F482524

General Info

Members Datasets Scaffolds Average Seq Length
827 337 1654 117

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0581761|Ga0466965_0581761_185_586
Length 133
Sequence MADTPANQQPSPHAADRPVPYKVEKPWGWELIWARTDRYVGKILHVKAGHILSLQYHHRKDETMHVLSGELILRSRGQDETELQERPFRAGESVHIPPLLVHQIEAVQDTDVLEASTPELDDLVRIQDRYGRG

Samples

Sample ID Description Type Environment
1 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
190 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
191 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
196 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
203 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
204 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
205 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
206 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
207 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
208 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
209 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
210 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
211 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
212 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
213 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
214 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
215 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
237 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
250 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
268 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
269 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
270 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
271 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
272 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
288 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
289 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
290 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
291 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
292 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
293 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
294 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
295 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
296 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
297 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
298 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
299 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
300 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
301 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
302 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
303 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
304 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
305 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
306 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
307 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
308 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
309 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
310 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
311 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
312 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
313 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
314 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
315 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
316 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
317 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
318 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
319 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
320 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
323 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
324 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
325 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
326 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
330 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
331 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
332 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
333 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
334 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
335 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
336 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
337 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.13
Rhizosphere 92.74
Stem 0
Stem Tuber 0
Unclassified 22.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466965_0581761 3300044683 Unclassified 635
2 Ga0065715_10106221 3300005293 Bacteria 2843
3 Ga0065715_10119747 3300005293 Bacteria 2278
4 Ga0065715_10453137 3300005293 Unclassified 824
5 Ga0065715_10974148 3300005293 Unclassified 545
6 Ga0065707_10231002 3300005295 Bacteria 1189
7 Ga0070676_10009939 3300005328 Bacteria 5150
8 Ga0070683_100035503 3300005329 Bacteria 4557
9 Ga0070683_100488617 3300005329 Unclassified 1176
10 Ga0070683_100925485 3300005329 Unclassified 836
11 Ga0070677_10551761 3300005333 Unclassified 632
12 Ga0070677_10595979 3300005333 Unclassified 611
13 Ga0068869_100533126 3300005334 Bacteria 984
14 Ga0070666_10435635 3300005335 Bacteria 945
15 Ga0070680_100007400 3300005336 Bacteria 8381
16 Ga0070680_100009987 3300005336 Bacteria 7311
17 Ga0070680_100495358 3300005336 Unclassified 1045
18 Ga0070680_101254901 3300005336 Unclassified 641
19 Ga0070682_100196220 3300005337 Bacteria 1421
20 Ga0070682_100546055 3300005337 Bacteria 906
21 Ga0070682_100941282 3300005337 Unclassified 713
22 Ga0068868_100461565 3300005338 Bacteria 1106
23 Ga0070660_100080309 3300005339 Bacteria 2559
24 Ga0070660_100239194 3300005339 Bacteria 1478
25 Ga0070691_10088108 3300005341 Bacteria 1527
26 Ga0070691_10163147 3300005341 Unclassified 1150
27 Ga0070691_10972105 3300005341 Unclassified 528
28 Ga0070687_100861585 3300005343 Unclassified 647
29 Ga0070661_100168733 3300005344 Unclassified 1661
30 Ga0070661_101748537 3300005344 Unclassified 527
31 Ga0070692_10299290 3300005345 Bacteria 982
32 Ga0070692_10392555 3300005345 Bacteria 874
33 Ga0070692_10903168 3300005345 Unclassified 611
34 Ga0070668_100366127 3300005347 Unclassified 1223
35 Ga0070668_101912112 3300005347 Unclassified 546
36 Ga0070669_100048012 3300005353 Bacteria 3115
37 Ga0070675_100732364 3300005354 Bacteria 902
38 Ga0070675_101415987 3300005354 Unclassified 641
39 Ga0070675_101730709 3300005354 Bacteria 577
40 Ga0070671_100322448 3300005355 Bacteria 1317
41 Ga0070674_100221940 3300005356 Bacteria 1470
42 Ga0070674_101411157 3300005356 Unclassified 624
43 Ga0070674_101642640 3300005356 Bacteria 580
44 Ga0070673_100144744 3300005364 Bacteria 2008
45 Ga0070688_100211059 3300005365 Bacteria 1363
46 Ga0070659_100191639 3300005366 Bacteria 1680
47 Ga0070659_100274161 3300005366 Bacteria 1402
48 Ga0070659_100410255 3300005366 Bacteria 1145
49 Ga0070667_100171270 3300005367 Bacteria 1917
50 Ga0070703_10068688 3300005406 Bacteria 1178
51 Ga0070709_10251696 3300005434 Bacteria 1273
52 Ga0070714_101392430 3300005435 Bacteria 685
53 Ga0070713_101263620 3300005436 Bacteria 715
54 Ga0070711_100002799 3300005439 Bacteria 10006
55 Ga0070711_100766837 3300005439 Bacteria 816
56 Ga0070705_100083594 3300005440 Bacteria 1968
57 Ga0070705_100105925 3300005440 Bacteria 1786
58 Ga0070705_100129032 3300005440 Bacteria 1646
59 Ga0070705_100199740 3300005440 Bacteria 1370
60 Ga0070705_100396641 3300005440 Bacteria 1020
61 Ga0070705_100915607 3300005440 Bacteria 706
62 Ga0070705_101257970 3300005440 Bacteria 612
63 Ga0070700_100115134 3300005441 Unclassified 1794
64 Ga0070700_100391238 3300005441 Bacteria 1043
65 Ga0070694_100164490 3300005444 Bacteria 1631
66 Ga0070694_100247848 3300005444 Bacteria 1346
67 Ga0070694_100325370 3300005444 Bacteria 1184
68 Ga0070708_100025224 3300005445 Bacteria 5080
69 Ga0070708_100118032 3300005445 Bacteria 2444
70 Ga0070708_100190878 3300005445 Bacteria 1916
71 Ga0070708_100563512 3300005445 Bacteria 1074
72 Ga0070708_100597822 3300005445 Unclassified 1040
73 Ga0070708_100654063 3300005445 Bacteria 990
74 Ga0070708_100757494 3300005445 Bacteria 913
75 Ga0070708_100890771 3300005445 Unclassified 836
76 Ga0070663_100140083 3300005455 Bacteria 1845
77 Ga0070663_101655121 3300005455 Unclassified 571
78 Ga0070678_100038030 3300005456 Bacteria 3385
79 Ga0070662_100057690 3300005457 Bacteria 2822
80 Ga0070662_100901947 3300005457 Bacteria 754
81 Ga0070662_100952042 3300005457 Unclassified 734
82 Ga0070681_10076015 3300005458 Bacteria 3318
83 Ga0070681_10167675 3300005458 Bacteria 2118
84 Ga0070681_10528825 3300005458 Unclassified 1093
85 Ga0070681_10793326 3300005458 Bacteria 864
86 Ga0068867_100008098 3300005459 Bacteria 7428
87 Ga0068867_100038907 3300005459 Bacteria 3465
88 Ga0070706_100004466 3300005467 Bacteria 13503
89 Ga0070706_100289330 3300005467 Bacteria 1529
90 Ga0070706_100398749 3300005467 Bacteria 1281
91 Ga0070706_100968835 3300005467 Bacteria 785
92 Ga0070707_100004738 3300005468 Bacteria 12751
93 Ga0070707_100175091 3300005468 Bacteria 2091
94 Ga0070707_101041672 3300005468 Unclassified 784
95 Ga0070707_101754353 3300005468 Bacteria 588
96 Ga0070707_102218107 3300005468 Unclassified 517
97 Ga0070698_100014842 3300005471 Bacteria 8235
