_10415813 | Ga0207674_104158132 | 74 |
| 374 | 3300026142 | Ga0207698_10002899 | Ga0207698_1000289910 | 74 |
| 375 | 3300028379 | Ga0268266_10017332 | Ga0268266_100173325 | 74 |
| 376 | 3300031852 | Ga0307410_10426408 | Ga0307410_104264082 | 74 |
| 377 | 3300031852 | Ga0307410_10993435 | Ga0307410_109934352 | 74 |
| 378 | 3300031903 | Ga0307407_10472964 | Ga0307407_104729642 | 74 |
| 379 | 3300031995 | Ga0307409_100784373 | Ga0307409_1007843733 | 74 |
| 380 | 3300032005 | Ga0307411_11917588 | Ga0307411_119175882 | 74 |
| 381 | 3300035114 | Ga0373939_0352234 | Ga0373939_0352234_302_547 | 74 |
| 382 | 3300035121 | Ga0373960_0072439 | Ga0373960_0072439_741_986 | 74 |
| 383 | 3300035241 | Ga0373961_0109640 | Ga0373961_0109640_540_785 | 74 |
| 384 | 3300035242 | Ga0373962_0078700 | Ga0373962_0078700_250_495 | 74 |
| 385 | 3300035691 | Ga0373931_0127236 | Ga0373931_0127236_398_643 | 74 |
| 386 | 3300037312 | Ga0395899_0029113 | Ga0395899_0029113_3631_3876 | 74 |
| 387 | 3300037312 | Ga0395899_0064834 | Ga0395899_0064834_1471_1716 | 74 |
| 388 | 3300037312 | Ga0395899_0143187 | Ga0395899_0143187_260_505 | 74 |
| 389 | 3300037418 | Ga0395900_0007204 | Ga0395900_0007204_4250_4495 | 74 |
| 390 | 3300037418 | Ga0395900_0015090 | Ga0395900_0015090_7063_7317 | 74 |
| 391 | 3300037418 | Ga0395900_0034005 | Ga0395900_0034005_4733_4978 | 74 |
| 392 | 3300037418 | Ga0395900_0073120 | Ga0395900_0073120_201_446 | 74 |
| 393 | 3300037418 | Ga0395900_1308199 | Ga0395900_1308199_33_284 | 74 |
| 394 | 3300037466 | Ga0395898_0046153 | Ga0395898_0046153_2827_3072 | 74 |
| 395 | 3300037466 | Ga0395898_0156038 | Ga0395898_0156038_370_615 | 74 |
| 396 | 3300037466 | Ga0395898_0196576 | Ga0395898_0196576_1096_1341 | 74 |
| 397 | 3300037466 | Ga0395898_0328621 | Ga0395898_0328621_1101_1346 | 74 |
| 398 | 3300037466 | Ga0395898_0585345 | Ga0395898_0585345_542_796 | 74 |
| 399 | 3300037471 | Ga0395905_0001816 | Ga0395905_0001816_23643_23888 | 74 |
| 400 | 3300037471 | Ga0395905_0021865 | Ga0395905_0021865_2012_2257 | 74 |
| 401 | 3300037471 | Ga0395905_0026041 | Ga0395905_0026041_1091_1345 | 74 |
| 402 | 3300037471 | Ga0395905_0096392 | Ga0395905_0096392_2064_2309 | 74 |
| 403 | 3300037471 | Ga0395905_0267617 | Ga0395905_0267617_1041_1292 | 74 |
| 404 | 3300037471 | Ga0395905_0320919 | Ga0395905_0320919_816_1061 | 74 |
| 405 | 3300038443 | Ga0395901_0048833 | Ga0395901_0048833_2685_2930 | 74 |
| 406 | 3300038443 | Ga0395901_0078945 | Ga0395901_0078945_2208_2462 | 74 |
| 407 | 3300038443 | Ga0395901_0499530 | Ga0395901_0499530_657_902 | 74 |
| 408 | 3300041512 | Ga0451853_1184346 | Ga0451853_1184346_591_830 | 74 |
| 409 | 3300044694 | Ga0466963_0011810 | Ga0466963_0011810_1315_1560 | 74 |
| 410 | 3300045976 | Ga0466967_0034787 | Ga0466967_0034787_2519_2764 | 74 |
| 411 | 3300046684 | Ga0495669_0007514 | Ga0495669_0007514_1383_1634 | 74 |
| 412 | 3300047445 | Ga0495677_0279321 | Ga0495677_0279321_177_428 | 74 |
| 413 | 3300048912 | Ga0496109_0240217 | Ga0496109_0240217_881_1126 | 74 |
| 414 | 3300048913 | Ga0496110_0102725 | Ga0496110_0102725_865_1110 | 74 |
| 415 | 3300048914 | Ga0496111_0537685 | Ga0496111_0537685_361_606 | 74 |
| 416 | 3300048915 | Ga0496112_0803508 | Ga0496112_0803508_307_552 | 74 |
| 417 | 3300059426 | Ga0590077_099068 | Ga0590077_099068_336_587 | 74 |
| 418 | 3300005327 | Ga0070658_10003530 | Ga0070658_100035304 | 75 |
| 419 | 3300005327 | Ga0070658_10004563 | Ga0070658_1000456314 | 75 |
| 420 | 3300005327 | Ga0070658_10041796 | Ga0070658_100417965 | 75 |
| 421 | 3300005327 | Ga0070658_10421098 | Ga0070658_104210981 | 75 |
| 422 | 3300005329 | Ga0070683_100180550 | Ga0070683_1001805503 | 75 |
| 423 | 3300005335 | Ga0070666_10033780 | Ga0070666_100337801 | 75 |
| 424 | 3300005336 | Ga0070680_100953154 | Ga0070680_1009531542 | 75 |
| 425 | 3300005338 | Ga0068868_100040249 | Ga0068868_1000402494 | 75 |
| 426 | 3300005339 | Ga0070660_100013726 | Ga0070660_1000137269 | 75 |
| 427 | 3300005339 | Ga0070660_100046154 | Ga0070660_1000461544 | 75 |
| 428 | 3300005339 | Ga0070660_100375345 | Ga0070660_1003753453 | 75 |
