F482524
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 827 | 337 | 1654 | 117 |
Family's Representative Sequence
| Representative Sequence | 3300044683|Ga0466965_0581761|Ga0466965_0581761_185_586 |
| Length | 133 |
| Sequence | MADTPANQQPSPHAADRPVPYKVEKPWGWELIWARTDRYVGKILHVKAGHILSLQYHHRKDETMHVLSGELILRSRGQDETELQERPFRAGESVHIPPLLVHQIEAVQDTDVLEASTPELDDLVRIQDRYGRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 178 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 180 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 181 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 182 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 203 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 204 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 205 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 207 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 208 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 209 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 210 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 211 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 212 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 213 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 214 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 215 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 216 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 217 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 218 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 219 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 220 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 254 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 257 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 258 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 259 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 262 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 263 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 264 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 265 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 266 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 267 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 268 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 269 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 270 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 271 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 272 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 299 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 300 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 301 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 302 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 303 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 304 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 305 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 306 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 307 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 308 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 309 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 310 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 315 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 316 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 317 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 318 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 319 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 320 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 321 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 323 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 324 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 335 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 336 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.13 |
| Rhizosphere | 92.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 22.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466965_0581761 | 3300044683 | Unclassified | 635 |
| 2 | Ga0065715_10106221 | 3300005293 | Bacteria | 2843 |
| 3 | Ga0065715_10119747 | 3300005293 | Bacteria | 2278 |
| 4 | Ga0065715_10453137 | 3300005293 | Unclassified | 824 |
| 5 | Ga0065715_10974148 | 3300005293 | Unclassified | 545 |
| 6 | Ga0065707_10231002 | 3300005295 | Bacteria | 1189 |
| 7 | Ga0070676_10009939 | 3300005328 | Bacteria | 5150 |
| 8 | Ga0070683_100035503 | 3300005329 | Bacteria | 4557 |
| 9 | Ga0070683_100488617 | 3300005329 | Unclassified | 1176 |
| 10 | Ga0070683_100925485 | 3300005329 | Unclassified | 836 |
| 11 | Ga0070677_10551761 | 3300005333 | Unclassified | 632 |
| 12 | Ga0070677_10595979 | 3300005333 | Unclassified | 611 |
| 13 | Ga0068869_100533126 | 3300005334 | Bacteria | 984 |
| 14 | Ga0070666_10435635 | 3300005335 | Bacteria | 945 |
| 15 | Ga0070680_100007400 | 3300005336 | Bacteria | 8381 |
| 16 | Ga0070680_100009987 | 3300005336 | Bacteria | 7311 |
| 17 | Ga0070680_100495358 | 3300005336 | Unclassified | 1045 |
| 18 | Ga0070680_101254901 | 3300005336 | Unclassified | 641 |
| 19 | Ga0070682_100196220 | 3300005337 | Bacteria | 1421 |
| 20 | Ga0070682_100546055 | 3300005337 | Bacteria | 906 |
| 21 | Ga0070682_100941282 | 3300005337 | Unclassified | 713 |
| 22 | Ga0068868_100461565 | 3300005338 | Bacteria | 1106 |
| 23 | Ga0070660_100080309 | 3300005339 | Bacteria | 2559 |
| 24 | Ga0070660_100239194 | 3300005339 | Bacteria | 1478 |
| 25 | Ga0070691_10088108 | 3300005341 | Bacteria | 1527 |
| 26 | Ga0070691_10163147 | 3300005341 | Unclassified | 1150 |
| 27 | Ga0070691_10972105 | 3300005341 | Unclassified | 528 |
| 28 | Ga0070687_100861585 | 3300005343 | Unclassified | 647 |
| 29 | Ga0070661_100168733 | 3300005344 | Unclassified | 1661 |
| 30 | Ga0070661_101748537 | 3300005344 | Unclassified | 527 |
| 31 | Ga0070692_10299290 | 3300005345 | Bacteria | 982 |
| 32 | Ga0070692_10392555 | 3300005345 | Bacteria | 874 |
| 33 | Ga0070692_10903168 | 3300005345 | Unclassified | 611 |
| 34 | Ga0070668_100366127 | 3300005347 | Unclassified | 1223 |
| 35 | Ga0070668_101912112 | 3300005347 | Unclassified | 546 |
| 36 | Ga0070669_100048012 | 3300005353 | Bacteria | 3115 |
| 37 | Ga0070675_100732364 | 3300005354 | Bacteria | 902 |
| 38 | Ga0070675_101415987 | 3300005354 | Unclassified | 641 |
| 39 | Ga0070675_101730709 | 3300005354 | Bacteria | 577 |
| 40 | Ga0070671_100322448 | 3300005355 | Bacteria | 1317 |
| 41 | Ga0070674_100221940 | 3300005356 | Bacteria | 1470 |
| 42 | Ga0070674_101411157 | 3300005356 | Unclassified | 624 |
| 43 | Ga0070674_101642640 | 3300005356 | Bacteria | 580 |
| 44 | Ga0070673_100144744 | 3300005364 | Bacteria | 2008 |
| 45 | Ga0070688_100211059 | 3300005365 | Bacteria | 1363 |
| 46 | Ga0070659_100191639 | 3300005366 | Bacteria | 1680 |
| 47 | Ga0070659_100274161 | 3300005366 | Bacteria | 1402 |
| 48 | Ga0070659_100410255 | 3300005366 | Bacteria | 1145 |
| 49 | Ga0070667_100171270 | 3300005367 | Bacteria | 1917 |
| 50 | Ga0070703_10068688 | 3300005406 | Bacteria | 1178 |
| 51 | Ga0070709_10251696 | 3300005434 | Bacteria | 1273 |
| 52 | Ga0070714_101392430 | 3300005435 | Bacteria | 685 |
| 53 | Ga0070713_101263620 | 3300005436 | Bacteria | 715 |
| 54 | Ga0070711_100002799 | 3300005439 | Bacteria | 10006 |
| 55 | Ga0070711_100766837 | 3300005439 | Bacteria | 816 |
| 56 | Ga0070705_100083594 | 3300005440 | Bacteria | 1968 |
| 57 | Ga0070705_100105925 | 3300005440 | Bacteria | 1786 |
| 58 | Ga0070705_100129032 | 3300005440 | Bacteria | 1646 |
| 59 | Ga0070705_100199740 | 3300005440 | Bacteria | 1370 |
| 60 | Ga0070705_100396641 | 3300005440 | Bacteria | 1020 |
| 61 | Ga0070705_100915607 | 3300005440 | Bacteria | 706 |
| 62 | Ga0070705_101257970 | 3300005440 | Bacteria | 612 |
| 63 | Ga0070700_100115134 | 3300005441 | Unclassified | 1794 |
| 64 | Ga0070700_100391238 | 3300005441 | Bacteria | 1043 |
| 65 | Ga0070694_100164490 | 3300005444 | Bacteria | 1631 |
| 66 | Ga0070694_100247848 | 3300005444 | Bacteria | 1346 |
| 67 | Ga0070694_100325370 | 3300005444 | Bacteria | 1184 |
| 68 | Ga0070708_100025224 | 3300005445 | Bacteria | 5080 |
| 69 | Ga0070708_100118032 | 3300005445 | Bacteria | 2444 |
| 70 | Ga0070708_100190878 | 3300005445 | Bacteria | 1916 |
| 71 | Ga0070708_100563512 | 3300005445 | Bacteria | 1074 |
| 72 | Ga0070708_100597822 | 3300005445 | Unclassified | 1040 |
| 73 | Ga0070708_100654063 | 3300005445 | Bacteria | 990 |
| 74 | Ga0070708_100757494 | 3300005445 | Bacteria | 913 |
| 75 | Ga0070708_100890771 | 3300005445 | Unclassified | 836 |
| 76 | Ga0070663_100140083 | 3300005455 | Bacteria | 1845 |
| 77 | Ga0070663_101655121 | 3300005455 | Unclassified | 571 |
| 78 | Ga0070678_100038030 | 3300005456 | Bacteria | 3385 |
| 79 | Ga0070662_100057690 | 3300005457 | Bacteria | 2822 |
| 80 | Ga0070662_100901947 | 3300005457 | Bacteria | 754 |
| 81 | Ga0070662_100952042 | 3300005457 | Unclassified | 734 |
| 82 | Ga0070681_10076015 | 3300005458 | Bacteria | 3318 |
| 83 | Ga0070681_10167675 | 3300005458 | Bacteria | 2118 |
| 84 | Ga0070681_10528825 | 3300005458 | Unclassified | 1093 |
| 85 | Ga0070681_10793326 | 3300005458 | Bacteria | 864 |
| 86 | Ga0068867_100008098 | 3300005459 | Bacteria | 7428 |
| 87 | Ga0068867_100038907 | 3300005459 | Bacteria | 3465 |
| 88 | Ga0070706_100004466 | 3300005467 | Bacteria | 13503 |
| 89 | Ga0070706_100289330 | 3300005467 | Bacteria | 1529 |
| 90 | Ga0070706_100398749 | 3300005467 | Bacteria | 1281 |
| 91 | Ga0070706_100968835 | 3300005467 | Bacteria | 785 |
| 92 | Ga0070707_100004738 | 3300005468 | Bacteria | 12751 |
| 93 | Ga0070707_100175091 | 3300005468 | Bacteria | 2091 |
| 94 | Ga0070707_101041672 | 3300005468 | Unclassified | 784 |
| 95 | Ga0070707_101754353 | 3300005468 | Bacteria | 588 |
| 96 | Ga0070707_102218107 | 3300005468 | Unclassified | 517 |
| 97 | Ga0070698_100014842 | 3300005471 | Bacteria | 8235 |
| 98 | Ga0070698_100191377 | 3300005471 | Bacteria | 1983 |
| 99 | Ga0070698_100264815 | 3300005471 | Bacteria | 1651 |
| 100 | Ga0070698_101973365 | 3300005471 | Bacteria | 537 |
| 101 | Ga0070699_100000131 | 3300005518 | Bacteria | 69337 |
| 102 | Ga0070699_100003191 | 3300005518 | Bacteria | 14504 |
| 103 | Ga0070699_100004511 | 3300005518 | Bacteria | 12318 |
| 104 | Ga0070699_100008937 | 3300005518 | Bacteria | 8678 |
| 105 | Ga0070699_100128518 | 3300005518 | Bacteria | 2233 |
| 106 | Ga0070699_100153892 | 3300005518 | Bacteria | 2035 |
| 107 | Ga0070699_100266612 | 3300005518 | Bacteria | 1532 |