98 Ga0070698_100191377 3300005471 Bacteria 1983
99 Ga0070698_100264815 3300005471 Bacteria 1651
100 Ga0070698_101973365 3300005471 Bacteria 537
101 Ga0070699_100000131 3300005518 Bacteria 69337
102 Ga0070699_100003191 3300005518 Bacteria 14504
103 Ga0070699_100004511 3300005518 Bacteria 12318
104 Ga0070699_100008937 3300005518 Bacteria 8678
105 Ga0070699_100128518 3300005518 Bacteria 2233
106 Ga0070699_100153892 3300005518 Bacteria 2035
107 Ga0070699_100266612 3300005518 Bacteria 1532
108 Ga0070699_100608198 3300005518 Bacteria 997
109 Ga0070679_100237887 3300005530 Bacteria 1779
110 Ga0070679_100292417 3300005530 Bacteria 1580
111 Ga0070679_100753558 3300005530 Bacteria 917
112 Ga0070684_100558228 3300005535 Unclassified 1063
113 Ga0070684_100589895 3300005535 Bacteria 1033
114 Ga0070697_100004653 3300005536 Bacteria 10530
115 Ga0070697_100075760 3300005536 Bacteria 2766
116 Ga0070697_100081128 3300005536 Bacteria 2673
117 Ga0070697_100778954 3300005536 Bacteria 846
118 Ga0068853_100133861 3300005539 Bacteria 2221
119 Ga0068853_100666522 3300005539 Bacteria 991
120 Ga0070672_100624782 3300005543 Bacteria 940
121 Ga0070686_101049323 3300005544 Bacteria 671
122 Ga0070695_100031774 3300005545 Bacteria 3296
123 Ga0070695_100522560 3300005545 Bacteria 921
124 Ga0070695_100630825 3300005545 Unclassified 844
125 Ga0070696_100000526 3300005546 Bacteria 24285
126 Ga0070696_100060512 3300005546 Bacteria 2648
127 Ga0070696_100153863 3300005546 Bacteria 1690
128 Ga0070696_100174429 3300005546 Bacteria 1591
129 Ga0070696_100179735 3300005546 Bacteria 1569
130 Ga0070696_100221443 3300005546 Bacteria 1420
131 Ga0070696_100490698 3300005546 Bacteria 975
132 Ga0070696_101027920 3300005546 Unclassified 690
133 Ga0070693_100216251 3300005547 Bacteria 1253
134 Ga0070693_100814445 3300005547 Bacteria 693
135 Ga0070665_101221690 3300005548 Bacteria 762
136 Ga0070704_100035572 3300005549 Bacteria 3386
137 Ga0070704_100156171 3300005549 Unclassified 1799
138 Ga0070704_100340756 3300005549 Bacteria 1262
139 Ga0070704_101921195 3300005549 Unclassified 549
140 Ga0070664_100031929 3300005564 Bacteria 4404
141 Ga0070664_100113170 3300005564 Bacteria 2370
142 Ga0070664_100409554 3300005564 Unclassified 1241
143 Ga0070664_101958322 3300005564 Unclassified 556
144 Ga0068857_100003989 3300005577 Bacteria 12433
145 Ga0068854_100005676 3300005578 Bacteria 7888
146 Ga0068854_100795889 3300005578 Bacteria 824
147 Ga0068856_101827960 3300005614 Unclassified 619
148 Ga0070702_100049156 3300005615 Bacteria 2404
149 Ga0070702_100499905 3300005615 Unclassified 893
150 Ga0070702_101045272 3300005615 Bacteria 649
151 Ga0068852_100666561 3300005616 Bacteria 1049
152 Ga0068859_100098835 3300005617 Bacteria 2973
153 Ga0068864_100005813 3300005618 Bacteria 10114
154 Ga0068864_100008732 3300005618 Bacteria 8356
155 Ga0068864_100293696 3300005618 Bacteria 1520
156 Ga0068866_10012010 3300005718 Bacteria 3767
157 Ga0068866_10391271 3300005718 Unclassified 894
158 Ga0068861_100171105 3300005719 Bacteria 1800
159 Ga0068861_101829658 3300005719 Unclassified 603
160 Ga0068870_10153393 3300005840 Bacteria 1359
161 Ga0068863_100011471 3300005841 Bacteria 8569
162 Ga0068863_102469400 3300005841 Unclassified 529
163 Ga0068858_100100427 3300005842 Bacteria 2698
164 Ga0068858_100107831 3300005842 Unclassified 2600
165 Ga0068858_100174352 3300005842 Bacteria 2029
166 Ga0068858_101431698 3300005842 Archaea 681
167 Ga0068860_100047764 3300005843 Bacteria 4079
168 Ga0068860_100898876 3300005843 Unclassified 901
169 Ga0068860_102781077 3300005843 Unclassified 507
170 Ga0068862_100024031 3300005844 Bacteria 5109
171 Ga0068862_101248718 3300005844 Bacteria 743
172 Ga0081455_10110720 3300005937 Bacteria 2182
173 Ga0081538_10066647 3300005981 Bacteria 2016
174 Ga0081538_10383080 3300005981 Unclassified 507
175 Ga0081539_10113658 3300005985 Bacteria 1358
176 Ga0070715_10261105 3300006163 Bacteria 910
177 Ga0070716_101209979 3300006173 Bacteria 607
178 Ga0070712_100171890 3300006175 Bacteria 1682
179 Ga0070712_100366293 3300006175 Unclassified 1183
180 Ga0097621_101493218 3300006237 Unclassified 641
181 Ga0068871_100372903 3300006358 Bacteria 1266
182 Ga0075428_100036820 3300006844 Bacteria 5388
183 Ga0075428_100102374 3300006844 Bacteria 3123
184 Ga0075428_100347329 3300006844 Unclassified 1593
185 Ga0075428_101460913 3300006844 Bacteria 717
186 Ga0075428_102528121 3300006844 Bacteria 526
187 Ga0075430_100154604 3300006846 Unclassified 1910
188 Ga0075430_101111701 3300006846 Unclassified 651
189 Ga0075431_100015302 3300006847 Bacteria 7773
190 Ga0075431_100118877 3300006847 Unclassified 2727
191 Ga0075431_100141624 3300006847 Bacteria 2479
192 Ga0075431_100966593 3300006847 Bacteria 819
193 Ga0075433_10042982 3300006852 Bacteria 3922
194 Ga0075433_10079795 3300006852 Bacteria 2884
195 Ga0075433_10419686 3300006852 Bacteria 1180
196 Ga0075433_11278486 3300006852 Unclassified 636
197 Ga0075434_100032494 3300006871 Bacteria 5145
198 Ga0075434_100070739 3300006871 Bacteria 3480
199 Ga0075434_100415659 3300006871 Bacteria 1366
200 Ga0075434_100612819 3300006871 Bacteria 1107
201 Ga0075434_100763007 3300006871 Bacteria 984
202 Ga0075429_100005664 3300006880 Bacteria 10774
203 Ga0075429_100117673 3300006880 Bacteria 2322
204 Ga0075429_100543181 3300006880 Bacteria 1018
205 Ga0075429_100647292 3300006880 Bacteria 926
206 Ga0068865_100023280 3300006881 Bacteria 4054
207 Ga0068865_100054376 3300006881 Bacteria 2781
208 Ga0075436_100031537 3300006914 Bacteria 3650
209 Ga0075436_100421974 3300006914 Bacteria 969
210 Ga0075436_100512874 3300006914 Unclassified 878
211 Ga0097620_100098837 3300006931 Bacteria 2973
212 Ga0075435_100116035 3300007076 Bacteria 2230
213 Ga0075435_100192631 3300007076 Bacteria 1726
214 Ga0075435_100259193 3300007076 Bacteria 1481
215 Ga0075435_100377464 3300007076 Bacteria 1218
216 Ga0075435_100400362 3300007076 Unclassified 1181
217 Ga0075435_100629376 3300007076 Bacteria 931
218 Ga0105240_10080722 3300009093 Bacteria 3999
219 Ga0111539_10064564 3300009094 Bacteria 4329
220 Ga0111539_10291319 3300009094 Bacteria 1900
221 Ga0111539_10346686 3300009094 Bacteria 1728
222 Ga0105245_10848762 3300009098 Unclassified 953
223 Ga0105245_12346769 3300009098 Unclassified 587
224 Ga0105247_10288638 3300009101 Bacteria 1134
225 Ga0105247_10311124 3300009101 Bacteria 1096
226 Ga0114129_10005002 3300009147 Bacteria 18666
227 Ga0114129_10025521 3300009147 Bacteria 8374
228 Ga0114129_10046313 3300009147 Bacteria 6112
229 Ga0114129_10133652 3300009147 Bacteria 3406
230 Ga0114129_10135190 3300009147 Bacteria 3384
231 Ga0114129_10439801 3300009147 Bacteria 1712
232 Ga0114129_10576885 3300009147 Bacteria 1460
233 Ga0114129_10582248 3300009147 Bacteria 1452
234 Ga0114129_11401477 3300009147 Bacteria 862
235 Ga0114129_12169510 3300009147 Bacteria 669
236 Ga0105243_10007267 3300009148 Bacteria 8512
237 Ga0105241_10017856 3300009174 Bacteria 5218
238 Ga0105241_10727394 3300009174 Bacteria 908
239 Ga0105241_10860471 3300009174 Bacteria 839
240 Ga0105242_10269372 3300009176 Bacteria 1542
241 Ga0105242_10374358 3300009176 Bacteria 1322
242 Ga0105242_11503597 3300009176 Unclassified 704
243 Ga0105242_11524594 3300009176 Unclassified 700
244 Ga0105248_10164703 3300009177 Bacteria 2500
245 Ga0105248_10614421 3300009177 Bacteria 1226
246 Ga0105248_10707800 3300009177 Unclassified 1136
247 Ga0105237_10072012 3300009545 Bacteria 3450
248 Ga0105249_10022117 3300009553 Bacteria 5695
249 Ga0105249_10104613 3300009553 Bacteria 2668
250 Ga0105249_10480911 3300009553 Unclassified 1285
251 Ga0105249_10799685 3300009553 Unclassified 1007
252 Ga0105249_11454938 3300009553 Bacteria 757
253 Ga0105239_10007902 3300010375 Bacteria 12160
254 Ga0105246_10040986 3300011119 Unclassified 3128
255 Ga0105246_10410468 3300011119 Bacteria 1127
256 Ga0105246_10569860 3300011119 Bacteria 973
257 Ga0157373_10894666 3300013100 Unclassified 658
258 Ga0157378_10003362 3300013297 Bacteria 14228
259 Ga0163162_10037565 3300013306 Unclassified 4833
260 Ga0163162_10047295 3300013306 Bacteria 4312
261 Ga0163162_10313960 3300013306 Bacteria 1700
262 Ga0163162_11270566 3300013306 Bacteria 836
263 Ga0157372_10103508 3300013307 Bacteria 3253
264 Ga0157372_11178341 3300013307 Bacteria 886
265 Ga0157375_12628733 3300013308 Unclassified 602
266 Ga0163163_10080871 3300014325 Bacteria 3250
267 Ga0163163_10156630 3300014325 Unclassified 2322
268 Ga0163163_11453926 3300014325 Bacteria 747
269 Ga0163163_12950435 3300014325 Unclassified 531
270 Ga0157380_10796010 3300014326 Unclassified 962
271 Ga0157380_10905774 3300014326 Unclassified 908
272 Ga0182008_10197663 3300014497 Bacteria 1022
273 Ga0157377_10376974 3300014745 Unclassified 959
274 Ga0157379_10221242 3300014968 Bacteria 1715
275 Ga0157379_10820198 3300014968 Unclassified 879
276 Ga0157379_12437771 3300014968 Bacteria 522
277 Ga0157376_10211694 3300014969 Bacteria 1790
278 Ga0163161_10070245 3300017792 Bacteria 2560
279 Ga0163161_10234741 3300017792 Bacteria 1424
280 Ga0207653_10159320 3300025885 Bacteria 835
281 Ga0207642_10005341 3300025899 Bacteria 4186
282 Ga0207688_10437702 3300025901 Bacteria 814
283 Ga0207688_10963815 3300025901 Unclassified 540