| 429 | 3300005344 | Ga0070661_100116973 | Ga0070661_1001169732 | 75 |
| 430 | 3300005344 | Ga0070661_101396765 | Ga0070661_1013967652 | 75 |
| 431 | 3300005345 | Ga0070692_10001797 | Ga0070692_100017976 | 75 |
| 432 | 3300005345 | Ga0070692_10017834 | Ga0070692_100178342 | 75 |
| 433 | 3300005345 | Ga0070692_10781996 | Ga0070692_107819962 | 75 |
| 434 | 3300005364 | Ga0070673_100110296 | Ga0070673_1001102964 | 75 |
| 435 | 3300005435 | Ga0070714_100208154 | Ga0070714_1002081545 | 75 |
| 436 | 3300005440 | Ga0070705_100615236 | Ga0070705_1006152362 | 75 |
| 437 | 3300005455 | Ga0070663_100055102 | Ga0070663_1000551028 | 75 |
| 438 | 3300005455 | Ga0070663_100108543 | Ga0070663_1001085434 | 75 |
| 439 | 3300005458 | Ga0070681_10416148 | Ga0070681_104161482 | 75 |
| 440 | 3300005530 | Ga0070679_100513010 | Ga0070679_1005130102 | 75 |
| 441 | 3300005530 | Ga0070679_101765548 | Ga0070679_1017655481 | 75 |
| 442 | 3300005535 | Ga0070684_100151766 | Ga0070684_1001517664 | 75 |
| 443 | 3300005563 | Ga0068855_100963859 | Ga0068855_1009638592 | 75 |
| 444 | 3300005563 | Ga0068855_101326837 | Ga0068855_1013268372 | 75 |
| 445 | 3300005614 | Ga0068856_100333593 | Ga0068856_1003335933 | 75 |
| 446 | 3300005616 | Ga0068852_100064099 | Ga0068852_1000640993 | 75 |
| 447 | 3300006844 | Ga0075428_100465962 | Ga0075428_1004659621 | 75 |
| 448 | 3300006846 | Ga0075430_101061152 | Ga0075430_1010611521 | 75 |
| 449 | 3300006880 | Ga0075429_100432455 | Ga0075429_1004324552 | 75 |
| 450 | 3300013100 | Ga0157373_10089120 | Ga0157373_100891203 | 75 |
| 451 | 3300013102 | Ga0157371_10265602 | Ga0157371_102656021 | 75 |
| 452 | 3300013102 | Ga0157371_10877615 | Ga0157371_108776152 | 75 |
| 453 | 3300013104 | Ga0157370_10243965 | Ga0157370_102439654 | 75 |
| 454 | 3300013105 | Ga0157369_11267770 | Ga0157369_112677702 | 75 |
| 455 | 3300013105 | Ga0157369_11482758 | Ga0157369_114827582 | 75 |
| 456 | 3300013296 | Ga0157374_12438754 | Ga0157374_124387542 | 75 |
| 457 | 3300013307 | Ga0157372_10913690 | Ga0157372_109136903 | 75 |
| 458 | 3300020610 | Ga0154015_1390661 | Ga0154015_13906612 | 75 |
| 459 | 3300025903 | Ga0207680_10162970 | Ga0207680_101629704 | 75 |
| 460 | 3300025909 | Ga0207705_10039426 | Ga0207705_100394267 | 75 |
| 461 | 3300025909 | Ga0207705_10160590 | Ga0207705_101605903 | 75 |
| 462 | 3300025912 | Ga0207707_10140733 | Ga0207707_101407332 | 75 |
| 463 | 3300025917 | Ga0207660_10105145 | Ga0207660_101051452 | 75 |
| 464 | 3300025919 | Ga0207657_10003802 | Ga0207657_1000380212 | 75 |
| 465 | 3300025919 | Ga0207657_10034671 | Ga0207657_100346714 | 75 |
| 466 | 3300025920 | Ga0207649_10076316 | Ga0207649_100763163 | 75 |
| 467 | 3300025921 | Ga0207652_10328008 | Ga0207652_103280083 | 75 |
| 468 | 3300025929 | Ga0207664_10412321 | Ga0207664_104123214 | 75 |
| 469 | 3300025944 | Ga0207661_10148673 | Ga0207661_101486734 | 75 |
| 470 | 3300025949 | Ga0207667_10335467 | Ga0207667_103354674 | 75 |
| 471 | 3300025949 | Ga0207667_11128349 | Ga0207667_111283492 | 75 |
| 472 | 3300025986 | Ga0207658_10763824 | Ga0207658_107638241 | 75 |
| 473 | 3300026023 | Ga0207677_10048256 | Ga0207677_100482564 | 75 |
| 474 | 3300026067 | Ga0207678_10006377 | Ga0207678_1000637715 | 75 |
| 475 | 3300026067 | Ga0207678_10062122 | Ga0207678_100621221 | 75 |
| 476 | 3300026067 | Ga0207678_10079589 | Ga0207678_100795892 | 75 |
| 477 | 3300026078 | Ga0207702_10210531 | Ga0207702_102105313 | 75 |
| 478 | 3300026142 | Ga0207698_10092160 | Ga0207698_100921602 | 75 |
| 479 | 3300031548 | Ga0307408_100023329 | Ga0307408_1000233295 | 75 |
| 480 | 3300031731 | Ga0307405_10044382 | Ga0307405_100443822 | 75 |
| 481 | 3300031852 | Ga0307410_10600990 | Ga0307410_106009902 | 75 |
| 482 | 3300031901 | Ga0307406_10119008 | Ga0307406_101190083 | 75 |
| 483 | 3300031903 | Ga0307407_10045075 | Ga0307407_100450753 | 75 |
| 484 | 3300031911 | Ga0307412_10224331 | Ga0307412_102243313 | 75 |
| 485 | 3300031995 | Ga0307409_100125321 | Ga0307409_1001253214 | 75 |
| 486 | 3300032002 | Ga0307416_100180772 | Ga0307416_1001807723 | 75 |
| 487 | 3300032004 | Ga0307414_10262243 | Ga0307414_102622433 | 75 |