| 108 | Ga0070699_100608198 | 3300005518 | Bacteria | 997 |
| 109 | Ga0070679_100237887 | 3300005530 | Bacteria | 1779 |
| 110 | Ga0070679_100292417 | 3300005530 | Bacteria | 1580 |
| 111 | Ga0070679_100753558 | 3300005530 | Bacteria | 917 |
| 112 | Ga0070684_100558228 | 3300005535 | Unclassified | 1063 |
| 113 | Ga0070684_100589895 | 3300005535 | Bacteria | 1033 |
| 114 | Ga0070697_100004653 | 3300005536 | Bacteria | 10530 |
| 115 | Ga0070697_100075760 | 3300005536 | Bacteria | 2766 |
| 116 | Ga0070697_100081128 | 3300005536 | Bacteria | 2673 |
| 117 | Ga0070697_100778954 | 3300005536 | Bacteria | 846 |
| 118 | Ga0068853_100133861 | 3300005539 | Bacteria | 2221 |
| 119 | Ga0068853_100666522 | 3300005539 | Bacteria | 991 |
| 120 | Ga0070672_100624782 | 3300005543 | Bacteria | 940 |
| 121 | Ga0070686_101049323 | 3300005544 | Bacteria | 671 |
| 122 | Ga0070695_100031774 | 3300005545 | Bacteria | 3296 |
| 123 | Ga0070695_100522560 | 3300005545 | Bacteria | 921 |
| 124 | Ga0070695_100630825 | 3300005545 | Unclassified | 844 |
| 125 | Ga0070696_100000526 | 3300005546 | Bacteria | 24285 |
| 126 | Ga0070696_100060512 | 3300005546 | Bacteria | 2648 |
| 127 | Ga0070696_100153863 | 3300005546 | Bacteria | 1690 |
| 128 | Ga0070696_100174429 | 3300005546 | Bacteria | 1591 |
| 129 | Ga0070696_100179735 | 3300005546 | Bacteria | 1569 |
| 130 | Ga0070696_100221443 | 3300005546 | Bacteria | 1420 |
| 131 | Ga0070696_100490698 | 3300005546 | Bacteria | 975 |
| 132 | Ga0070696_101027920 | 3300005546 | Unclassified | 690 |
| 133 | Ga0070693_100216251 | 3300005547 | Bacteria | 1253 |
| 134 | Ga0070693_100814445 | 3300005547 | Bacteria | 693 |
| 135 | Ga0070665_101221690 | 3300005548 | Bacteria | 762 |
| 136 | Ga0070704_100035572 | 3300005549 | Bacteria | 3386 |
| 137 | Ga0070704_100156171 | 3300005549 | Unclassified | 1799 |
| 138 | Ga0070704_100340756 | 3300005549 | Bacteria | 1262 |
| 139 | Ga0070704_101921195 | 3300005549 | Unclassified | 549 |
| 140 | Ga0070664_100031929 | 3300005564 | Bacteria | 4404 |
| 141 | Ga0070664_100113170 | 3300005564 | Bacteria | 2370 |
| 142 | Ga0070664_100409554 | 3300005564 | Unclassified | 1241 |
| 143 | Ga0070664_101958322 | 3300005564 | Unclassified | 556 |
| 144 | Ga0068857_100003989 | 3300005577 | Bacteria | 12433 |
| 145 | Ga0068854_100005676 | 3300005578 | Bacteria | 7888 |
| 146 | Ga0068854_100795889 | 3300005578 | Bacteria | 824 |
| 147 | Ga0068856_101827960 | 3300005614 | Unclassified | 619 |
| 148 | Ga0070702_100049156 | 3300005615 | Bacteria | 2404 |
| 149 | Ga0070702_100499905 | 3300005615 | Unclassified | 893 |
| 150 | Ga0070702_101045272 | 3300005615 | Bacteria | 649 |
| 151 | Ga0068852_100666561 | 3300005616 | Bacteria | 1049 |
| 152 | Ga0068859_100098835 | 3300005617 | Bacteria | 2973 |
| 153 | Ga0068864_100005813 | 3300005618 | Bacteria | 10114 |
| 154 | Ga0068864_100008732 | 3300005618 | Bacteria | 8356 |
| 155 | Ga0068864_100293696 | 3300005618 | Bacteria | 1520 |
| 156 | Ga0068866_10012010 | 3300005718 | Bacteria | 3767 |
| 157 | Ga0068866_10391271 | 3300005718 | Unclassified | 894 |
| 158 | Ga0068861_100171105 | 3300005719 | Bacteria | 1800 |
| 159 | Ga0068861_101829658 | 3300005719 | Unclassified | 603 |
| 160 | Ga0068870_10153393 | 3300005840 | Bacteria | 1359 |
| 161 | Ga0068863_100011471 | 3300005841 | Bacteria | 8569 |
| 162 | Ga0068863_102469400 | 3300005841 | Unclassified | 529 |
| 163 | Ga0068858_100100427 | 3300005842 | Bacteria | 2698 |
| 164 | Ga0068858_100107831 | 3300005842 | Unclassified | 2600 |
| 165 | Ga0068858_100174352 | 3300005842 | Bacteria | 2029 |
| 166 | Ga0068858_101431698 | 3300005842 | Archaea | 681 |
| 167 | Ga0068860_100047764 | 3300005843 | Bacteria | 4079 |
| 168 | Ga0068860_100898876 | 3300005843 | Unclassified | 901 |
| 169 | Ga0068860_102781077 | 3300005843 | Unclassified | 507 |
| 170 | Ga0068862_100024031 | 3300005844 | Bacteria | 5109 |
| 171 | Ga0068862_101248718 | 3300005844 | Bacteria | 743 |
| 172 | Ga0081455_10110720 | 3300005937 | Bacteria | 2182 |
| 173 | Ga0081538_10066647 | 3300005981 | Bacteria | 2016 |
| 174 | Ga0081538_10383080 | 3300005981 | Unclassified | 507 |
| 175 | Ga0081539_10113658 | 3300005985 | Bacteria | 1358 |
| 176 | Ga0070715_10261105 | 3300006163 | Bacteria | 910 |
| 177 | Ga0070716_101209979 | 3300006173 | Bacteria | 607 |
| 178 | Ga0070712_100171890 | 3300006175 | Bacteria | 1682 |
| 179 | Ga0070712_100366293 | 3300006175 | Unclassified | 1183 |
| 180 | Ga0097621_101493218 | 3300006237 | Unclassified | 641 |
| 181 | Ga0068871_100372903 | 3300006358 | Bacteria | 1266 |
| 182 | Ga0075428_100036820 | 3300006844 | Bacteria | 5388 |
| 183 | Ga0075428_100102374 | 3300006844 | Bacteria | 3123 |
| 184 | Ga0075428_100347329 | 3300006844 | Unclassified | 1593 |
| 185 | Ga0075428_101460913 | 3300006844 | Bacteria | 717 |
| 186 | Ga0075428_102528121 | 3300006844 | Bacteria | 526 |
| 187 | Ga0075430_100154604 | 3300006846 | Unclassified | 1910 |
| 188 | Ga0075430_101111701 | 3300006846 | Unclassified | 651 |
| 189 | Ga0075431_100015302 | 3300006847 | Bacteria | 7773 |
| 190 | Ga0075431_100118877 | 3300006847 | Unclassified | 2727 |
| 191 | Ga0075431_100141624 | 3300006847 | Bacteria | 2479 |
| 192 | Ga0075431_100966593 | 3300006847 | Bacteria | 819 |
| 193 | Ga0075433_10042982 | 3300006852 | Bacteria | 3922 |
| 194 | Ga0075433_10079795 | 3300006852 | Bacteria | 2884 |
| 195 | Ga0075433_10419686 | 3300006852 | Bacteria | 1180 |
| 196 | Ga0075433_11278486 | 3300006852 | Unclassified | 636 |
| 197 | Ga0075434_100032494 | 3300006871 | Bacteria | 5145 |
| 198 | Ga0075434_100070739 | 3300006871 | Bacteria | 3480 |
| 199 | Ga0075434_100415659 | 3300006871 | Bacteria | 1366 |
| 200 | Ga0075434_100612819 | 3300006871 | Bacteria | 1107 |
| 201 | Ga0075434_100763007 | 3300006871 | Bacteria | 984 |
| 202 | Ga0075429_100005664 | 3300006880 | Bacteria | 10774 |
| 203 | Ga0075429_100117673 | 3300006880 | Bacteria | 2322 |
| 204 | Ga0075429_100543181 | 3300006880 | Bacteria | 1018 |
| 205 | Ga0075429_100647292 | 3300006880 | Bacteria | 926 |
| 206 | Ga0068865_100023280 | 3300006881 | Bacteria | 4054 |
| 207 | Ga0068865_100054376 | 3300006881 | Bacteria | 2781 |
| 208 | Ga0075436_100031537 | 3300006914 | Bacteria | 3650 |
| 209 | Ga0075436_100421974 | 3300006914 | Bacteria | 969 |
| 210 | Ga0075436_100512874 | 3300006914 | Unclassified | 878 |
| 211 | Ga0097620_100098837 | 3300006931 | Bacteria | 2973 |
| 212 | Ga0075435_100116035 | 3300007076 | Bacteria | 2230 |
| 213 | Ga0075435_100192631 | 3300007076 | Bacteria | 1726 |
| 214 | Ga0075435_100259193 | 3300007076 | Bacteria | 1481 |
| 215 | Ga0075435_100377464 | 3300007076 | Bacteria | 1218 |
| 216 | Ga0075435_100400362 | 3300007076 | Unclassified | 1181 |
| 217 | Ga0075435_100629376 | 3300007076 | Bacteria | 931 |
| 218 | Ga0105240_10080722 | 3300009093 | Bacteria | 3999 |
| 219 | Ga0111539_10064564 | 3300009094 | Bacteria | 4329 |
| 220 | Ga0111539_10291319 | 3300009094 | Bacteria | 1900 |
| 221 | Ga0111539_10346686 | 3300009094 | Bacteria | 1728 |
| 222 | Ga0105245_10848762 | 3300009098 | Unclassified | 953 |
| 223 | Ga0105245_12346769 | 3300009098 | Unclassified | 587 |
| 224 | Ga0105247_10288638 | 3300009101 | Bacteria | 1134 |
| 225 | Ga0105247_10311124 | 3300009101 | Bacteria | 1096 |
| 226 | Ga0114129_10005002 | 3300009147 | Bacteria | 18666 |
| 227 | Ga0114129_10025521 | 3300009147 | Bacteria | 8374 |
| 228 | Ga0114129_10046313 | 3300009147 | Bacteria | 6112 |
| 229 | Ga0114129_10133652 | 3300009147 | Bacteria | 3406 |
| 230 | Ga0114129_10135190 | 3300009147 | Bacteria | 3384 |
| 231 | Ga0114129_10439801 | 3300009147 | Bacteria | 1712 |
| 232 | Ga0114129_10576885 | 3300009147 | Bacteria | 1460 |
| 233 | Ga0114129_10582248 | 3300009147 | Bacteria | 1452 |
| 234 | Ga0114129_11401477 | 3300009147 | Bacteria | 862 |
| 235 | Ga0114129_12169510 | 3300009147 | Bacteria | 669 |
| 236 | Ga0105243_10007267 | 3300009148 | Bacteria | 8512 |
| 237 | Ga0105241_10017856 | 3300009174 | Bacteria | 5218 |
| 238 | Ga0105241_10727394 | 3300009174 | Bacteria | 908 |
| 239 | Ga0105241_10860471 | 3300009174 | Bacteria | 839 |
| 240 | Ga0105242_10269372 | 3300009176 | Bacteria | 1542 |
| 241 | Ga0105242_10374358 | 3300009176 | Bacteria | 1322 |
| 242 | Ga0105242_11503597 | 3300009176 | Unclassified | 704 |
| 243 | Ga0105242_11524594 | 3300009176 | Unclassified | 700 |
| 244 | Ga0105248_10164703 | 3300009177 | Bacteria | 2500 |
| 245 | Ga0105248_10614421 | 3300009177 | Bacteria | 1226 |
| 246 | Ga0105248_10707800 | 3300009177 | Unclassified | 1136 |
| 247 | Ga0105237_10072012 | 3300009545 | Bacteria | 3450 |
| 248 | Ga0105249_10022117 | 3300009553 | Bacteria | 5695 |
| 249 | Ga0105249_10104613 | 3300009553 | Bacteria | 2668 |
| 250 | Ga0105249_10480911 | 3300009553 | Unclassified | 1285 |
| 251 | Ga0105249_10799685 | 3300009553 | Unclassified | 1007 |
| 252 | Ga0105249_11454938 | 3300009553 | Bacteria | 757 |
| 253 | Ga0105239_10007902 | 3300010375 | Bacteria | 12160 |
| 254 | Ga0105246_10040986 | 3300011119 | Unclassified | 3128 |
| 255 | Ga0105246_10410468 | 3300011119 | Bacteria | 1127 |
| 256 | Ga0105246_10569860 | 3300011119 | Bacteria | 973 |
| 257 | Ga0157373_10894666 | 3300013100 | Unclassified | 658 |
| 258 | Ga0157378_10003362 | 3300013297 | Bacteria | 14228 |
| 259 | Ga0163162_10037565 | 3300013306 | Unclassified | 4833 |
| 260 | Ga0163162_10047295 | 3300013306 | Bacteria | 4312 |
| 261 | Ga0163162_10313960 | 3300013306 | Bacteria | 1700 |
| 262 | Ga0163162_11270566 | 3300013306 | Bacteria | 836 |
| 263 | Ga0157372_10103508 | 3300013307 | Bacteria | 3253 |
| 264 | Ga0157372_11178341 | 3300013307 | Bacteria | 886 |
| 265 | Ga0157375_12628733 | 3300013308 | Unclassified | 602 |
| 266 | Ga0163163_10080871 | 3300014325 | Bacteria | 3250 |
| 267 | Ga0163163_10156630 | 3300014325 | Unclassified | 2322 |
| 268 | Ga0163163_11453926 | 3300014325 | Bacteria | 747 |
| 269 | Ga0163163_12950435 | 3300014325 | Unclassified | 531 |
| 270 | Ga0157380_10796010 | 3300014326 | Unclassified | 962 |
| 271 | Ga0157380_10905774 | 3300014326 | Unclassified | 908 |
| 272 | Ga0182008_10197663 | 3300014497 | Bacteria | 1022 |
| 273 | Ga0157377_10376974 | 3300014745 | Unclassified | 959 |
| 274 | Ga0157379_10221242 | 3300014968 | Bacteria | 1715 |
| 275 | Ga0157379_10820198 | 3300014968 | Unclassified | 879 |
| 276 | Ga0157379_12437771 | 3300014968 | Bacteria | 522 |
| 277 | Ga0157376_10211694 | 3300014969 | Bacteria | 1790 |