284 Ga0207680_10130869 3300025903 Bacteria 1654
285 Ga0207647_10659464 3300025904 Unclassified 573
286 Ga0207647_10722797 3300025904 Unclassified 541
287 Ga0207685_10090616 3300025905 Unclassified 1286
288 Ga0207685_10161267 3300025905 Bacteria 1024
289 Ga0207699_11085800 3300025906 Bacteria 592
290 Ga0207645_10001959 3300025907 Bacteria 16566
291 Ga0207643_10004403 3300025908 Bacteria 7575
292 Ga0207643_10223662 3300025908 Bacteria 1153
293 Ga0207684_10011945 3300025910 Bacteria 7565
294 Ga0207684_10122174 3300025910 Bacteria 2233
295 Ga0207684_10147766 3300025910 Bacteria 2022
296 Ga0207684_10941313 3300025910 Bacteria 725
297 Ga0207654_10003690 3300025911 Bacteria 7722
298 Ga0207654_10644681 3300025911 Bacteria 758
299 Ga0207707_10010026 3300025912 Bacteria 8222
300 Ga0207707_10141884 3300025912 Bacteria 2100
301 Ga0207707_10467934 3300025912 Unclassified 1077
302 Ga0207707_11131312 3300025912 Bacteria 637
303 Ga0207695_10817787 3300025913 Bacteria 812
304 Ga0207671_10387449 3300025914 Bacteria 1111
305 Ga0207693_10305122 3300025915 Bacteria 1247
306 Ga0207693_10386118 3300025915 Unclassified 1095
307 Ga0207663_10004700 3300025916 Bacteria 6818
308 Ga0207663_10597103 3300025916 Bacteria 867
309 Ga0207663_10911876 3300025916 Bacteria 703
310 Ga0207660_10068416 3300025917 Bacteria 2575
311 Ga0207660_10567558 3300025917 Bacteria 923
312 Ga0207660_10868757 3300025917 Bacteria 736
313 Ga0207662_11120925 3300025918 Unclassified 559
314 Ga0207662_11170190 3300025918 Unclassified 547
315 Ga0207657_10261483 3300025919 Unclassified 1377
316 Ga0207649_10127379 3300025920 Unclassified 1725
317 Ga0207652_10010159 3300025921 Bacteria 7581
318 Ga0207652_10195330 3300025921 Bacteria 1820
319 Ga0207646_10013251 3300025922 Bacteria 7887
320 Ga0207646_10047450 3300025922 Bacteria 3852
321 Ga0207646_10376125 3300025922 Bacteria 1283
322 Ga0207646_11609210 3300025922 Unclassified 560
323 Ga0207694_10493768 3300025924 Unclassified 1025
324 Ga0207687_10394012 3300025927 Bacteria 1137
325 Ga0207700_10916415 3300025928 Unclassified 784
326 Ga0207664_11454704 3300025929 Bacteria 606
327 Ga0207664_11529734 3300025929 Bacteria 589
328 Ga0207690_10258717 3300025932 Bacteria 1348
329 Ga0207690_10284395 3300025932 Bacteria 1289
330 Ga0207706_10008792 3300025933 Bacteria 9297
331 Ga0207706_10755524 3300025933 Bacteria 828
332 Ga0207686_10002785 3300025934 Bacteria 9462
333 Ga0207709_10030296 3300025935 Bacteria 3146
334 Ga0207669_10183202 3300025937 Bacteria 1503
335 Ga0207669_10903348 3300025937 Unclassified 738
336 Ga0207704_10013556 3300025938 Bacteria 4084
337 Ga0207665_10826435 3300025939 Bacteria 733
338 Ga0207665_10973666 3300025939 Bacteria 674
339 Ga0207665_11076967 3300025939 Unclassified 640
340 Ga0207691_10126022 3300025940 Bacteria 2266
341 Ga0207691_11713221 3300025940 Unclassified 508
342 Ga0207711_10347993 3300025941 Bacteria 1372
343 Ga0207711_10418670 3300025941 Bacteria 1246
344 Ga0207689_10044212 3300025942 Bacteria 3682
345 Ga0207689_10443838 3300025942 Bacteria 1084
346 Ga0207661_10042428 3300025944 Bacteria 3586
347 Ga0207661_10505291 3300025944 Unclassified 1105
348 Ga0207661_11086130 3300025944 Bacteria 737
349 Ga0207679_10036953 3300025945 Bacteria 3468
350 Ga0207679_10250052 3300025945 Bacteria 1506
351 Ga0207679_10266378 3300025945 Unclassified 1463
352 Ga0207667_10137895 3300025949 Bacteria 2512
353 Ga0207667_12076956 3300025949 Unclassified 527
354 Ga0207651_10688250 3300025960 Bacteria 900
355 Ga0207712_10013453 3300025961 Bacteria 5246
356 Ga0207712_10084776 3300025961 Bacteria 2316
357 Ga0207668_10059917 3300025972 Bacteria 2670
358 Ga0207668_10623659 3300025972 Unclassified 941
359 Ga0207640_10019626 3300025981 Bacteria 3998
360 Ga0207658_10163736 3300025986 Bacteria 1825
361 Ga0207658_10393988 3300025986 Unclassified 1216
362 Ga0207703_10302956 3300026035 Bacteria 1458
363 Ga0207703_10338643 3300026035 Bacteria 1382
364 Ga0207703_12365263 3300026035 Archaea 507
365 Ga0207639_10418145 3300026041 Bacteria 1211
366 Ga0207639_10433528 3300026041 Bacteria 1190
367 Ga0207639_10646964 3300026041 Bacteria 978
368 Ga0207678_10131214 3300026067 Bacteria 2137
369 Ga0207678_10299744 3300026067 Bacteria 1381
370 Ga0207678_10330413 3300026067 Bacteria 1312
371 Ga0207708_10007267 3300026075 Bacteria 8187
372 Ga0207708_10035505 3300026075 Unclassified 3793
373 Ga0207708_10257718 3300026075 Bacteria 1407
374 Ga0207702_10547418 3300026078 Bacteria 1132
375 Ga0207641_10793750 3300026088 Bacteria 936
376 Ga0207648_10002060 3300026089 Bacteria 21904
377 Ga0207648_10432571 3300026089 Bacteria 1196
378 Ga0207676_10002069 3300026095 Bacteria 14566
379 Ga0207676_10009280 3300026095 Bacteria 6998
380 Ga0207676_10074337 3300026095 Bacteria 2738
381 Ga0207674_10017092 3300026116 Bacteria 7918
382 Ga0207674_10096916 3300026116 Bacteria 2934
383 Ga0207675_100176646 3300026118 Unclassified 2043
384 Ga0207675_100205122 3300026118 Bacteria 1894
385 Ga0207675_100287274 3300026118 Bacteria 1599
386 Ga0207683_10058273 3300026121 Bacteria 3391
387 Ga0207683_10707172 3300026121 Unclassified 934
388 Ga0207698_10119060 3300026142 Bacteria 2231
389 Ga0207698_10635810 3300026142 Unclassified 1055
390 Ga0209999_1063585 3300027543 Unclassified 704
391 Ga0209982_1070084 3300027552 Bacteria 574
392 Ga0209966_1043284 3300027695 Bacteria 943
393 Ga0209998_10168098 3300027717 Bacteria 567
394 Ga0209974_10067559 3300027876 Bacteria 1216
395 Ga0207428_11147654 3300027907 Bacteria 542
396 Ga0268266_11047356 3300028379 Bacteria 789
397 Ga0268265_10189117 3300028380 Unclassified 1776
398 Ga0307408_100011030 3300031548 Bacteria 5963
399 Ga0307408_100069104 3300031548 Bacteria 2603
400 Ga0307408_100096458 3300031548 Unclassified 2244
401 Ga0307408_100691583 3300031548 Bacteria 916
402 Ga0307405_10058570 3300031731 Bacteria 2424
403 Ga0307405_10074483 3300031731 Bacteria 2196
404 Ga0307405_10425188 3300031731 Bacteria 1046
405 Ga0307405_11578679 3300031731 Unclassified 578
406 Ga0307413_10006927 3300031824 Bacteria 5218
407 Ga0307413_10010645 3300031824 Bacteria 4476
408 Ga0307413_10022298 3300031824 Bacteria 3410
409 Ga0307413_10037584 3300031824 Unclassified 2797
410 Ga0307413_10056800 3300031824 Bacteria 2389
411 Ga0307413_10113182 3300031824 Bacteria 1821
412 Ga0307413_10161437 3300031824 Bacteria 1575
413 Ga0307413_10206381 3300031824 Bacteria 1423
414 Ga0307413_10556480 3300031824 Unclassified 931
415 Ga0307413_10590527 3300031824 Bacteria 907
416 Ga0307410_10002633 3300031852 Bacteria 8742
417 Ga0307410_10005177 3300031852 Bacteria 6868
418 Ga0307410_10007383 3300031852 Bacteria 6015
419 Ga0307410_10024757 3300031852 Unclassified 3755
420 Ga0307410_10037922 3300031852 Bacteria 3153
421 Ga0307410_10044398 3300031852 Bacteria 2952
422 Ga0307410_10355012 3300031852 Bacteria 1172
423 Ga0307410_10592788 3300031852 Unclassified 923
424 Ga0307410_11190781 3300031852 Bacteria 663
425 Ga0307406_10013425 3300031901 Bacteria 4692
426 Ga0307406_10123863 3300031901 Bacteria 1802
427 Ga0307406_10150470 3300031901 Bacteria 1659
428 Ga0307406_10173641 3300031901 Bacteria 1562
429 Ga0307406_10293606 3300031901 Bacteria 1245
430 Ga0307406_10458334 3300031901 Unclassified 1024
431 Ga0307406_11032253 3300031901 Bacteria 707
432 Ga0307407_10038931 3300031903 Bacteria 2639
433 Ga0307407_10041451 3300031903 Bacteria 2575
434 Ga0307407_10094962 3300031903 Bacteria 1837
435 Ga0307407_10256784 3300031903 Bacteria 1200
436 Ga0307407_10442801 3300031903 Bacteria 941
437 Ga0307407_10442844 3300031903 Bacteria 941
438 Ga0307407_10669770 3300031903 Bacteria 779
439 Ga0307407_10744591 3300031903 Bacteria 741
440 Ga0307412_10217905 3300031911 Bacteria 1461
441 Ga0307412_10292562 3300031911 Bacteria 1283
442 Ga0307412_10387103 3300031911 Bacteria 1134
443 Ga0307412_10411135 3300031911 Bacteria 1104
444 Ga0307412_10427103 3300031911 Bacteria 1085
445 Ga0307412_11605034 3300031911 Bacteria 594
446 Ga0307412_12312785 3300031911 Bacteria 502
447 Ga0307409_100010966 3300031995 Bacteria 5677
448 Ga0307409_100017349 3300031995 Bacteria 4795
449 Ga0307409_100048008 3300031995 Bacteria 3245
450 Ga0307409_100207157 3300031995 Bacteria 1759
451 Ga0307409_100217146 3300031995 Bacteria 1723
452 Ga0307409_100238474 3300031995 Bacteria 1654
453 Ga0307409_100360935 3300031995 Bacteria 1374
454 Ga0307409_101118310 3300031995 Bacteria 809
455 Ga0307416_100001764 3300032002 Bacteria 11983
456 Ga0307416_100018370 3300032002 Bacteria 4924
457 Ga0307416_100021841 3300032002 Unclassified 4605
458 Ga0307416_100033140 3300032002 Bacteria 3913
459 Ga0307416_100060168 3300032002 Bacteria 3091
460 Ga0307416_100096272 3300032002 Bacteria 2559
461 Ga0307416_100102675 3300032002 Unclassified 2494
462 Ga0307416_100116164 3300032002 Unclassified 2371
463 Ga0307416_100255897 3300032002 Bacteria 1707
464 Ga0307416_100427333 3300032002 Bacteria 1371
465 Ga0307416_100484333 3300032002 Bacteria 1298
466 Ga0307416_100578157 3300032002 Bacteria 1200
467 Ga0307416_100898718 3300032002 Bacteria 986
468 Ga0307416_101660192 3300032002 Unclassified 744
469 Ga0307414_10041216 3300032004 Bacteria 3125
470 Ga0307414_10053221 3300032004 Bacteria 2822
471 Ga0307414_10066020 3300032004 Bacteria 2584
472 Ga0307414_10073089 3300032004 Bacteria 2479