| 488 | 3300032005 | Ga0307411_10077747 | Ga0307411_100777473 | 75 |
| 489 | 3300032005 | Ga0307411_11529998 | Ga0307411_115299981 | 75 |
| 490 | 3300032126 | Ga0307415_100018291 | Ga0307415_1000182914 | 75 |
| 491 | 3300035170 | Ga0373943_0007352 | Ga0373943_0007352_2660_2908 | 75 |
| 492 | 3300035171 | Ga0373946_0016959 | Ga0373946_0016959_1652_1900 | 75 |
| 493 | 3300035692 | Ga0373935_0009197 | Ga0373935_0009197_4872_5120 | 75 |
| 494 | 3300035725 | Ga0373947_0066567 | Ga0373947_0066567_777_1025 | 75 |
| 495 | 3300037312 | Ga0395899_0000261 | Ga0395899_0000261_62867_63121 | 75 |
| 496 | 3300037312 | Ga0395899_0129809 | Ga0395899_0129809_731_982 | 75 |
| 497 | 3300037312 | Ga0395899_0264310 | Ga0395899_0264310_387_638 | 75 |
| 498 | 3300037312 | Ga0395899_0427382 | Ga0395899_0427382_349_600 | 75 |
| 499 | 3300037418 | Ga0395900_0000036 | Ga0395900_0000036_91606_91860 | 75 |
| 500 | 3300037418 | Ga0395900_0027017 | Ga0395900_0027017_4798_5049 | 75 |
| 501 | 3300037418 | Ga0395900_0072943 | Ga0395900_0072943_1847_2098 | 75 |
| 502 | 3300037466 | Ga0395898_0157111 | Ga0395898_0157111_1474_1728 | 75 |
| 503 | 3300037466 | Ga0395898_0266292 | Ga0395898_0266292_323_574 | 75 |
| 504 | 3300037466 | Ga0395898_0369176 | Ga0395898_0369176_1047_1298 | 75 |
| 505 | 3300037466 | Ga0395898_1428388 | Ga0395898_1428388_128_382 | 75 |
| 506 | 3300037471 | Ga0395905_0021292 | Ga0395905_0021292_3952_4203 | 75 |
| 507 | 3300037471 | Ga0395905_0173926 | Ga0395905_0173926_538_792 | 75 |
| 508 | 3300037471 | Ga0395905_0216916 | Ga0395905_0216916_689_940 | 75 |
| 509 | 3300037471 | Ga0395905_0218498 | Ga0395905_0218498_445_696 | 75 |
| 510 | 3300037471 | Ga0395905_0230665 | Ga0395905_0230665_246_497 | 75 |
| 511 | 3300038443 | Ga0395901_0000036 | Ga0395901_0000036_128038_128292 | 75 |
| 512 | 3300038443 | Ga0395901_0221686 | Ga0395901_0221686_65_316 | 75 |
| 513 | 3300038443 | Ga0395901_0318161 | Ga0395901_0318161_323_574 | 75 |
| 514 | 3300041408 | Ga0439453_0124444 | Ga0439453_0124444_35_286 | 75 |
| 515 | 3300041413 | Ga0439465_0036102 | Ga0439465_0036102_856_1104 | 75 |
| 516 | 3300042005 | Ga0439448_0003366 | Ga0439448_0003366_3669_3920 | 75 |
| 517 | 3300042006 | Ga0439432_069814 | Ga0439432_069814_492_740 | 75 |
| 518 | 3300042012 | Ga0439455_0030288 | Ga0439455_0030288_476_727 | 75 |
| 519 | 3300042157 | Ga0439458_0000154 | Ga0439458_0000154_10746_10997 | 75 |
| 520 | 3300049515 | Ga0501292_030873 | Ga0501292_030873_79_327 | 75 |
| 521 | 3300049519 | Ga0501296_023567 | Ga0501296_023567_180_428 | 75 |
| 522 | 3300049551 | Ga0501335_033951 | Ga0501335_033951_273_521 | 75 |
| 523 | 3300049649 | Ga0501198_002666 | Ga0501198_002666_722_970 | 75 |
| 524 | 3300049650 | Ga0501199_019343 | Ga0501199_019343_380_628 | 75 |
| 525 | 3300049660 | Ga0501216_040969 | Ga0501216_040969_450_698 | 75 |
| 526 | 3300049663 | Ga0501223_002563 | Ga0501223_002563_2581_2829 | 75 |
| 527 | 3300049665 | Ga0501227_006974 | Ga0501227_006974_1766_2014 | 75 |
| 528 | 3300049669 | Ga0501235_000839 | Ga0501235_000839_100_348 | 75 |
| 529 | 3300049670 | Ga0501236_005573 | Ga0501236_005573_1101_1349 | 75 |
| 530 | 3300049674 | Ga0501242_002577 | Ga0501242_002577_96_344 | 75 |
| 531 | 3300049677 | Ga0501247_046328 | Ga0501247_046328_79_327 | 75 |
| 532 | 3300049682 | Ga0501252_002644 | Ga0501252_002644_1413_1661 | 75 |
| 533 | 3300049687 | Ga0501258_026822 | Ga0501258_026822_256_504 | 75 |
| 534 | 3300049688 | Ga0501259_012244 | Ga0501259_012244_403_651 | 75 |
| 535 | 3300049704 | Ga0501221_002834 | Ga0501221_002834_283_531 | 75 |
| 536 | 3300049705 | Ga0501225_0005682 | Ga0501225_0005682_283_531 | 75 |
| 537 | 3300049706 | Ga0501229_055266 | Ga0501229_055266_310_558 | 75 |
| 538 | 3300049707 | Ga0501234_041584 | Ga0501234_041584_339_587 | 75 |
| 539 | 3300049759 | Ga0501262_000723 | Ga0501262_000723_2024_2272 | 75 |
| 540 | 3300049765 | Ga0501268_014506 | Ga0501268_014506_705_953 | 75 |
| 541 | 3300049767 | Ga0501270_003667 | Ga0501270_003667_477_725 | 75 |
| 542 | 3300049769 | Ga0501272_004369 | Ga0501272_004369_370_618 | 75 |
| 543 | 3300049770 | Ga0501273_036952 | Ga0501273_036952_256_504 | 75 |