| 278 | Ga0163161_10070245 | 3300017792 | Bacteria | 2560 |
| 279 | Ga0163161_10234741 | 3300017792 | Bacteria | 1424 |
| 280 | Ga0207653_10159320 | 3300025885 | Bacteria | 835 |
| 281 | Ga0207642_10005341 | 3300025899 | Bacteria | 4186 |
| 282 | Ga0207688_10437702 | 3300025901 | Bacteria | 814 |
| 283 | Ga0207688_10963815 | 3300025901 | Unclassified | 540 |
| 284 | Ga0207680_10130869 | 3300025903 | Bacteria | 1654 |
| 285 | Ga0207647_10659464 | 3300025904 | Unclassified | 573 |
| 286 | Ga0207647_10722797 | 3300025904 | Unclassified | 541 |
| 287 | Ga0207685_10090616 | 3300025905 | Unclassified | 1286 |
| 288 | Ga0207685_10161267 | 3300025905 | Bacteria | 1024 |
| 289 | Ga0207699_11085800 | 3300025906 | Bacteria | 592 |
| 290 | Ga0207645_10001959 | 3300025907 | Bacteria | 16566 |
| 291 | Ga0207643_10004403 | 3300025908 | Bacteria | 7575 |
| 292 | Ga0207643_10223662 | 3300025908 | Bacteria | 1153 |
| 293 | Ga0207684_10011945 | 3300025910 | Bacteria | 7565 |
| 294 | Ga0207684_10122174 | 3300025910 | Bacteria | 2233 |
| 295 | Ga0207684_10147766 | 3300025910 | Bacteria | 2022 |
| 296 | Ga0207684_10941313 | 3300025910 | Bacteria | 725 |
| 297 | Ga0207654_10003690 | 3300025911 | Bacteria | 7722 |
| 298 | Ga0207654_10644681 | 3300025911 | Bacteria | 758 |
| 299 | Ga0207707_10010026 | 3300025912 | Bacteria | 8222 |
| 300 | Ga0207707_10141884 | 3300025912 | Bacteria | 2100 |
| 301 | Ga0207707_10467934 | 3300025912 | Unclassified | 1077 |
| 302 | Ga0207707_11131312 | 3300025912 | Bacteria | 637 |
| 303 | Ga0207695_10817787 | 3300025913 | Bacteria | 812 |
| 304 | Ga0207671_10387449 | 3300025914 | Bacteria | 1111 |
| 305 | Ga0207693_10305122 | 3300025915 | Bacteria | 1247 |
| 306 | Ga0207693_10386118 | 3300025915 | Unclassified | 1095 |
| 307 | Ga0207663_10004700 | 3300025916 | Bacteria | 6818 |
| 308 | Ga0207663_10597103 | 3300025916 | Bacteria | 867 |
| 309 | Ga0207663_10911876 | 3300025916 | Bacteria | 703 |
| 310 | Ga0207660_10068416 | 3300025917 | Bacteria | 2575 |
| 311 | Ga0207660_10567558 | 3300025917 | Bacteria | 923 |
| 312 | Ga0207660_10868757 | 3300025917 | Bacteria | 736 |
| 313 | Ga0207662_11120925 | 3300025918 | Unclassified | 559 |
| 314 | Ga0207662_11170190 | 3300025918 | Unclassified | 547 |
| 315 | Ga0207657_10261483 | 3300025919 | Unclassified | 1377 |
| 316 | Ga0207649_10127379 | 3300025920 | Unclassified | 1725 |
| 317 | Ga0207652_10010159 | 3300025921 | Bacteria | 7581 |
| 318 | Ga0207652_10195330 | 3300025921 | Bacteria | 1820 |
| 319 | Ga0207646_10013251 | 3300025922 | Bacteria | 7887 |
| 320 | Ga0207646_10047450 | 3300025922 | Bacteria | 3852 |
| 321 | Ga0207646_10376125 | 3300025922 | Bacteria | 1283 |
| 322 | Ga0207646_11609210 | 3300025922 | Unclassified | 560 |
| 323 | Ga0207694_10493768 | 3300025924 | Unclassified | 1025 |
| 324 | Ga0207687_10394012 | 3300025927 | Bacteria | 1137 |
| 325 | Ga0207700_10916415 | 3300025928 | Unclassified | 784 |
| 326 | Ga0207664_11454704 | 3300025929 | Bacteria | 606 |
| 327 | Ga0207664_11529734 | 3300025929 | Bacteria | 589 |
| 328 | Ga0207690_10258717 | 3300025932 | Bacteria | 1348 |
| 329 | Ga0207690_10284395 | 3300025932 | Bacteria | 1289 |
| 330 | Ga0207706_10008792 | 3300025933 | Bacteria | 9297 |
| 331 | Ga0207706_10755524 | 3300025933 | Bacteria | 828 |
| 332 | Ga0207686_10002785 | 3300025934 | Bacteria | 9462 |
| 333 | Ga0207709_10030296 | 3300025935 | Bacteria | 3146 |
| 334 | Ga0207669_10183202 | 3300025937 | Bacteria | 1503 |
| 335 | Ga0207669_10903348 | 3300025937 | Unclassified | 738 |
| 336 | Ga0207704_10013556 | 3300025938 | Bacteria | 4084 |
| 337 | Ga0207665_10826435 | 3300025939 | Bacteria | 733 |
| 338 | Ga0207665_10973666 | 3300025939 | Bacteria | 674 |
| 339 | Ga0207665_11076967 | 3300025939 | Unclassified | 640 |
| 340 | Ga0207691_10126022 | 3300025940 | Bacteria | 2266 |
| 341 | Ga0207691_11713221 | 3300025940 | Unclassified | 508 |
| 342 | Ga0207711_10347993 | 3300025941 | Bacteria | 1372 |
| 343 | Ga0207711_10418670 | 3300025941 | Bacteria | 1246 |
| 344 | Ga0207689_10044212 | 3300025942 | Bacteria | 3682 |
| 345 | Ga0207689_10443838 | 3300025942 | Bacteria | 1084 |
| 346 | Ga0207661_10042428 | 3300025944 | Bacteria | 3586 |
| 347 | Ga0207661_10505291 | 3300025944 | Unclassified | 1105 |
| 348 | Ga0207661_11086130 | 3300025944 | Bacteria | 737 |
| 349 | Ga0207679_10036953 | 3300025945 | Bacteria | 3468 |
| 350 | Ga0207679_10250052 | 3300025945 | Bacteria | 1506 |
| 351 | Ga0207679_10266378 | 3300025945 | Unclassified | 1463 |
| 352 | Ga0207667_10137895 | 3300025949 | Bacteria | 2512 |
| 353 | Ga0207667_12076956 | 3300025949 | Unclassified | 527 |
| 354 | Ga0207651_10688250 | 3300025960 | Bacteria | 900 |
| 355 | Ga0207712_10013453 | 3300025961 | Bacteria | 5246 |
| 356 | Ga0207712_10084776 | 3300025961 | Bacteria | 2316 |
| 357 | Ga0207668_10059917 | 3300025972 | Bacteria | 2670 |
| 358 | Ga0207668_10623659 | 3300025972 | Unclassified | 941 |
| 359 | Ga0207640_10019626 | 3300025981 | Bacteria | 3998 |
| 360 | Ga0207658_10163736 | 3300025986 | Bacteria | 1825 |
| 361 | Ga0207658_10393988 | 3300025986 | Unclassified | 1216 |
| 362 | Ga0207703_10302956 | 3300026035 | Bacteria | 1458 |
| 363 | Ga0207703_10338643 | 3300026035 | Bacteria | 1382 |
| 364 | Ga0207703_12365263 | 3300026035 | Archaea | 507 |
| 365 | Ga0207639_10418145 | 3300026041 | Bacteria | 1211 |
| 366 | Ga0207639_10433528 | 3300026041 | Bacteria | 1190 |
| 367 | Ga0207639_10646964 | 3300026041 | Bacteria | 978 |
| 368 | Ga0207678_10131214 | 3300026067 | Bacteria | 2137 |
| 369 | Ga0207678_10299744 | 3300026067 | Bacteria | 1381 |
| 370 | Ga0207678_10330413 | 3300026067 | Bacteria | 1312 |
| 371 | Ga0207708_10007267 | 3300026075 | Bacteria | 8187 |
| 372 | Ga0207708_10035505 | 3300026075 | Unclassified | 3793 |
| 373 | Ga0207708_10257718 | 3300026075 | Bacteria | 1407 |
| 374 | Ga0207702_10547418 | 3300026078 | Bacteria | 1132 |
| 375 | Ga0207641_10793750 | 3300026088 | Bacteria | 936 |
| 376 | Ga0207648_10002060 | 3300026089 | Bacteria | 21904 |
| 377 | Ga0207648_10432571 | 3300026089 | Bacteria | 1196 |
| 378 | Ga0207676_10002069 | 3300026095 | Bacteria | 14566 |
| 379 | Ga0207676_10009280 | 3300026095 | Bacteria | 6998 |
| 380 | Ga0207676_10074337 | 3300026095 | Bacteria | 2738 |
| 381 | Ga0207674_10017092 | 3300026116 | Bacteria | 7918 |
| 382 | Ga0207674_10096916 | 3300026116 | Bacteria | 2934 |
| 383 | Ga0207675_100176646 | 3300026118 | Unclassified | 2043 |
| 384 | Ga0207675_100205122 | 3300026118 | Bacteria | 1894 |
| 385 | Ga0207675_100287274 | 3300026118 | Bacteria | 1599 |
| 386 | Ga0207683_10058273 | 3300026121 | Bacteria | 3391 |
| 387 | Ga0207683_10707172 | 3300026121 | Unclassified | 934 |
| 388 | Ga0207698_10119060 | 3300026142 | Bacteria | 2231 |
| 389 | Ga0207698_10635810 | 3300026142 | Unclassified | 1055 |
| 390 | Ga0209999_1063585 | 3300027543 | Unclassified | 704 |
| 391 | Ga0209982_1070084 | 3300027552 | Bacteria | 574 |
| 392 | Ga0209966_1043284 | 3300027695 | Bacteria | 943 |
| 393 | Ga0209998_10168098 | 3300027717 | Bacteria | 567 |
| 394 | Ga0209974_10067559 | 3300027876 | Bacteria | 1216 |
| 395 | Ga0207428_11147654 | 3300027907 | Bacteria | 542 |
| 396 | Ga0268266_11047356 | 3300028379 | Bacteria | 789 |
| 397 | Ga0268265_10189117 | 3300028380 | Unclassified | 1776 |
| 398 | Ga0307408_100011030 | 3300031548 | Bacteria | 5963 |
| 399 | Ga0307408_100069104 | 3300031548 | Bacteria | 2603 |
| 400 | Ga0307408_100096458 | 3300031548 | Unclassified | 2244 |
| 401 | Ga0307408_100691583 | 3300031548 | Bacteria | 916 |
| 402 | Ga0307405_10058570 | 3300031731 | Bacteria | 2424 |
| 403 | Ga0307405_10074483 | 3300031731 | Bacteria | 2196 |
| 404 | Ga0307405_10425188 | 3300031731 | Bacteria | 1046 |
| 405 | Ga0307405_11578679 | 3300031731 | Unclassified | 578 |
| 406 | Ga0307413_10006927 | 3300031824 | Bacteria | 5218 |
| 407 | Ga0307413_10010645 | 3300031824 | Bacteria | 4476 |
| 408 | Ga0307413_10022298 | 3300031824 | Bacteria | 3410 |
| 409 | Ga0307413_10037584 | 3300031824 | Unclassified | 2797 |
| 410 | Ga0307413_10056800 | 3300031824 | Bacteria | 2389 |
| 411 | Ga0307413_10113182 | 3300031824 | Bacteria | 1821 |
| 412 | Ga0307413_10161437 | 3300031824 | Bacteria | 1575 |
| 413 | Ga0307413_10206381 | 3300031824 | Bacteria | 1423 |
| 414 | Ga0307413_10556480 | 3300031824 | Unclassified | 931 |
| 415 | Ga0307413_10590527 | 3300031824 | Bacteria | 907 |
| 416 | Ga0307410_10002633 | 3300031852 | Bacteria | 8742 |
| 417 | Ga0307410_10005177 | 3300031852 | Bacteria | 6868 |
| 418 | Ga0307410_10007383 | 3300031852 | Bacteria | 6015 |
| 419 | Ga0307410_10024757 | 3300031852 | Unclassified | 3755 |
| 420 | Ga0307410_10037922 | 3300031852 | Bacteria | 3153 |
| 421 | Ga0307410_10044398 | 3300031852 | Bacteria | 2952 |
| 422 | Ga0307410_10355012 | 3300031852 | Bacteria | 1172 |
| 423 | Ga0307410_10592788 | 3300031852 | Unclassified | 923 |
| 424 | Ga0307410_11190781 | 3300031852 | Bacteria | 663 |
| 425 | Ga0307406_10013425 | 3300031901 | Bacteria | 4692 |
| 426 | Ga0307406_10123863 | 3300031901 | Bacteria | 1802 |
| 427 | Ga0307406_10150470 | 3300031901 | Bacteria | 1659 |
| 428 | Ga0307406_10173641 | 3300031901 | Bacteria | 1562 |
| 429 | Ga0307406_10293606 | 3300031901 | Bacteria | 1245 |
| 430 | Ga0307406_10458334 | 3300031901 | Unclassified | 1024 |
| 431 | Ga0307406_11032253 | 3300031901 | Bacteria | 707 |
| 432 | Ga0307407_10038931 | 3300031903 | Bacteria | 2639 |
| 433 | Ga0307407_10041451 | 3300031903 | Bacteria | 2575 |
| 434 | Ga0307407_10094962 | 3300031903 | Bacteria | 1837 |
| 435 | Ga0307407_10256784 | 3300031903 | Bacteria | 1200 |
| 436 | Ga0307407_10442801 | 3300031903 | Bacteria | 941 |
| 437 | Ga0307407_10442844 | 3300031903 | Bacteria | 941 |
| 438 | Ga0307407_10669770 | 3300031903 | Bacteria | 779 |
| 439 | Ga0307407_10744591 | 3300031903 | Bacteria | 741 |
| 440 | Ga0307412_10217905 | 3300031911 | Bacteria | 1461 |
| 441 | Ga0307412_10292562 | 3300031911 | Bacteria | 1283 |
| 442 | Ga0307412_10387103 | 3300031911 | Bacteria | 1134 |
| 443 | Ga0307412_10411135 | 3300031911 | Bacteria | 1104 |
| 444 | Ga0307412_10427103 | 3300031911 | Bacteria | 1085 |
| 445 | Ga0307412_11605034 | 3300031911 | Bacteria | 594 |
| 446 | Ga0307412_12312785 | 3300031911 | Bacteria | 502 |
| 447 | Ga0307409_100010966 | 3300031995 | Bacteria | 5677 |
| 448 | Ga0307409_100017349 | 3300031995 | Bacteria | 4795 |
| 449 | Ga0307409_100048008 | 3300031995 | Bacteria | 3245 |
| 450 | Ga0307409_100207157 | 3300031995 | Bacteria | 1759 |