473 Ga0307414_10127773 3300032004 Bacteria 1967
474 Ga0307414_10227790 3300032004 Bacteria 1535
475 Ga0307414_10347875 3300032004 Bacteria 1271
476 Ga0307411_10007633 3300032005 Bacteria 5534
477 Ga0307411_10009538 3300032005 Bacteria 5112
478 Ga0307411_10015803 3300032005 Bacteria 4253
479 Ga0307411_10043216 3300032005 Bacteria 2882
480 Ga0307411_10102680 3300032005 Bacteria 2027
481 Ga0307411_10109302 3300032005 Bacteria 1974
482 Ga0307411_10144125 3300032005 Bacteria 1760
483 Ga0307415_100016741 3300032126 Unclassified 4378
484 Ga0307415_100017132 3300032126 Bacteria 4338
485 Ga0307415_100036306 3300032126 Bacteria 3228
486 Ga0307415_100058472 3300032126 Bacteria 2654
487 Ga0307415_100069066 3300032126 Bacteria 2476
488 Ga0307415_100506473 3300032126 Bacteria 1057
489 Ga0373958_0105106 3300034819 Bacteria 667
490 Ga0373928_0072478 3300035084 Bacteria 854
491 Ga0373940_0004243 3300035088 Bacteria 3016
492 Ga0373940_0113430 3300035088 Unclassified 834
493 Ga0373940_0134924 3300035088 Unclassified 776
494 Ga0373940_0342105 3300035088 Unclassified 523
495 Ga0373932_0123041 3300035112 Bacteria 867
496 Ga0373941_0064966 3300035115 Bacteria 1197
497 Ga0373941_0074712 3300035115 Bacteria 1133
498 Ga0373943_0255564 3300035170 Unclassified 985
499 Ga0373942_0217133 3300035207 Bacteria 640
500 Ga0316574_0567230 3300035398 Bacteria 703
501 Ga0373931_0003655 3300035691 Bacteria 6953
502 Ga0373931_0540243 3300035691 Bacteria 756
503 Ga0373931_0640655 3300035691 Bacteria 698
504 Ga0373937_0161755 3300036401 Bacteria 2099
505 Ga0395900_0507152 3300037418 Bacteria 1156
506 Ga0395905_0030032 3300037471 Bacteria 5123
507 Ga0395905_0093574 3300037471 Bacteria 2819
508 Ga0395905_0775498 3300037471 Bacteria 862
509 Ga0395905_1765051 3300037471 Unclassified 524
510 Ga0395901_1100319 3300038443 Unclassified 765
511 Ga0242419_001918 3300038698 Bacteria 1322
512 Ga0242420_017065 3300038996 Bacteria 1268
513 Ga0242420_075742 3300038996 Bacteria 689
514 Ga0439439_0003943 3300041406 Unclassified 3308
515 Ga0451793_0454245 3300041452 Unclassified 632
516 Ga0451793_0650265 3300041452 Bacteria 701
517 Ga0451845_0087672 3300041501 Bacteria 671
518 Ga0439431_0042126 3300041997 Bacteria 1166
519 Ga0439448_0015975 3300042005 Unclassified 2280
520 Ga0439448_0160346 3300042005 Bacteria 783
521 Ga0439448_0272688 3300042005 Unclassified 599
522 Ga0439455_0030225 3300042012 Unclassified 1343
523 Ga0439462_0012907 3300042015 Unclassified 2138
524 Ga0439462_0037973 3300042015 Bacteria 1284
525 Ga0450894_038233 3300042131 Bacteria 684
526 Ga0450898_012677 3300042134 Bacteria 1396
527 Ga0439434_0118194 3300042435 Unclassified 863
528 Ga0439444_0050789 3300042437 Bacteria 842
529 Ga0453683_0018695 3300044673 Bacteria 4447
530 Ga0453683_0189812 3300044673 Bacteria 1303
531 Ga0453683_0203726 3300044673 Bacteria 1256
532 Ga0453684_0226200 3300044712 Bacteria 2163
533 Ga0453684_1844208 3300044712 Bacteria 613
534 Ga0466960_0595408 3300044901 Bacteria 656
535 Ga0466960_0617490 3300044901 Bacteria 645
536 Ga0451576_0350543 3300045051 Bacteria 1545
537 Ga0451576_0424215 3300045051 Bacteria 1396
538 Ga0451576_1234785 3300045051 Bacteria 780
539 Ga0466967_0417901 3300045976 Bacteria 1307
540 Ga0495603_0065731 3300046455 Bacteria 2137
541 Ga0495603_0639997 3300046455 Bacteria 609
542 Ga0495629_0093161 3300046459 Bacteria 2103
543 Ga0495641_0039760 3300046461 Bacteria 2191
544 Ga0495580_0092817 3300046472 Bacteria 2101
545 Ga0495580_0563671 3300046472 Unclassified 755
546 Ga0495582_0050911 3300046473 Bacteria 2283
547 Ga0495664_0029270 3300046477 Bacteria 3220
548 Ga0495585_0234592 3300046492 Unclassified 921
549 Ga0495594_0005575 3300046499 Bacteria 6467
550 Ga0495594_0037831 3300046499 Bacteria 2634
551 Ga0495618_0097347 3300046514 Bacteria 1882
552 Ga0495628_0078527 3300046516 Bacteria 2567
553 Ga0495628_0466481 3300046516 Bacteria 915
554 Ga0495630_0002989 3300046517 Bacteria 11727
555 Ga0495666_0005633 3300046526 Bacteria 6304
556 Ga0495652_0725501 3300046529 Unclassified 667
557 Ga0495665_0079354 3300046531 Bacteria 1727
558 Ga0495640_0090469 3300046533 Unclassified 2020
559 Ga0495586_0036631 3300046535 Bacteria 2633
560 Ga0495622_0227579 3300046557 Unclassified 825
561 Ga0495633_0408595 3300046558 Unclassified 614
562 Ga0495667_0062279 3300046559 Bacteria 2445
563 Ga0495656_0709565 3300046615 Unclassified 541
564 Ga0495634_0011783 3300046642 Bacteria 6357
565 Ga0495635_0123742 3300046663 Bacteria 1764
566 Ga0495647_0011579 3300046681 Bacteria 3024
567 Ga0495658_0001049 3300046683 Bacteria 14600
568 Ga0495613_0015519 3300046689 Bacteria 5664
569 Ga0495624_0057845 3300046690 Bacteria 2437
570 Ga0495600_0056985 3300046809 Bacteria 2553
571 Ga0495636_0029528 3300047318 Unclassified 2238
572 Ga0495674_0021326 3300047319 Bacteria 5993
573 Ga0495680_0005099 3300047322 Bacteria 12401
574 Ga0495614_0064609 3300048089 Bacteria 1574
575 Ga0496100_0070289 3300048903 Bacteria 2334
576 Ga0496100_0558326 3300048903 Bacteria 886
577 Ga0496101_0041301 3300048904 Bacteria 3289
578 Ga0496101_0081058 3300048904 Bacteria 2399
579 Ga0496102_0012691 3300048905 Bacteria 7297
580 Ga0496102_0036524 3300048905 Bacteria 4427
581 Ga0496102_0040322 3300048905 Bacteria 4223
582 Ga0496102_0110469 3300048905 Bacteria 2563
583 Ga0496102_0466491 3300048905 Bacteria 1184
584 Ga0496102_1008184 3300048905 Unclassified 753
585 Ga0496103_0004583 3300048906 Bacteria 8372
586 Ga0496104_0005257 3300048907 Bacteria 11316
587 Ga0496104_0065226 3300048907 Bacteria 3455
588 Ga0496104_0104166 3300048907 Bacteria 2718
589 Ga0496104_0668634 3300048907 Bacteria 947
590 Ga0496104_0996220 3300048907 Unclassified 742
591 Ga0496105_0433492 3300048908 Unclassified 1039
592 Ga0496105_0922817 3300048908 Unclassified 657
593 Ga0496106_0029316 3300048909 Bacteria 4101
594 Ga0496106_0103022 3300048909 Bacteria 2215
595 Ga0496106_0104271 3300048909 Bacteria 2202
596 Ga0496106_0309800 3300048909 Bacteria 1267
597 Ga0496107_0262086 3300048910 Bacteria 1286
598 Ga0496107_0266974 3300048910 Unclassified 1274
599 Ga0496107_0431246 3300048910 Bacteria 980
600 Ga0496107_0701255 3300048910 Bacteria 744
601 Ga0496108_0001821 3300048911 Bacteria 17010
602 Ga0496108_0008113 3300048911 Bacteria 8515
603 Ga0496108_0017792 3300048911 Bacteria 5812
604 Ga0496108_0038132 3300048911 Bacteria 4003
605 Ga0496108_0559694 3300048911 Bacteria 997
606 Ga0496108_1216055 3300048911 Bacteria 636
607 Ga0496109_0001699 3300048912 Bacteria 18354
608 Ga0496109_0011547 3300048912 Bacteria 7597
609 Ga0496109_0030354 3300048912 Bacteria 4845
610 Ga0496109_0032959 3300048912 Unclassified 4660
611 Ga0496109_0921953 3300048912 Unclassified 811
612 Ga0496110_0021956 3300048913 Bacteria 5414
613 Ga0496110_0027057 3300048913 Bacteria 4913
614 Ga0496110_0847589 3300048913 Bacteria 819
615 Ga0496111_0003685 3300048914 Bacteria 9521
616 Ga0496111_0078454 3300048914 Bacteria 2408
617 Ga0496111_0086842 3300048914 Bacteria 2289
618 Ga0496111_0615840 3300048914 Bacteria 794
619 Ga0496111_0822557 3300048914 Bacteria 671
620 Ga0496112_0066805 3300048915 Bacteria 3548
621 Ga0496112_0081398 3300048915 Bacteria 3202
622 Ga0496112_0087606 3300048915 Bacteria 3080
623 Ga0496112_0602444 3300048915 Bacteria 1030
624 Ga0496113_0010528 3300048916 Bacteria 6117
625 Ga0496113_0030216 3300048916 Bacteria 3920
626 Ga0496113_0045681 3300048916 Bacteria 3249
627 Ga0496113_0246915 3300048916 Bacteria 1424
628 Ga0496113_0842536 3300048916 Unclassified 727
629 Ga0496114_0330092 3300048917 Bacteria 1348
630 Ga0496114_0396281 3300048917 Unclassified 1223
631 Ga0496115_0442144 3300048918 Bacteria 1051
632 Ga0501290_027126 3300049513 Bacteria 807
633 Ga0501292_070223 3300049515 Unclassified 650
634 Ga0501297_065443 3300049520 Unclassified 564
635 Ga0501298_029466 3300049521 Bacteria 1070
636 Ga0501299_172098 3300049522 Bacteria 560
637 Ga0501031_0087493 3300049568 Bacteria 2032
638 Ga0501031_0131795 3300049568 Unclassified 1633
639 Ga0501031_0410096 3300049568 Archaea 876
640 Ga0501032_0194005 3300049569 Bacteria 1327
641 Ga0501033_0540507 3300049570 Bacteria 803
642 Ga0501034_0101964 3300049571 Bacteria 2863
643 Ga0501034_0172042 3300049571 Bacteria 2133
644 Ga0501036_0423816 3300049572 Bacteria 1109
645 Ga0501036_0919226 3300049572 Unclassified 718
646 Ga0501036_0981122 3300049572 Bacteria 692
647 Ga0501037_0030237 3300049573 Bacteria 4003
648 Ga0501038_0135552 3300049574 Bacteria 2018
649 Ga0501038_0561756 3300049574 Bacteria 867
650 Ga0501039_0046067 3300049575 Bacteria 3369
651 Ga0501039_0637157 3300049575 Bacteria 835
652 Ga0501039_0793018 3300049575 Bacteria 739
653 Ga0501040_0023073 3300049576 Bacteria 4170
654 Ga0501040_0043305 3300049576 Bacteria 3068
655 Ga0501040_0061646 3300049576 Bacteria 2580
656 Ga0501040_0338120 3300049576 Bacteria 1078
657 Ga0501040_0905389 3300049576 Archaea 639
658 Ga0501041_0038407 3300049577 Bacteria 2903
659 Ga0501041_0079609 3300049577 Bacteria 2017
660 Ga0501041_0392250 3300049577 Bacteria 879
661 Ga0501042_0031112 3300049578 Bacteria 3776
662 Ga0501042_0042201 3300049578 Bacteria 3246
663 Ga0501042_0620141 3300049578 Bacteria 786
664 Ga0501043_0368012 3300049579 Bacteria 1090
665 Ga0501046_0118337 3300049580 Bacteria 2018