| 544 | 3300049851 | Ga0501212_043151 | Ga0501212_043151_256_504 | 75 |
| 545 | 3300050508 | nmdc:mga09592_430071_c1 | nmdc:mga09592_430071_c1_470_724 | 75 |
| 546 | 3300005434 | Ga0070709_10212295 | Ga0070709_102122952 | 76 |
| 547 | 3300005435 | Ga0070714_100030055 | Ga0070714_1000300559 | 76 |
| 548 | 3300005435 | Ga0070714_100059117 | Ga0070714_1000591176 | 76 |
| 549 | 3300005435 | Ga0070714_100137572 | Ga0070714_1001375721 | 76 |
| 550 | 3300005436 | Ga0070713_100014227 | Ga0070713_1000142274 | 76 |
| 551 | 3300005436 | Ga0070713_100147383 | Ga0070713_1001473832 | 76 |
| 552 | 3300005436 | Ga0070713_100150026 | Ga0070713_1001500264 | 76 |
| 553 | 3300006028 | Ga0070717_10003857 | Ga0070717_100038576 | 76 |
| 554 | 3300006028 | Ga0070717_10651326 | Ga0070717_106513262 | 76 |
| 555 | 3300006173 | Ga0070716_100248592 | Ga0070716_1002485922 | 76 |
| 556 | 3300009093 | Ga0105240_10645616 | Ga0105240_106456163 | 76 |
| 557 | 3300009545 | Ga0105237_10614269 | Ga0105237_106142692 | 76 |
| 558 | 3300009551 | Ga0105238_12209630 | Ga0105238_122096302 | 76 |
| 559 | 3300010375 | Ga0105239_10522398 | Ga0105239_105223984 | 76 |
| 560 | 3300013100 | Ga0157373_10042424 | Ga0157373_100424247 | 76 |
| 561 | 3300013104 | Ga0157370_11006610 | Ga0157370_110066103 | 76 |
| 562 | 3300013105 | Ga0157369_10170396 | Ga0157369_101703964 | 76 |
| 563 | 3300013307 | Ga0157372_10441451 | Ga0157372_104414514 | 76 |
| 564 | 3300025928 | Ga0207700_10427408 | Ga0207700_104274082 | 76 |
| 565 | 3300025928 | Ga0207700_10431149 | Ga0207700_104311494 | 76 |
| 566 | 3300025928 | Ga0207700_10742058 | Ga0207700_107420582 | 76 |
| 567 | 3300025929 | Ga0207664_10168872 | Ga0207664_101688723 | 76 |
| 568 | 3300025929 | Ga0207664_10297246 | Ga0207664_102972461 | 76 |
| 569 | 3300025929 | Ga0207664_11037995 | Ga0207664_110379952 | 76 |
| 570 | 3300025939 | Ga0207665_10108440 | Ga0207665_101084402 | 76 |
| 571 | 3300037312 | Ga0395899_0140771 | Ga0395899_0140771_216_470 | 76 |
| 572 | 3300037418 | Ga0395900_0051163 | Ga0395900_0051163_129_395 | 76 |
| 573 | 3300037418 | Ga0395900_1682146 | Ga0395900_1682146_244_498 | 76 |
| 574 | 3300037466 | Ga0395898_0157678 | Ga0395898_0157678_23_289 | 76 |
| 575 | 3300037466 | Ga0395898_0986484 | Ga0395898_0986484_168_422 | 76 |
| 576 | 3300037471 | Ga0395905_0034161 | Ga0395905_0034161_540_806 | 76 |
| 577 | 3300037471 | Ga0395905_0166595 | Ga0395905_0166595_839_1090 | 76 |
| 578 | 3300037471 | Ga0395905_0171558 | Ga0395905_0171558_1616_1870 | 76 |
| 579 | 3300037471 | Ga0395905_1194766 | Ga0395905_1194766_284_550 | 76 |
| 580 | 3300038443 | Ga0395901_0056121 | Ga0395901_0056121_295_561 | 76 |
| 581 | 3300038443 | Ga0395901_0358286 | Ga0395901_0358286_852_1106 | 76 |
| 582 | 3300044684 | Ga0466966_0102924 | Ga0466966_0102924_1109_1369 | 76 |
| 583 | 3300044694 | Ga0466963_0085151 | Ga0466963_0085151_1277_1540 | 76 |
| 584 | 3300045836 | Ga0466958_0153603 | Ga0466958_0153603_597_860 | 76 |
| 585 | 3300045976 | Ga0466967_0121799 | Ga0466967_0121799_91_354 | 76 |
| 586 | 3300050513 | nmdc:mga0rr50_93274_c1 | nmdc:mga0rr50_93274_c1_1181_1438 | 76 |
| 587 | 3300001915 | JGI24741J21665_1033965 | JGI24741J21665_10339652 | 77 |
| 588 | 3300001979 | JGI24740J21852_10006386 | JGI24740J21852_100063865 | 77 |
| 589 | 3300001989 | JGI24739J22299_10000378 | JGI24739J22299_1000037815 | 77 |
| 590 | 3300001990 | JGI24737J22298_10000438 | JGI24737J22298_1000043813 | 77 |
| 591 | 3300002075 | JGI24738J21930_10003426 | JGI24738J21930_100034266 | 77 |
| 592 | 3300002077 | JGI24744J21845_10075494 | JGI24744J21845_100754942 | 77 |
| 593 | 3300005293 | Ga0065715_10429166 | Ga0065715_104291663 | 77 |
| 594 | 3300005327 | Ga0070658_10068698 | Ga0070658_100686982 | 77 |
| 595 | 3300005328 | Ga0070676_10005815 | Ga0070676_100058157 | 77 |
| 596 | 3300005328 | Ga0070676_11030101 | Ga0070676_110301012 | 77 |
| 597 | 3300005329 | Ga0070683_102194634 | Ga0070683_1021946341 | 77 |
| 598 | 3300005330 | Ga0070690_100643257 | Ga0070690_1006432571 | 77 |
| 599 | 3300005331 | Ga0070670_100034717 | Ga0070670_1000347178 | 77 |
| 600 | 3300005331 | Ga0070670_101028748 | Ga0070670_1010287482 | 77 |