| 451 | Ga0307409_100217146 | 3300031995 | Bacteria | 1723 |
| 452 | Ga0307409_100238474 | 3300031995 | Bacteria | 1654 |
| 453 | Ga0307409_100360935 | 3300031995 | Bacteria | 1374 |
| 454 | Ga0307409_101118310 | 3300031995 | Bacteria | 809 |
| 455 | Ga0307416_100001764 | 3300032002 | Bacteria | 11983 |
| 456 | Ga0307416_100018370 | 3300032002 | Bacteria | 4924 |
| 457 | Ga0307416_100021841 | 3300032002 | Unclassified | 4605 |
| 458 | Ga0307416_100033140 | 3300032002 | Bacteria | 3913 |
| 459 | Ga0307416_100060168 | 3300032002 | Bacteria | 3091 |
| 460 | Ga0307416_100096272 | 3300032002 | Bacteria | 2559 |
| 461 | Ga0307416_100102675 | 3300032002 | Unclassified | 2494 |
| 462 | Ga0307416_100116164 | 3300032002 | Unclassified | 2371 |
| 463 | Ga0307416_100255897 | 3300032002 | Bacteria | 1707 |
| 464 | Ga0307416_100427333 | 3300032002 | Bacteria | 1371 |
| 465 | Ga0307416_100484333 | 3300032002 | Bacteria | 1298 |
| 466 | Ga0307416_100578157 | 3300032002 | Bacteria | 1200 |
| 467 | Ga0307416_100898718 | 3300032002 | Bacteria | 986 |
| 468 | Ga0307416_101660192 | 3300032002 | Unclassified | 744 |
| 469 | Ga0307414_10041216 | 3300032004 | Bacteria | 3125 |
| 470 | Ga0307414_10053221 | 3300032004 | Bacteria | 2822 |
| 471 | Ga0307414_10066020 | 3300032004 | Bacteria | 2584 |
| 472 | Ga0307414_10073089 | 3300032004 | Bacteria | 2479 |
| 473 | Ga0307414_10127773 | 3300032004 | Bacteria | 1967 |
| 474 | Ga0307414_10227790 | 3300032004 | Bacteria | 1535 |
| 475 | Ga0307414_10347875 | 3300032004 | Bacteria | 1271 |
| 476 | Ga0307411_10007633 | 3300032005 | Bacteria | 5534 |
| 477 | Ga0307411_10009538 | 3300032005 | Bacteria | 5112 |
| 478 | Ga0307411_10015803 | 3300032005 | Bacteria | 4253 |
| 479 | Ga0307411_10043216 | 3300032005 | Bacteria | 2882 |
| 480 | Ga0307411_10102680 | 3300032005 | Bacteria | 2027 |
| 481 | Ga0307411_10109302 | 3300032005 | Bacteria | 1974 |
| 482 | Ga0307411_10144125 | 3300032005 | Bacteria | 1760 |
| 483 | Ga0307415_100016741 | 3300032126 | Unclassified | 4378 |
| 484 | Ga0307415_100017132 | 3300032126 | Bacteria | 4338 |
| 485 | Ga0307415_100036306 | 3300032126 | Bacteria | 3228 |
| 486 | Ga0307415_100058472 | 3300032126 | Bacteria | 2654 |
| 487 | Ga0307415_100069066 | 3300032126 | Bacteria | 2476 |
| 488 | Ga0307415_100506473 | 3300032126 | Bacteria | 1057 |
| 489 | Ga0373958_0105106 | 3300034819 | Bacteria | 667 |
| 490 | Ga0373928_0072478 | 3300035084 | Bacteria | 854 |
| 491 | Ga0373940_0004243 | 3300035088 | Bacteria | 3016 |
| 492 | Ga0373940_0113430 | 3300035088 | Unclassified | 834 |
| 493 | Ga0373940_0134924 | 3300035088 | Unclassified | 776 |
| 494 | Ga0373940_0342105 | 3300035088 | Unclassified | 523 |
| 495 | Ga0373932_0123041 | 3300035112 | Bacteria | 867 |
| 496 | Ga0373941_0064966 | 3300035115 | Bacteria | 1197 |
| 497 | Ga0373941_0074712 | 3300035115 | Bacteria | 1133 |
| 498 | Ga0373943_0255564 | 3300035170 | Unclassified | 985 |
| 499 | Ga0373942_0217133 | 3300035207 | Bacteria | 640 |
| 500 | Ga0316574_0567230 | 3300035398 | Bacteria | 703 |
| 501 | Ga0373931_0003655 | 3300035691 | Bacteria | 6953 |
| 502 | Ga0373931_0540243 | 3300035691 | Bacteria | 756 |
| 503 | Ga0373931_0640655 | 3300035691 | Bacteria | 698 |
| 504 | Ga0373937_0161755 | 3300036401 | Bacteria | 2099 |
| 505 | Ga0395900_0507152 | 3300037418 | Bacteria | 1156 |
| 506 | Ga0395905_0030032 | 3300037471 | Bacteria | 5123 |
| 507 | Ga0395905_0093574 | 3300037471 | Bacteria | 2819 |
| 508 | Ga0395905_0775498 | 3300037471 | Bacteria | 862 |
| 509 | Ga0395905_1765051 | 3300037471 | Unclassified | 524 |
| 510 | Ga0395901_1100319 | 3300038443 | Unclassified | 765 |
| 511 | Ga0242419_001918 | 3300038698 | Bacteria | 1322 |
| 512 | Ga0242420_017065 | 3300038996 | Bacteria | 1268 |
| 513 | Ga0242420_075742 | 3300038996 | Bacteria | 689 |
| 514 | Ga0439439_0003943 | 3300041406 | Unclassified | 3308 |
| 515 | Ga0451793_0454245 | 3300041452 | Unclassified | 632 |
| 516 | Ga0451793_0650265 | 3300041452 | Bacteria | 701 |
| 517 | Ga0451845_0087672 | 3300041501 | Bacteria | 671 |
| 518 | Ga0439431_0042126 | 3300041997 | Bacteria | 1166 |
| 519 | Ga0439448_0015975 | 3300042005 | Unclassified | 2280 |
| 520 | Ga0439448_0160346 | 3300042005 | Bacteria | 783 |
| 521 | Ga0439448_0272688 | 3300042005 | Unclassified | 599 |
| 522 | Ga0439455_0030225 | 3300042012 | Unclassified | 1343 |
| 523 | Ga0439462_0012907 | 3300042015 | Unclassified | 2138 |
| 524 | Ga0439462_0037973 | 3300042015 | Bacteria | 1284 |
| 525 | Ga0450894_038233 | 3300042131 | Bacteria | 684 |
| 526 | Ga0450898_012677 | 3300042134 | Bacteria | 1396 |
| 527 | Ga0439434_0118194 | 3300042435 | Unclassified | 863 |
| 528 | Ga0439444_0050789 | 3300042437 | Bacteria | 842 |
| 529 | Ga0453683_0018695 | 3300044673 | Bacteria | 4447 |
| 530 | Ga0453683_0189812 | 3300044673 | Bacteria | 1303 |
| 531 | Ga0453683_0203726 | 3300044673 | Bacteria | 1256 |
| 532 | Ga0453684_0226200 | 3300044712 | Bacteria | 2163 |
| 533 | Ga0453684_1844208 | 3300044712 | Bacteria | 613 |
| 534 | Ga0466960_0595408 | 3300044901 | Bacteria | 656 |
| 535 | Ga0466960_0617490 | 3300044901 | Bacteria | 645 |
| 536 | Ga0451576_0350543 | 3300045051 | Bacteria | 1545 |
| 537 | Ga0451576_0424215 | 3300045051 | Bacteria | 1396 |
| 538 | Ga0451576_1234785 | 3300045051 | Bacteria | 780 |
| 539 | Ga0466967_0417901 | 3300045976 | Bacteria | 1307 |
| 540 | Ga0495603_0065731 | 3300046455 | Bacteria | 2137 |
| 541 | Ga0495603_0639997 | 3300046455 | Bacteria | 609 |
| 542 | Ga0495629_0093161 | 3300046459 | Bacteria | 2103 |
| 543 | Ga0495641_0039760 | 3300046461 | Bacteria | 2191 |
| 544 | Ga0495580_0092817 | 3300046472 | Bacteria | 2101 |
| 545 | Ga0495580_0563671 | 3300046472 | Unclassified | 755 |
| 546 | Ga0495582_0050911 | 3300046473 | Bacteria | 2283 |
| 547 | Ga0495664_0029270 | 3300046477 | Bacteria | 3220 |
| 548 | Ga0495585_0234592 | 3300046492 | Unclassified | 921 |
| 549 | Ga0495594_0005575 | 3300046499 | Bacteria | 6467 |
| 550 | Ga0495594_0037831 | 3300046499 | Bacteria | 2634 |
| 551 | Ga0495618_0097347 | 3300046514 | Bacteria | 1882 |
| 552 | Ga0495628_0078527 | 3300046516 | Bacteria | 2567 |
| 553 | Ga0495628_0466481 | 3300046516 | Bacteria | 915 |
| 554 | Ga0495630_0002989 | 3300046517 | Bacteria | 11727 |
| 555 | Ga0495666_0005633 | 3300046526 | Bacteria | 6304 |
| 556 | Ga0495652_0725501 | 3300046529 | Unclassified | 667 |
| 557 | Ga0495665_0079354 | 3300046531 | Bacteria | 1727 |
| 558 | Ga0495640_0090469 | 3300046533 | Unclassified | 2020 |
| 559 | Ga0495586_0036631 | 3300046535 | Bacteria | 2633 |
| 560 | Ga0495622_0227579 | 3300046557 | Unclassified | 825 |
| 561 | Ga0495633_0408595 | 3300046558 | Unclassified | 614 |
| 562 | Ga0495667_0062279 | 3300046559 | Bacteria | 2445 |
| 563 | Ga0495656_0709565 | 3300046615 | Unclassified | 541 |
| 564 | Ga0495634_0011783 | 3300046642 | Bacteria | 6357 |
| 565 | Ga0495635_0123742 | 3300046663 | Bacteria | 1764 |
| 566 | Ga0495647_0011579 | 3300046681 | Bacteria | 3024 |
| 567 | Ga0495658_0001049 | 3300046683 | Bacteria | 14600 |
| 568 | Ga0495613_0015519 | 3300046689 | Bacteria | 5664 |
| 569 | Ga0495624_0057845 | 3300046690 | Bacteria | 2437 |
| 570 | Ga0495600_0056985 | 3300046809 | Bacteria | 2553 |
| 571 | Ga0495636_0029528 | 3300047318 | Unclassified | 2238 |
| 572 | Ga0495674_0021326 | 3300047319 | Bacteria | 5993 |
| 573 | Ga0495680_0005099 | 3300047322 | Bacteria | 12401 |
| 574 | Ga0495614_0064609 | 3300048089 | Bacteria | 1574 |
| 575 | Ga0496100_0070289 | 3300048903 | Bacteria | 2334 |
| 576 | Ga0496100_0558326 | 3300048903 | Bacteria | 886 |
| 577 | Ga0496101_0041301 | 3300048904 | Bacteria | 3289 |
| 578 | Ga0496101_0081058 | 3300048904 | Bacteria | 2399 |
| 579 | Ga0496102_0012691 | 3300048905 | Bacteria | 7297 |
| 580 | Ga0496102_0036524 | 3300048905 | Bacteria | 4427 |
| 581 | Ga0496102_0040322 | 3300048905 | Bacteria | 4223 |
| 582 | Ga0496102_0110469 | 3300048905 | Bacteria | 2563 |
| 583 | Ga0496102_0466491 | 3300048905 | Bacteria | 1184 |
| 584 | Ga0496102_1008184 | 3300048905 | Unclassified | 753 |
| 585 | Ga0496103_0004583 | 3300048906 | Bacteria | 8372 |
| 586 | Ga0496104_0005257 | 3300048907 | Bacteria | 11316 |
| 587 | Ga0496104_0065226 | 3300048907 | Bacteria | 3455 |
| 588 | Ga0496104_0104166 | 3300048907 | Bacteria | 2718 |
| 589 | Ga0496104_0668634 | 3300048907 | Bacteria | 947 |
| 590 | Ga0496104_0996220 | 3300048907 | Unclassified | 742 |
| 591 | Ga0496105_0433492 | 3300048908 | Unclassified | 1039 |
| 592 | Ga0496105_0922817 | 3300048908 | Unclassified | 657 |
| 593 | Ga0496106_0029316 | 3300048909 | Bacteria | 4101 |
| 594 | Ga0496106_0103022 | 3300048909 | Bacteria | 2215 |
| 595 | Ga0496106_0104271 | 3300048909 | Bacteria | 2202 |
| 596 | Ga0496106_0309800 | 3300048909 | Bacteria | 1267 |
| 597 | Ga0496107_0262086 | 3300048910 | Bacteria | 1286 |
| 598 | Ga0496107_0266974 | 3300048910 | Unclassified | 1274 |
| 599 | Ga0496107_0431246 | 3300048910 | Bacteria | 980 |
| 600 | Ga0496107_0701255 | 3300048910 | Bacteria | 744 |
| 601 | Ga0496108_0001821 | 3300048911 | Bacteria | 17010 |
| 602 | Ga0496108_0008113 | 3300048911 | Bacteria | 8515 |
| 603 | Ga0496108_0017792 | 3300048911 | Bacteria | 5812 |
| 604 | Ga0496108_0038132 | 3300048911 | Bacteria | 4003 |
| 605 | Ga0496108_0559694 | 3300048911 | Bacteria | 997 |
| 606 | Ga0496108_1216055 | 3300048911 | Bacteria | 636 |
| 607 | Ga0496109_0001699 | 3300048912 | Bacteria | 18354 |
| 608 | Ga0496109_0011547 | 3300048912 | Bacteria | 7597 |
| 609 | Ga0496109_0030354 | 3300048912 | Bacteria | 4845 |
| 610 | Ga0496109_0032959 | 3300048912 | Unclassified | 4660 |
| 611 | Ga0496109_0921953 | 3300048912 | Unclassified | 811 |
| 612 | Ga0496110_0021956 | 3300048913 | Bacteria | 5414 |
| 613 | Ga0496110_0027057 | 3300048913 | Bacteria | 4913 |
| 614 | Ga0496110_0847589 | 3300048913 | Bacteria | 819 |
| 615 | Ga0496111_0003685 | 3300048914 | Bacteria | 9521 |
| 616 | Ga0496111_0078454 | 3300048914 | Bacteria | 2408 |
| 617 | Ga0496111_0086842 | 3300048914 | Bacteria | 2289 |
| 618 | Ga0496111_0615840 | 3300048914 | Bacteria | 794 |
| 619 | Ga0496111_0822557 | 3300048914 | Bacteria | 671 |
| 620 | Ga0496112_0066805 | 3300048915 | Bacteria | 3548 |
| 621 | Ga0496112_0081398 | 3300048915 | Bacteria | 3202 |
| 622 | Ga0496112_0087606 | 3300048915 | Bacteria | 3080 |
| 623 | Ga0496112_0602444 | 3300048915 | Bacteria | 1030 |
| 624 | Ga0496113_0010528 | 3300048916 | Bacteria | 6117 |
| 625 | Ga0496113_0030216 | 3300048916 | Bacteria | 3920 |
| 626 | Ga0496113_0045681 | 3300048916 | Bacteria | 3249 |
| 627 | Ga0496113_0246915 | 3300048916 | Bacteria | 1424 |
| 628 | Ga0496113_0842536 | 3300048916 | Unclassified | 727 |
| 629 | Ga0496114_0330092 | 3300048917 | Bacteria | 1348 |
| 630 | Ga0496114_0396281 | 3300048917 | Unclassified | 1223 |
| 631 | Ga0496115_0442144 | 3300048918 | Bacteria | 1051 |
| 632 | Ga0501290_027126 | 3300049513 | Bacteria | 807 |
| 633 | Ga0501292_070223 | 3300049515 | Unclassified | 650 |
| 634 | Ga0501297_065443 | 3300049520 | Unclassified | 564 |
| 635 | Ga0501298_029466 | 3300049521 | Bacteria | 1070 |
| 636 | Ga0501299_172098 | 3300049522 | Bacteria | 560 |
| 637 | Ga0501031_0087493 | 3300049568 | Bacteria | 2032 |
| 638 | Ga0501031_0131795 | 3300049568 | Unclassified | 1633 |
| 639 | Ga0501031_0410096 | 3300049568 | Archaea | 876 |
| 640 | Ga0501032_0194005 | 3300049569 | Bacteria | 1327 |
| 641 | Ga0501033_0540507 | 3300049570 | Bacteria | 803 |
| 642 | Ga0501034_0101964 | 3300049571 | Bacteria | 2863 |
| 643 | Ga0501034_0172042 | 3300049571 | Bacteria | 2133 |
| 644 | Ga0501036_0423816 | 3300049572 | Bacteria | 1109 |
| 645 | Ga0501036_0919226 | 3300049572 | Unclassified | 718 |
| 646 | Ga0501036_0981122 | 3300049572 | Bacteria | 692 |
| 647 | Ga0501037_0030237 | 3300049573 | Bacteria | 4003 |
| 648 | Ga0501038_0135552 | 3300049574 | Bacteria | 2018 |
| 649 | Ga0501038_0561756 | 3300049574 | Bacteria | 867 |
| 650 | Ga0501039_0046067 | 3300049575 | Bacteria | 3369 |
| 651 | Ga0501039_0637157 | 3300049575 | Bacteria | 835 |
| 652 | Ga0501039_0793018 | 3300049575 | Bacteria | 739 |
| 653 | Ga0501040_0023073 | 3300049576 | Bacteria | 4170 |
| 654 | Ga0501040_0043305 | 3300049576 | Bacteria | 3068 |
| 655 | Ga0501040_0061646 | 3300049576 | Bacteria | 2580 |
| 656 | Ga0501040_0338120 | 3300049576 | Bacteria | 1078 |
| 657 | Ga0501040_0905389 | 3300049576 | Archaea | 639 |
| 658 | Ga0501041_0038407 | 3300049577 | Bacteria | 2903 |
| 659 | Ga0501041_0079609 | 3300049577 | Bacteria | 2017 |
| 660 | Ga0501041_0392250 | 3300049577 | Bacteria | 879 |
| 661 | Ga0501042_0031112 | 3300049578 | Bacteria | 3776 |
| 662 | Ga0501042_0042201 | 3300049578 | Bacteria | 3246 |
| 663 | Ga0501042_0620141 | 3300049578 | Bacteria | 786 |
| 664 | Ga0501043_0368012 | 3300049579 | Bacteria | 1090 |
| 665 | Ga0501046_0118337 | 3300049580 | Bacteria | 2018 |
| 666 | Ga0501046_0947232 | 3300049580 | Unclassified | 599 |
| 667 | Ga0501047_0046515 | 3300049581 | Bacteria | 4194 |
| 668 | Ga0501048_0067143 | 3300049582 | Bacteria | 2536 |
| 669 | Ga0501048_0361137 | 3300049582 | Bacteria | 1036 |
| 670 | Ga0501048_1021753 | 3300049582 | Bacteria | 595 |
| 671 | Ga0501067_0030721 | 3300049583 | Bacteria | 2979 |
| 672 | Ga0501067_0105732 | 3300049583 | Bacteria | 1564 |
| 673 | Ga0501067_0139465 | 3300049583 | Bacteria | 1350 |
| 674 | Ga0501068_0005640 | 3300049584 | Bacteria | 6857 |
| 675 | Ga0501068_0045015 | 3300049584 | Bacteria | 2658 |
| 676 | Ga0501068_0065436 | 3300049584 | Bacteria | 2213 |
| 677 | Ga0501068_0091535 | 3300049584 | Bacteria | 1877 |
| 678 | Ga0501069_0001844 | 3300049585 | Bacteria | 10573 |
| 679 | Ga0501069_0006355 | 3300049585 | Bacteria | 6174 |
| 680 | Ga0501069_0036713 | 3300049585 | Bacteria | 2703 |
| 681 | Ga0501069_0445642 | 3300049585 | Unclassified | 769 |
| 682 | Ga0501069_0535024 | 3300049585 | Unclassified | 700 |
| 683 | Ga0501069_0680396 | 3300049585 | Unclassified | 620 |
| 684 | Ga0501070_0007476 | 3300049586 | Bacteria | 9281 |
| 685 | Ga0501070_0016540 | 3300049586 | Bacteria | 6194 |
| 686 | Ga0501070_0087997 | 3300049586 | Bacteria | 2571 |
| 687 | Ga0501070_0140826 | 3300049586 | Bacteria | 1991 |
| 688 | Ga0501070_0346411 | 3300049586 | Bacteria | 1206 |
| 689 | Ga0501070_0608001 | 3300049586 | Bacteria | 871 |
| 690 | Ga0501070_0792902 | 3300049586 | Bacteria | 744 |
| 691 | Ga0501070_1174031 | 3300049586 | Unclassified | 590 |
| 692 | Ga0501071_0005277 | 3300049587 | Bacteria | 8287 |
| 693 | Ga0501071_0028913 | 3300049587 | Bacteria | 3908 |
| 694 | Ga0501071_0130483 | 3300049587 | Bacteria | 1866 |
| 695 | Ga0501071_0719164 | 3300049587 | Unclassified | 769 |
| 696 | Ga0501072_0007071 | 3300049588 | Bacteria | 8520 |
| 697 | Ga0501072_0096087 | 3300049588 | Bacteria | 2355 |
| 698 | Ga0501072_0277052 | 3300049588 | Bacteria | 1334 |
| 699 | Ga0501072_0477643 | 3300049588 | Bacteria | 986 |
| 700 | Ga0501072_0507692 | 3300049588 | Bacteria | 954 |
| 701 | Ga0501072_0583712 | 3300049588 | Bacteria | 881 |
| 702 | Ga0501073_0055549 | 3300049589 | Bacteria | 2770 |
| 703 | Ga0501073_0071481 | 3300049589 | Bacteria | 2417 |
| 704 | Ga0501073_0310885 | 3300049589 | Bacteria | 1087 |
| 705 | Ga0501074_0002538 | 3300049590 | Bacteria | 12734 |
| 706 | Ga0501074_0018756 | 3300049590 | Bacteria | 5026 |
| 707 | Ga0501074_0153605 | 3300049590 | Bacteria | 1645 |
| 708 | Ga0501074_0340077 | 3300049590 | Bacteria | 1065 |
| 709 | Ga0501074_0387491 | 3300049590 | Bacteria | 991 |
| 710 | Ga0501075_0056527 | 3300049591 | Bacteria | 2954 |
| 711 | Ga0501075_0070000 | 3300049591 | Bacteria | 2652 |
| 712 | Ga0501075_0168108 | 3300049591 | Bacteria | 1673 |
| 713 | Ga0501075_0389631 | 3300049591 | Bacteria | 1062 |
| 714 | Ga0501075_0503638 | 3300049591 | Unclassified | 924 |
| 715 | Ga0501075_1158115 | 3300049591 | Bacteria | 587 |
| 716 | Ga0501076_0043680 | 3300049592 | Bacteria | 3532 |
| 717 | Ga0501076_0099303 | 3300049592 | Bacteria | 2345 |
| 718 | Ga0501076_0143737 | 3300049592 | Bacteria | 1939 |
| 719 | Ga0501076_0385978 | 3300049592 | Unclassified | 1151 |
| 720 | Ga0501076_0403998 | 3300049592 | Bacteria | 1123 |
| 721 | Ga0501076_1173533 | 3300049592 | Unclassified | 632 |
| 722 | Ga0501076_1591123 | 3300049592 | Unclassified | 536 |
| 723 | Ga0501077_0000524 | 3300049593 | Bacteria | 23229 |
| 724 | Ga0501077_0032949 | 3300049593 | Bacteria | 3299 |
| 725 | Ga0501077_0546261 | 3300049593 | Bacteria | 743 |
| 726 | Ga0501077_0883786 | 3300049593 | Bacteria | 575 |
| 727 | Ga0501198_032815 | 3300049649 | Unclassified | 873 |
| 728 | Ga0501202_111281 | 3300049652 | Unclassified | 678 |
| 729 | Ga0501209_068089 | 3300049656 | Bacteria | 1008 |
| 730 | Ga0501209_195525 | 3300049656 | Unclassified | 621 |
| 731 | Ga0501248_003799 | 3300049678 | Bacteria | 1109 |
| 732 | Ga0501249_019971 | 3300049679 | Unclassified | 1456 |
| 733 | Ga0501249_128937 | 3300049679 | Unclassified | 622 |
| 734 | Ga0501253_073629 | 3300049683 | Unclassified | 759 |
| 735 | Ga0501256_019907 | 3300049685 | Unclassified | 698 |
| 736 | Ga0501257_063951 | 3300049686 | Bacteria | 932 |
| 737 | Ga0501258_027047 | 3300049687 | Unclassified | 706 |
| 738 | Ga0501221_094280 | 3300049704 | Unclassified | 735 |
| 739 | Ga0501221_136169 | 3300049704 | Bacteria | 640 |
| 740 | Ga0501225_0125738 | 3300049705 | Bacteria | 765 |
| 741 | Ga0501225_0151119 | 3300049705 | Unclassified | 708 |
| 742 | Ga0501245_028909 | 3300049708 | Unclassified | 907 |
| 743 | Ga0501079_0005768 | 3300049741 | Bacteria | 9258 |
| 744 | Ga0501079_0043214 | 3300049741 | Bacteria | 3478 |
| 745 | Ga0501079_0373597 | 3300049741 | Bacteria | 1118 |
| 746 | Ga0501079_1191522 | 3300049741 | Unclassified | 600 |
| 747 | Ga0501080_0035917 | 3300049742 | Bacteria | 4626 |
| 748 | Ga0501080_0129067 | 3300049742 | Bacteria | 2340 |
| 749 | Ga0501080_0174428 | 3300049742 | Bacteria | 1981 |
| 750 | Ga0501080_0444521 | 3300049742 | Bacteria | 1163 |
| 751 | Ga0501080_1456988 | 3300049742 | Bacteria | 583 |
| 752 | Ga0501081_0004622 | 3300049743 | Bacteria | 8840 |
| 753 | Ga0501081_0011130 | 3300049743 | Bacteria | 5883 |
| 754 | Ga0501081_0260012 | 3300049743 | Bacteria | 1268 |
| 755 | Ga0501081_0278434 | 3300049743 | Bacteria | 1224 |
| 756 | Ga0501081_0382939 | 3300049743 | Unclassified | 1040 |
| 757 | Ga0501081_0546025 | 3300049743 | Bacteria | 866 |
| 758 | Ga0501081_0632401 | 3300049743 | Bacteria | 802 |
| 759 | Ga0501081_1130548 | 3300049743 | Bacteria | 593 |
| 760 | Ga0501083_0004073 | 3300049744 | Bacteria | 10282 |
| 761 | Ga0501083_0060306 | 3300049744 | Bacteria | 2534 |
| 762 | Ga0501083_0471470 | 3300049744 | Bacteria | 817 |
| 763 | Ga0501083_0698392 | 3300049744 | Bacteria | 660 |
| 764 | Ga0501083_0923986 | 3300049744 | Unclassified | 568 |
| 765 | Ga0501263_009568 | 3300049760 | Unclassified | 1176 |
| 766 | Ga0501263_034553 | 3300049760 | Bacteria | 725 |
| 767 | Ga0501265_046920 | 3300049762 | Bacteria | 669 |
| 768 | Ga0501268_023205 | 3300049765 | Bacteria | 1076 |
| 769 | Ga0501270_016726 | 3300049767 | Bacteria | 1064 |
| 770 | Ga0501271_006745 | 3300049768 | Bacteria | 1146 |
| 771 | Ga0501273_040468 | 3300049770 | Bacteria | 688 |
| 772 | Ga0501273_094477 | 3300049770 | Unclassified | 512 |
| 773 | Ga0501274_033325 | 3300049771 | Unclassified | 591 |
| 774 | Ga0501045_0027982 | 3300049824 | Bacteria | 4066 |
| 775 | Ga0501045_0130840 | 3300049824 | Bacteria | 1865 |
| 776 | Ga0501045_0728345 | 3300049824 | Archaea | 731 |
| 777 | Ga0501212_093295 | 3300049851 | Unclassified | 558 |
| 778 | Ga0501226_013093 | 3300049853 | Bacteria | 917 |
| 779 | nmdc:mga05p37_1187_c1 | 3300050507 | Bacteria | 30065 |
| 780 | nmdc:mga05p37_13069_c1 | 3300050507 | Bacteria | 9935 |
| 781 | nmdc:mga05p37_1748424_c1 | 3300050507 | Bacteria | 603 |
| 782 | nmdc:mga05p37_230979_c1 | 3300050507 | Bacteria | 2229 |
| 783 | nmdc:mga05p37_599746_c1 | 3300050507 | Bacteria | 1243 |
| 784 | nmdc:mga05p37_88826_c1 | 3300050507 | Unclassified | 3809 |
| 785 | nmdc:mga05p37_898065_c1 | 3300050507 | Unclassified | 956 |
| 786 | nmdc:mga09592_1281671_c1 | 3300050508 | Unclassified | 603 |
| 787 | nmdc:mga09592_1491985_c1 | 3300050508 | Bacteria | 550 |
| 788 | nmdc:mga09592_4808_c1 | 3300050508 | Bacteria | 10944 |
| 789 | nmdc:mga09592_796857_c1 | 3300050508 | Bacteria | 799 |
| 790 | nmdc:mga0qj67_142793_c1 | 3300050509 | Unclassified | 1941 |
| 791 | nmdc:mga06r32_144016_c1 | 3300050510 | Bacteria | 2360 |
| 792 | nmdc:mga06r32_159161_c1 | 3300050510 | Unclassified | 2240 |
| 793 | nmdc:mga06r32_410718_c1 | 3300050510 | Bacteria | 1335 |
| 794 | nmdc:mga06r32_974694_c1 | 3300050510 | Archaea | 801 |
| 795 | nmdc:mga08y16_663180_c1 | 3300050511 | Unclassified | 1046 |
| 796 | nmdc:mga0n895_16838_c1 | 3300050512 | Bacteria | 6719 |
| 797 | nmdc:mga0n895_302955_c1 | 3300050512 | Bacteria | 1620 |
| 798 | nmdc:mga0n895_48146_c1 | 3300050512 | Bacteria | 4171 |
| 799 | nmdc:mga0n895_77176_c1 | 3300050512 | Bacteria | 3313 |
| 800 | nmdc:mga0n895_937925_c1 | 3300050512 | Bacteria | 849 |
| 801 | nmdc:mga0rr50_1782741_c1 | 3300050513 | Unclassified | 518 |
| 802 | nmdc:mga0rr50_381395_c1 | 3300050513 | Bacteria | 1189 |
| 803 | nmdc:mga0rr50_542930_c1 | 3300050513 | Bacteria | 990 |
| 804 | nmdc:mga08x19_104515_c1 | 3300050514 | Unclassified | 1882 |
| 805 | nmdc:mga0a205_33902_c1 | 3300050515 | Bacteria | 4097 |
| 806 | nmdc:mga0a205_350782_c1 | 3300050515 | Unclassified | 1343 |
| 807 | nmdc:mga0a205_845337_c1 | 3300050515 | Unclassified | 762 |
| 808 | nmdc:mga0a205_89447_c1 | 3300050515 | Bacteria | 2976 |
| 809 | Ga0501084_0013422 | 3300054114 | Bacteria | 6779 |
| 810 | Ga0501084_0015548 | 3300054114 | Bacteria | 6312 |
| 811 | Ga0501084_0055493 | 3300054114 | Bacteria | 3314 |
| 812 | Ga0501084_0185666 | 3300054114 | Bacteria | 1755 |
| 813 | Ga0501084_0339544 | 3300054114 | Bacteria | 1269 |
| 814 | Ga0501084_0424966 | 3300054114 | Bacteria | 1123 |
| 815 | Ga0590071_006015 | 3300059421 | Bacteria | 2901 |
| 816 | Ga0590071_079440 | 3300059421 | Bacteria | 814 |
| 817 | Ga0590075_008433 | 3300059424 | Bacteria | 2462 |
| 818 | Ga0590075_028013 | 3300059424 | Unclassified | 1422 |
| 819 | Ga0501082_0009687 | 3300060353 | Bacteria | 8296 |
| 820 | Ga0501082_0016393 | 3300060353 | Bacteria | 6379 |
| 821 | Ga0501082_0154619 | 3300060353 | Bacteria | 1993 |
| 822 | Ga0501082_0562469 | 3300060353 | Bacteria | 997 |
| 823 | Ga0530510_0035315 | 3300061734 | Bacteria | 3603 |
| 824 | Ga0530510_0353930 | 3300061734 | Bacteria | 1103 |
| 825 | Ga0530510_0512416 | 3300061734 | Bacteria | 910 |
| 826 | Ga0530510_0710009 | 3300061734 | Bacteria | 766 |
| 827 | Ga0530510_1014803 | 3300061734 | Bacteria | 635 |
| 828 | Ga0466965_0581761 | |||
| 829 | Ga0065715_10106221 | |||
| 830 | Ga0065715_10119747 | |||
| 831 | Ga0065715_10453137 | |||
| 832 | Ga0065715_10974148 | |||
| 833 | Ga0065707_10231002 | |||
| 834 | Ga0070676_10009939 | |||
| 835 | Ga0070683_100035503 | |||
| 836 | Ga0070683_100488617 | |||
| 837 | Ga0070683_100925485 | |||
| 838 | Ga0070677_10551761 | |||
| 839 | Ga0070677_10595979 | |||
| 840 | Ga0068869_100533126 | |||
| 841 | Ga0070666_10435635 | |||
| 842 | Ga0070680_100007400 | |||
| 843 | Ga0070680_100009987 | |||
| 844 | Ga0070680_100495358 | |||
| 845 | Ga0070680_101254901 | |||
| 846 | Ga0070682_100196220 | |||
| 847 | Ga0070682_100546055 | |||
| 848 | Ga0070682_100941282 | |||
| 849 | Ga0068868_100461565 | |||
| 850 | Ga0070660_100080309 | |||
| 851 | Ga0070660_100239194 | |||
| 852 | Ga0070691_10088108 | |||
| 853 | Ga0070691_10163147 | |||
| 854 | Ga0070691_10972105 | |||
| 855 | Ga0070687_100861585 | |||
| 856 | Ga0070661_100168733 | |||
| 857 | Ga0070661_101748537 | |||
| 858 | Ga0070692_10299290 | |||
| 859 | Ga0070692_10392555 | |||
| 860 | Ga0070692_10903168 | |||
| 861 | Ga0070668_100366127 | |||
| 862 | Ga0070668_101912112 | |||
| 863 | Ga0070669_100048012 | |||
| 864 | Ga0070675_100732364 | |||
| 865 | Ga0070675_101415987 | |||
| 866 | Ga0070675_101730709 | |||
| 867 | Ga0070671_100322448 | |||
| 868 | Ga0070674_100221940 | |||
| 869 | Ga0070674_101411157 | |||
| 870 | Ga0070674_101642640 | |||
| 871 | Ga0070673_100144744 | |||
| 872 | Ga0070688_100211059 | |||
| 873 | Ga0070659_100191639 | |||
| 874 | Ga0070659_100274161 | |||
| 875 | Ga0070659_100410255 | |||
| 876 | Ga0070667_100171270 | |||
| 877 | Ga0070703_10068688 | |||
| 878 | Ga0070709_10251696 | |||
| 879 | Ga0070714_101392430 | |||
| 880 | Ga0070713_101263620 | |||
| 881 | Ga0070711_100002799 | |||
| 882 | Ga0070711_100766837 | |||
| 883 | Ga0070705_100083594 | |||
| 884 | Ga0070705_100105925 | |||
| 885 | Ga0070705_100129032 | |||
| 886 | Ga0070705_100199740 | |||
| 887 | Ga0070705_100396641 | |||
| 888 | Ga0070705_100915607 | |||
| 889 | Ga0070705_101257970 | |||
| 890 | Ga0070700_100115134 | |||
| 891 | Ga0070700_100391238 | |||
| 892 | Ga0070694_100164490 | |||
| 893 | Ga0070694_100247848 | |||
| 894 | Ga0070694_100325370 | |||
| 895 | Ga0070708_100025224 | |||
| 896 | Ga0070708_100118032 | |||
| 897 | Ga0070708_100190878 | |||
| 898 | Ga0070708_100563512 | |||
| 899 | Ga0070708_100597822 | |||
| 900 | Ga0070708_100654063 | |||
| 901 | Ga0070708_100757494 | |||
| 902 | Ga0070708_100890771 | |||
| 903 | Ga0070663_100140083 | |||
| 904 | Ga0070663_101655121 | |||
| 905 | Ga0070678_100038030 | |||
| 906 | Ga0070662_100057690 | |||
| 907 | Ga0070662_100901947 | |||
| 908 | Ga0070662_100952042 | |||
| 909 | Ga0070681_10076015 | |||
| 910 | Ga0070681_10167675 | |||
| 911 | Ga0070681_10528825 | |||
| 912 | Ga0070681_10793326 | |||
| 913 | Ga0068867_100008098 | |||
| 914 | Ga0068867_100038907 | |||
| 915 | Ga0070706_100004466 | |||
| 916 | Ga0070706_100289330 | |||
| 917 | Ga0070706_100398749 | |||
| 918 | Ga0070706_100968835 | |||
| 919 | Ga0070707_100004738 | |||
| 920 | Ga0070707_100175091 | |||
| 921 | Ga0070707_101041672 | |||
| 922 | Ga0070707_101754353 | |||
| 923 | Ga0070707_102218107 | |||
| 924 | Ga0070698_100014842 | |||
| 925 | Ga0070698_100191377 | |||
| 926 | Ga0070698_100264815 | |||
| 927 | Ga0070698_101973365 | |||
| 928 | Ga0070699_100000131 | |||
| 929 | Ga0070699_100003191 | |||
| 930 | Ga0070699_100004511 | |||
| 931 | Ga0070699_100008937 | |||
| 932 | Ga0070699_100128518 | |||
| 933 | Ga0070699_100153892 | |||
| 934 | Ga0070699_100266612 | |||
| 935 | Ga0070699_100608198 | |||
| 936 | Ga0070679_100237887 | |||
| 937 | Ga0070679_100292417 | |||
| 938 | Ga0070679_100753558 | |||
| 939 | Ga0070684_100558228 | |||
| 940 | Ga0070684_100589895 | |||
| 941 | Ga0070697_100004653 | |||
| 942 | Ga0070697_100075760 | |||
| 943 | Ga0070697_100081128 | |||
| 944 | Ga0070697_100778954 | |||
| 945 | Ga0068853_100133861 | |||
| 946 | Ga0068853_100666522 | |||
| 947 | Ga0070672_100624782 | |||
| 948 | Ga0070686_101049323 | |||
| 949 | Ga0070695_100031774 | |||
| 950 | Ga0070695_100522560 | |||
| 951 | Ga0070695_100630825 | |||
| 952 | Ga0070696_100000526 | |||
| 953 | Ga0070696_100060512 | |||
| 954 | Ga0070696_100153863 | |||
| 955 | Ga0070696_100174429 | |||
| 956 | Ga0070696_100179735 | |||
| 957 | Ga0070696_100221443 | |||
| 958 | Ga0070696_100490698 | |||
| 959 | Ga0070696_101027920 | |||
| 960 | Ga0070693_100216251 | |||
| 961 | Ga0070693_100814445 | |||
| 962 | Ga0070665_101221690 | |||
| 963 | Ga0070704_100035572 | |||
| 964 | Ga0070704_100156171 | |||
| 965 | Ga0070704_100340756 | |||
| 966 | Ga0070704_101921195 | |||
| 967 | Ga0070664_100031929 | |||
| 968 | Ga0070664_100113170 | |||
| 969 | Ga0070664_100409554 | |||
| 970 | Ga0070664_101958322 | |||
| 971 | Ga0068857_100003989 | |||
| 972 | Ga0068854_100005676 | |||
| 973 | Ga0068854_100795889 | |||
| 974 | Ga0068856_101827960 | |||
| 975 | Ga0070702_100049156 | |||
| 976 | Ga0070702_100499905 | |||
| 977 | Ga0070702_101045272 | |||
| 978 | Ga0068852_100666561 | |||
| 979 | Ga0068859_100098835 | |||
| 980 | Ga0068864_100005813 | |||
| 981 | Ga0068864_100008732 | |||
| 982 | Ga0068864_100293696 | |||
| 983 | Ga0068866_10012010 | |||
| 984 | Ga0068866_10391271 | |||
| 985 | Ga0068861_100171105 | |||
| 986 | Ga0068861_101829658 | |||
| 987 | Ga0068870_10153393 | |||
| 988 | Ga0068863_100011471 | |||
| 989 | Ga0068863_102469400 | |||
| 990 | Ga0068858_100100427 | |||
| 991 | Ga0068858_100107831 | |||
| 992 | Ga0068858_100174352 | |||
| 993 | Ga0068858_101431698 | |||
| 994 | Ga0068860_100047764 | |||
| 995 | Ga0068860_100898876 | |||
| 996 | Ga0068860_102781077 | |||
| 997 | Ga0068862_100024031 | |||
| 998 | Ga0068862_101248718 | |||
| 999 | Ga0081455_10110720 | |||
| 1000 | Ga0081538_10066647 | |||
| 1001 | Ga0081538_10383080 | |||
| 1002 | Ga0081539_10113658 | |||
| 1003 | Ga0070715_10261105 | |||
| 1004 | Ga0070716_101209979 | |||
| 1005 | Ga0070712_100171890 | |||
| 1006 | Ga0070712_100366293 | |||
| 1007 | Ga0097621_101493218 | |||
| 1008 | Ga0068871_100372903 | |||
| 1009 | Ga0075428_100036820 | |||
| 1010 | Ga0075428_100102374 | |||
| 1011 | Ga0075428_100347329 | |||
| 1012 | Ga0075428_101460913 | |||
| 1013 | Ga0075428_102528121 | |||
| 1014 | Ga0075430_100154604 | |||
| 1015 | Ga0075430_101111701 | |||
| 1016 | Ga0075431_100015302 | |||
| 1017 | Ga0075431_100118877 | |||
| 1018 | Ga0075431_100141624 | |||
| 1019 | Ga0075431_100966593 | |||
| 1020 | Ga0075433_10042982 | |||
| 1021 | Ga0075433_10079795 | |||
| 1022 | Ga0075433_10419686 | |||
| 1023 | Ga0075433_11278486 | |||
| 1024 | Ga0075434_100032494 | |||
| 1025 | Ga0075434_100070739 | |||
| 1026 | Ga0075434_100415659 | |||
| 1027 | Ga0075434_100612819 | |||
| 1028 | Ga0075434_100763007 | |||
| 1029 | Ga0075429_100005664 | |||
| 1030 | Ga0075429_100117673 | |||
| 1031 | Ga0075429_100543181 | |||
| 1032 | Ga0075429_100647292 | |||
| 1033 | Ga0068865_100023280 | |||
| 1034 | Ga0068865_100054376 | |||
| 1035 | Ga0075436_100031537 | |||
| 1036 | Ga0075436_100421974 | |||
| 1037 | Ga0075436_100512874 | |||
| 1038 | Ga0097620_100098837 | |||
| 1039 | Ga0075435_100116035 | |||
| 1040 | Ga0075435_100192631 | |||
| 1041 | Ga0075435_100259193 | |||
| 1042 | Ga0075435_100377464 | |||
| 1043 | Ga0075435_100400362 | |||
| 1044 | Ga0075435_100629376 | |||
| 1045 | Ga0105240_10080722 | |||
| 1046 | Ga0111539_10064564 | |||
| 1047 | Ga0111539_10291319 | |||
| 1048 | Ga0111539_10346686 | |||
| 1049 | Ga0105245_10848762 | |||
| 1050 | Ga0105245_12346769 | |||
| 1051 | Ga0105247_10288638 | |||
| 1052 | Ga0105247_10311124 | |||
| 1053 | Ga0114129_10005002 | |||
| 1054 | Ga0114129_10025521 | |||
| 1055 | Ga0114129_10046313 | |||
| 1056 | Ga0114129_10133652 | |||
| 1057 | Ga0114129_10135190 | |||
| 1058 | Ga0114129_10439801 | |||
| 1059 | Ga0114129_10576885 | |||
| 1060 | Ga0114129_10582248 | |||
| 1061 | Ga0114129_11401477 | |||
| 1062 | Ga0114129_12169510 | |||
| 1063 | Ga0105243_10007267 | |||
| 1064 | Ga0105241_10017856 | |||
| 1065 | Ga0105241_10727394 | |||
| 1066 | Ga0105241_10860471 | |||
| 1067 | Ga0105242_10269372 | |||
| 1068 | Ga0105242_10374358 | |||
| 1069 | Ga0105242_11503597 | |||
| 1070 | Ga0105242_11524594 | |||
| 1071 | Ga0105248_10164703 | |||
| 1072 | Ga0105248_10614421 | |||
| 1073 | Ga0105248_10707800 | |||
| 1074 | Ga0105237_10072012 | |||
| 1075 | Ga0105249_10022117 | |||
| 1076 | Ga0105249_10104613 | |||
| 1077 | Ga0105249_10480911 | |||
| 1078 | Ga0105249_10799685 | |||
| 1079 | Ga0105249_11454938 | |||
| 1080 | Ga0105239_10007902 | |||
| 1081 | Ga0105246_10040986 | |||