666 Ga0501046_0947232 3300049580 Unclassified 599
667 Ga0501047_0046515 3300049581 Bacteria 4194
668 Ga0501048_0067143 3300049582 Bacteria 2536
669 Ga0501048_0361137 3300049582 Bacteria 1036
670 Ga0501048_1021753 3300049582 Bacteria 595
671 Ga0501067_0030721 3300049583 Bacteria 2979
672 Ga0501067_0105732 3300049583 Bacteria 1564
673 Ga0501067_0139465 3300049583 Bacteria 1350
674 Ga0501068_0005640 3300049584 Bacteria 6857
675 Ga0501068_0045015 3300049584 Bacteria 2658
676 Ga0501068_0065436 3300049584 Bacteria 2213
677 Ga0501068_0091535 3300049584 Bacteria 1877
678 Ga0501069_0001844 3300049585 Bacteria 10573
679 Ga0501069_0006355 3300049585 Bacteria 6174
680 Ga0501069_0036713 3300049585 Bacteria 2703
681 Ga0501069_0445642 3300049585 Unclassified 769
682 Ga0501069_0535024 3300049585 Unclassified 700
683 Ga0501069_0680396 3300049585 Unclassified 620
684 Ga0501070_0007476 3300049586 Bacteria 9281
685 Ga0501070_0016540 3300049586 Bacteria 6194
686 Ga0501070_0087997 3300049586 Bacteria 2571
687 Ga0501070_0140826 3300049586 Bacteria 1991
688 Ga0501070_0346411 3300049586 Bacteria 1206
689 Ga0501070_0608001 3300049586 Bacteria 871
690 Ga0501070_0792902 3300049586 Bacteria 744
691 Ga0501070_1174031 3300049586 Unclassified 590
692 Ga0501071_0005277 3300049587 Bacteria 8287
693 Ga0501071_0028913 3300049587 Bacteria 3908
694 Ga0501071_0130483 3300049587 Bacteria 1866
695 Ga0501071_0719164 3300049587 Unclassified 769
696 Ga0501072_0007071 3300049588 Bacteria 8520
697 Ga0501072_0096087 3300049588 Bacteria 2355
698 Ga0501072_0277052 3300049588 Bacteria 1334
699 Ga0501072_0477643 3300049588 Bacteria 986
700 Ga0501072_0507692 3300049588 Bacteria 954
701 Ga0501072_0583712 3300049588 Bacteria 881
702 Ga0501073_0055549 3300049589 Bacteria 2770
703 Ga0501073_0071481 3300049589 Bacteria 2417
704 Ga0501073_0310885 3300049589 Bacteria 1087
705 Ga0501074_0002538 3300049590 Bacteria 12734
706 Ga0501074_0018756 3300049590 Bacteria 5026
707 Ga0501074_0153605 3300049590 Bacteria 1645
708 Ga0501074_0340077 3300049590 Bacteria 1065
709 Ga0501074_0387491 3300049590 Bacteria 991
710 Ga0501075_0056527 3300049591 Bacteria 2954
711 Ga0501075_0070000 3300049591 Bacteria 2652
712 Ga0501075_0168108 3300049591 Bacteria 1673
713 Ga0501075_0389631 3300049591 Bacteria 1062
714 Ga0501075_0503638 3300049591 Unclassified 924
715 Ga0501075_1158115 3300049591 Bacteria 587
716 Ga0501076_0043680 3300049592 Bacteria 3532
717 Ga0501076_0099303 3300049592 Bacteria 2345
718 Ga0501076_0143737 3300049592 Bacteria 1939
719 Ga0501076_0385978 3300049592 Unclassified 1151
720 Ga0501076_0403998 3300049592 Bacteria 1123
721 Ga0501076_1173533 3300049592 Unclassified 632
722 Ga0501076_1591123 3300049592 Unclassified 536
723 Ga0501077_0000524 3300049593 Bacteria 23229
724 Ga0501077_0032949 3300049593 Bacteria 3299
725 Ga0501077_0546261 3300049593 Bacteria 743
726 Ga0501077_0883786 3300049593 Bacteria 575
727 Ga0501198_032815 3300049649 Unclassified 873
728 Ga0501202_111281 3300049652 Unclassified 678
729 Ga0501209_068089 3300049656 Bacteria 1008
730 Ga0501209_195525 3300049656 Unclassified 621
731 Ga0501248_003799 3300049678 Bacteria 1109
732 Ga0501249_019971 3300049679 Unclassified 1456
733 Ga0501249_128937 3300049679 Unclassified 622
734 Ga0501253_073629 3300049683 Unclassified 759
735 Ga0501256_019907 3300049685 Unclassified 698
736 Ga0501257_063951 3300049686 Bacteria 932
737 Ga0501258_027047 3300049687 Unclassified 706
738 Ga0501221_094280 3300049704 Unclassified 735
739 Ga0501221_136169 3300049704 Bacteria 640
740 Ga0501225_0125738 3300049705 Bacteria 765
741 Ga0501225_0151119 3300049705 Unclassified 708
742 Ga0501245_028909 3300049708 Unclassified 907
743 Ga0501079_0005768 3300049741 Bacteria 9258
744 Ga0501079_0043214 3300049741 Bacteria 3478
745 Ga0501079_0373597 3300049741 Bacteria 1118
746 Ga0501079_1191522 3300049741 Unclassified 600
747 Ga0501080_0035917 3300049742 Bacteria 4626
748 Ga0501080_0129067 3300049742 Bacteria 2340
749 Ga0501080_0174428 3300049742 Bacteria 1981
750 Ga0501080_0444521 3300049742 Bacteria 1163
751 Ga0501080_1456988 3300049742 Bacteria 583
752 Ga0501081_0004622 3300049743 Bacteria 8840
753 Ga0501081_0011130 3300049743 Bacteria 5883
754 Ga0501081_0260012 3300049743 Bacteria 1268
755 Ga0501081_0278434 3300049743 Bacteria 1224
756 Ga0501081_0382939 3300049743 Unclassified 1040
757 Ga0501081_0546025 3300049743 Bacteria 866
758 Ga0501081_0632401 3300049743 Bacteria 802
759 Ga0501081_1130548 3300049743 Bacteria 593
760 Ga0501083_0004073 3300049744 Bacteria 10282
761 Ga0501083_0060306 3300049744 Bacteria 2534
762 Ga0501083_0471470 3300049744 Bacteria 817
763 Ga0501083_0698392 3300049744 Bacteria 660
764 Ga0501083_0923986 3300049744 Unclassified 568
765 Ga0501263_009568 3300049760 Unclassified 1176
766 Ga0501263_034553 3300049760 Bacteria 725
767 Ga0501265_046920 3300049762 Bacteria 669
768 Ga0501268_023205 3300049765 Bacteria 1076
769 Ga0501270_016726 3300049767 Bacteria 1064
770 Ga0501271_006745 3300049768 Bacteria 1146
771 Ga0501273_040468 3300049770 Bacteria 688
772 Ga0501273_094477 3300049770 Unclassified 512
773 Ga0501274_033325 3300049771 Unclassified 591
774 Ga0501045_0027982 3300049824 Bacteria 4066
775 Ga0501045_0130840 3300049824 Bacteria 1865
776 Ga0501045_0728345 3300049824 Archaea 731
777 Ga0501212_093295 3300049851 Unclassified 558
778 Ga0501226_013093 3300049853 Bacteria 917
779 nmdc:mga05p37_1187_c1 3300050507 Bacteria 30065
780 nmdc:mga05p37_13069_c1 3300050507 Bacteria 9935
781 nmdc:mga05p37_1748424_c1 3300050507 Bacteria 603
782 nmdc:mga05p37_230979_c1 3300050507 Bacteria 2229
783 nmdc:mga05p37_599746_c1 3300050507 Bacteria 1243
784 nmdc:mga05p37_88826_c1 3300050507 Unclassified 3809
785 nmdc:mga05p37_898065_c1 3300050507 Unclassified 956
786 nmdc:mga09592_1281671_c1 3300050508 Unclassified 603
787 nmdc:mga09592_1491985_c1 3300050508 Bacteria 550
788 nmdc:mga09592_4808_c1 3300050508 Bacteria 10944
789 nmdc:mga09592_796857_c1 3300050508 Bacteria 799
790 nmdc:mga0qj67_142793_c1 3300050509 Unclassified 1941
791 nmdc:mga06r32_144016_c1 3300050510 Bacteria 2360
792 nmdc:mga06r32_159161_c1 3300050510 Unclassified 2240
793 nmdc:mga06r32_410718_c1 3300050510 Bacteria 1335
794 nmdc:mga06r32_974694_c1 3300050510 Archaea 801
795 nmdc:mga08y16_663180_c1 3300050511 Unclassified 1046
796 nmdc:mga0n895_16838_c1 3300050512 Bacteria 6719
797 nmdc:mga0n895_302955_c1 3300050512 Bacteria 1620
798 nmdc:mga0n895_48146_c1 3300050512 Bacteria 4171
799 nmdc:mga0n895_77176_c1 3300050512 Bacteria 3313
800 nmdc:mga0n895_937925_c1 3300050512 Bacteria 849
801 nmdc:mga0rr50_1782741_c1 3300050513 Unclassified 518
802 nmdc:mga0rr50_381395_c1 3300050513 Bacteria 1189
803 nmdc:mga0rr50_542930_c1 3300050513 Bacteria 990
804 nmdc:mga08x19_104515_c1 3300050514 Unclassified 1882
805 nmdc:mga0a205_33902_c1 3300050515 Bacteria 4097
806 nmdc:mga0a205_350782_c1 3300050515 Unclassified 1343
807 nmdc:mga0a205_845337_c1 3300050515 Unclassified 762
808 nmdc:mga0a205_89447_c1 3300050515 Bacteria 2976
809 Ga0501084_0013422 3300054114 Bacteria 6779
810 Ga0501084_0015548 3300054114 Bacteria 6312
811 Ga0501084_0055493 3300054114 Bacteria 3314
812 Ga0501084_0185666 3300054114 Bacteria 1755
813 Ga0501084_0339544 3300054114 Bacteria 1269
814 Ga0501084_0424966 3300054114 Bacteria 1123
815 Ga0590071_006015 3300059421 Bacteria 2901
816 Ga0590071_079440 3300059421 Bacteria 814
817 Ga0590075_008433 3300059424 Bacteria 2462
818 Ga0590075_028013 3300059424 Unclassified 1422
819 Ga0501082_0009687 3300060353 Bacteria 8296
820 Ga0501082_0016393 3300060353 Bacteria 6379
821 Ga0501082_0154619 3300060353 Bacteria 1993
822 Ga0501082_0562469 3300060353 Bacteria 997
823 Ga0530510_0035315 3300061734 Bacteria 3603
824 Ga0530510_0353930 3300061734 Bacteria 1103
825 Ga0530510_0512416 3300061734 Bacteria 910
826 Ga0530510_0710009 3300061734 Bacteria 766
827 Ga0530510_1014803 3300061734 Bacteria 635
828 Ga0466965_0581761
829 Ga0065715_10106221
830 Ga0065715_10119747
831 Ga0065715_10453137
832 Ga0065715_10974148
833 Ga0065707_10231002
834 Ga0070676_10009939
835 Ga0070683_100035503
836 Ga0070683_100488617
837 Ga0070683_100925485
838 Ga0070677_10551761
839 Ga0070677_10595979
840 Ga0068869_100533126
841 Ga0070666_10435635
842 Ga0070680_100007400
843 Ga0070680_100009987
844 Ga0070680_100495358
845 Ga0070680_101254901
846 Ga0070682_100196220
847 Ga0070682_100546055
848 Ga0070682_100941282
849 Ga0068868_100461565
850 Ga0070660_100080309
851 Ga0070660_100239194
852 Ga0070691_10088108
853 Ga0070691_10163147
854 Ga0070691_10972105
855 Ga0070687_100861585
856 Ga0070661_100168733
857 Ga0070661_101748537
858 Ga0070692_10299290
859 Ga0070692_10392555
860 Ga0070692_10903168
861 Ga0070668_100366127
862 Ga0070668_101912112
863 Ga0070669_100048012
864 Ga0070675_100732364
865 Ga0070675_101415987
866 Ga0070675_101730709
867 Ga0070671_100322448
868 Ga0070674_100221940
869 Ga0070674_101411157
870 Ga0070674_101642640
871 Ga0070673_100144744
872 Ga0070688_100211059
873 Ga0070659_100191639
874 Ga0070659_100274161
875 Ga0070659_100410255
876 Ga0070667_100171270
877 Ga0070703_10068688
878 Ga0070709_10251696
879 Ga0070714_101392430
880 Ga0070713_101263620
881 Ga0070711_100002799
882 Ga0070711_100766837
883 Ga0070705_100083594
884 Ga0070705_100105925
885 Ga0070705_100129032
886 Ga0070705_100199740
887 Ga0070705_100396641
888 Ga0070705_100915607
889 Ga0070705_101257970
890 Ga0070700_100115134
891 Ga0070700_100391238
892 Ga0070694_100164490
893 Ga0070694_100247848
894 Ga0070694_100325370
895 Ga0070708_100025224
896 Ga0070708_100118032
897 Ga0070708_100190878
898 Ga0070708_100563512
899 Ga0070708_100597822
900 Ga0070708_100654063
901 Ga0070708_100757494
902 Ga0070708_100890771
903 Ga0070663_100140083
904 Ga0070663_101655121
905 Ga0070678_100038030
906 Ga0070662_100057690
907 Ga0070662_100901947
908 Ga0070662_100952042
909 Ga0070681_10076015
910 Ga0070681_10167675
911 Ga0070681_10528825
912 Ga0070681_10793326
913 Ga0068867_100008098
914 Ga0068867_100038907
915 Ga0070706_100004466
916 Ga0070706_100289330
917 Ga0070706_100398749
918 Ga0070706_100968835
919 Ga0070707_100004738
920 Ga0070707_100175091
921 Ga0070707_101041672
922 Ga0070707_101754353
923 Ga0070707_102218107
924 Ga0070698_100014842
925 Ga0070698_100191377
926 Ga0070698_100264815
927 Ga0070698_101973365
928 Ga0070699_100000131
929 Ga0070699_100003191
930 Ga0070699_100004511
931 Ga0070699_100008937
932 Ga0070699_100128518
933 Ga0070699_100153892
934 Ga0070699_100266612
935 Ga0070699_100608198
936 Ga0070679_100237887
937 Ga0070679_100292417
938 Ga0070679_100753558
939 Ga0070684_100558228
940 Ga0070684_100589895
941 Ga0070697_100004653
942 Ga0070697_100075760
943 Ga0070697_100081128
944 Ga0070697_100778954
945 Ga0068853_100133861
946 Ga0068853_100666522
947 Ga0070672_100624782
948 Ga0070686_101049323
949 Ga0070695_100031774
950 Ga0070695_100522560
951 Ga0070695_100630825
952 Ga0070696_100000526
953 Ga0070696_100060512
954 Ga0070696_100153863
955 Ga0070696_100174429
956 Ga0070696_100179735
957 Ga0070696_100221443
958 Ga0070696_100490698
959 Ga0070696_101027920
960 Ga0070693_100216251
961 Ga0070693_100814445
962 Ga0070665_101221690
963 Ga0070704_100035572
964 Ga0070704_100156171
965 Ga0070704_100340756
966 Ga0070704_101921195
967 Ga0070664_100031929
968 Ga0070664_100113170
969 Ga0070664_100409554
970 Ga0070664_101958322
971 Ga0068857_100003989
972 Ga0068854_100005676
973 Ga0068854_100795889
974 Ga0068856_101827960
975 Ga0070702_100049156
976 Ga0070702_100499905
977 Ga0070702_101045272
978 Ga0068852_100666561
979 Ga0068859_100098835
980 Ga0068864_100005813
981 Ga0068864_100008732
982 Ga0068864_100293696
983 Ga0068866_10012010
984 Ga0068866_10391271
985 Ga0068861_100171105
986 Ga0068861_101829658
987 Ga0068870_10153393
988 Ga0068863_100011471
989 Ga0068863_102469400
990 Ga0068858_100100427
991 Ga0068858_100107831
992 Ga0068858_100174352
993 Ga0068858_101431698
994 Ga0068860_100047764
995 Ga0068860_100898876
996 Ga0068860_102781077
997 Ga0068862_100024031
998 Ga0068862_101248718
999 Ga0081455_10110720
1000 Ga0081538_10066647
1001 Ga0081538_10383080
1002 Ga0081539_10113658
1003 Ga0070715_10261105
1004 Ga0070716_101209979
1005 Ga0070712_100171890
1006 Ga0070712_100366293
1007 Ga0097621_101493218
1008 Ga0068871_100372903
1009 Ga0075428_100036820
1010 Ga0075428_100102374
1011 Ga0075428_100347329
1012 Ga0075428_101460913
1013 Ga0075428_102528121
1014 Ga0075430_100154604
1015 Ga0075430_101111701
1016 Ga0075431_100015302
1017 Ga0075431_100118877
1018 Ga0075431_100141624
1019 Ga0075431_100966593
1020 Ga0075433_10042982
1021 Ga0075433_10079795
1022 Ga0075433_10419686
1023 Ga0075433_11278486
1024 Ga0075434_100032494
1025 Ga0075434_100070739
1026 Ga0075434_100415659
1027 Ga0075434_100612819
1028 Ga0075434_100763007
1029 Ga0075429_100005664
1030 Ga0075429_100117673
1031 Ga0075429_100543181
1032 Ga0075429_100647292
1033 Ga0068865_100023280
1034 Ga0068865_100054376
1035 Ga0075436_100031537
1036 Ga0075436_100421974
1037 Ga0075436_100512874
1038 Ga0097620_100098837
1039 Ga0075435_100116035
1040 Ga0075435_100192631
1041 Ga0075435_100259193
1042 Ga0075435_100377464
1043 Ga0075435_100400362
1044 Ga0075435_100629376
1045 Ga0105240_10080722
1046 Ga0111539_10064564
1047 Ga0111539_10291319
1048 Ga0111539_10346686
1049 Ga0105245_10848762
1050 Ga0105245_12346769
1051 Ga0105247_10288638
1052 Ga0105247_10311124
1053 Ga0114129_10005002
1054 Ga0114129_10025521
1055 Ga0114129_10046313
1056 Ga0114129_10133652
1057 Ga0114129_10135190
1058 Ga0114129_10439801
1059 Ga0114129_10576885
1060 Ga0114129_10582248
1061 Ga0114129_11401477
1062 Ga0114129_12169510
1063 Ga0105243_10007267
1064 Ga0105241_10017856
1065 Ga0105241_10727394
1066 Ga0105241_10860471
1067 Ga0105242_10269372
1068 Ga0105242_10374358
1069 Ga0105242_11503597
1070 Ga0105242_11524594
1071 Ga0105248_10164703
1072 Ga0105248_10614421
1073 Ga0105248_10707800
1074 Ga0105237_10072012
1075 Ga0105249_10022117
1076 Ga0105249_10104613
1077 Ga0105249_10480911
1078 Ga0105249_10799685
1079 Ga0105249_11454938
1080 Ga0105239_10007902
1081 Ga0105246_10040986
1082 Ga0105246_10410468
1083 Ga0105246_10569860
1084 Ga0157373_10894666
1085 Ga0157378_10003362
1086 Ga0163162_10037565
1087 Ga0163162_10047295
1088 Ga0163162_10313960
1089 Ga0163162_11270566
1090 Ga0157372_10103508
1091 Ga0157372_11178341
1092 Ga0157375_12628733
1093 Ga0163163_10080871
1094 Ga0163163_10156630
1095 Ga0163163_11453926
1096 Ga0163163_12950435
1097 Ga0157380_10796010
1098 Ga0157380_10905774
1099 Ga0182008_10197663
1100 Ga0157377_10376974
1101 Ga0157379_10221242
1102 Ga0157379_10820198
1103 Ga0157379_12437771
1104 Ga0157376_10211694
1105 Ga0163161_10070245
1106 Ga0163161_10234741
1107 Ga0207653_10159320
1108 Ga0207642_10005341
1109 Ga0207688_10437702
1110 Ga0207688_10963815
1111 Ga0207680_10130869
1112 Ga0207647_10659464
1113 Ga0207647_10722797
1114 Ga0207685_10090616
1115 Ga0207685_10161267
1116 Ga0207699_11085800
1117 Ga0207645_10001959
1118 Ga0207643_10004403
1119 Ga0207643_10223662
1120 Ga0207684_10011945
1121 Ga0207684_10122174
1122 Ga0207684_10147766
1123 Ga0207684_10941313
1124 Ga0207654_10003690
1125 Ga0207654_10644681
1126 Ga0207707_10010026
1127 Ga0207707_10141884
1128 Ga0207707_10467934
1129 Ga0207707_11131312
1130 Ga0207695_10817787
1131 Ga0207671_10387449
1132 Ga0207693_10305122
1133 Ga0207693_10386118
1134 Ga0207663_10004700
1135 Ga0207663_10597103
1136 Ga0207663_10911876
1137 Ga0207660_10068416
1138 Ga0207660_10567558
1139 Ga0207660_10868757
1140 Ga0207662_11120925
1141 Ga0207662_11170190
1142 Ga0207657_10261483
1143 Ga0207649_10127379
1144 Ga0207652_10010159
1145 Ga0207652_10195330
1146 Ga0207646_10013251
1147 Ga0207646_10047450
1148 Ga0207646_10376125
1149 Ga0207646_11609210
1150 Ga0207694_10493768
1151 Ga0207687_10394012
1152 Ga0207700_10916415
1153 Ga0207664_11454704
1154 Ga0207664_11529734
1155 Ga0207690_10258717
1156 Ga0207690_10284395
1157 Ga0207706_10008792
1158 Ga0207706_10755524
1159 Ga0207686_10002785
1160 Ga0207709_10030296
1161 Ga0207669_10183202
1162 Ga0207669_10903348
1163 Ga0207704_10013556
1164 Ga0207665_10826435
1165 Ga0207665_10973666
1166 Ga0207665_11076967
1167 Ga0207691_10126022
1168 Ga0207691_11713221
1169 Ga0207711_10347993
1170 Ga0207711_10418670
1171 Ga0207689_10044212
1172 Ga0207689_10443838
1173 Ga0207661_10042428
1174 Ga0207661_10505291
1175 Ga0207661_11086130
1176 Ga0207679_10036953
1177 Ga0207679_10250052
1178 Ga0207679_10266378
1179 Ga0207667_10137895
1180 Ga0207667_12076956
1181 Ga0207651_10688250
1182 Ga0207712_10013453
1183 Ga0207712_10084776
1184 Ga0207668_10059917
1185 Ga0207668_10623659
1186 Ga0207640_10019626
1187 Ga0207658_10163736
1188 Ga0207658_10393988
1189 Ga0207703_10302956
1190 Ga0207703_10338643
1191 Ga0207703_12365263
1192 Ga0207639_10418145
1193 Ga0207639_10433528
1194 Ga0207639_10646964
1195 Ga0207678_10131214
1196 Ga0207678_10299744
1197 Ga0207678_10330413
1198 Ga0207708_10007267
1199 Ga0207708_10035505
1200 Ga0207708_10257718
1201 Ga0207702_10547418
1202 Ga0207641_10793750
1203 Ga0207648_10002060
1204 Ga0207648_10432571
1205 Ga0207676_10002069
1206 Ga0207676_10009280
1207 Ga0207676_10074337
1208 Ga0207674_10017092
1209 Ga0207674_10096916
1210 Ga0207675_100176646
1211 Ga0207675_100205122
1212 Ga0207675_100287274
1213 Ga0207683_10058273
1214 Ga0207683_10707172
1215 Ga0207698_10119060
1216 Ga0207698_10635810
1217 Ga0209999_1063585
1218 Ga0209982_1070084
1219 Ga0209966_1043284
1220 Ga0209998_10168098
1221 Ga0209974_10067559
1222 Ga0207428_11147654
1223 Ga0268266_11047356
1224 Ga0268265_10189117
1225 Ga0307408_100011030
1226 Ga0307408_100069104
1227 Ga0307408_100096458
1228 Ga0307408_100691583
1229 Ga0307405_10058570
1230 Ga0307405_10074483
1231 Ga0307405_10425188
1232 Ga0307405_11578679
1233 Ga0307413_10006927
1234 Ga0307413_10010645
1235 Ga0307413_10022298
1236 Ga0307413_10037584
1237 Ga0307413_10056800
1238 Ga0307413_10113182
1239 Ga0307413_10161437
1240 Ga0307413_10206381
1241 Ga0307413_10556480
1242 Ga0307413_10590527
1243 Ga0307410_10002633
1244 Ga0307410_10005177
1245 Ga0307410_10007383
1246 Ga0307410_10024757
1247 Ga0307410_10037922
1248 Ga0307410_10044398
1249 Ga0307410_10355012
1250 Ga0307410_10592788
1251 Ga0307410_11190781
1252 Ga0307406_10013425
1253 Ga0307406_10123863
1254 Ga0307406_10150470
1255 Ga0307406_10173641
1256 Ga0307406_10293606
1257 Ga0307406_10458334
1258 Ga0307406_11032253
1259 Ga0307407_10038931
1260 Ga0307407_10041451
1261 Ga0307407_10094962
1262 Ga0307407_10256784
1263 Ga0307407_10442801
1264 Ga0307407_10442844
1265 Ga0307407_10669770
1266 Ga0307407_10744591
1267 Ga0307412_10217905
1268 Ga0307412_10292562
1269 Ga0307412_10387103
1270 Ga0307412_10411135
1271 Ga0307412_10427103
1272 Ga0307412_11605034
1273 Ga0307412_12312785
1274 Ga0307409_100010966
1275 Ga0307409_100017349
1276 Ga0307409_100048008
1277 Ga0307409_100207157
1278 Ga0307409_100217146
1279 Ga0307409_100238474
1280 Ga0307409_100360935
1281 Ga0307409_101118310
1282 Ga0307416_100001764
1283 Ga0307416_100018370
1284 Ga0307416_100021841
1285 Ga0307416_100033140
1286 Ga0307416_100060168
1287 Ga0307416_100096272
1288 Ga0307416_100102675
1289 Ga0307416_100116164
1290 Ga0307416_100255897
1291 Ga0307416_100427333
1292 Ga0307416_100484333
1293 Ga0307416_100578157
1294 Ga0307416_100898718
1295 Ga0307416_101660192
1296 Ga0307414_10041216
1297 Ga0307414_10053221
1298 Ga0307414_10066020
1299 Ga0307414_10073089
1300 Ga0307414_10127773
1301 Ga0307414_10227790
1302 Ga0307414_10347875
1303 Ga0307411_10007633
1304 Ga0307411_10009538
1305 Ga0307411_10015803
1306 Ga0307411_10043216
1307 Ga0307411_10102680
1308 Ga0307411_10109302
1309 Ga0307411_10144125
1310 Ga0307415_100016741
1311 Ga0307415_100017132
1312 Ga0307415_100036306
1313 Ga0307415_100058472
1314 Ga0307415_100069066
1315 Ga0307415_100506473
1316 Ga0373958_0105106
1317 Ga0373928_0072478
1318 Ga0373940_0004243
1319 Ga0373940_0113430
1320 Ga0373940_0134924
1321 Ga0373940_0342105
1322 Ga0373932_0123041
1323 Ga0373941_0064966
1324 Ga0373941_0074712
1325 Ga0373943_0255564
1326 Ga0373942_0217133
1327 Ga0316574_0567230
1328 Ga0373931_0003655
1329 Ga0373931_0540243
1330 Ga0373931_0640655
1331 Ga0373937_0161755
1332 Ga0395900_0507152
1333 Ga0395905_0030032
1334 Ga0395905_0093574
1335 Ga0395905_0775498
1336 Ga0395905_1765051
1337 Ga0395901_1100319
1338 Ga0242419_001918
1339 Ga0242420_017065
1340 Ga0242420_075742
1341 Ga0439439_0003943
1342 Ga0451793_0454245
1343 Ga0451793_0650265
1344 Ga0451845_0087672
1345 Ga0439431_0042126
1346 Ga0439448_0015975
1347 Ga0439448_0160346
1348 Ga0439448_0272688
1349 Ga0439455_0030225
1350 Ga0439462_0012907
1351 Ga0439462_0037973
1352 Ga0450894_038233
1353 Ga0450898_012677
1354 Ga0439434_0118194
1355 Ga0439444_0050789
1356 Ga0453683_0018695
1357 Ga0453683_0189812
1358 Ga0453683_0203726
1359 Ga0453684_0226200
1360 Ga0453684_1844208
1361 Ga0466960_0595408
1362 Ga0466960_0617490
1363 Ga0451576_0350543
1364 Ga0451576_0424215
1365 Ga0451576_1234785
1366 Ga0466967_0417901
1367 Ga0495603_0065731
1368 Ga0495603_0639997
1369 Ga0495629_0093161
1370 Ga0495641_0039760
1371 Ga0495580_0092817
1372 Ga0495580_0563671
1373 Ga0495582_0050911
1374 Ga0495664_0029270
1375 Ga0495585_0234592
1376 Ga0495594_0005575
1377 Ga0495594_0037831
1378 Ga0495618_0097347
1379 Ga0495628_0078527
1380 Ga0495628_0466481
1381 Ga0495630_0002989
1382 Ga0495666_0005633
1383 Ga0495652_0725501
1384 Ga0495665_0079354
1385 Ga0495640_0090469
1386 Ga0495586_0036631
1387 Ga0495622_0227579
1388 Ga0495633_0408595
1389 Ga0495667_0062279
1390 Ga0495656_0709565
1391 Ga0495634_0011783
1392 Ga0495635_0123742
1393 Ga0495647_0011579
1394 Ga0495658_0001049
1395 Ga0495613_0015519
1396 Ga0495624_0057845
1397 Ga0495600_0056985
1398 Ga0495636_0029528
1399 Ga0495674_0021326
1400 Ga0495680_0005099
1401 Ga0495614_0064609
1402 Ga0496100_0070289
1403 Ga0496100_0558326
1404 Ga0496101_0041301
1405 Ga0496101_0081058
1406 Ga0496102_0012691
1407 Ga0496102_0036524
1408 Ga0496102_0040322
1409 Ga0496102_0110469
1410 Ga0496102_0466491
1411 Ga0496102_1008184
1412 Ga0496103_0004583
1413 Ga0496104_0005257
1414 Ga0496104_0065226
1415 Ga0496104_0104166
1416 Ga0496104_0668634
1417 Ga0496104_0996220
1418 Ga0496105_0433492
1419 Ga0496105_0922817
1420 Ga0496106_0029316
1421 Ga0496106_0103022
1422 Ga0496106_0104271
1423 Ga0496106_0309800
1424 Ga0496107_0262086
1425 Ga0496107_0266974
1426 Ga0496107_0431246
1427 Ga0496107_0701255
1428 Ga0496108_0001821
1429 Ga0496108_0008113
1430 Ga0496108_0017792
1431 Ga0496108_0038132
1432 Ga0496108_0559694
1433 Ga0496108_1216055
1434 Ga0496109_0001699
1435 Ga0496109_0011547
1436 Ga0496109_0030354
1437 Ga0496109_0032959
1438 Ga0496109_0921953
1439 Ga0496110_0021956
1440 Ga0496110_0027057
1441 Ga0496110_0847589
1442 Ga0496111_0003685
1443 Ga0496111_0078454
1444 Ga0496111_0086842
1445 Ga0496111_0615840
1446 Ga0496111_0822557
1447 Ga0496112_0066805
1448 Ga0496112_0081398
1449 Ga0496112_0087606
1450 Ga0496112_0602444
1451 Ga0496113_0010528
1452 Ga0496113_0030216
1453 Ga0496113_0045681
1454 Ga0496113_0246915
1455 Ga0496113_0842536
1456 Ga0496114_0330092
1457 Ga0496114_0396281
1458 Ga0496115_0442144
1459 Ga0501290_027126
1460 Ga0501292_070223
1461 Ga0501297_065443
1462 Ga0501298_029466
1463 Ga0501299_172098
1464 Ga0501031_0087493
1465 Ga0501031_0131795
1466 Ga0501031_0410096
1467 Ga0501032_0194005
1468 Ga0501033_0540507
1469 Ga0501034_0101964
1470 Ga0501034_0172042
1471 Ga0501036_0423816
1472 Ga0501036_0919226
1473 Ga0501036_0981122
1474 Ga0501037_0030237
1475 Ga0501038_0135552
1476 Ga0501038_0561756
1477 Ga0501039_0046067
1478 Ga0501039_0637157
1479 Ga0501039_0793018
1480 Ga0501040_0023073
1481 Ga0501040_0043305
1482 Ga0501040_0061646
1483 Ga0501040_0338120
1484 Ga0501040_0905389
1485 Ga0501041_0038407
1486 Ga0501041_0079609
1487 Ga0501041_0392250
1488 Ga0501042_0031112
1489 Ga0501042_0042201
1490 Ga0501042_0620141
1491 Ga0501043_0368012
1492 Ga0501046_0118337
1493 Ga0501046_0947232
1494 Ga0501047_0046515
1495 Ga0501048_0067143
1496 Ga0501048_0361137
1497 Ga0501048_1021753
1498 Ga0501067_0030721
1499 Ga0501067_0105732
1500 Ga0501067_0139465
1501 Ga0501068_0005640
1502 Ga0501068_0045015
1503 Ga0501068_0065436
1504 Ga0501068_0091535
1505 Ga0501069_0001844
1506 Ga0501069_0006355
1507 Ga0501069_0036713
1508 Ga0501069_0445642
1509 Ga0501069_0535024
1510 Ga0501069_0680396
1511 Ga0501070_0007476
1512 Ga0501070_0016540
1513 Ga0501070_0087997
1514 Ga0501070_0140826
1515 Ga0501070_0346411
1516 Ga0501070_0608001
1517 Ga0501070_0792902
1518 Ga0501070_1174031
1519 Ga0501071_0005277
1520 Ga0501071_0028913
1521 Ga0501071_0130483
1522 Ga0501071_0719164
1523 Ga0501072_0007071
1524 Ga0501072_0096087
1525 Ga0501072_0277052
1526 Ga0501072_0477643
1527 Ga0501072_0507692
1528 Ga0501072_0583712
1529 Ga0501073_0055549
1530 Ga0501073_0071481
1531 Ga0501073_0310885
1532 Ga0501074_0002538
1533 Ga0501074_0018756
1534 Ga0501074_0153605
1535 Ga0501074_0340077
1536 Ga0501074_0387491
1537 Ga0501075_0056527
1538 Ga0501075_0070000
1539 Ga0501075_0168108
1540 Ga0501075_0389631
1541 Ga0501075_0503638
1542 Ga0501075_1158115
1543 Ga0501076_0043680
1544 Ga0501076_0099303
1545 Ga0501076_0143737
1546 Ga0501076_0385978
1547 Ga0501076_0403998
1548 Ga0501076_1173533
1549 Ga0501076_1591123
1550 Ga0501077_0000524
1551 Ga0501077_0032949
1552 Ga0501077_0546261
1553 Ga0501077_0883786
1554 Ga0501198_032815
1555 Ga0501202_111281
1556 Ga0501209_068089
1557 Ga0501209_195525
1558 Ga0501248_003799
1559 Ga0501249_019971
1560 Ga0501249_128937
1561 Ga0501253_073629
1562 Ga0501256_019907
1563 Ga0501257_063951
1564 Ga0501258_027047
1565 Ga0501221_094280
1566 Ga0501221_136169
1567 Ga0501225_0125738
1568 Ga0501225_0151119
1569 Ga0501245_028909
1570 Ga0501079_0005768
1571 Ga0501079_0043214
1572 Ga0501079_0373597
1573 Ga0501079_1191522
1574 Ga0501080_0035917
1575 Ga0501080_0129067
1576 Ga0501080_0174428
1577 Ga0501080_0444521
1578 Ga0501080_1456988
1579 Ga0501081_0004622
1580 Ga0501081_0011130
1581 Ga0501081_0260012
1582 Ga0501081_0278434
1583 Ga0501081_0382939
1584 Ga0501081_0546025
1585 Ga0501081_0632401
1586 Ga0501081_1130548
1587 Ga0501083_0004073
1588 Ga0501083_0060306
1589 Ga0501083_0471470
1590 Ga0501083_0698392
1591 Ga0501083_0923986
1592 Ga0501263_009568
1593 Ga0501263_034553
1594 Ga0501265_046920
1595 Ga0501268_023205
1596 Ga0501270_016726
1597 Ga0501271_006745
1598 Ga0501273_040468
1599 Ga0501273_094477
1600 Ga0501274_033325
1601 Ga0501045_0027982
1602 Ga0501045_0130840
1603 Ga0501045_0728345
1604 Ga0501212_093295
1605 Ga0501226_013093
1606 nmdc:mga05p37_1187_c1
1607 nmdc:mga05p37_13069_c1
1608 nmdc:mga05p37_1748424_c1
1609 nmdc:mga05p37_230979_c1
1610 nmdc:mga05p37_599746_c1
1611 nmdc:mga05p37_88826_c1
1612 nmdc:mga05p37_898065_c1
1613 nmdc:mga09592_1281671_c1
1614 nmdc:mga09592_1491985_c1
1615 nmdc:mga09592_4808_c1
1616 nmdc:mga09592_796857_c1
1617 nmdc:mga0qj67_142793_c1
1618 nmdc:mga06r32_144016_c1
1619 nmdc:mga06r32_159161_c1
1620 nmdc:mga06r32_410718_c1
1621 nmdc:mga06r32_974694_c1
1622 nmdc:mga08y16_663180_c1
1623 nmdc:mga0n895_16838_c1
1624 nmdc:mga0n895_302955_c1
1625 nmdc:mga0n895_48146_c1
1626 nmdc:mga0n895_77176_c1
1627 nmdc:mga0n895_937925_c1
1628 nmdc:mga0rr50_1782741_c1
1629 nmdc:mga0rr50_381395_c1
1630 nmdc:mga0rr50_542930_c1
1631 nmdc:mga08x19_104515_c1
1632 nmdc:mga0a205_33902_c1
1633 nmdc:mga0a205_350782_c1
1634 nmdc:mga0a205_845337_c1
1635 nmdc:mga0a205_89447_c1
1636 Ga0501084_0013422
1637 Ga0501084_0015548
1638 Ga0501084_0055493
1639 Ga0501084_0185666
1640 Ga0501084_0339544
1641 Ga0501084_0424966
1642 Ga0590071_006015
1643 Ga0590071_079440
1644 Ga0590075_008433
1645 Ga0590075_028013
1646 Ga0501082_0009687
1647 Ga0501082_0016393
1648 Ga0501082_0154619
1649 Ga0501082_0562469
1650 Ga0530510_0035315
1651 Ga0530510_0353930
1652 Ga0530510_0512416
1653 Ga0530510_0710009
1654 Ga0530510_1014803