| 601 | 3300005335 | Ga0070666_10410738 | Ga0070666_104107383 | 77 |
| 602 | 3300005338 | Ga0068868_100006361 | Ga0068868_1000063618 | 77 |
| 603 | 3300005339 | Ga0070660_100063778 | Ga0070660_1000637785 | 77 |
| 604 | 3300005343 | Ga0070687_100133740 | Ga0070687_1001337405 | 77 |
| 605 | 3300005344 | Ga0070661_100053915 | Ga0070661_1000539159 | 77 |
| 606 | 3300005344 | Ga0070661_100089633 | Ga0070661_1000896334 | 77 |
| 607 | 3300005344 | Ga0070661_100913717 | Ga0070661_1009137172 | 77 |
| 608 | 3300005347 | Ga0070668_100269459 | Ga0070668_1002694593 | 77 |
| 609 | 3300005353 | Ga0070669_100000565 | Ga0070669_1000005655 | 77 |
| 610 | 3300005354 | Ga0070675_100043992 | Ga0070675_1000439929 | 77 |
| 611 | 3300005355 | Ga0070671_100062925 | Ga0070671_1000629253 | 77 |
| 612 | 3300005355 | Ga0070671_100221202 | Ga0070671_1002212024 | 77 |
| 613 | 3300005356 | Ga0070674_102118904 | Ga0070674_1021189041 | 77 |
| 614 | 3300005364 | Ga0070673_100010306 | Ga0070673_1000103065 | 77 |
| 615 | 3300005366 | Ga0070659_100004211 | Ga0070659_10000421114 | 77 |
| 616 | 3300005366 | Ga0070659_100008451 | Ga0070659_10000845112 | 77 |
| 617 | 3300005367 | Ga0070667_100002091 | Ga0070667_10000209116 | 77 |
| 618 | 3300005367 | Ga0070667_100737056 | Ga0070667_1007370561 | 77 |
| 619 | 3300005455 | Ga0070663_100283832 | Ga0070663_1002838323 | 77 |
| 620 | 3300005455 | Ga0070663_100361851 | Ga0070663_1003618513 | 77 |
| 621 | 3300005455 | Ga0070663_100554416 | Ga0070663_1005544162 | 77 |
| 622 | 3300005456 | Ga0070678_100110897 | Ga0070678_1001108973 | 77 |
| 623 | 3300005457 | Ga0070662_100003479 | Ga0070662_10000347910 | 77 |
| 624 | 3300005457 | Ga0070662_100615085 | Ga0070662_1006150853 | 77 |
| 625 | 3300005457 | Ga0070662_100885873 | Ga0070662_1008858732 | 77 |
| 626 | 3300005458 | Ga0070681_10484390 | Ga0070681_104843903 | 77 |
| 627 | 3300005459 | Ga0068867_100000818 | Ga0068867_1000008185 | 77 |
| 628 | 3300005459 | Ga0068867_100008041 | Ga0068867_1000080414 | 77 |
| 629 | 3300005539 | Ga0068853_100032999 | Ga0068853_1000329993 | 77 |
| 630 | 3300005539 | Ga0068853_100233721 | Ga0068853_1002337212 | 77 |
| 631 | 3300005543 | Ga0070672_100061279 | Ga0070672_1000612793 | 77 |
| 632 | 3300005543 | Ga0070672_100273250 | Ga0070672_1002732504 | 77 |
| 633 | 3300005547 | Ga0070693_100867735 | Ga0070693_1008677351 | 77 |
| 634 | 3300005548 | Ga0070665_100005836 | Ga0070665_10000583611 | 77 |
| 635 | 3300005548 | Ga0070665_100625686 | Ga0070665_1006256862 | 77 |
| 636 | 3300005563 | Ga0068855_100396531 | Ga0068855_1003965313 | 77 |
| 637 | 3300005563 | Ga0068855_100668067 | Ga0068855_1006680672 | 77 |
| 638 | 3300005564 | Ga0070664_100012195 | Ga0070664_1000121959 | 77 |
| 639 | 3300005564 | Ga0070664_100283199 | Ga0070664_1002831994 | 77 |
| 640 | 3300005577 | Ga0068857_100011311 | Ga0068857_10001131113 | 77 |
| 641 | 3300005578 | Ga0068854_100028696 | Ga0068854_1000286963 | 77 |
| 642 | 3300005578 | Ga0068854_100299905 | Ga0068854_1002999053 | 77 |
| 643 | 3300005614 | Ga0068856_100658421 | Ga0068856_1006584213 | 77 |
| 644 | 3300005616 | Ga0068852_100053492 | Ga0068852_1000534927 | 77 |
| 645 | 3300005616 | Ga0068852_100260972 | Ga0068852_1002609725 | 77 |
| 646 | 3300005616 | Ga0068852_100444124 | Ga0068852_1004441244 | 77 |
| 647 | 3300005616 | Ga0068852_101524601 | Ga0068852_1015246012 | 77 |
| 648 | 3300005617 | Ga0068859_100060129 | Ga0068859_1000601293 | 77 |
| 649 | 3300005618 | Ga0068864_100001241 | Ga0068864_10000124124 | 77 |
| 650 | 3300005718 | Ga0068866_10055233 | Ga0068866_100552332 | 77 |
| 651 | 3300005719 | Ga0068861_100109047 | Ga0068861_1001090473 | 77 |
| 652 | 3300005834 | Ga0068851_10009861 | Ga0068851_100098613 | 77 |
| 653 | 3300005834 | Ga0068851_10420087 | Ga0068851_104200872 | 77 |
| 654 | 3300005840 | Ga0068870_10082254 | Ga0068870_100822542 | 77 |
| 655 | 3300005841 | Ga0068863_100006362 | Ga0068863_10000636213 | 77 |
| 656 | 3300005843 | Ga0068860_100032878 | Ga0068860_1000328787 | 77 |
| 657 | 3300005843 | Ga0068860_100133731 | Ga0068860_1001337313 | 77 |
| 658 | 3300005983 | Ga0081540_1314932 | Ga0081540_13149322 | 77 |