| 1082 | Ga0105246_10410468 | |||
| 1083 | Ga0105246_10569860 | |||
| 1084 | Ga0157373_10894666 | |||
| 1085 | Ga0157378_10003362 | |||
| 1086 | Ga0163162_10037565 | |||
| 1087 | Ga0163162_10047295 | |||
| 1088 | Ga0163162_10313960 | |||
| 1089 | Ga0163162_11270566 | |||
| 1090 | Ga0157372_10103508 | |||
| 1091 | Ga0157372_11178341 | |||
| 1092 | Ga0157375_12628733 | |||
| 1093 | Ga0163163_10080871 | |||
| 1094 | Ga0163163_10156630 | |||
| 1095 | Ga0163163_11453926 | |||
| 1096 | Ga0163163_12950435 | |||
| 1097 | Ga0157380_10796010 | |||
| 1098 | Ga0157380_10905774 | |||
| 1099 | Ga0182008_10197663 | |||
| 1100 | Ga0157377_10376974 | |||
| 1101 | Ga0157379_10221242 | |||
| 1102 | Ga0157379_10820198 | |||
| 1103 | Ga0157379_12437771 | |||
| 1104 | Ga0157376_10211694 | |||
| 1105 | Ga0163161_10070245 | |||
| 1106 | Ga0163161_10234741 | |||
| 1107 | Ga0207653_10159320 | |||
| 1108 | Ga0207642_10005341 | |||
| 1109 | Ga0207688_10437702 | |||
| 1110 | Ga0207688_10963815 | |||
| 1111 | Ga0207680_10130869 | |||
| 1112 | Ga0207647_10659464 | |||
| 1113 | Ga0207647_10722797 | |||
| 1114 | Ga0207685_10090616 | |||
| 1115 | Ga0207685_10161267 | |||
| 1116 | Ga0207699_11085800 | |||
| 1117 | Ga0207645_10001959 | |||
| 1118 | Ga0207643_10004403 | |||
| 1119 | Ga0207643_10223662 | |||
| 1120 | Ga0207684_10011945 | |||
| 1121 | Ga0207684_10122174 | |||
| 1122 | Ga0207684_10147766 | |||
| 1123 | Ga0207684_10941313 | |||
| 1124 | Ga0207654_10003690 | |||
| 1125 | Ga0207654_10644681 | |||
| 1126 | Ga0207707_10010026 | |||
| 1127 | Ga0207707_10141884 | |||
| 1128 | Ga0207707_10467934 | |||
| 1129 | Ga0207707_11131312 | |||
| 1130 | Ga0207695_10817787 | |||
| 1131 | Ga0207671_10387449 | |||
| 1132 | Ga0207693_10305122 | |||
| 1133 | Ga0207693_10386118 | |||
| 1134 | Ga0207663_10004700 | |||
| 1135 | Ga0207663_10597103 | |||
| 1136 | Ga0207663_10911876 | |||
| 1137 | Ga0207660_10068416 | |||
| 1138 | Ga0207660_10567558 | |||
| 1139 | Ga0207660_10868757 | |||
| 1140 | Ga0207662_11120925 | |||
| 1141 | Ga0207662_11170190 | |||
| 1142 | Ga0207657_10261483 | |||
| 1143 | Ga0207649_10127379 | |||
| 1144 | Ga0207652_10010159 | |||
| 1145 | Ga0207652_10195330 | |||
| 1146 | Ga0207646_10013251 | |||
| 1147 | Ga0207646_10047450 | |||
| 1148 | Ga0207646_10376125 | |||
| 1149 | Ga0207646_11609210 | |||
| 1150 | Ga0207694_10493768 | |||
| 1151 | Ga0207687_10394012 | |||
| 1152 | Ga0207700_10916415 | |||
| 1153 | Ga0207664_11454704 | |||
| 1154 | Ga0207664_11529734 | |||
| 1155 | Ga0207690_10258717 | |||
| 1156 | Ga0207690_10284395 | |||
| 1157 | Ga0207706_10008792 | |||
| 1158 | Ga0207706_10755524 | |||
| 1159 | Ga0207686_10002785 | |||
| 1160 | Ga0207709_10030296 | |||
| 1161 | Ga0207669_10183202 | |||
| 1162 | Ga0207669_10903348 | |||
| 1163 | Ga0207704_10013556 | |||
| 1164 | Ga0207665_10826435 | |||
| 1165 | Ga0207665_10973666 | |||
| 1166 | Ga0207665_11076967 | |||
| 1167 | Ga0207691_10126022 | |||
| 1168 | Ga0207691_11713221 | |||
| 1169 | Ga0207711_10347993 | |||
| 1170 | Ga0207711_10418670 | |||
| 1171 | Ga0207689_10044212 | |||
| 1172 | Ga0207689_10443838 | |||
| 1173 | Ga0207661_10042428 | |||
| 1174 | Ga0207661_10505291 | |||
| 1175 | Ga0207661_11086130 | |||
| 1176 | Ga0207679_10036953 | |||
| 1177 | Ga0207679_10250052 | |||
| 1178 | Ga0207679_10266378 | |||
| 1179 | Ga0207667_10137895 | |||
| 1180 | Ga0207667_12076956 | |||
| 1181 | Ga0207651_10688250 | |||
| 1182 | Ga0207712_10013453 | |||
| 1183 | Ga0207712_10084776 | |||
| 1184 | Ga0207668_10059917 | |||
| 1185 | Ga0207668_10623659 | |||
| 1186 | Ga0207640_10019626 | |||
| 1187 | Ga0207658_10163736 | |||
| 1188 | Ga0207658_10393988 | |||
| 1189 | Ga0207703_10302956 | |||
| 1190 | Ga0207703_10338643 | |||
| 1191 | Ga0207703_12365263 | |||
| 1192 | Ga0207639_10418145 | |||
| 1193 | Ga0207639_10433528 | |||
| 1194 | Ga0207639_10646964 | |||
| 1195 | Ga0207678_10131214 | |||
| 1196 | Ga0207678_10299744 | |||
| 1197 | Ga0207678_10330413 | |||
| 1198 | Ga0207708_10007267 | |||
| 1199 | Ga0207708_10035505 | |||
| 1200 | Ga0207708_10257718 | |||
| 1201 | Ga0207702_10547418 | |||
| 1202 | Ga0207641_10793750 | |||
| 1203 | Ga0207648_10002060 | |||
| 1204 | Ga0207648_10432571 | |||
| 1205 | Ga0207676_10002069 | |||
| 1206 | Ga0207676_10009280 | |||
| 1207 | Ga0207676_10074337 | |||
| 1208 | Ga0207674_10017092 | |||
| 1209 | Ga0207674_10096916 | |||
| 1210 | Ga0207675_100176646 | |||
| 1211 | Ga0207675_100205122 | |||
| 1212 | Ga0207675_100287274 | |||
| 1213 | Ga0207683_10058273 | |||
| 1214 | Ga0207683_10707172 | |||
| 1215 | Ga0207698_10119060 | |||
| 1216 | Ga0207698_10635810 | |||
| 1217 | Ga0209999_1063585 | |||
| 1218 | Ga0209982_1070084 | |||
| 1219 | Ga0209966_1043284 | |||
| 1220 | Ga0209998_10168098 | |||
| 1221 | Ga0209974_10067559 | |||
| 1222 | Ga0207428_11147654 | |||
| 1223 | Ga0268266_11047356 | |||
| 1224 | Ga0268265_10189117 | |||
| 1225 | Ga0307408_100011030 | |||
| 1226 | Ga0307408_100069104 | |||
| 1227 | Ga0307408_100096458 | |||
| 1228 | Ga0307408_100691583 | |||
| 1229 | Ga0307405_10058570 | |||
| 1230 | Ga0307405_10074483 | |||
| 1231 | Ga0307405_10425188 | |||
| 1232 | Ga0307405_11578679 | |||
| 1233 | Ga0307413_10006927 | |||
| 1234 | Ga0307413_10010645 | |||
| 1235 | Ga0307413_10022298 | |||
| 1236 | Ga0307413_10037584 | |||
| 1237 | Ga0307413_10056800 | |||
| 1238 | Ga0307413_10113182 | |||
| 1239 | Ga0307413_10161437 | |||
| 1240 | Ga0307413_10206381 | |||
| 1241 | Ga0307413_10556480 | |||
| 1242 | Ga0307413_10590527 | |||
| 1243 | Ga0307410_10002633 | |||
| 1244 | Ga0307410_10005177 | |||
| 1245 | Ga0307410_10007383 | |||
| 1246 | Ga0307410_10024757 | |||
| 1247 | Ga0307410_10037922 | |||
| 1248 | Ga0307410_10044398 | |||
| 1249 | Ga0307410_10355012 | |||
| 1250 | Ga0307410_10592788 | |||
| 1251 | Ga0307410_11190781 | |||
| 1252 | Ga0307406_10013425 | |||
| 1253 | Ga0307406_10123863 | |||
| 1254 | Ga0307406_10150470 | |||
| 1255 | Ga0307406_10173641 | |||
| 1256 | Ga0307406_10293606 | |||
| 1257 | Ga0307406_10458334 | |||
| 1258 | Ga0307406_11032253 | |||
| 1259 | Ga0307407_10038931 | |||
| 1260 | Ga0307407_10041451 | |||
| 1261 | Ga0307407_10094962 | |||
| 1262 | Ga0307407_10256784 | |||
| 1263 | Ga0307407_10442801 | |||
| 1264 | Ga0307407_10442844 | |||
| 1265 | Ga0307407_10669770 | |||
| 1266 | Ga0307407_10744591 | |||
| 1267 | Ga0307412_10217905 | |||
| 1268 | Ga0307412_10292562 | |||
| 1269 | Ga0307412_10387103 | |||
| 1270 | Ga0307412_10411135 | |||
| 1271 | Ga0307412_10427103 | |||
| 1272 | Ga0307412_11605034 | |||
| 1273 | Ga0307412_12312785 | |||
| 1274 | Ga0307409_100010966 | |||
| 1275 | Ga0307409_100017349 | |||
| 1276 | Ga0307409_100048008 | |||
| 1277 | Ga0307409_100207157 | |||
| 1278 | Ga0307409_100217146 | |||
| 1279 | Ga0307409_100238474 | |||
| 1280 | Ga0307409_100360935 | |||
| 1281 | Ga0307409_101118310 | |||
| 1282 | Ga0307416_100001764 | |||
| 1283 | Ga0307416_100018370 | |||
| 1284 | Ga0307416_100021841 | |||
| 1285 | Ga0307416_100033140 | |||
| 1286 | Ga0307416_100060168 | |||
| 1287 | Ga0307416_100096272 | |||
| 1288 | Ga0307416_100102675 | |||
| 1289 | Ga0307416_100116164 | |||
| 1290 | Ga0307416_100255897 | |||
| 1291 | Ga0307416_100427333 | |||
| 1292 | Ga0307416_100484333 | |||
| 1293 | Ga0307416_100578157 | |||
| 1294 | Ga0307416_100898718 | |||
| 1295 | Ga0307416_101660192 | |||
| 1296 | Ga0307414_10041216 | |||
| 1297 | Ga0307414_10053221 | |||
| 1298 | Ga0307414_10066020 | |||
| 1299 | Ga0307414_10073089 | |||
| 1300 | Ga0307414_10127773 | |||
| 1301 | Ga0307414_10227790 | |||
| 1302 | Ga0307414_10347875 | |||
| 1303 | Ga0307411_10007633 | |||
| 1304 | Ga0307411_10009538 | |||
| 1305 | Ga0307411_10015803 | |||
| 1306 | Ga0307411_10043216 | |||
| 1307 | Ga0307411_10102680 | |||
| 1308 | Ga0307411_10109302 | |||
| 1309 | Ga0307411_10144125 | |||
| 1310 | Ga0307415_100016741 | |||
| 1311 | Ga0307415_100017132 | |||
| 1312 | Ga0307415_100036306 | |||
| 1313 | Ga0307415_100058472 | |||
| 1314 | Ga0307415_100069066 | |||
| 1315 | Ga0307415_100506473 | |||
| 1316 | Ga0373958_0105106 | |||
| 1317 | Ga0373928_0072478 | |||
| 1318 | Ga0373940_0004243 | |||
| 1319 | Ga0373940_0113430 | |||
| 1320 | Ga0373940_0134924 | |||
| 1321 | Ga0373940_0342105 | |||
| 1322 | Ga0373932_0123041 | |||
| 1323 | Ga0373941_0064966 | |||
| 1324 | Ga0373941_0074712 | |||
| 1325 | Ga0373943_0255564 | |||
| 1326 | Ga0373942_0217133 | |||
| 1327 | Ga0316574_0567230 | |||
| 1328 | Ga0373931_0003655 | |||
| 1329 | Ga0373931_0540243 | |||
| 1330 | Ga0373931_0640655 | |||
| 1331 | Ga0373937_0161755 | |||
| 1332 | Ga0395900_0507152 | |||
| 1333 | Ga0395905_0030032 | |||
| 1334 | Ga0395905_0093574 | |||
| 1335 | Ga0395905_0775498 | |||
| 1336 | Ga0395905_1765051 | |||
| 1337 | Ga0395901_1100319 | |||
| 1338 | Ga0242419_001918 | |||
| 1339 | Ga0242420_017065 | |||
| 1340 | Ga0242420_075742 | |||
| 1341 | Ga0439439_0003943 | |||
| 1342 | Ga0451793_0454245 | |||
| 1343 | Ga0451793_0650265 | |||
| 1344 | Ga0451845_0087672 | |||
| 1345 | Ga0439431_0042126 | |||
| 1346 | Ga0439448_0015975 | |||
| 1347 | Ga0439448_0160346 | |||
| 1348 | Ga0439448_0272688 | |||
| 1349 | Ga0439455_0030225 | |||
| 1350 | Ga0439462_0012907 | |||
| 1351 | Ga0439462_0037973 | |||
| 1352 | Ga0450894_038233 | |||
| 1353 | Ga0450898_012677 | |||
| 1354 | Ga0439434_0118194 | |||
| 1355 | Ga0439444_0050789 | |||
| 1356 | Ga0453683_0018695 | |||
| 1357 | Ga0453683_0189812 | |||
| 1358 | Ga0453683_0203726 | |||
| 1359 | Ga0453684_0226200 | |||
| 1360 | Ga0453684_1844208 | |||
| 1361 | Ga0466960_0595408 | |||
| 1362 | Ga0466960_0617490 | |||
| 1363 | Ga0451576_0350543 | |||
| 1364 | Ga0451576_0424215 | |||
| 1365 | Ga0451576_1234785 | |||
| 1366 | Ga0466967_0417901 | |||
| 1367 | Ga0495603_0065731 | |||
| 1368 | Ga0495603_0639997 | |||
| 1369 | Ga0495629_0093161 | |||
| 1370 | Ga0495641_0039760 | |||
| 1371 | Ga0495580_0092817 | |||
| 1372 | Ga0495580_0563671 | |||
| 1373 | Ga0495582_0050911 | |||
| 1374 | Ga0495664_0029270 | |||
| 1375 | Ga0495585_0234592 | |||
| 1376 | Ga0495594_0005575 | |||
| 1377 | Ga0495594_0037831 | |||
| 1378 | Ga0495618_0097347 | |||
| 1379 | Ga0495628_0078527 | |||
| 1380 | Ga0495628_0466481 | |||
| 1381 | Ga0495630_0002989 | |||
| 1382 | Ga0495666_0005633 | |||
| 1383 | Ga0495652_0725501 | |||
| 1384 | Ga0495665_0079354 | |||
| 1385 | Ga0495640_0090469 | |||
| 1386 | Ga0495586_0036631 | |||
| 1387 | Ga0495622_0227579 | |||
| 1388 | Ga0495633_0408595 | |||
| 1389 | Ga0495667_0062279 | |||
| 1390 | Ga0495656_0709565 | |||