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

42

115

0.8

PF01050

MannoseP_isomer

Mannose-6-phosphate isomerase C-terminal

14

128

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2phd-assembly1.cif.gz_C crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.9327 21 99
2phd-assembly1.cif.gz_A crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.9314 21 99
2oa2-assembly1.cif.gz_A-2 crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution 0.9218 17 101
2y0o-assembly1.cif.gz_A-2 the structure of a d-lyxose isomerase from the sigmab regulon of bacillus subtilis 0.9172 14 108
5fli-assembly1.cif.gz_K enzyme-substrate complex of ni-quercetinase 0.9099 7 101
ID Description Score Start End Superfamily
2y0oA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9022 14 108 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8998 17 100 2.60.120.10
2oa2A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8987 17 101 2.60.120.10
1gqhC02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8959 14 101 2.60.120.10
af_A0A0R0KME4_229_450_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8934 26 100 2.60.120.650
ID Description Score Start End GO Terms
AF-A0A7C7DH31-F1-model_v4 ROK family protein 0.9651 2 115 GO:0005976
GO:0016779
AF-A0A536MAX0-F1-model_v4 Cupin domain-containing protein 0.9626 7 115
AF-A0A2V7NCQ3-F1-model_v4 Cupin 0.9624 1 115
AF-A0A1F2T8B0-F1-model_v4 Cupin 0.9623 6 115
AF-A0A2E7RQ97-F1-model_v4 Cupin type-2 domain-containing protein 0.9609 4 108

Map