| 659 | 3300006358 | Ga0068871_100320483 | Ga0068871_1003204832 | 77 |
| 660 | 3300006358 | Ga0068871_100611353 | Ga0068871_1006113533 | 77 |
| 661 | 3300006881 | Ga0068865_100047978 | Ga0068865_1000479783 | 77 |
| 662 | 3300006931 | Ga0097620_100060129 | Ga0097620_1000601293 | 77 |
| 663 | 3300009092 | Ga0105250_10167012 | Ga0105250_101670123 | 77 |
| 664 | 3300009093 | Ga0105240_12115650 | Ga0105240_121156502 | 77 |
| 665 | 3300009098 | Ga0105245_10000782 | Ga0105245_1000078230 | 77 |
| 666 | 3300009101 | Ga0105247_11537823 | Ga0105247_115378232 | 77 |
| 667 | 3300009148 | Ga0105243_10042556 | Ga0105243_100425564 | 77 |
| 668 | 3300009176 | Ga0105242_11118682 | Ga0105242_111186821 | 77 |
| 669 | 3300009177 | Ga0105248_10003845 | Ga0105248_100038452 | 77 |
| 670 | 3300009177 | Ga0105248_10105445 | Ga0105248_101054453 | 77 |
| 671 | 3300009177 | Ga0105248_12859339 | Ga0105248_128593392 | 77 |
| 672 | 3300009551 | Ga0105238_10079835 | Ga0105238_100798358 | 77 |
| 673 | 3300009551 | Ga0105238_10178102 | Ga0105238_101781023 | 77 |
| 674 | 3300009551 | Ga0105238_10448863 | Ga0105238_104488633 | 77 |
| 675 | 3300010375 | Ga0105239_10020946 | Ga0105239_1002094612 | 77 |
| 676 | 3300011119 | Ga0105246_10007706 | Ga0105246_100077066 | 77 |
| 677 | 3300013100 | Ga0157373_10452445 | Ga0157373_104524453 | 77 |
| 678 | 3300013102 | Ga0157371_10013469 | Ga0157371_100134699 | 77 |
| 679 | 3300013104 | Ga0157370_10005413 | Ga0157370_100054133 | 77 |
| 680 | 3300013297 | Ga0157378_10049574 | Ga0157378_100495744 | 77 |
| 681 | 3300013306 | Ga0163162_10054638 | Ga0163162_100546387 | 77 |
| 682 | 3300013306 | Ga0163162_10114319 | Ga0163162_101143193 | 77 |
| 683 | 3300013308 | Ga0157375_10115316 | Ga0157375_101153166 | 77 |
| 684 | 3300014745 | Ga0157377_10072623 | Ga0157377_100726231 | 77 |
| 685 | 3300017792 | Ga0163161_10111939 | Ga0163161_101119392 | 77 |
| 686 | 3300025290 | Ga0207673_1009686 | Ga0207673_10096863 | 77 |
| 687 | 3300025315 | Ga0207697_10003187 | Ga0207697_1000318714 | 77 |
| 688 | 3300025321 | Ga0207656_10012905 | Ga0207656_100129051 | 77 |
| 689 | 3300025893 | Ga0207682_10387833 | Ga0207682_103878331 | 77 |
| 690 | 3300025899 | Ga0207642_10106444 | Ga0207642_101064445 | 77 |
| 691 | 3300025901 | Ga0207688_10026749 | Ga0207688_100267496 | 77 |
| 692 | 3300025904 | Ga0207647_10016767 | Ga0207647_100167673 | 77 |
| 693 | 3300025907 | Ga0207645_10015526 | Ga0207645_100155265 | 77 |
| 694 | 3300025912 | Ga0207707_10473331 | Ga0207707_104733313 | 77 |
| 695 | 3300025913 | Ga0207695_11608841 | Ga0207695_116088412 | 77 |
| 696 | 3300025918 | Ga0207662_10148154 | Ga0207662_101481542 | 77 |
| 697 | 3300025920 | Ga0207649_10127278 | Ga0207649_101272782 | 77 |
| 698 | 3300025920 | Ga0207649_10231538 | Ga0207649_102315383 | 77 |
| 699 | 3300025923 | Ga0207681_10010000 | Ga0207681_100100004 | 77 |
| 700 | 3300025924 | Ga0207694_10200744 | Ga0207694_102007443 | 77 |
| 701 | 3300025925 | Ga0207650_10032491 | Ga0207650_100324913 | 77 |
| 702 | 3300025925 | Ga0207650_11143361 | Ga0207650_111433612 | 77 |
| 703 | 3300025926 | Ga0207659_10817726 | Ga0207659_108177262 | 77 |
| 704 | 3300025927 | Ga0207687_10013795 | Ga0207687_100137953 | 77 |
| 705 | 3300025931 | Ga0207644_10068554 | Ga0207644_100685547 | 77 |
| 706 | 3300025931 | Ga0207644_10140478 | Ga0207644_101404784 | 77 |
| 707 | 3300025932 | Ga0207690_10006739 | Ga0207690_100067399 | 77 |
| 708 | 3300025933 | Ga0207706_10005896 | Ga0207706_100058969 | 77 |
| 709 | 3300025933 | Ga0207706_10034827 | Ga0207706_100348274 | 77 |
| 710 | 3300025933 | Ga0207706_10128684 | Ga0207706_101286842 | 77 |
| 711 | 3300025933 | Ga0207706_10205907 | Ga0207706_102059072 | 77 |
| 712 | 3300025935 | Ga0207709_10030191 | Ga0207709_100301914 | 77 |
| 713 | 3300025940 | Ga0207691_10007770 | Ga0207691_1000777011 | 77 |
| 714 | 3300025940 | Ga0207691_10138182 | Ga0207691_101381824 | 77 |
| 715 | 3300025941 | Ga0207711_10189157 | Ga0207711_101891572 | 77 |
| 716 | 3300025941 | Ga0207711_10780502 | Ga0207711_107805022 | 77 |
| 717 | 3300025942 | Ga0207689_10000167 | Ga0207689_1000016748 | 77 |