| 1391 | Ga0495634_0011783 | |||
| 1392 | Ga0495635_0123742 | |||
| 1393 | Ga0495647_0011579 | |||
| 1394 | Ga0495658_0001049 | |||
| 1395 | Ga0495613_0015519 | |||
| 1396 | Ga0495624_0057845 | |||
| 1397 | Ga0495600_0056985 | |||
| 1398 | Ga0495636_0029528 | |||
| 1399 | Ga0495674_0021326 | |||
| 1400 | Ga0495680_0005099 | |||
| 1401 | Ga0495614_0064609 | |||
| 1402 | Ga0496100_0070289 | |||
| 1403 | Ga0496100_0558326 | |||
| 1404 | Ga0496101_0041301 | |||
| 1405 | Ga0496101_0081058 | |||
| 1406 | Ga0496102_0012691 | |||
| 1407 | Ga0496102_0036524 | |||
| 1408 | Ga0496102_0040322 | |||
| 1409 | Ga0496102_0110469 | |||
| 1410 | Ga0496102_0466491 | |||
| 1411 | Ga0496102_1008184 | |||
| 1412 | Ga0496103_0004583 | |||
| 1413 | Ga0496104_0005257 | |||
| 1414 | Ga0496104_0065226 | |||
| 1415 | Ga0496104_0104166 | |||
| 1416 | Ga0496104_0668634 | |||
| 1417 | Ga0496104_0996220 | |||
| 1418 | Ga0496105_0433492 | |||
| 1419 | Ga0496105_0922817 | |||
| 1420 | Ga0496106_0029316 | |||
| 1421 | Ga0496106_0103022 | |||
| 1422 | Ga0496106_0104271 | |||
| 1423 | Ga0496106_0309800 | |||
| 1424 | Ga0496107_0262086 | |||
| 1425 | Ga0496107_0266974 | |||
| 1426 | Ga0496107_0431246 | |||
| 1427 | Ga0496107_0701255 | |||
| 1428 | Ga0496108_0001821 | |||
| 1429 | Ga0496108_0008113 | |||
| 1430 | Ga0496108_0017792 | |||
| 1431 | Ga0496108_0038132 | |||
| 1432 | Ga0496108_0559694 | |||
| 1433 | Ga0496108_1216055 | |||
| 1434 | Ga0496109_0001699 | |||
| 1435 | Ga0496109_0011547 | |||
| 1436 | Ga0496109_0030354 | |||
| 1437 | Ga0496109_0032959 | |||
| 1438 | Ga0496109_0921953 | |||
| 1439 | Ga0496110_0021956 | |||
| 1440 | Ga0496110_0027057 | |||
| 1441 | Ga0496110_0847589 | |||
| 1442 | Ga0496111_0003685 | |||
| 1443 | Ga0496111_0078454 | |||
| 1444 | Ga0496111_0086842 | |||
| 1445 | Ga0496111_0615840 | |||
| 1446 | Ga0496111_0822557 | |||
| 1447 | Ga0496112_0066805 | |||
| 1448 | Ga0496112_0081398 | |||
| 1449 | Ga0496112_0087606 | |||
| 1450 | Ga0496112_0602444 | |||
| 1451 | Ga0496113_0010528 | |||
| 1452 | Ga0496113_0030216 | |||
| 1453 | Ga0496113_0045681 | |||
| 1454 | Ga0496113_0246915 | |||
| 1455 | Ga0496113_0842536 | |||
| 1456 | Ga0496114_0330092 | |||
| 1457 | Ga0496114_0396281 | |||
| 1458 | Ga0496115_0442144 | |||
| 1459 | Ga0501290_027126 | |||
| 1460 | Ga0501292_070223 | |||
| 1461 | Ga0501297_065443 | |||
| 1462 | Ga0501298_029466 | |||
| 1463 | Ga0501299_172098 | |||
| 1464 | Ga0501031_0087493 | |||
| 1465 | Ga0501031_0131795 | |||
| 1466 | Ga0501031_0410096 | |||
| 1467 | Ga0501032_0194005 | |||
| 1468 | Ga0501033_0540507 | |||
| 1469 | Ga0501034_0101964 | |||
| 1470 | Ga0501034_0172042 | |||
| 1471 | Ga0501036_0423816 | |||
| 1472 | Ga0501036_0919226 | |||
| 1473 | Ga0501036_0981122 | |||
| 1474 | Ga0501037_0030237 | |||
| 1475 | Ga0501038_0135552 | |||
| 1476 | Ga0501038_0561756 | |||
| 1477 | Ga0501039_0046067 | |||
| 1478 | Ga0501039_0637157 | |||
| 1479 | Ga0501039_0793018 | |||
| 1480 | Ga0501040_0023073 | |||
| 1481 | Ga0501040_0043305 | |||
| 1482 | Ga0501040_0061646 | |||
| 1483 | Ga0501040_0338120 | |||
| 1484 | Ga0501040_0905389 | |||
| 1485 | Ga0501041_0038407 | |||
| 1486 | Ga0501041_0079609 | |||
| 1487 | Ga0501041_0392250 | |||
| 1488 | Ga0501042_0031112 | |||
| 1489 | Ga0501042_0042201 | |||
| 1490 | Ga0501042_0620141 | |||
| 1491 | Ga0501043_0368012 | |||
| 1492 | Ga0501046_0118337 | |||
| 1493 | Ga0501046_0947232 | |||
| 1494 | Ga0501047_0046515 | |||
| 1495 | Ga0501048_0067143 | |||
| 1496 | Ga0501048_0361137 | |||
| 1497 | Ga0501048_1021753 | |||
| 1498 | Ga0501067_0030721 | |||
| 1499 | Ga0501067_0105732 | |||
| 1500 | Ga0501067_0139465 | |||
| 1501 | Ga0501068_0005640 | |||
| 1502 | Ga0501068_0045015 | |||
| 1503 | Ga0501068_0065436 | |||
| 1504 | Ga0501068_0091535 | |||
| 1505 | Ga0501069_0001844 | |||
| 1506 | Ga0501069_0006355 | |||
| 1507 | Ga0501069_0036713 | |||
| 1508 | Ga0501069_0445642 | |||
| 1509 | Ga0501069_0535024 | |||
| 1510 | Ga0501069_0680396 | |||
| 1511 | Ga0501070_0007476 | |||
| 1512 | Ga0501070_0016540 | |||
| 1513 | Ga0501070_0087997 | |||
| 1514 | Ga0501070_0140826 | |||
| 1515 | Ga0501070_0346411 | |||
| 1516 | Ga0501070_0608001 | |||
| 1517 | Ga0501070_0792902 | |||
| 1518 | Ga0501070_1174031 | |||
| 1519 | Ga0501071_0005277 | |||
| 1520 | Ga0501071_0028913 | |||
| 1521 | Ga0501071_0130483 | |||
| 1522 | Ga0501071_0719164 | |||
| 1523 | Ga0501072_0007071 | |||
| 1524 | Ga0501072_0096087 | |||
| 1525 | Ga0501072_0277052 | |||
| 1526 | Ga0501072_0477643 | |||
| 1527 | Ga0501072_0507692 | |||
| 1528 | Ga0501072_0583712 | |||
| 1529 | Ga0501073_0055549 | |||
| 1530 | Ga0501073_0071481 | |||
| 1531 | Ga0501073_0310885 | |||
| 1532 | Ga0501074_0002538 | |||
| 1533 | Ga0501074_0018756 | |||
| 1534 | Ga0501074_0153605 | |||
| 1535 | Ga0501074_0340077 | |||
| 1536 | Ga0501074_0387491 | |||
| 1537 | Ga0501075_0056527 | |||
| 1538 | Ga0501075_0070000 | |||
| 1539 | Ga0501075_0168108 | |||
| 1540 | Ga0501075_0389631 | |||
| 1541 | Ga0501075_0503638 | |||
| 1542 | Ga0501075_1158115 | |||
| 1543 | Ga0501076_0043680 | |||
| 1544 | Ga0501076_0099303 | |||
| 1545 | Ga0501076_0143737 | |||
| 1546 | Ga0501076_0385978 | |||
| 1547 | Ga0501076_0403998 | |||
| 1548 | Ga0501076_1173533 | |||
| 1549 | Ga0501076_1591123 | |||
| 1550 | Ga0501077_0000524 | |||
| 1551 | Ga0501077_0032949 | |||
| 1552 | Ga0501077_0546261 | |||
| 1553 | Ga0501077_0883786 | |||
| 1554 | Ga0501198_032815 | |||
| 1555 | Ga0501202_111281 | |||
| 1556 | Ga0501209_068089 | |||
| 1557 | Ga0501209_195525 | |||
| 1558 | Ga0501248_003799 | |||
| 1559 | Ga0501249_019971 | |||
| 1560 | Ga0501249_128937 | |||
| 1561 | Ga0501253_073629 | |||
| 1562 | Ga0501256_019907 | |||
| 1563 | Ga0501257_063951 | |||
| 1564 | Ga0501258_027047 | |||
| 1565 | Ga0501221_094280 | |||
| 1566 | Ga0501221_136169 | |||
| 1567 | Ga0501225_0125738 | |||
| 1568 | Ga0501225_0151119 | |||
| 1569 | Ga0501245_028909 | |||
| 1570 | Ga0501079_0005768 | |||
| 1571 | Ga0501079_0043214 | |||
| 1572 | Ga0501079_0373597 | |||
| 1573 | Ga0501079_1191522 | |||
| 1574 | Ga0501080_0035917 | |||
| 1575 | Ga0501080_0129067 | |||
| 1576 | Ga0501080_0174428 | |||
| 1577 | Ga0501080_0444521 | |||
| 1578 | Ga0501080_1456988 | |||
| 1579 | Ga0501081_0004622 | |||
| 1580 | Ga0501081_0011130 | |||
| 1581 | Ga0501081_0260012 | |||
| 1582 | Ga0501081_0278434 | |||
| 1583 | Ga0501081_0382939 | |||
| 1584 | Ga0501081_0546025 | |||
| 1585 | Ga0501081_0632401 | |||
| 1586 | Ga0501081_1130548 | |||
| 1587 | Ga0501083_0004073 | |||
| 1588 | Ga0501083_0060306 | |||
| 1589 | Ga0501083_0471470 | |||
| 1590 | Ga0501083_0698392 | |||
| 1591 | Ga0501083_0923986 | |||
| 1592 | Ga0501263_009568 | |||
| 1593 | Ga0501263_034553 | |||
| 1594 | Ga0501265_046920 | |||
| 1595 | Ga0501268_023205 | |||
| 1596 | Ga0501270_016726 | |||
| 1597 | Ga0501271_006745 | |||
| 1598 | Ga0501273_040468 | |||
| 1599 | Ga0501273_094477 | |||
| 1600 | Ga0501274_033325 | |||
| 1601 | Ga0501045_0027982 | |||
| 1602 | Ga0501045_0130840 | |||
| 1603 | Ga0501045_0728345 | |||
| 1604 | Ga0501212_093295 | |||
| 1605 | Ga0501226_013093 | |||
| 1606 | nmdc:mga05p37_1187_c1 | |||
| 1607 | nmdc:mga05p37_13069_c1 | |||
| 1608 | nmdc:mga05p37_1748424_c1 | |||
| 1609 | nmdc:mga05p37_230979_c1 | |||
| 1610 | nmdc:mga05p37_599746_c1 | |||
| 1611 | nmdc:mga05p37_88826_c1 | |||
| 1612 | nmdc:mga05p37_898065_c1 | |||
| 1613 | nmdc:mga09592_1281671_c1 | |||
| 1614 | nmdc:mga09592_1491985_c1 | |||
| 1615 | nmdc:mga09592_4808_c1 | |||
| 1616 | nmdc:mga09592_796857_c1 | |||
| 1617 | nmdc:mga0qj67_142793_c1 | |||
| 1618 | nmdc:mga06r32_144016_c1 | |||
| 1619 | nmdc:mga06r32_159161_c1 | |||
| 1620 | nmdc:mga06r32_410718_c1 | |||
| 1621 | nmdc:mga06r32_974694_c1 | |||
| 1622 | nmdc:mga08y16_663180_c1 | |||
| 1623 | nmdc:mga0n895_16838_c1 | |||
| 1624 | nmdc:mga0n895_302955_c1 | |||
| 1625 | nmdc:mga0n895_48146_c1 | |||
| 1626 | nmdc:mga0n895_77176_c1 | |||
| 1627 | nmdc:mga0n895_937925_c1 | |||
| 1628 | nmdc:mga0rr50_1782741_c1 | |||
| 1629 | nmdc:mga0rr50_381395_c1 | |||
| 1630 | nmdc:mga0rr50_542930_c1 | |||
| 1631 | nmdc:mga08x19_104515_c1 | |||
| 1632 | nmdc:mga0a205_33902_c1 | |||
| 1633 | nmdc:mga0a205_350782_c1 | |||
| 1634 | nmdc:mga0a205_845337_c1 | |||
| 1635 | nmdc:mga0a205_89447_c1 | |||
| 1636 | Ga0501084_0013422 | |||
| 1637 | Ga0501084_0015548 | |||
| 1638 | Ga0501084_0055493 | |||
| 1639 | Ga0501084_0185666 | |||
| 1640 | Ga0501084_0339544 | |||
| 1641 | Ga0501084_0424966 | |||
| 1642 | Ga0590071_006015 | |||
| 1643 | Ga0590071_079440 | |||
| 1644 | Ga0590075_008433 | |||
| 1645 | Ga0590075_028013 | |||
| 1646 | Ga0501082_0009687 | |||
| 1647 | Ga0501082_0016393 | |||
| 1648 | Ga0501082_0154619 | |||
| 1649 | Ga0501082_0562469 | |||
| 1650 | Ga0530510_0035315 | |||
| 1651 | Ga0530510_0353930 | |||
| 1652 | Ga0530510_0512416 | |||
| 1653 | Ga0530510_0710009 | |||
| 1654 | Ga0530510_1014803 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2phd-assembly1.cif.gz_C | crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans | 0.9327 | 21 | 99 |
| 2phd-assembly1.cif.gz_A | crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans | 0.9314 | 21 | 99 |
| 2oa2-assembly1.cif.gz_A-2 | crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution | 0.9218 | 17 | 101 |
| 2y0o-assembly1.cif.gz_A-2 | the structure of a d-lyxose isomerase from the sigmab regulon of bacillus subtilis | 0.9172 | 14 | 108 |
| 5fli-assembly1.cif.gz_K | enzyme-substrate complex of ni-quercetinase | 0.9099 | 7 | 101 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2y0oA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9022 | 14 | 108 | 2.60.120.10 |
| 3fjsA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8998 | 17 | 100 | 2.60.120.10 |
| 2oa2A01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8987 | 17 | 101 | 2.60.120.10 |
| 1gqhC02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8959 | 14 | 101 | 2.60.120.10 |
| af_A0A0R0KME4_229_450_2.60.120.650 | Mainly Beta;Sandwich;Jelly Rolls;Cupin | 0.8934 | 26 | 100 | 2.60.120.650 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C7DH31-F1-model_v4 | ROK family protein | 0.9651 | 2 | 115 |
GO:0005976
GO:0016779 |
| AF-A0A536MAX0-F1-model_v4 | Cupin domain-containing protein | 0.9626 | 7 | 115 |
|
| AF-A0A2V7NCQ3-F1-model_v4 | Cupin | 0.9624 | 1 | 115 |
|
| AF-A0A1F2T8B0-F1-model_v4 | Cupin | 0.9623 | 6 | 115 |
|
| AF-A0A2E7RQ97-F1-model_v4 | Cupin type-2 domain-containing protein | 0.9609 | 4 | 108 |
|