| 718 | 3300025945 | Ga0207679_10015266 | Ga0207679_100152662 | 77 |
| 719 | 3300025945 | Ga0207679_10353971 | Ga0207679_103539712 | 77 |
| 720 | 3300025945 | Ga0207679_10430961 | Ga0207679_104309611 | 77 |
| 721 | 3300025949 | Ga0207667_10125942 | Ga0207667_101259425 | 77 |
| 722 | 3300025960 | Ga0207651_10001801 | Ga0207651_100018013 | 77 |
| 723 | 3300025972 | Ga0207668_10071748 | Ga0207668_100717486 | 77 |
| 724 | 3300025972 | Ga0207668_12055678 | Ga0207668_120556782 | 77 |
| 725 | 3300025981 | Ga0207640_10025143 | Ga0207640_100251436 | 77 |
| 726 | 3300025981 | Ga0207640_10443572 | Ga0207640_104435722 | 77 |
| 727 | 3300025986 | Ga0207658_10029117 | Ga0207658_1002911710 | 77 |
| 728 | 3300025986 | Ga0207658_10728071 | Ga0207658_107280711 | 77 |
| 729 | 3300026023 | Ga0207677_10002698 | Ga0207677_1000269810 | 77 |
| 730 | 3300026035 | Ga0207703_10045860 | Ga0207703_100458604 | 77 |
| 731 | 3300026041 | Ga0207639_10002893 | Ga0207639_1000289310 | 77 |
| 732 | 3300026041 | Ga0207639_10103686 | Ga0207639_101036862 | 77 |
| 733 | 3300026041 | Ga0207639_10241778 | Ga0207639_102417784 | 77 |
| 734 | 3300026067 | Ga0207678_10281897 | Ga0207678_102818973 | 77 |
| 735 | 3300026067 | Ga0207678_10342903 | Ga0207678_103429033 | 77 |
| 736 | 3300026067 | Ga0207678_10414955 | Ga0207678_104149552 | 77 |
| 737 | 3300026067 | Ga0207678_10775979 | Ga0207678_107759792 | 77 |
| 738 | 3300026078 | Ga0207702_10442956 | Ga0207702_104429562 | 77 |
| 739 | 3300026088 | Ga0207641_10080480 | Ga0207641_100804804 | 77 |
| 740 | 3300026089 | Ga0207648_10001222 | Ga0207648_100012229 | 77 |
| 741 | 3300026089 | Ga0207648_10016014 | Ga0207648_100160145 | 77 |
| 742 | 3300026095 | Ga0207676_10016650 | Ga0207676_100166505 | 77 |
| 743 | 3300026095 | Ga0207676_11277125 | Ga0207676_112771252 | 77 |
| 744 | 3300026116 | Ga0207674_10002073 | Ga0207674_1000207332 | 77 |
| 745 | 3300026118 | Ga0207675_100142165 | Ga0207675_1001421654 | 77 |
| 746 | 3300026121 | Ga0207683_10109265 | Ga0207683_101092653 | 77 |
| 747 | 3300026121 | Ga0207683_10135548 | Ga0207683_101355484 | 77 |
| 748 | 3300026142 | Ga0207698_10026332 | Ga0207698_100263329 | 77 |
| 749 | 3300026142 | Ga0207698_11818686 | Ga0207698_118186862 | 77 |
| 750 | 3300028379 | Ga0268266_10000950 | Ga0268266_100009508 | 77 |
| 751 | 3300028379 | Ga0268266_10236407 | Ga0268266_102364075 | 77 |
| 752 | 3300028379 | Ga0268266_10635015 | Ga0268266_106350151 | 77 |
| 753 | 3300028381 | Ga0268264_10046189 | Ga0268264_100461893 | 77 |
| 754 | 3300028381 | Ga0268264_10065660 | Ga0268264_100656604 | 77 |
| 755 | 3300031548 | Ga0307408_100226711 | Ga0307408_1002267113 | 77 |
| 756 | 3300031548 | Ga0307408_100562602 | Ga0307408_1005626023 | 77 |
| 757 | 3300031731 | Ga0307405_10041065 | Ga0307405_100410652 | 77 |
| 758 | 3300031731 | Ga0307405_11439762 | Ga0307405_114397622 | 77 |
| 759 | 3300031901 | Ga0307406_10274880 | Ga0307406_102748803 | 77 |
| 760 | 3300031901 | Ga0307406_10392371 | Ga0307406_103923713 | 77 |
| 761 | 3300031911 | Ga0307412_10041732 | Ga0307412_100417324 | 77 |
| 762 | 3300032002 | Ga0307416_100075543 | Ga0307416_1000755433 | 77 |
| 763 | 3300032002 | Ga0307416_100581963 | Ga0307416_1005819634 | 77 |
| 764 | 3300032002 | Ga0307416_100979418 | Ga0307416_1009794183 | 77 |
| 765 | 3300035691 | Ga0373931_0220302 | Ga0373931_0220302_763_1020 | 77 |
| 766 | 3300037312 | Ga0395899_0073077 | Ga0395899_0073077_293_553 | 77 |
| 767 | 3300037418 | Ga0395900_0025107 | Ga0395900_0025107_145_402 | 77 |
| 768 | 3300037418 | Ga0395900_0089785 | Ga0395900_0089785_437_697 | 77 |
| 769 | 3300037466 | Ga0395898_0077919 | Ga0395898_0077919_2732_2989 | 77 |
| 770 | 3300037466 | Ga0395898_0158678 | Ga0395898_0158678_266_526 | 77 |
| 771 | 3300037471 | Ga0395905_0067932 | Ga0395905_0067932_2302_2562 | 77 |
| 772 | 3300037471 | Ga0395905_0088113 | Ga0395905_0088113_1500_1760 | 77 |
| 773 | 3300038443 | Ga0395901_0159150 | Ga0395901_0159150_45_305 | 77 |
| 774 | 3300038443 | Ga0395901_0160151 | Ga0395901_0160151_559_816 | 77 |
| 775 | 3300044693 | Ga0466961_0063876 | Ga0466961_0063876_1708_1965 | 77 |
| 776 | 3300045049 | Ga0466959_0142119 | Ga0466959_0142119_647_904 | 77 |
| 777 | 3300045836 | Ga0466958_0943243 | Ga0466958_0943243_13_270 | 77 |
| 778 | 3300045836 | Ga0466958_1138175 | Ga0466958_1138175_223_480 | 77 |
| 779 | 3300046528 | Ga0495642_0163347 | Ga0495642_0163347_261_515 | 77 |
| 780 | 3300046528 | Ga0495642_0536828 | Ga0495642_0536828_181_432 | 77 |
| 781 | 3300046684 | Ga0495669_0089420 | Ga0495669_0089420_1028_1279 | 77 |
| 782 | 3300046684 | Ga0495669_0130306 | Ga0495669_0130306_441_692 | 77 |
| 783 | 3300046684 | Ga0495669_0179497 | Ga0495669_0179497_371_625 | 77 |
| 784 | 3300046684 | Ga0495669_0405076 | Ga0495669_0405076_123_383 | 77 |
| 785 | 3300047445 | Ga0495677_0058880 | Ga0495677_0058880_152_403 | 77 |
| 786 | 3300048918 | Ga0496115_0497419 | Ga0496115_0497419_38_292 | 77 |
| 787 | 3300049583 | Ga0501067_0254396 | Ga0501067_0254396_496_753 | 77 |
| 788 | 3300049584 | Ga0501068_0029686 | Ga0501068_0029686_913_1164 | 77 |
| 789 | 3300049585 | Ga0501069_0448975 | Ga0501069_0448975_476_727 | 77 |
| 790 | 3300049586 | Ga0501070_1412000 | Ga0501070_1412000_266_517 | 77 |
| 791 | 3300001904 | JGI24736J21556_1021267 | JGI24736J21556_10212672 | 79 |
| 792 | 3300001915 | JGI24741J21665_1003236 | JGI24741J21665_10032367 | 79 |
| 793 | 3300001979 | JGI24740J21852_10008822 | JGI24740J21852_100088223 | 79 |
| 794 | 3300001989 | JGI24739J22299_10077429 | JGI24739J22299_100774294 | 79 |
| 795 | 3300001990 | JGI24737J22298_10035882 | JGI24737J22298_100358822 | 79 |
| 796 | 3300002067 | JGI24735J21928_10000581 | JGI24735J21928_1000058115 | 79 |
| 797 | 3300005329 | Ga0070683_100382418 | Ga0070683_1003824183 | 79 |
| 798 | 3300005336 | Ga0070680_100031873 | Ga0070680_1000318736 | 79 |
| 799 | 3300005337 | Ga0070682_100068961 | Ga0070682_1000689613 | 79 |
| 800 | 3300005344 | Ga0070661_100580567 | Ga0070661_1005805671 | 79 |
| 801 | 3300005366 | Ga0070659_101860591 | Ga0070659_1018605912 | 79 |
| 802 | 3300005455 | Ga0070663_100070717 | Ga0070663_1000707177 | 79 |
| 803 | 3300005457 | Ga0070662_100044861 | Ga0070662_1000448612 | 79 |
| 804 | 3300005458 | Ga0070681_10425709 | Ga0070681_104257092 | 79 |
| 805 | 3300005535 | Ga0070684_100133757 | Ga0070684_1001337574 | 79 |
| 806 | 3300005539 | Ga0068853_100070421 | Ga0068853_1000704212 | 79 |
| 807 | 3300005563 | Ga0068855_101006428 | Ga0068855_1010064282 | 79 |
| 808 | 3300005564 | Ga0070664_100121711 | Ga0070664_1001217115 | 79 |
| 809 | 3300005577 | Ga0068857_100100522 | Ga0068857_1001005225 | 79 |
| 810 | 3300005578 | Ga0068854_100050057 | Ga0068854_1000500578 | 79 |
| 811 | 3300005614 | Ga0068856_100534488 | Ga0068856_1005344883 | 79 |
| 812 | 3300005616 | Ga0068852_100363828 | Ga0068852_1003638284 | 79 |
| 813 | 3300005834 | Ga0068851_10017033 | Ga0068851_100170332 | 79 |
| 814 | 3300009551 | Ga0105238_10180190 | Ga0105238_101801905 | 79 |
| 815 | 3300013100 | Ga0157373_10182542 | Ga0157373_101825423 | 79 |
| 816 | 3300013102 | Ga0157371_10063630 | Ga0157371_100636305 | 79 |
| 817 | 3300013105 | Ga0157369_10879445 | Ga0157369_108794453 | 79 |
| 818 | 3300013307 | Ga0157372_10931968 | Ga0157372_109319683 | 79 |
| 819 | 3300025904 | Ga0207647_10000857 | Ga0207647_100008578 | 79 |
| 820 | 3300025909 | Ga0207705_10072555 | Ga0207705_100725554 | 79 |
| 821 | 3300025917 | Ga0207660_10189111 | Ga0207660_101891113 | 79 |
| 822 | 3300025919 | Ga0207657_10008325 | Ga0207657_100083257 | 79 |
| 823 | 3300025920 | Ga0207649_10744590 | Ga0207649_107445902 | 79 |
| 824 | 3300025921 | Ga0207652_10167059 | Ga0207652_101670594 | 79 |
| 825 | 3300025933 | Ga0207706_10007738 | Ga0207706_100077389 | 79 |
| 826 | 3300025944 | Ga0207661_11373800 | Ga0207661_113738003 | 79 |
| 827 | 3300025945 | Ga0207679_11156104 | Ga0207679_111561042 | 79 |
| 828 | 3300025981 | Ga0207640_10445883 | Ga0207640_104458833 | 79 |
| 829 | 3300026067 | Ga0207678_10005637 | Ga0207678_1000563711 | 79 |
| 830 | 3300026078 | Ga0207702_10073760 | Ga0207702_100737606 | 79 |
| 831 | 3300026116 | Ga0207674_10078939 | Ga0207674_100789397 | 79 |
| 832 | 3300026142 | Ga0207698_10086173 | Ga0207698_100861732 | 79 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar