F482457

General Info

Members Datasets Scaffolds Average Seq Length
825 425 712 280

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2937877337|2937884099
Length 287
Sequence MPNTSSGSLAAFLKDRRTRLDPSSFGFSGRRRTPGLRREEVAQRANISPTWYTWLEQGRGGAPSADVLNRIAKGLLLTEAEREHLFMLGLGRPPEVRYLRADGVSPRLQRLIDTLEASPALIKTATWDVVAWNSAAQVVMTDSTLPHGQRNILRFMFLSPTIRAKQHDWENLARFVVGAFRADAARAGAVSEVAQLVDELCGASPEFATLWRENDVLAHGDGTKRLKHPELGDIELEYSAFAVDGRPDLSLTVYNPVDAAVADRIRDLARRRKERDATDPSTKPTTP

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
3 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
4 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
5 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
6 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
7 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
8 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
9 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
10 2643221674 Devosia sp. Root436 Isolate Unclassified
11 2643221719 Rhizobium sp. Root274 Isolate Unclassified
12 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
13 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
14 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
15 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
16 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
17 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
18 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
19 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
20 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
21 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
22 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
23 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
24 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
25 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
26 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
27 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
28 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
29 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
30 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
31 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
32 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
33 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
34 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
35 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
36 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
37 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
38 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
39 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
40 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
41 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
42 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
43 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
44 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
45 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
46 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
47 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
48 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
49 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
50 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
51 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
52 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
53 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
54 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
55 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
56 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
57 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
58 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
59 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
60 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
61 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
62 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
63 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
64 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
65 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
66 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
67 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
68 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
69 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
70 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
71 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
72 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
73 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
74 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
75 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
76 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
77 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
78 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
79 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
80 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
81 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
82 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
83 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
84 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
85 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
86 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
87 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
88 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
89 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
90 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
91 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
92 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
93 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
94 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
95 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
96 3004167301 Mesorhizobium loti 582 Isolate Unclassified
97 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
98 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
99 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
100 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
101 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
102 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
103 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
104 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
105 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
106 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
107 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
108 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
109 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
110 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
111 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
112 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
113 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
114 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
115 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
116 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
117 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
118 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
119 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
120 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
121 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
122 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
123 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
124 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
125 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
126 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
127 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
128 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
129 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
130 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
131 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
132 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
133 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
134 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
135 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
136 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
137 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
138 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
139 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
140 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
141 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
142 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
143 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
144 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
145 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
146 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
147 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
148 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
149 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
150 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
151 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
152 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
153 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
154 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
155 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
156 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
157 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
158 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
159 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
160 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
161 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
162 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
163 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
164 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
165 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
166 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
167 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
168 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
169 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
170 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
171 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
172 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
173 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
174 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
175 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
176 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
177 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
178 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
179 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
180 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
181 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
182 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
183 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
184 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
185 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
186 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
187 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
191 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
192 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
194 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
195 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
198 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
199 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
203 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
204 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
206 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
238 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
242 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
243 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
244 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
247 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
248 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
249 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
250 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
253 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
254 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
255 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
256 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
259 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
260 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
261 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
262 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
263 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
264 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
265 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
266 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
267 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
268 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
269 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
270 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
271 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
272 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
273 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
274 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
275 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
276 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
277 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
278 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
279 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
280 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
281 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
282 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
283 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
284 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
285 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
286 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
287 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
288 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
289 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
290 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
291 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
292 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
293 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
294 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
295 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
296 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
297 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
298 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
299 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
300 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
301 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
302 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
303 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
304 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
305 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
306 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
307 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
308 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
309 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
310 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
311 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
312 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
313 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
314 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
315 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
316 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
317 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
318 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
319 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
320 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
323 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
324 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
325 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
326 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
327 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
328 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
329 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
330 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
331 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
332 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
333 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
334 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
335 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
336 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
337 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
338 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
345 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
346 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
347 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
348 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
349 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
350 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
351 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
352 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
353 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
354 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
355 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
356 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
357 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
358 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
359 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
360 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
361 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
375 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
376 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
377 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
378 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
379 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
380 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
381 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
382 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
383 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
384 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
385 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
388 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
389 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
390 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
391 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
392 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
393 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
394 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
395 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
396 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
397 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
398 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
399 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
400 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
401 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
402 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
403 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
404 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
405 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
406 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
407 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
408 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
409 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
410 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
411 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
412 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
413 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
414 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
415 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
416 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
417 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
418 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
419 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
420 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
421 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
422 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
423 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
424 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
425 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.06
Metatranscriptomes 0.24
Isolates 13.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.42
Nodule 11.39
Rhizoplane 2.42
Rhizosphere 60.73
Stem 0
Stem Tuber 0
Unclassified 15.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001546 3300001904 Bacteria 4188
2 JGI24736J21556_1006811 3300001904 Bacteria 1922
3 JGI24741J21665_1012915 3300001915 Bacteria 1425
4 JGI24740J21852_10031332 3300001979 Bacteria 1716
5 JGI24739J22299_10009539 3300001989 Bacteria 3614
6 JGI24739J22299_10011259 3300001989 Bacteria 3304
7 JGI24739J22299_10023269 3300001989 Bacteria 2191
8 JGI24739J22299_10038737 3300001989 Bacteria 1601
9 JGI24737J22298_10004299 3300001990 Bacteria 4975
10 JGI24737J22298_10032342 3300001990 Bacteria 1629
11 JGI24735J21928_10003343 3300002067 Bacteria 5473
12 JGI24735J21928_10005340 3300002067 Bacteria 4263
13 JGI24735J21928_10023509 3300002067 Bacteria 1869
14 JGI24735J21928_10038041 3300002067 Bacteria 1409
15 JGI24738J21930_10007946 3300002075 Bacteria 2426
16 JGI24742J22300_10005287 3300002244 Bacteria 2121
17 JGI25156J39149_1000430 3300002705 Bacteria 25973
18 JGI25156J39149_1005097 3300002705 Bacteria 3869
19 JGI25156J39149_1006965 3300002705 Bacteria 3029
20 JGI25154J39366_1000018 3300002738 Bacteria 251612
21 JGI25157J39369_1000074 3300002741 Bacteria 88240
22 JGI25157J39369_1000564 3300002741 Bacteria 22170
23 JGI25157J39369_1000921 3300002741 Bacteria 14002
24 JGI25165J46597_1000020 3300003214 Bacteria 370477
25 JGI25165J46597_1000021 3300003214 Bacteria 359288
26 JGI25153J46596_10000070 3300003215 Bacteria 117125
27 rootH1_10012195 3300003316 Bacteria 8969
28 Ga0055539_1001378 3300003752 Bacteria 4615
29 Ga0055533_1004286 3300003756 Bacteria 2598
30 Ga0055525_1000013 3300003759 Bacteria 440870
31 Ga0055525_1000203 3300003759 Bacteria 68926
32 Ga0055527_1000190 3300003760 Bacteria 40884
33 Ga0055535_1000397 3300003761 Bacteria 40876
34 Ga0055542_1000040 3300003762 Bacteria 214035
35 Ga0055542_1000043 3300003762 Bacteria 207531
36 Ga0055542_1000546 3300003762 Bacteria 33448
37 Ga0055529_1000037 3300003763 Bacteria 237307
38 Ga0055529_1000380 3300003763 Bacteria 48083
39 Ga0055536_1001410 3300003781 Bacteria 14516
40 Ga0055540_1001153 3300003792 Bacteria 16440
41 Ga0055531_10006682 3300003794 Bacteria 6467
42 Ga0055543_1008796 3300004625 Bacteria 2213
43 Ga0055543_1009840 3300004625 Bacteria 2033
44 Ga0065165_1000214 3300005262 Bacteria 100283
45 Ga0065165_1005328 3300005262 Bacteria 7309
46 Ga0070658_10003583 3300005327 Bacteria 12732
47 Ga0070658_10014451 3300005327 Bacteria 6335
48 Ga0070658_10045429 3300005327 Bacteria 3552
49 Ga0070658_10125565 3300005327 Bacteria 2135
50 Ga0070658_10214783 3300005327 Bacteria 1625
51 Ga0070683_100285764 3300005329 Bacteria 1569
52 Ga0070670_100089110 3300005331 Bacteria 2652
53 Ga0070670_100161730 3300005331 Bacteria 1940
54 Ga0070666_10000046 3300005335 Bacteria 107525
55 Ga0070666_10097645 3300005335 Bacteria 2022
56 Ga0070682_100048577 3300005337 Bacteria 2642
57 Ga0070660_100009935 3300005339 Bacteria 6714
58 Ga0070661_100008770 3300005344 Bacteria 6997
59 Ga0070661_100051676 3300005344 Bacteria 3008
60 Ga0070661_100181882 3300005344 Bacteria 1600
61 Ga0070692_10216655 3300005345 Bacteria 1129
62 Ga0070675_100222429 3300005354 Bacteria 1644
63 Ga0070674_100015015 3300005356 Bacteria 4826
64 Ga0070674_100098110 3300005356 Bacteria 2129
65 Ga0070659_100000274 3300005366 Bacteria 40352
66 Ga0070659_100126875 3300005366 Bacteria 2070
67 Ga0070667_100074476 3300005367 Bacteria 2897
68 Ga0070667_100181404 3300005367 Bacteria 1862
69 Ga0070714_100199881 3300005435 Bacteria 1828
70 Ga0070663_100003022 3300005455 Bacteria 9606
71 Ga0070663_100045480 3300005455 Bacteria 3101
72 Ga0070663_100188735 3300005455 Bacteria 1603
73 Ga0070663_100388932 3300005455 Bacteria 1137
74 Ga0070678_100000523 3300005456 Bacteria 18610
75 Ga0070662_100064143 3300005457 Bacteria 2689
76 Ga0070662_100079136 3300005457 Bacteria 2443
77 Ga0068867_100292692 3300005459 Bacteria 1339
78 Ga0070684_100105147 3300005535 Bacteria 2526
79 Ga0068853_100140670 3300005539 Bacteria 2166
80 Ga0068853_100174820 3300005539 Bacteria 1944
81 Ga0068853_100179669 3300005539 Bacteria 1918
82 Ga0070672_100283192 3300005543 Bacteria 1402
83 Ga0070665_100057418 3300005548 Bacteria 3901
84 Ga0070665_100177577 3300005548 Bacteria 2130
85 Ga0068855_100003956 3300005563 Bacteria 18093
86 Ga0068855_100020329 3300005563 Bacteria 7965
87 Ga0068855_100035135 3300005563 Bacteria 5971
88 Ga0068855_100219778 3300005563 Bacteria 2131
89 Ga0068855_100370110 3300005563 Bacteria 1575
90 Ga0068857_100008515 3300005577 Bacteria 8868
91 Ga0068857_100112429 3300005577 Bacteria 2448
92 Ga0068854_100066352 3300005578 Bacteria 2626
93 Ga0068854_100131105 3300005578 Bacteria 1914
94 Ga0068854_100408605 3300005578 Bacteria 1125
95 Ga0068856_100001457 3300005614 Bacteria 24824
96 Ga0068856_100021865 3300005614 Bacteria 6217
97 Ga0068856_100026353 3300005614 Bacteria 5669
98 Ga0068856_100106768 3300005614 Bacteria 2795
99 Ga0068856_100465744 3300005614 Bacteria 1284
100 Ga0068852_100011426 3300005616 Bacteria 6684
101 Ga0068852_100015364 3300005616 Bacteria 5934
102 Ga0068863_100152267 3300005841 Bacteria 2213
103 Ga0068860_100000274 3300005843 Bacteria 75310
104 Ga0068860_100409261 3300005843 Bacteria 1343
105 Ga0081540_1026589 3300005983 Bacteria 3299
106 Ga0081539_10008834 3300005985 Bacteria 8620
107 Ga0070717_10133670 3300006028 Bacteria 2135
108 Ga0075365_10012007 3300006038 Bacteria 5120
109 Ga0075368_10083092 3300006042 Bacteria 1305
110 Ga0075364_10100396 3300006051 Bacteria 1926
111 Ga0068871_100260598 3300006358 Bacteria 1512
112 Ga0075434_100007651 3300006871 Bacteria 9994
113 Ga0068865_100001677 3300006881 Bacteria 12969
114 Ga0075435_100004917 3300007076 Bacteria 9266
115 Ga0099794_10060084 3300007265 Bacteria 1845
116 Ga0105251_10046708 3300009011 Bacteria 2083
117 Ga0105240_10000005 3300009093 Bacteria 702630
118 Ga0105240_10004777 3300009093 Bacteria 20435
119 Ga0105240_10005953 3300009093 Bacteria 18040
120 Ga0105240_10178901 3300009093 Bacteria 2505
121 Ga0105240_10180163 3300009093 Bacteria 2494
122 Ga0105240_10254023 3300009093 Bacteria 2031
123 Ga0105240_10418966 3300009093 Bacteria 1505
124 Ga0105240_10571677 3300009093 Bacteria 1248
125 Ga0105247_10341220 3300009101 Bacteria 1051
126 Ga0105243_10000913 3300009148 Bacteria 27723
127 Ga0105241_10014367 3300009174 Bacteria 5798
128 Ga0105241_10015541 3300009174 Bacteria 5579
129 Ga0105241_10558228 3300009174 Bacteria 1029
130 Ga0105248_10302657 3300009177 Bacteria 1800
131 Ga0105237_10002112 3300009545 Bacteria 25083
132 Ga0105237_10010055 3300009545 Bacteria 10090
133 Ga0105237_10267651 3300009545 Bacteria 1712
134 Ga0105238_10000521 3300009551 Bacteria 40372
135 Ga0105238_10001346 3300009551 Bacteria 24704
136 Ga0105238_10060936 3300009551 Bacteria 3777
137 Ga0105238_10061613 3300009551 Bacteria 3754
138 Ga0105238_10125893 3300009551 Bacteria 2541
139 Ga0105239_10002672 3300010375 Bacteria 22471
140 Ga0105239_10007523 3300010375 Bacteria 12489
141 Ga0105239_10014042 3300010375 Bacteria 8891
142 Ga0105239_10016174 3300010375 Bacteria 8254
143 Ga0105239_10057743 3300010375 Bacteria 4257
144 Ga0105239_10079994 3300010375 Bacteria 3596
145 Ga0105239_10096883 3300010375 Bacteria 3259
146 Ga0105239_10164843 3300010375 Bacteria 2478
147 Ga0105239_10461165 3300010375 Bacteria 1442
148 Ga0105239_10602137 3300010375 Bacteria 1253
149 Ga0105239_10640324 3300010375 Bacteria 1214
150 Ga0105239_10836098 3300010375 Bacteria 1055
151 Ga0157373_10031474 3300013100 Bacteria 3819
152 Ga0157373_10064685 3300013100 Bacteria 2589
153 Ga0157373_10088611 3300013100 Bacteria 2180
154 Ga0157370_10000163 3300013104 Bacteria 81428
155 Ga0157370_10001660 3300013104 Bacteria 27428
156 Ga0157370_10011892 3300013104 Bacteria 9078
157 Ga0157370_10024273 3300013104 Bacteria 6006
158 Ga0157370_10084264 3300013104 Bacteria 2988
159 Ga0157369_10169296 3300013105 Bacteria 2302
160 Ga0157369_10179974 3300013105 Bacteria 2225
161 Ga0157369_10223096 3300013105 Bacteria 1972
162 Ga0157369_10368046 3300013105 Bacteria 1492
163 Ga0163162_10002496 3300013306 Bacteria 17387
164 Ga0163162_10127536 3300013306 Bacteria 2652
165 Ga0163162_10698990 3300013306 Bacteria 1136
166 Ga0157372_10031478 3300013307 Bacteria 5808
167 Ga0157372_10186993 3300013307 Bacteria 2399
168 Ga0182008_10069423 3300014497 Bacteria 1733
169 Ga0157376_10204192 3300014969 Bacteria 1820
170 Ga0182005_1000027 3300015265 Bacteria 223652
171 Ga0213872_10000106 3300021361 Bacteria 77503
172 Ga0213876_10010245 3300021384 Bacteria 5034
173 Ga0209435_100044 3300025206 Bacteria 99051
174 Ga0209674_100170 3300025226 Bacteria 81718
175 Ga0209674_100393 3300025226 Bacteria 22498
176 Ga0209674_101002 3300025226 Bacteria 8705
177 Ga0209672_100009 3300025228 Bacteria 883623
178 Ga0209563_100025 3300025230 Bacteria 596456
179 Ga0209563_100147 3300025230 Bacteria 69021
180 Ga0207427_105671 3300025231 Bacteria 1713
181 Ga0209437_101211 3300025233 Bacteria 7443
182 Ga0209258_100011 3300025242 Bacteria 867542
183 Ga0209646_1000151 3300025246 Bacteria 99050
184 Ga0209026_1000005 3300025250 Bacteria 731387
185 Ga0209026_1000070 3300025250 Bacteria 205861
186 Ga0209026_1000170 3300025250 Bacteria 99050
187 Ga0209677_109016 3300025253 Bacteria 1844
188 Ga0209148_1000011 3300025254 Bacteria 1196503
189 Ga0209148_1000013 3300025254 Bacteria 956684
190 Ga0209148_1000686 3300025254 Bacteria 28101
191 Ga0209759_1000111 3300025256 Bacteria 143545
192 Ga0209759_1000186 3300025256 Bacteria 100413
193 Ga0209759_1000285 3300025256 Bacteria 70420
194 Ga0209233_1000047 3300025261 Bacteria 459614
195 Ga0209233_1000065 3300025261 Bacteria 387195
196 Ga0209565_1000100 3300025263 Bacteria 130380
197 Ga0209455_1000006 3300025272 Bacteria 1196503
198 Ga0209455_1000012 3300025272 Bacteria 867234
199 Ga0209676_1000115 3300025292 Bacteria 205183
200 Ga0209025_1000044 3300025294 Bacteria 349480
201 Ga0209758_1000023 3300025297 Bacteria 612453
202 Ga0209758_1011384 3300025297 Bacteria 5160
203 Ga0209050_1000001 3300025298 Bacteria 3563507
204 Ga0209050_1004592 3300025298 Bacteria 9248
205 Ga0207426_1002612 3300025302 Bacteria 11173
206 Ga0207426_1007314 3300025302 Bacteria 4639
207 Ga0207426_1053787 3300025302 Bacteria 1187
208 Ga0209051_1000279 3300025303 Bacteria 83677
209 Ga0209051_1006951 3300025303 Bacteria 6278
210 Ga0209257_1000090 3300025304 Bacteria 274746
211 Ga0209257_1001934 3300025304 Bacteria 22347
212 Ga0209257_1011200 3300025304 Bacteria 4360
213 Ga0207680_10000003 3300025903 Bacteria 925264
214 Ga0207680_10028915 3300025903 Bacteria 3107
215 Ga0207647_10000007 3300025904 Bacteria 209754
216 Ga0207647_10004336 3300025904 Bacteria 10518
217 Ga0207647_10004518 3300025904 Bacteria 10306
218 Ga0207647_10085466 3300025904 Bacteria 1887
219 Ga0207647_10088924 3300025904 Bacteria 1844
220 Ga0207643_10126526 3300025908 Bacteria 1517
221 Ga0207705_10000891 3300025909 Bacteria 24453
222 Ga0207705_10005791 3300025909 Bacteria 9205
223 Ga0207654_10074846 3300025911 Bacteria 2022
224 Ga0207695_10000011 3300025913 Bacteria 910221
225 Ga0207695_10000015 3300025913 Bacteria 803205
226 Ga0207695_10030300 3300025913 Bacteria 5958
227 Ga0207695_10366167 3300025913 Bacteria 1328
228 Ga0207695_10401380 3300025913 Bacteria 1255
229 Ga0207671_10012369 3300025914 Bacteria 6867
230 Ga0207671_10015930 3300025914 Bacteria 5862
231 Ga0207671_10076929 3300025914 Bacteria 2498
232 Ga0207657_10023163 3300025919 Bacteria 5788
233 Ga0207649_10005284 3300025920 Bacteria 6983
234 Ga0207694_10015326 3300025924 Bacteria 5783
235 Ga0207694_10057256 3300025924 Bacteria 3030
236 Ga0207694_10114313 3300025924 Bacteria 2150
237 Ga0207694_10596134 3300025924 Bacteria 929
238 Ga0207650_10273003 3300025925 Bacteria 1374
239 Ga0207644_10094502 3300025931 Bacteria 2234
240 Ga0207690_10000092 3300025932 Bacteria 74832
241 Ga0207709_10000039 3300025935 Bacteria 260127
242 Ga0207669_10000117 3300025937 Bacteria 39781
243 Ga0207704_10000796 3300025938 Bacteria 13941
244 Ga0207711_10231928 3300025941 Bacteria 1691
245 Ga0207667_10000002 3300025949 Bacteria 895662
246 Ga0207667_10012423 3300025949 Bacteria 9813
247 Ga0207667_10018525 3300025949 Bacteria 7805
248 Ga0207651_10092633 3300025960 Bacteria 2217
249 Ga0207640_10041502 3300025981 Bacteria 2927
250 Ga0207640_10042590 3300025981 Bacteria 2896
251 Ga0207640_10206011 3300025981 Bacteria 1494
252 Ga0207658_10453650 3300025986 Bacteria 1135
253 Ga0207703_10216921 3300026035 Bacteria 1709
254 Ga0207639_10034085 3300026041 Bacteria 3760
255 Ga0207639_10047677 3300026041 Bacteria 3239
256 Ga0207678_10017343 3300026067 Bacteria 6321
257 Ga0207678_10126428 3300026067 Bacteria 2181
258 Ga0207678_10217866 3300026067 Bacteria 1634
259 Ga0207678_10572964 3300026067 Bacteria 988
260 Ga0207702_10011648 3300026078 Bacteria 7326
261 Ga0207702_10028184 3300026078 Bacteria 4666
262 Ga0207702_10120372 3300026078 Bacteria 2348
263 Ga0207648_10199901 3300026089 Bacteria 1772
264 Ga0207674_10009769 3300026116 Bacteria 10931
265 Ga0207674_10136354 3300026116 Bacteria 2416
266 Ga0207674_10360958 3300026116 Bacteria 1404
267 Ga0207683_10008488 3300026121 Bacteria 8791
268 Ga0207698_10199835 3300026142 Bacteria 1789
269 Ga0207698_10247253 3300026142 Bacteria 1630
270 Ga0265354_1001446 3300028016 Bacteria 3398
271 Ga0265356_1000405 3300028017 Bacteria 7824
272 Ga0268266_10000011 3300028379 Bacteria 757403
273 Ga0268264_10000058 3300028381 Bacteria 308956
274 Ga0268264_10000060 3300028381 Bacteria 305056
275 Ga0268264_10013032 3300028381 Bacteria 6834
276 Ga0307517_10044986 3300028786 Bacteria 4651
277 Ga0307515_10013091 3300028794 Bacteria 15528
278 Ga0307515_10021681 3300028794 Bacteria 11371
279 Ga0265338_10017529 3300028800 Bacteria 7713
280 Ga0265770_1000128 3300030878 Bacteria 9195
281 Ga0265760_10018201 3300031090 Bacteria 2021
282 Ga0265331_10034213 3300031250 Bacteria 2508
283 Ga0307406_10021673 3300031901 Bacteria 3804
284 Ga0307412_10000751 3300031911 Bacteria 18811
285 Ga0307414_10000835 3300032004 Bacteria 15717
286 Ga0307510_10008938 3300033180 Bacteria 11932
287 Ga0307510_10038241 3300033180 Bacteria 5307
288 Ga0307510_10129345 3300033180 Bacteria 2204
289 Ga0307510_10159368 3300033180 Bacteria 1857
290 Ga0373925_0106780 3300037068 Bacteria 2159
291 Ga0395899_0000004 3300037312 Bacteria 874267
292 Ga0395899_0000228 3300037312 Bacteria 76251
293 Ga0395899_0012532 3300037312 Bacteria 6498
294 Ga0395900_0000052 3300037418 Bacteria 223910
295 Ga0395900_0000070 3300037418 Bacteria 188320
296 Ga0395898_0000501 3300037466 Bacteria 76264
297 Ga0395898_0012979 3300037466 Bacteria 8590
298 Ga0395905_0000622 3300037471 Bacteria 47376
299 Ga0395905_0015761 3300037471 Bacteria 7180
300 Ga0395905_0022154 3300037471 Bacteria 6011
301 Ga0395905_0060948 3300037471 Bacteria 3528
302 Ga0395905_0520845 3300037471 Bacteria 1090
303 Ga0436364_0097704 3300037853 Bacteria 1000
304 Ga0436364_0237048 3300037853 Bacteria 2994
305 Ga0436364_0669598 3300037853 Bacteria 1490
306 Ga0436364_0968346 3300037853 Bacteria 19925
307 Ga0395901_0000001 3300038443 Bacteria 800383
308 Ga0395901_0008360 3300038443 Bacteria 10462
309 Ga0395901_0014150 3300038443 Bacteria 8122
310 Ga0395901_0084393 3300038443 Bacteria 3320
311 Ga0395901_0502247 3300038443 Bacteria 1234
312 Ga0237819_00668 3300038705 Bacteria 11148
313 Ga0436365_0178523 3300039437 Bacteria 11582
314 Ga0436365_1181455 3300039437 Bacteria 2492
315 Ga0436361_0152690 3300039447 Bacteria 36214
316 Ga0436362_1099931 3300039453 Bacteria 1062
317 Ga0451795_0775736 3300041456 Bacteria 1365
318 Ga0439448_0022430 3300042005 Bacteria 1962
319 Ga0439458_0004032 3300042157 Bacteria 3390
320 Ga0466972_0087225 3300044658 Bacteria 1482
321 Ga0466965_0104928 3300044683 Bacteria 1448
322 Ga0466965_0147726 3300044683 Bacteria 1227
323 Ga0466966_0000076 3300044684 Bacteria 62856
324 Ga0466966_0013501 3300044684 Bacteria 5407
325 Ga0466966_0081547 3300044684 Bacteria 2014
326 Ga0466961_0010995 3300044693 Bacteria 5783
327 Ga0466961_0119707 3300044693 Bacteria 1653
328 Ga0466963_0136094 3300044694 Bacteria 1700
329 Ga0466971_0028955 3300044719 Bacteria 2477
330 Ga0466968_0027748 3300044735 Bacteria 2330
331 Ga0466970_0012421 3300044765 Bacteria 4352
332 Ga0466970_0110734 3300044765 Bacteria 1499
333 Ga0466970_0118932 3300044765 Bacteria 1446
334 Ga0466957_0013567 3300044842 Bacteria 4729
335 Ga0466960_0075796 3300044901 Bacteria 1683
336 Ga0466959_0000058 3300045049 Bacteria 77145
337 Ga0466959_0000994 3300045049 Bacteria 16893
338 Ga0466959_0047784 3300045049 Bacteria 3147
339 Ga0466959_0198036 3300045049 Bacteria 1399
340 Ga0466958_0000754 3300045836 Bacteria 14207
341 Ga0466958_0161111 3300045836 Bacteria 1417
342 Ga0495627_000082 3300046453 Bacteria 113641
343 Ga0495627_016270 3300046453 Bacteria 2550
344 Ga0495629_0004264 3300046459 Bacteria 10723
345 Ga0495629_0047480 3300046459 Bacteria 3012
346 Ga0495638_0005941 3300046460 Bacteria 8960
347 Ga0495638_0007585 3300046460 Bacteria 7762
348 Ga0495651_0003944 3300046462 Bacteria 11347
349 Ga0495651_0114085 3300046462 Bacteria 1994
350 Ga0495653_0129879 3300046463 Bacteria 1785
351 Ga0495650_0000470 3300046471 Bacteria 62114
352 Ga0495650_0000616 3300046471 Bacteria 48324
353 Ga0495650_0036072 3300046471 Bacteria 2169
354 Ga0495650_0053687 3300046471 Bacteria 1648
355 Ga0495605_0000050 3300046474 Bacteria 165667
356 Ga0495605_0119065 3300046474 Bacteria 1198
357 Ga0495584_0050095 3300046491 Bacteria 2103
358 Ga0495584_0058559 3300046491 Bacteria 1938
359 Ga0495585_0003969 3300046492 Bacteria 9763
360 Ga0495585_0008789 3300046492 Bacteria 6099
361 Ga0495585_0212604 3300046492 Bacteria 979
362 Ga0495594_0000310 3300046499 Bacteria 23931
363 Ga0495596_0001637 3300046500 Bacteria 12721
364 Ga0495596_0110054 3300046500 Bacteria 1070
365 Ga0495607_0000006 3300046501 Bacteria 281664
366 Ga0495607_0008757 3300046501 Bacteria 6894
367 Ga0495583_0000002 3300046506 Bacteria 782521
368 Ga0495583_0000007 3300046506 Bacteria 434661
369 Ga0495583_0001366 3300046506 Bacteria 25162
370 Ga0495583_0002053 3300046506 Bacteria 18245
371 Ga0495583_0005931 3300046506 Bacteria 8117
372 Ga0495606_0000092 3300046507 Bacteria 152369
373 Ga0495606_0000281 3300046507 Bacteria 88474
374 Ga0495606_0002734 3300046507 Bacteria 19853
375 Ga0495606_0091812 3300046507 Bacteria 1866
376 Ga0495606_0169829 3300046507 Bacteria 1266
377 Ga0495606_0221039 3300046507 Bacteria 1067
378 Ga0495608_0035426 3300046511 Bacteria 3366
379 Ga0495610_0000013 3300046512 Bacteria 465872
380 Ga0495610_0000157 3300046512 Bacteria 75701
381 Ga0495610_0000525 3300046512 Bacteria 38499
382 Ga0495610_0000606 3300046512 Bacteria 35491
383 Ga0495610_0005531 3300046512 Bacteria 8948
384 Ga0495610_0055474 3300046512 Bacteria 1909
385 Ga0495616_0000286 3300046513 Bacteria 40792
386 Ga0495616_0040799 3300046513 Bacteria 2370
387 Ga0495616_0089173 3300046513 Bacteria 1463
388 Ga0495620_0000017 3300046515 Bacteria 153019
389 Ga0495620_0001200 3300046515 Bacteria 15851
390 Ga0495620_0001880 3300046515 Bacteria 12349
391 Ga0495628_0020854 3300046516 Bacteria 5399
392 Ga0495631_0034996 3300046518 Bacteria 2249
393 Ga0495632_0000096 3300046519 Bacteria 89284
394 Ga0495632_0000196 3300046519 Bacteria 61287
395 Ga0495632_0004529 3300046519 Bacteria 9423
396 Ga0495632_0006724 3300046519 Bacteria 7354
397 Ga0495632_0009425 3300046519 Bacteria 5891
398 Ga0495632_0037413 3300046519 Bacteria 2462
399 Ga0495637_0000259 3300046520 Bacteria 41761
400 Ga0495637_0001690 3300046520 Bacteria 12740
401 Ga0495637_0019620 3300046520 Bacteria 3123
402 Ga0495643_0001606 3300046522 Bacteria 20005
403 Ga0495643_0001832 3300046522 Bacteria 18081
404 Ga0495643_0008189 3300046522 Bacteria 6645
405 Ga0495643_0009366 3300046522 Bacteria 6088
406 Ga0495643_0023276 3300046522 Bacteria 3523
407 Ga0495643_0023396 3300046522 Bacteria 3513
408 Ga0495643_0055918 3300046522 Bacteria 2108
409 Ga0495644_0023659 3300046523 Bacteria 2338
410 Ga0495648_0000146 3300046524 Bacteria 84443
411 Ga0495648_0007691 3300046524 Bacteria 8590
412 Ga0495648_0077532 3300046524 Bacteria 1904
413 Ga0495663_0000016 3300046525 Bacteria 142125
414 Ga0495663_0000968 3300046525 Bacteria 9553
415 Ga0495642_0032028 3300046528 Bacteria 2108
416 Ga0495652_0014444 3300046529 Bacteria 7087
417 Ga0495652_0128861 3300046529 Bacteria 2006
418 Ga0495654_0001157 3300046530 Bacteria 18885
419 Ga0495654_0010980 3300046530 Bacteria 4919
420 Ga0495654_0021519 3300046530 Bacteria 3354
421 Ga0495640_0120853 3300046533 Bacteria 1703
422 Ga0495587_0010466 3300046536 Bacteria 5902
423 Ga0495609_0000004 3300046538 Bacteria 697346
424 Ga0495609_0000243 3300046538 Bacteria 51423
425 Ga0495597_0077369 3300046542 Bacteria 1426
426 Ga0495645_0039537 3300046543 Bacteria 3440
427 Ga0495622_0000811 3300046557 Bacteria 17289
428 Ga0495622_0079556 3300046557 Bacteria 1508
429 Ga0495633_0000051 3300046558 Bacteria 154944
430 Ga0495633_0001313 3300046558 Bacteria 19617
431 Ga0495633_0001331 3300046558 Bacteria 19380
432 Ga0495633_0159054 3300046558 Bacteria 1042
433 Ga0495668_0000056 3300046616 Bacteria 197862
434 Ga0495668_0005967 3300046616 Bacteria 8093
435 Ga0495668_0044700 3300046616 Bacteria 2461
436 Ga0495668_0177738 3300046616 Bacteria 1166
437 Ga0495611_0001518 3300046648 Bacteria 11425
438 Ga0495611_0014485 3300046648 Bacteria 3369
439 Ga0495611_0016497 3300046648 Bacteria 3157
440 Ga0495611_0113967 3300046648 Bacteria 1259
441 Ga0495625_0000004 3300046660 Bacteria 611314
442 Ga0495625_0000255 3300046660 Bacteria 82750
443 Ga0495625_0010467 3300046660 Bacteria 7673
444 Ga0495625_0022116 3300046660 Bacteria 4881
445 Ga0495625_0212629 3300046660 Bacteria 1270
446 Ga0495635_0137854 3300046663 Bacteria 1662
447 Ga0495661_0000005 3300046665 Bacteria 433622
448 Ga0495661_0000006 3300046665 Bacteria 427288
449 Ga0495661_0062264 3300046665 Bacteria 2211
450 Ga0495657_0012056 3300046675 Bacteria 6432
451 Ga0495599_0033179 3300046678 Bacteria 3243
452 Ga0495669_0000140 3300046684 Bacteria 45734
453 Ga0495613_0076608 3300046689 Bacteria 2434
454 Ga0495670_0016590 3300046691 Bacteria 3621
455 Ga0495671_0000974 3300046692 Bacteria 20005
456 Ga0495671_0087473 3300046692 Bacteria 1526
457 Ga0495649_0001686 3300046694 Bacteria 16376
458 Ga0495649_0016249 3300046694 Bacteria 4220
459 Ga0495649_0051539 3300046694 Bacteria 2231
460 Ga0495649_0052354 3300046694 Bacteria 2212
461 Ga0495649_0106009 3300046694 Bacteria 1492
462 Ga0495589_0001000 3300046794 Bacteria 17151
463 Ga0495600_0000238 3300046809 Bacteria 30249
464 Ga0495600_0004612 3300046809 Bacteria 8257
465 Ga0495600_0019775 3300046809 Bacteria 4303
466 Ga0495660_0007985 3300046810 Bacteria 6215
467 Ga0495660_0044671 3300046810 Bacteria 2436
468 Ga0495660_0045673 3300046810 Bacteria 2403
469 Ga0495604_0002725 3300047317 Bacteria 14169
470 Ga0495604_0067248 3300047317 Bacteria 2723
471 Ga0495683_0000004 3300047323 Bacteria 321136
472 Ga0495683_0002838 3300047323 Bacteria 10258
473 Ga0495683_0009713 3300047323 Bacteria 5116
474 Ga0495687_000323 3300047443 Bacteria 62186
475 Ga0495687_000353 3300047443 Bacteria 58833
476 Ga0495677_0004893 3300047445 Bacteria 5108
477 Ga0495679_000015 3300047446 Bacteria 287256
478 Ga0495679_008355 3300047446 Bacteria 4217
479 Ga0495673_0000118 3300047469 Bacteria 147670
480 Ga0495673_0000186 3300047469 Bacteria 100563
481 Ga0495673_0011223 3300047469 Bacteria 4832
482 Ga0495673_0011733 3300047469 Bacteria 4691
483 Ga0495681_0000030 3300047470 Bacteria 129910
484 Ga0495681_0002539 3300047470 Bacteria 13002
485 Ga0495681_0010402 3300047470 Bacteria 5632
486 Ga0495681_0019035 3300047470 Bacteria 3763
487 Ga0495681_0079228 3300047470 Bacteria 1470
488 Ga0495684_0124217 3300047471 Bacteria 1942
489 Ga0495686_0000092 3300047472 Bacteria 189292
490 Ga0495686_0000262 3300047472 Bacteria 94462
491 Ga0495686_0054626 3300047472 Bacteria 2500
492 Ga0495686_0079969 3300047472 Bacteria 1999
493 Ga0495686_0085601 3300047472 Bacteria 1919
494 Ga0495686_0103186 3300047472 Bacteria 1718
495 Ga0495686_0210278 3300047472 Unclassified 1112
496 Ga0495615_0000250 3300048090 Bacteria 10525
497 Ga0495626_0000201 3300048091 Bacteria 72576
498 Ga0496102_0000163 3300048905 Bacteria 89673
499 Ga0496102_0465179 3300048905 Bacteria 1186
500 Ga0496103_0000052 3300048906 Bacteria 149437
501 Ga0496104_0001022 3300048907 Bacteria 23940
502 Ga0496104_0004010 3300048907 Bacteria 12763
503 Ga0496105_0001540 3300048908 Bacteria 16320
504 Ga0496105_0004645 3300048908 Bacteria 10353
505 Ga0496105_0017709 3300048908 Bacteria 5716
506 Ga0496106_0037370 3300048909 Bacteria 3633
507 Ga0496106_0067736 3300048909 Bacteria 2722
508 Ga0496110_0022048 3300048913 Bacteria 5402
509 Ga0496110_0308696 3300048913 Bacteria 1441
510 Ga0496111_0053896 3300048914 Bacteria 2906
511 Ga0496114_0012792 3300048917 Bacteria 6718
512 Ga0496114_0035807 3300048917 Bacteria 4100
513 Ga0496115_0000078 3300048918 Bacteria 89817
514 Ga0496115_0001140 3300048918 Bacteria 19184
515 Ga0496115_0035167 3300048918 Bacteria 3962
516 Ga0496115_0199874 3300048918 Bacteria 1651
517 Ga0496116_0002348 3300048919 Bacteria 20011
518 Ga0496116_0022840 3300048919 Bacteria 4673
519 Ga0496116_0118327 3300048919 Bacteria 1539
520 Ga0496117_0000141 3300048920 Bacteria 158041
521 Ga0496117_0014772 3300048920 Bacteria 6702
522 Ga0496117_0072252 3300048920 Bacteria 2308
523 Ga0496117_0139092 3300048920 Bacteria 1457
524 Ga0496118_0000103 3300048921 Bacteria 158099
525 Ga0496118_0001211 3300048921 Bacteria 39688
526 Ga0496118_0007258 3300048921 Bacteria 11817
527 Ga0496118_0007966 3300048921 Bacteria 11076
528 Ga0496118_0013683 3300048921 Bacteria 7656
529 Ga0496118_0229625 3300048921 Bacteria 1072
530 Ga0496119_0000450 3300048922 Bacteria 56283
531 Ga0496119_0008606 3300048922 Bacteria 8934
532 Ga0496119_0009469 3300048922 Bacteria 8352
533 Ga0496119_0012222 3300048922 Bacteria 6999
534 Ga0496119_0149911 3300048922 Bacteria 1251
535 Ga0496120_0001560 3300048923 Bacteria 26816
536 Ga0496120_0003845 3300048923 Bacteria 13194
537 Ga0496120_0029940 3300048923 Bacteria 3317
538 Ga0496120_0030120 3300048923 Bacteria 3304
539 Ga0496120_0034189 3300048923 Bacteria 3048
540 Ga0496120_0052615 3300048923 Bacteria 2318
541 Ga0496120_0062119 3300048923 Bacteria 2082
542 Ga0496121_0000075 3300048924 Bacteria 240437
543 Ga0496121_0000156 3300048924 Bacteria 149376
544 Ga0496121_0002278 3300048924 Bacteria 29851
545 Ga0496121_0067986 3300048924 Bacteria 2885
546 Ga0496121_0074242 3300048924 Bacteria 2721
547 Ga0496121_0081216 3300048924 Bacteria 2567
548 Ga0496121_0203303 3300048924 Bacteria 1410
549 Ga0496121_0208179 3300048924 Bacteria 1388
550 Ga0496122_0001025 3300048925 Bacteria 49395
551 Ga0496122_0001717 3300048925 Bacteria 33994
552 Ga0496122_0003081 3300048925 Bacteria 22440
553 Ga0496122_0011237 3300048925 Bacteria 9098
554 Ga0496122_0048796 3300048925 Bacteria 3250
555 Ga0496122_0058091 3300048925 Bacteria 2867
556 Ga0496122_0217345 3300048925 Bacteria 1100
557 Ga0496123_0000018 3300048926 Bacteria 404553
558 Ga0496123_0000211 3300048926 Bacteria 118697
559 Ga0496123_0000949 3300048926 Bacteria 45130
560 Ga0496123_0004603 3300048926 Bacteria 14356
561 Ga0496123_0005769 3300048926 Bacteria 12308
562 Ga0496123_0011302 3300048926 Bacteria 7759
563 Ga0496123_0015413 3300048926 Bacteria 6270
564 Ga0496123_0017459 3300048926 Bacteria 5770
565 Ga0496123_0029034 3300048926 Bacteria 4083
566 Ga0496123_0070185 3300048926 Bacteria 2194
567 Ga0496123_0075212 3300048926 Bacteria 2086
568 Ga0496123_0102025 3300048926 Bacteria 1666
569 Ga0496123_0189934 3300048926 Bacteria 1063
570 Ga0496124_0000041 3300048927 Bacteria 303887
571 Ga0496124_0000110 3300048927 Bacteria 166321
572 Ga0496124_0000175 3300048927 Bacteria 128785
573 Ga0496124_0002880 3300048927 Bacteria 21737
574 Ga0496124_0007902 3300048927 Bacteria 11204
575 Ga0496124_0035212 3300048927 Bacteria 4382
576 Ga0496124_0044957 3300048927 Bacteria 3787
577 Ga0496124_0100876 3300048927 Bacteria 2339
578 Ga0496124_0111555 3300048927 Bacteria 2200
579 Ga0496125_0000215 3300048928 Bacteria 118487
580 Ga0496125_0000238 3300048928 Bacteria 113252
581 Ga0496125_0004460 3300048928 Bacteria 16141
582 Ga0496125_0005040 3300048928 Bacteria 14904
583 Ga0496125_0022996 3300048928 Bacteria 5770
584 Ga0496125_0116286 3300048928 Bacteria 1921
585 Ga0496125_0118046 3300048928 Bacteria 1901
586 Ga0496125_0127714 3300048928 Bacteria 1798
587 Ga0496126_0000155 3300048929 Bacteria 158816
588 Ga0496126_0007407 3300048929 Bacteria 12040
589 Ga0496126_0015879 3300048929 Bacteria 7560
590 Ga0496126_0035447 3300048929 Bacteria 4677
591 Ga0496126_0069759 3300048929 Bacteria 3133
592 Ga0496126_0074200 3300048929 Bacteria 3022
593 Ga0496126_0483172 3300048929 Bacteria 992
594 Ga0495678_000014 3300049459 Bacteria 313755
595 Ga0495678_008882 3300049459 Bacteria 5024
596 Ga0495682_0016391 3300049460 Bacteria 2805
597 Ga0501031_0054455 3300049568 Bacteria 2607
598 Ga0501031_0083117 3300049568 Bacteria 2087
599 Ga0501032_0000683 3300049569 Bacteria 27581
600 Ga0501032_0004574 3300049569 Bacteria 10409
601 Ga0501032_0017514 3300049569 Bacteria 5029
602 Ga0501032_0098198 3300049569 Bacteria 1941
603 Ga0501032_0255287 3300049569 Bacteria 1137
604 Ga0501033_0000645 3300049570 Bacteria 32274
605 Ga0501033_0001599 3300049570 Bacteria 19914
606 Ga0501033_0068587 3300049570 Bacteria 2607
607 Ga0501033_0126332 3300049570 Bacteria 1854
608 Ga0501034_0004311 3300049571 Bacteria 15861
609 Ga0501034_0053703 3300049571 Bacteria 4057
610 Ga0501034_0139707 3300049571 Bacteria 2403
611 Ga0501034_0235958 3300049571 Bacteria 1776
612 Ga0501034_0419690 3300049571 Bacteria 1259
613 Ga0501034_0429289 3300049571 Bacteria 1241
614 Ga0501036_0003715 3300049572 Bacteria 12236
615 Ga0501036_0099212 3300049572 Bacteria 2463
616 Ga0501036_0216120 3300049572 Bacteria 1610
617 Ga0501037_0000484 3300049573 Bacteria 32262
618 Ga0501037_0000967 3300049573 Bacteria 21322
619 Ga0501038_0002722 3300049574 Bacteria 16485
620 Ga0501038_0114465 3300049574 Bacteria 2231
621 Ga0501038_0206323 3300049574 Bacteria 1575
622 Ga0501038_0301561 3300049574 Bacteria 1257
623 Ga0501038_0443049 3300049574 Bacteria 1000
624 Ga0501039_0001996 3300049575 Bacteria 15093
625 Ga0501042_0033225 3300049578 Bacteria 3657
626 Ga0501043_0000593 3300049579 Bacteria 32115
627 Ga0501043_0001016 3300049579 Bacteria 24650
628 Ga0501043_0071079 3300049579 Bacteria 2734
629 Ga0501043_0119814 3300049579 Bacteria 2064
630 Ga0501046_0000499 3300049580 Bacteria 39177
631 Ga0501046_0010181 3300049580 Bacteria 8091
632 Ga0501046_0105770 3300049580 Bacteria 2155
633 Ga0501046_0231119 3300049580 Bacteria 1366
634 Ga0501047_0001042 3300049581 Bacteria 27709
635 Ga0501047_0011495 3300049581 Bacteria 8380
636 Ga0501047_0106929 3300049581 Bacteria 2679
637 Ga0501047_0249106 3300049581 Bacteria 1625
638 Ga0501048_0022882 3300049582 Bacteria 4569
639 Ga0501048_0032973 3300049582 Bacteria 3743
640 Ga0501067_0007605 3300049583 Bacteria 6026
641 Ga0501068_0001651 3300049584 Bacteria 11922
642 Ga0501068_0059779 3300049584 Bacteria 2314
643 Ga0501069_0000331 3300049585 Bacteria 21342
644 Ga0501069_0008815 3300049585 Bacteria 5314
645 Ga0501070_0001433 3300049586 Bacteria 21342
646 Ga0501070_0003020 3300049586 Bacteria 14651
647 Ga0501070_0067679 3300049586 Bacteria 2958
648 Ga0501071_0045104 3300049587 Bacteria 3164
649 Ga0501071_0128530 3300049587 Bacteria 1881
650 Ga0501072_0542031 3300049588 Bacteria 919
651 Ga0501073_0014323 3300049589 Bacteria 5761
652 Ga0501073_0148255 3300049589 Bacteria 1626
653 Ga0501074_0001744 3300049590 Bacteria 14869
654 Ga0501074_0004226 3300049590 Bacteria 10257
655 Ga0501079_0070522 3300049741 Bacteria 2699
656 Ga0501080_0000326 3300049742 Bacteria 36467
657 Ga0501080_0010446 3300049742 Bacteria 8498
658 Ga0501083_0000748 3300049744 Bacteria 21231
659 Ga0501083_0023811 3300049744 Bacteria 4246
660 Ga0501083_0158829 3300049744 Bacteria 1479
661 Ga0501035_0001846 3300049822 Bacteria 21326
662 Ga0501035_0003801 3300049822 Bacteria 14387
663 Ga0501035_0075200 3300049822 Bacteria 2987
664 Ga0501035_0096409 3300049822 Bacteria 2599
665 Ga0501035_0228851 3300049822 Bacteria 1585
666 Ga0501044_0011279 3300049823 Bacteria 9684
667 Ga0501044_0029503 3300049823 Bacteria 5783
668 Ga0501044_0033544 3300049823 Bacteria 5394
669 Ga0501044_0113430 3300049823 Bacteria 2718
670 Ga0501044_0121158 3300049823 Bacteria 2617
671 Ga0501044_0155576 3300049823 Bacteria 2266
672 Ga0501044_0200826 3300049823 Bacteria 1952
673 Ga0501044_0278169 3300049823 Bacteria 1608
674 Ga0501044_0436134 3300049823 Bacteria 1218
675 Ga0501045_0014252 3300049824 Bacteria 5635
676 nmdc:mga0n895_8184_c1 3300050512 Bacteria 9038
677 nmdc:mga0rr50_3298_c1 3300050513 Bacteria 9266
678 nmdc:mga0a205_10744_c1 3300050515 Bacteria 8416
679 Ga0500610_0000018 3300053079 Bacteria 72777
680 Ga0500610_0048511 3300053079 Bacteria 2208
681 Ga0500643_000225 3300053087 Bacteria 52825
682 Ga0500643_002359 3300053087 Bacteria 9861
683 Ga0500646_0017153 3300053090 Bacteria 1896
684 Ga0500651_0010027 3300053093 Bacteria 5659
685 Ga0500641_0001522 3300053096 Bacteria 8271
686 Ga0500555_001252 3300053103 Bacteria 8149
687 Ga0500562_022854 3300053108 Bacteria 1630
688 Ga0500592_007028 3300053116 Bacteria 1790
689 Ga0500595_002053 3300053119 Bacteria 10287
690 Ga0500595_027264 3300053119 Bacteria 1958
691 Ga0500595_029014 3300053119 Bacteria 1881
692 Ga0500597_000551 3300053120 Bacteria 8071
693 Ga0500607_036360 3300053121 Bacteria 2689
694 Ga0500608_013669 3300053122 Bacteria 3603
695 Ga0500642_0000178 3300053130 Bacteria 26342
696 Ga0500642_0052048 3300053130 Bacteria 1811
697 Ga0500559_0000468 3300053136 Bacteria 28756
698 Ga0500559_0133345 3300053136 Bacteria 1161
699 Ga0500573_0009877 3300053140 Bacteria 5314
700 Ga0500616_0005043 3300053153 Bacteria 9130
701 Ga0500616_0026387 3300053153 Bacteria 3216
702 Ga0500616_0026860 3300053153 Bacteria 3183
703 Ga0500616_0142154 3300053153 Bacteria 1120
704 Ga0500622_0021616 3300053156 Bacteria 3414
705 Ga0500625_002064 3300053729 Bacteria 7336
706 Ga0500645_000073 3300053730 Bacteria 79133
707 Ga0500596_008393 3300053735 Bacteria 1649
708 Ga0501084_0297086 3300054114 Bacteria 1364
709 Ga0501084_0455952 3300054114 Bacteria 1081
710 Ga0500661_000041 3300055283 Bacteria 19487
711 Ga0501082_0214741 3300060353 Bacteria 1673
712 Ga0466962_0054966 3300061719 Bacteria 1902

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2977907340 2977907586 238
2 iso_pu_bacteria 2643221719 2644657109 267
3 3300013100 Ga0157373_10088611 Ga0157373_100886112 268
4 3300042005 Ga0439448_0022430 Ga0439448_0022430_982_1842 268
5 iso_pu_bacteria 2747842428 2747949770 268
6 iso_pu_bacteria 2765235840 2765579157 268
7 iso_pu_bacteria 2919100787 2919106411 268
8 3300003759 Ga0055525_1000013 Ga0055525_1000013308 269
9 3300025230 Ga0209563_100025 Ga0209563_100025278 269
10 iso_pu_bacteria 2503198000 2503201169 269
11 iso_pu_bacteria 2509276022 2509395926 269
12 iso_pu_bacteria 2856320880 2856326966 269
13 iso_pu_bacteria 2869278585 2869283490 269
14 iso_pu_bacteria 2874139085 2874143822 269
15 3300025298 Ga0209050_1004592 Ga0209050_10045926 270
16 3300025924 Ga0207694_10596134 Ga0207694_105961341 270
17 3300028800 Ga0265338_10017529 Ga0265338_100175293 270
18 3300044683 Ga0466965_0147726 Ga0466965_0147726_258_1091 270
19 3300044684 Ga0466966_0000076 Ga0466966_0000076_48977_49825 270
20 3300044684 Ga0466966_0081547 Ga0466966_0081547_521_1354 270
21 3300044694 Ga0466963_0136094 Ga0466963_0136094_469_1317 270
22 3300044719 Ga0466971_0028955 Ga0466971_0028955_1538_2386 270
23 3300044765 Ga0466970_0110734 Ga0466970_0110734_265_1113 270
24 3300044842 Ga0466957_0013567 Ga0466957_0013567_3518_4366 270
25 3300045049 Ga0466959_0000994 Ga0466959_0000994_1528_2376 270
26 3300045049 Ga0466959_0198036 Ga0466959_0198036_43_876 270
27 3300045836 Ga0466958_0000754 Ga0466958_0000754_7210_8058 270
28 3300046512 Ga0495610_0005531 Ga0495610_0005531_4995_5825 270
29 3300047472 Ga0495686_0210278 Ga0495686_0210278_209_1039 270
30 3300048922 Ga0496119_0000450 Ga0496119_0000450_31213_32055 270
31 3300048923 Ga0496120_0034189 Ga0496120_0034189_264_1106 270
32 3300053153 Ga0500616_0142154 Ga0500616_0142154_72_914 270
33 iso_pu_bacteria 2977986579 2977989556 270
34 iso_pu_bacteria 8054002106 8054008268 270
35 3300009093 Ga0105240_10254023 Ga0105240_102540232 271
36 3300037853 Ga0436364_0097704 Ga0436364_0097704_48_878 271
37 3300037853 Ga0436364_0968346 Ga0436364_0968346_6107_6943 271
38 3300039453 Ga0436362_1099931 Ga0436362_1099931_119_958 271
39 3300046506 Ga0495583_0002053 Ga0495583_0002053_16207_17037 271
40 3300046507 Ga0495606_0221039 Ga0495606_0221039_14_850 271
41 3300048907 Ga0496104_0001022 Ga0496104_0001022_8296_9213 271
42 3300048908 Ga0496105_0004645 Ga0496105_0004645_2238_3155 271
43 3300048909 Ga0496106_0037370 Ga0496106_0037370_571_1488 271
44 3300048913 Ga0496110_0022048 Ga0496110_0022048_2110_3027 271
45 3300048917 Ga0496114_0012792 Ga0496114_0012792_226_1068 271
46 3300048919 Ga0496116_0022840 Ga0496116_0022840_1240_2157 271
47 3300048922 Ga0496119_0012222 Ga0496119_0012222_3973_4890 271
48 3300048924 Ga0496121_0208179 Ga0496121_0208179_133_1050 271
49 3300048925 Ga0496122_0217345 Ga0496122_0217345_70_987 271
50 3300048926 Ga0496123_0070185 Ga0496123_0070185_1241_2158 271
51 3300048927 Ga0496124_0007902 Ga0496124_0007902_2108_3025 271
52 3300048928 Ga0496125_0022996 Ga0496125_0022996_3223_4140 271
53 iso_pu_bacteria 2756170246 2756672175 271
54 iso_pu_bacteria 2844002411 2844007874 271
55 iso_pu_bacteria 2871466892 2871471598 271
56 iso_pu_bacteria 2906378014 2906384906 271
57 iso_pu_bacteria 2924733363 2924737229 271
58 iso_pu_bacteria 2937877337 2937884099 271
59 iso_pu_bacteria 2958084443 2958091410 271
60 3300003762 Ga0055542_1000546 Ga0055542_10005467 272
61 3300005327 Ga0070658_10045429 Ga0070658_100454294 272
62 3300005335 Ga0070666_10097645 Ga0070666_100976453 272
63 3300005455 Ga0070663_100388932 Ga0070663_1003889322 272
64 3300005539 Ga0068853_100174820 Ga0068853_1001748202 272
65 3300005578 Ga0068854_100408605 Ga0068854_1004086051 272
66 3300005614 Ga0068856_100106768 Ga0068856_1001067683 272
67 3300005841 Ga0068863_100152267 Ga0068863_1001522672 272
68 3300005843 Ga0068860_100000274 Ga0068860_1000002746 272
69 3300006038 Ga0075365_10012007 Ga0075365_100120072 272
70 3300006042 Ga0075368_10083092 Ga0075368_100830921 272
71 3300006051 Ga0075364_10100396 Ga0075364_101003962 272
72 3300009101 Ga0105247_10341220 Ga0105247_103412201 272
73 3300010375 Ga0105239_10602137 Ga0105239_106021372 272
74 3300025903 Ga0207680_10028915 Ga0207680_100289153 272
75 3300025904 Ga0207647_10085466 Ga0207647_100854662 272
76 3300026067 Ga0207678_10017343 Ga0207678_100173433 272
77 3300028381 Ga0268264_10000058 Ga0268264_10000058257 272
78 3300028381 Ga0268264_10000060 Ga0268264_10000060251 272
79 3300028794 Ga0307515_10021681 Ga0307515_100216817 272
80 3300046694 Ga0495649_0106009 Ga0495649_0106009_179_1009 272
81 3300047469 Ga0495673_0000186 Ga0495673_0000186_16459_17289 272
82 3300047472 Ga0495686_0054626 Ga0495686_0054626_1352_2206 272
83 3300049569 Ga0501032_0255287 Ga0501032_0255287_278_1117 272
84 3300049580 Ga0501046_0231119 Ga0501046_0231119_30_869 272
85 3300053093 Ga0500651_0010027 Ga0500651_0010027_4609_5475 272
86 3300053153 Ga0500616_0026387 Ga0500616_0026387_1015_1896 272
87 3300054114 Ga0501084_0455952 Ga0501084_0455952_169_1008 272
88 iso_pu_bacteria 2593339238 2595448859 272
89 iso_pu_bacteria 2643221605 2644039892 272
90 iso_pu_bacteria 2643221674 2644412703 272
91 iso_pu_bacteria 2671180139 2671694744 272
92 iso_pu_bacteria 2842914999 2842915764 272
93 iso_pu_bacteria 2924776078 2924776444 272
94 iso_pu_bacteria 2937868953 2937877152 272
95 iso_pu_bacteria 2937972304 2937979795 272
96 iso_pu_bacteria 2958041894 2958054346 272
97 iso_pu_bacteria 2958144490 2958146663 272
98 iso_pu_bacteria 2968016561 2968018845 272
99 iso_pu_bacteria 2970469710 2970470982 272
100 iso_pu_bacteria 2970593180 2970598085 272
101 iso_pu_bacteria 2996348954 2996349703 272
102 iso_pu_bacteria 3004275668 3004276409 272
103 iso_pu_bacteria 3004289098 3004295080 272
104 3300002705 JGI25156J39149_1000430 JGI25156J39149_100043017 273
105 3300002738 JGI25154J39366_1000018 JGI25154J39366_1000018246 273
106 3300002741 JGI25157J39369_1000074 JGI25157J39369_100007472 273
107 3300004625 Ga0055543_1009840 Ga0055543_10098402 273
108 3300005262 Ga0065165_1005328 Ga0065165_10053283 273
109 3300005344 Ga0070661_100181882 Ga0070661_1001818823 273
110 3300006881 Ga0068865_100001677 Ga0068865_10000167712 273
111 3300009174 Ga0105241_10558228 Ga0105241_105582281 273
112 3300009551 Ga0105238_10061613 Ga0105238_100616132 273
113 3300021361 Ga0213872_10000106 Ga0213872_1000010616 273
114 3300025206 Ga0209435_100044 Ga0209435_10004483 273
115 3300025246 Ga0209646_1000151 Ga0209646_100015183 273
116 3300025250 Ga0209026_1000170 Ga0209026_100017083 273
117 3300025256 Ga0209759_1000186 Ga0209759_100018685 273
118 3300025302 Ga0207426_1002612 Ga0207426_10026127 273
119 3300025924 Ga0207694_10114313 Ga0207694_101143132 273
120 3300025931 Ga0207644_10094502 Ga0207644_100945022 273
121 3300025938 Ga0207704_10000796 Ga0207704_100007964 273
122 3300026067 Ga0207678_10572964 Ga0207678_105729641 273
123 3300028016 Ga0265354_1001446 Ga0265354_10014462 273
124 3300028017 Ga0265356_1000405 Ga0265356_100040510 273
125 3300030878 Ga0265770_1000128 Ga0265770_10001285 273
126 3300037312 Ga0395899_0000004 Ga0395899_0000004_742454_743287 273
127 3300039447 Ga0436361_0152690 Ga0436361_0152690_14634_15482 273
128 3300046460 Ga0495638_0005941 Ga0495638_0005941_4199_5032 273
129 3300046500 Ga0495596_0110054 Ga0495596_0110054_59_889 273
130 3300046512 Ga0495610_0000157 Ga0495610_0000157_30873_31706 273
131 3300046519 Ga0495632_0006724 Ga0495632_0006724_2798_3640 273
132 3300046616 Ga0495668_0005967 Ga0495668_0005967_6107_6949 273
133 3300046692 Ga0495671_0087473 Ga0495671_0087473_255_1088 273
134 3300048922 Ga0496119_0008606 Ga0496119_0008606_5201_6037 273
135 3300048923 Ga0496120_0062119 Ga0496120_0062119_874_1710 273
136 3300048926 Ga0496123_0189934 Ga0496123_0189934_116_961 273
137 3300048927 Ga0496124_0100876 Ga0496124_0100876_947_1780 273
138 3300048928 Ga0496125_0127714 Ga0496125_0127714_480_1313 273
139 3300049568 Ga0501031_0054455 Ga0501031_0054455_913_1743 273
140 3300049569 Ga0501032_0098198 Ga0501032_0098198_139_975 273
141 3300049570 Ga0501033_0068587 Ga0501033_0068587_800_1630 273
142 3300049571 Ga0501034_0139707 Ga0501034_0139707_890_1723 273
143 3300049571 Ga0501034_0429289 Ga0501034_0429289_362_1192 273
144 3300049574 Ga0501038_0206323 Ga0501038_0206323_27_863 273
145 3300049574 Ga0501038_0443049 Ga0501038_0443049_130_960 273
146 3300049581 Ga0501047_0011495 Ga0501047_0011495_6441_7280 273
147 3300049822 Ga0501035_0075200 Ga0501035_0075200_139_975 273
148 3300049823 Ga0501044_0121158 Ga0501044_0121158_858_1688 273
149 3300049823 Ga0501044_0278169 Ga0501044_0278169_467_1306 273
150 3300049823 Ga0501044_0436134 Ga0501044_0436134_154_984 273
151 3300053140 Ga0500573_0009877 Ga0500573_0009877_3460_4317 273
152 iso_pu_bacteria 2509276018 2509368191 273
153 iso_pu_bacteria 2513237084 2513573993 273
154 iso_pu_bacteria 2516653077 2517036449 273
155 iso_pu_bacteria 2687453392 2688598084 273
156 iso_pu_bacteria 2958122699 2958127468 273
157 iso_pu_bacteria 2958137437 2958139420 273
158 iso_pu_bacteria 2958158011 2958158116 273
159 iso_pu_bacteria 2961136820 2961138357 273
160 iso_pu_bacteria 2965025482 2965026089 273
161 iso_pu_bacteria 2965032056 2965034981 273
162 iso_pu_bacteria 2965040258 2965047536 273
163 iso_pu_bacteria 2965047637 2965051737 273
164 iso_pu_bacteria 2965089291 2965091916 273
165 iso_pu_bacteria 2965102966 2965104137 273
166 iso_pu_bacteria 2965110997 2965112200 273
167 iso_pu_bacteria 2970547951 2970551783 273
168 iso_pu_bacteria 2977872689 2977877807 273
169 iso_pu_bacteria 2977915119 2977915703 273
170 iso_pu_bacteria 2977935797 2977936673 273
171 iso_pu_bacteria 2977950692 2977951286 273
172 iso_pu_bacteria 2977957713 2977958629 273
173 iso_pu_bacteria 2979793036 2979794681 273
174 iso_pu_bacteria 2987673487 2987678399 273
175 iso_pu_bacteria 649633066 649872618 273
176 iso_pu_bacteria 8004300914 8004306901 273
177 iso_pu_bacteria 8004361976 8004369311 273
178 iso_pu_bacteria 8004695233 8004702020 273
179 3300001989 JGI24739J22299_10009539 JGI24739J22299_100095392 274
180 3300001990 JGI24737J22298_10004299 JGI24737J22298_100042993 274
181 3300002067 JGI24735J21928_10005340 JGI24735J21928_100053402 274
182 3300002705 JGI25156J39149_1005097 JGI25156J39149_10050973 274
183 3300002741 JGI25157J39369_1000564 JGI25157J39369_100056419 274
184 3300003752 Ga0055539_1001378 Ga0055539_10013782 274
185 3300003756 Ga0055533_1004286 Ga0055533_10042863 274
186 3300003760 Ga0055527_1000190 Ga0055527_100019038 274
187 3300003761 Ga0055535_1000397 Ga0055535_10003972 274
188 3300003762 Ga0055542_1000043 Ga0055542_1000043128 274
189 3300003763 Ga0055529_1000380 Ga0055529_100038043 274
190 3300003792 Ga0055540_1001153 Ga0055540_10011535 274
191 3300003794 Ga0055531_10006682 Ga0055531_100066824 274
192 3300005327 Ga0070658_10214783 Ga0070658_102147832 274
193 3300005435 Ga0070714_100199881 Ga0070714_1001998813 274
194 3300005455 Ga0070663_100045480 Ga0070663_1000454803 274
195 3300005457 Ga0070662_100064143 Ga0070662_1000641432 274
196 3300005539 Ga0068853_100179669 Ga0068853_1001796692 274
197 3300005563 Ga0068855_100020329 Ga0068855_1000203297 274
198 3300005563 Ga0068855_100219778 Ga0068855_1002197782 274
199 3300005577 Ga0068857_100008515 Ga0068857_1000085154 274
200 3300005614 Ga0068856_100001457 Ga0068856_10000145715 274
201 3300005614 Ga0068856_100026353 Ga0068856_1000263532 274
202 3300005616 Ga0068852_100015364 Ga0068852_1000153644 274
203 3300005983 Ga0081540_1026589 Ga0081540_10265893 274
204 3300009093 Ga0105240_10004777 Ga0105240_1000477718 274
205 3300009093 Ga0105240_10005953 Ga0105240_100059539 274
206 3300009174 Ga0105241_10014367 Ga0105241_100143675 274
207 3300009174 Ga0105241_10015541 Ga0105241_100155413 274
208 3300009545 Ga0105237_10002112 Ga0105237_1000211214 274
209 3300009551 Ga0105238_10060936 Ga0105238_100609363 274
210 3300010375 Ga0105239_10007523 Ga0105239_100075237 274
211 3300010375 Ga0105239_10096883 Ga0105239_100968833 274
212 3300010375 Ga0105239_10164843 Ga0105239_101648432 274
213 3300021384 Ga0213876_10010245 Ga0213876_100102453 274
214 3300025226 Ga0209674_100170 Ga0209674_10017036 274
215 3300025226 Ga0209674_101002 Ga0209674_10100211 274
216 3300025228 Ga0209672_100009 Ga0209672_100009602 274
217 3300025242 Ga0209258_100011 Ga0209258_10001142 274
218 3300025250 Ga0209026_1000070 Ga0209026_100007079 274
219 3300025254 Ga0209148_1000013 Ga0209148_100001342 274
220 3300025256 Ga0209759_1000285 Ga0209759_100028511 274
221 3300025263 Ga0209565_1000100 Ga0209565_1000100119 274
222 3300025272 Ga0209455_1000012 Ga0209455_100001242 274
223 3300025294 Ga0209025_1000044 Ga0209025_100004480 274
224 3300025297 Ga0209758_1011384 Ga0209758_10113844 274
225 3300025298 Ga0209050_1000001 Ga0209050_10000012795 274
226 3300025302 Ga0207426_1007314 Ga0207426_10073141 274
227 3300025303 Ga0209051_1000279 Ga0209051_10002797 274
228 3300025304 Ga0209257_1001934 Ga0209257_100193420 274
229 3300025904 Ga0207647_10004518 Ga0207647_100045186 274
230 3300025911 Ga0207654_10074846 Ga0207654_100748463 274
231 3300025913 Ga0207695_10000015 Ga0207695_10000015169 274
232 3300025913 Ga0207695_10030300 Ga0207695_100303004 274
233 3300025914 Ga0207671_10012369 Ga0207671_100123695 274
234 3300025924 Ga0207694_10057256 Ga0207694_100572562 274
235 3300025949 Ga0207667_10012423 Ga0207667_100124232 274
236 3300025981 Ga0207640_10041502 Ga0207640_100415022 274
237 3300025981 Ga0207640_10042590 Ga0207640_100425903 274
238 3300025981 Ga0207640_10206011 Ga0207640_102060112 274
239 3300026041 Ga0207639_10034085 Ga0207639_100340852 274
240 3300026067 Ga0207678_10126428 Ga0207678_101264282 274
241 3300026078 Ga0207702_10011648 Ga0207702_100116486 274
242 3300026078 Ga0207702_10028184 Ga0207702_100281843 274
243 3300026116 Ga0207674_10009769 Ga0207674_100097693 274
244 3300031250 Ga0265331_10034213 Ga0265331_100342132 274
245 3300032004 Ga0307414_10000835 Ga0307414_1000083515 274
246 3300033180 Ga0307510_10129345 Ga0307510_101293452 274
247 3300037312 Ga0395899_0000228 Ga0395899_0000228_57343_58197 274
248 3300037418 Ga0395900_0000070 Ga0395900_0000070_143406_144260 274
249 3300037466 Ga0395898_0000501 Ga0395898_0000501_57325_58179 274
250 3300037853 Ga0436364_0237048 Ga0436364_0237048_1017_1868 274
251 3300038443 Ga0395901_0502247 Ga0395901_0502247_314_1168 274
252 3300039437 Ga0436365_0178523 Ga0436365_0178523_4141_4971 274
253 3300039437 Ga0436365_1181455 Ga0436365_1181455_978_1829 274
254 3300044684 Ga0466966_0013501 Ga0466966_0013501_1636_2490 274
255 3300044693 Ga0466961_0010995 Ga0466961_0010995_2790_3644 274
256 3300044693 Ga0466961_0119707 Ga0466961_0119707_701_1543 274
257 3300044765 Ga0466970_0012421 Ga0466970_0012421_1934_2788 274
258 3300044765 Ga0466970_0118932 Ga0466970_0118932_117_959 274
259 3300045049 Ga0466959_0000058 Ga0466959_0000058_22334_23188 274
260 3300045049 Ga0466959_0047784 Ga0466959_0047784_1021_1857 274
261 3300045836 Ga0466958_0161111 Ga0466958_0161111_417_1271 274
262 3300046459 Ga0495629_0004264 Ga0495629_0004264_8752_9585 274
263 3300046462 Ga0495651_0003944 Ga0495651_0003944_10372_11205 274
264 3300046462 Ga0495651_0114085 Ga0495651_0114085_1094_1927 274
265 3300046463 Ga0495653_0129879 Ga0495653_0129879_48_881 274
266 3300046471 Ga0495650_0000470 Ga0495650_0000470_33564_34400 274
267 3300046471 Ga0495650_0036072 Ga0495650_0036072_903_1739 274
268 3300046506 Ga0495583_0001366 Ga0495583_0001366_2612_3448 274
269 3300046511 Ga0495608_0035426 Ga0495608_0035426_1187_2020 274
270 3300046512 Ga0495610_0000013 Ga0495610_0000013_43167_43997 274
271 3300046515 Ga0495620_0001880 Ga0495620_0001880_4873_5703 274
272 3300046516 Ga0495628_0020854 Ga0495628_0020854_1405_2238 274
273 3300046529 Ga0495652_0014444 Ga0495652_0014444_4244_5077 274
274 3300046529 Ga0495652_0128861 Ga0495652_0128861_181_1014 274
275 3300046533 Ga0495640_0120853 Ga0495640_0120853_845_1678 274
276 3300046536 Ga0495587_0010466 Ga0495587_0010466_4868_5701 274
277 3300046543 Ga0495645_0039537 Ga0495645_0039537_2246_3079 274
278 3300046663 Ga0495635_0137854 Ga0495635_0137854_198_1031 274
279 3300046675 Ga0495657_0012056 Ga0495657_0012056_2333_3166 274
280 3300046678 Ga0495599_0033179 Ga0495599_0033179_890_1723 274
281 3300046689 Ga0495613_0076608 Ga0495613_0076608_1028_1861 274
282 3300046809 Ga0495600_0004612 Ga0495600_0004612_443_1276 274
283 3300046809 Ga0495600_0019775 Ga0495600_0019775_669_1502 274
284 3300047317 Ga0495604_0002725 Ga0495604_0002725_7169_8002 274
285 3300047317 Ga0495604_0067248 Ga0495604_0067248_1308_2141 274
286 3300047471 Ga0495684_0124217 Ga0495684_0124217_1024_1857 274
287 3300047472 Ga0495686_0000262 Ga0495686_0000262_92424_93266 274
288 3300047472 Ga0495686_0079969 Ga0495686_0079969_476_1324 274
289 3300047472 Ga0495686_0085601 Ga0495686_0085601_942_1772 274
290 3300048905 Ga0496102_0465179 Ga0496102_0465179_242_1078 274
291 3300048907 Ga0496104_0004010 Ga0496104_0004010_5074_5907 274
292 3300048908 Ga0496105_0017709 Ga0496105_0017709_4359_5192 274
293 3300048913 Ga0496110_0308696 Ga0496110_0308696_114_947 274
294 3300048918 Ga0496115_0199874 Ga0496115_0199874_374_1207 274
295 3300048921 Ga0496118_0013683 Ga0496118_0013683_6214_7047 274
296 3300048922 Ga0496119_0009469 Ga0496119_0009469_1207_2040 274
297 3300048923 Ga0496120_0030120 Ga0496120_0030120_2051_2884 274
298 3300048924 Ga0496121_0002278 Ga0496121_0002278_3076_3909 274
299 3300048924 Ga0496121_0067986 Ga0496121_0067986_340_1194 274
300 3300048924 Ga0496121_0074242 Ga0496121_0074242_1354_2205 274
301 3300048924 Ga0496121_0081216 Ga0496121_0081216_77_910 274
302 3300048926 Ga0496123_0000018 Ga0496123_0000018_310966_311799 274
303 3300048926 Ga0496123_0075212 Ga0496123_0075212_421_1263 274
304 3300048928 Ga0496125_0000215 Ga0496125_0000215_88160_88993 274
305 3300048928 Ga0496125_0118046 Ga0496125_0118046_710_1543 274
306 3300049460 Ga0495682_0016391 Ga0495682_0016391_35_868 274
307 3300049579 Ga0501043_0119814 Ga0501043_0119814_977_1816 274
308 3300053079 Ga0500610_0048511 Ga0500610_0048511_896_1729 274
309 3300053119 Ga0500595_029014 Ga0500595_029014_818_1651 274
310 3300053121 Ga0500607_036360 Ga0500607_036360_856_1692 274
311 3300053122 Ga0500608_013669 Ga0500608_013669_1374_2246 274
312 3300053153 Ga0500616_0005043 Ga0500616_0005043_4950_5780 274
313 3300061719 Ga0466962_0054966 Ga0466962_0054966_896_1732 274
314 iso_pu_bacteria 2643221595 2643987696 274
315 iso_pu_bacteria 2643221627 2644156692 274
316 iso_pu_bacteria 2937980651 2937985594 274
317 iso_pu_bacteria 2958108152 2958114751 274
318 iso_pu_bacteria 2961183825 2961187429 274
319 iso_pu_bacteria 2968138860 2968145958 274
320 iso_pu_bacteria 2970489779 2970493242 274
321 iso_pu_bacteria 2970532167 2970538031 274
322 iso_pu_bacteria 2970619444 2970621688 274
323 iso_pu_bacteria 2970627176 2970628552 274
324 iso_pu_bacteria 2977851361 2977857319 274
325 iso_pu_bacteria 2979764755 2979770712 274
326 iso_pu_bacteria 2979772303 2979778371 274
327 iso_pu_bacteria 2996386984 2996388965 274
328 iso_pu_bacteria 3004167301 3004168404 274
329 iso_pu_bacteria 3004232784 3004234812 274
330 iso_pu_bacteria 3004248173 3004253577 274
331 iso_pu_bacteria 3004268573 3004273001 274
332 iso_pu_bacteria 8004312739 8004317984 274
333 iso_pu_bacteria 8004727605 8004729192 274
334 3300001904 JGI24736J21556_1001546 JGI24736J21556_10015462 275
335 3300001904 JGI24736J21556_1006811 JGI24736J21556_10068112 275
336 3300001915 JGI24741J21665_1012915 JGI24741J21665_10129152 275
337 3300001979 JGI24740J21852_10031332 JGI24740J21852_100313322 275
338 3300001989 JGI24739J22299_10011259 JGI24739J22299_100112591 275
339 3300001989 JGI24739J22299_10023269 JGI24739J22299_100232693 275
340 3300001989 JGI24739J22299_10038737 JGI24739J22299_100387372 275
341 3300001990 JGI24737J22298_10032342 JGI24737J22298_100323422 275
342 3300002067 JGI24735J21928_10003343 JGI24735J21928_100033432 275
343 3300002067 JGI24735J21928_10023509 JGI24735J21928_100235091 275
344 3300002067 JGI24735J21928_10038041 JGI24735J21928_100380412 275
345 3300002075 JGI24738J21930_10007946 JGI24738J21930_100079462 275
346 3300002244 JGI24742J22300_10005287 JGI24742J22300_100052873 275
347 3300002705 JGI25156J39149_1006965 JGI25156J39149_10069654 275
348 3300002741 JGI25157J39369_1000921 JGI25157J39369_10009214 275
349 3300003214 JGI25165J46597_1000020 JGI25165J46597_1000020259 275
350 3300003214 JGI25165J46597_1000021 JGI25165J46597_100002189 275
351 3300003215 JGI25153J46596_10000070 JGI25153J46596_1000007048 275
352 3300003316 rootH1_10012195 rootH1_100121959 275
353 3300003759 Ga0055525_1000203 Ga0055525_100020343 275
354 3300003762 Ga0055542_1000040 Ga0055542_1000040139 275
355 3300003763 Ga0055529_1000037 Ga0055529_100003782 275
356 3300003781 Ga0055536_1001410 Ga0055536_10014107 275
357 3300004625 Ga0055543_1008796 Ga0055543_10087962 275
358 3300005262 Ga0065165_1000214 Ga0065165_10002145 275
359 3300005327 Ga0070658_10003583 Ga0070658_100035835 275
360 3300005327 Ga0070658_10014451 Ga0070658_100144512 275
361 3300005327 Ga0070658_10125565 Ga0070658_101255653 275
362 3300005329 Ga0070683_100285764 Ga0070683_1002857641 275
363 3300005331 Ga0070670_100089110 Ga0070670_1000891104 275
364 3300005331 Ga0070670_100161730 Ga0070670_1001617301 275
365 3300005335 Ga0070666_10000046 Ga0070666_1000004620 275
366 3300005337 Ga0070682_100048577 Ga0070682_1000485772 275
367 3300005339 Ga0070660_100009935 Ga0070660_1000099355 275
368 3300005344 Ga0070661_100008770 Ga0070661_1000087705 275
369 3300005344 Ga0070661_100051676 Ga0070661_1000516762 275
370 3300005345 Ga0070692_10216655 Ga0070692_102166551 275
371 3300005354 Ga0070675_100222429 Ga0070675_1002224291 275
372 3300005356 Ga0070674_100015015 Ga0070674_1000150153 275
373 3300005356 Ga0070674_100098110 Ga0070674_1000981101 275
374 3300005366 Ga0070659_100000274 Ga0070659_10000027413 275
375 3300005366 Ga0070659_100126875 Ga0070659_1001268754 275
376 3300005367 Ga0070667_100074476 Ga0070667_1000744764 275
377 3300005367 Ga0070667_100181404 Ga0070667_1001814042 275
378 3300005455 Ga0070663_100003022 Ga0070663_10000302210 275
379 3300005455 Ga0070663_100188735 Ga0070663_1001887352 275
380 3300005456 Ga0070678_100000523 Ga0070678_1000005236 275
381 3300005457 Ga0070662_100079136 Ga0070662_1000791363 275
382 3300005459 Ga0068867_100292692 Ga0068867_1002926922 275
383 3300005535 Ga0070684_100105147 Ga0070684_1001051472 275
384 3300005539 Ga0068853_100140670 Ga0068853_1001406702 275
385 3300005543 Ga0070672_100283192 Ga0070672_1002831922 275
386 3300005548 Ga0070665_100057418 Ga0070665_1000574184 275
387 3300005548 Ga0070665_100177577 Ga0070665_1001775773 275
388 3300005563 Ga0068855_100003956 Ga0068855_1000039568 275
389 3300005563 Ga0068855_100035135 Ga0068855_1000351352 275
390 3300005563 Ga0068855_100370110 Ga0068855_1003701101 275
391 3300005577 Ga0068857_100112429 Ga0068857_1001124292 275
392 3300005578 Ga0068854_100066352 Ga0068854_1000663524 275
393 3300005578 Ga0068854_100131105 Ga0068854_1001311052 275
394 3300005614 Ga0068856_100021865 Ga0068856_1000218656 275
395 3300005614 Ga0068856_100465744 Ga0068856_1004657442 275
396 3300005616 Ga0068852_100011426 Ga0068852_1000114262 275
397 3300005843 Ga0068860_100409261 Ga0068860_1004092612 275
398 3300005985 Ga0081539_10008834 Ga0081539_100088347 275
399 3300006028 Ga0070717_10133670 Ga0070717_101336702 275
400 3300006358 Ga0068871_100260598 Ga0068871_1002605982 275
401 3300006871 Ga0075434_100007651 Ga0075434_10000765111 275
402 3300007076 Ga0075435_100004917 Ga0075435_10000491711 275
403 3300007265 Ga0099794_10060084 Ga0099794_100600842 275
404 3300009011 Ga0105251_10046708 Ga0105251_100467082 275
405 3300009093 Ga0105240_10000005 Ga0105240_10000005138 275
406 3300009093 Ga0105240_10178901 Ga0105240_101789013 275
407 3300009093 Ga0105240_10180163 Ga0105240_101801633 275
408 3300009093 Ga0105240_10418966 Ga0105240_104189662 275
409 3300009093 Ga0105240_10571677 Ga0105240_105716771 275
410 3300009148 Ga0105243_10000913 Ga0105243_1000091320 275
411 3300009177 Ga0105248_10302657 Ga0105248_103026572 275
412 3300009545 Ga0105237_10010055 Ga0105237_100100554 275
413 3300009545 Ga0105237_10267651 Ga0105237_102676512 275
414 3300009551 Ga0105238_10000521 Ga0105238_1000052113 275
415 3300009551 Ga0105238_10001346 Ga0105238_1000134612 275
416 3300009551 Ga0105238_10125893 Ga0105238_101258932 275
417 3300010375 Ga0105239_10002672 Ga0105239_100026724 275
418 3300010375 Ga0105239_10014042 Ga0105239_100140424 275
419 3300010375 Ga0105239_10016174 Ga0105239_100161747 275
420 3300010375 Ga0105239_10057743 Ga0105239_100577434 275
421 3300010375 Ga0105239_10079994 Ga0105239_100799941 275
422 3300010375 Ga0105239_10461165 Ga0105239_104611652 275
423 3300010375 Ga0105239_10640324 Ga0105239_106403242 275
424 3300010375 Ga0105239_10836098 Ga0105239_108360981 275
425 3300013100 Ga0157373_10031474 Ga0157373_100314744 275
426 3300013100 Ga0157373_10064685 Ga0157373_100646853 275
427 3300013104 Ga0157370_10000163 Ga0157370_1000016388 275
428 3300013104 Ga0157370_10001660 Ga0157370_100016602 275
429 3300013104 Ga0157370_10011892 Ga0157370_100118928 275
430 3300013104 Ga0157370_10024273 Ga0157370_100242735 275
431 3300013104 Ga0157370_10084264 Ga0157370_100842644 275
432 3300013105 Ga0157369_10169296 Ga0157369_101692962 275
433 3300013105 Ga0157369_10179974 Ga0157369_101799743 275
434 3300013105 Ga0157369_10223096 Ga0157369_102230961 275
435 3300013105 Ga0157369_10368046 Ga0157369_103680462 275
436 3300013306 Ga0163162_10002496 Ga0163162_100024962 275
437 3300013306 Ga0163162_10127536 Ga0163162_101275365 275
438 3300013306 Ga0163162_10698990 Ga0163162_106989902 275
439 3300013307 Ga0157372_10031478 Ga0157372_100314785 275
440 3300013307 Ga0157372_10186993 Ga0157372_101869932 275
441 3300014497 Ga0182008_10069423 Ga0182008_100694232 275
442 3300014969 Ga0157376_10204192 Ga0157376_102041922 275
443 3300015265 Ga0182005_1000027 Ga0182005_100002728 275
444 3300025226 Ga0209674_100393 Ga0209674_1003939 275
445 3300025230 Ga0209563_100147 Ga0209563_10014744 275
446 3300025231 Ga0207427_105671 Ga0207427_1056712 275
447 3300025233 Ga0209437_101211 Ga0209437_1012115 275
448 3300025250 Ga0209026_1000005 Ga0209026_1000005583 275
449 3300025253 Ga0209677_109016 Ga0209677_1090162 275
450 3300025254 Ga0209148_1000011 Ga0209148_10000111036 275
451 3300025254 Ga0209148_1000686 Ga0209148_100068618 275
452 3300025256 Ga0209759_1000111 Ga0209759_100011150 275
453 3300025261 Ga0209233_1000047 Ga0209233_100004776 275
454 3300025261 Ga0209233_1000065 Ga0209233_100006590 275
455 3300025272 Ga0209455_1000006 Ga0209455_1000006156 275
456 3300025292 Ga0209676_1000115 Ga0209676_100011563 275
457 3300025297 Ga0209758_1000023 Ga0209758_1000023425 275
458 3300025302 Ga0207426_1053787 Ga0207426_10537872 275
459 3300025303 Ga0209051_1006951 Ga0209051_10069514 275
460 3300025304 Ga0209257_1000090 Ga0209257_100009045 275
461 3300025304 Ga0209257_1011200 Ga0209257_10112004 275
462 3300025903 Ga0207680_10000003 Ga0207680_10000003707 275
463 3300025904 Ga0207647_10000007 Ga0207647_10000007113 275
464 3300025904 Ga0207647_10004336 Ga0207647_1000433612 275
465 3300025904 Ga0207647_10088924 Ga0207647_100889242 275
466 3300025908 Ga0207643_10126526 Ga0207643_101265262 275
467 3300025909 Ga0207705_10000891 Ga0207705_100008915 275
468 3300025909 Ga0207705_10005791 Ga0207705_100057919 275
469 3300025913 Ga0207695_10000011 Ga0207695_10000011777 275
470 3300025913 Ga0207695_10366167 Ga0207695_103661672 275
471 3300025913 Ga0207695_10401380 Ga0207695_104013801 275
472 3300025914 Ga0207671_10015930 Ga0207671_100159304 275
473 3300025914 Ga0207671_10076929 Ga0207671_100769292 275
474 3300025919 Ga0207657_10023163 Ga0207657_100231635 275
475 3300025920 Ga0207649_10005284 Ga0207649_100052846 275
476 3300025924 Ga0207694_10015326 Ga0207694_100153266 275
477 3300025925 Ga0207650_10273003 Ga0207650_102730032 275
478 3300025932 Ga0207690_10000092 Ga0207690_1000009236 275
479 3300025935 Ga0207709_10000039 Ga0207709_10000039157 275
480 3300025937 Ga0207669_10000117 Ga0207669_100001177 275
481 3300025941 Ga0207711_10231928 Ga0207711_102319282 275
482 3300025949 Ga0207667_10000002 Ga0207667_10000002892 275
483 3300025949 Ga0207667_10018525 Ga0207667_100185258 275
484 3300025960 Ga0207651_10092633 Ga0207651_100926331 275
485 3300025986 Ga0207658_10453650 Ga0207658_104536502 275
486 3300026035 Ga0207703_10216921 Ga0207703_102169212 275
487 3300026041 Ga0207639_10047677 Ga0207639_100476773 275
488 3300026067 Ga0207678_10217866 Ga0207678_102178661 275
489 3300026078 Ga0207702_10120372 Ga0207702_101203722 275
490 3300026089 Ga0207648_10199901 Ga0207648_101999012 275
491 3300026116 Ga0207674_10136354 Ga0207674_101363543 275
492 3300026116 Ga0207674_10360958 Ga0207674_103609581 275
493 3300026121 Ga0207683_10008488 Ga0207683_1000848810 275
494 3300026142 Ga0207698_10199835 Ga0207698_101998352 275
495 3300026142 Ga0207698_10247253 Ga0207698_102472531 275
496 3300028379 Ga0268266_10000011 Ga0268266_10000011645 275
497 3300028381 Ga0268264_10013032 Ga0268264_100130322 275
498 3300028786 Ga0307517_10044986 Ga0307517_100449864 275
499 3300028794 Ga0307515_10013091 Ga0307515_1001309114 275
500 3300031090 Ga0265760_10018201 Ga0265760_100182012 275
501 3300031901 Ga0307406_10021673 Ga0307406_100216732 275
502 3300031911 Ga0307412_10000751 Ga0307412_100007518 275
503 3300033180 Ga0307510_10008938 Ga0307510_1000893816 275
504 3300033180 Ga0307510_10038241 Ga0307510_100382411 275
505 3300033180 Ga0307510_10159368 Ga0307510_101593682 275
506 3300037068 Ga0373925_0106780 Ga0373925_0106780_19_858 275
507 3300037312 Ga0395899_0012532 Ga0395899_0012532_1868_2713 275
508 3300037418 Ga0395900_0000052 Ga0395900_0000052_64876_65721 275
509 3300037466 Ga0395898_0012979 Ga0395898_0012979_1351_2196 275
510 3300037471 Ga0395905_0000622 Ga0395905_0000622_35461_36324 275
511 3300037471 Ga0395905_0015761 Ga0395905_0015761_2312_3157 275
512 3300037471 Ga0395905_0022154 Ga0395905_0022154_2296_3177 275
513 3300037471 Ga0395905_0060948 Ga0395905_0060948_466_1317 275
514 3300037471 Ga0395905_0520845 Ga0395905_0520845_89_946 275
515 3300037853 Ga0436364_0669598 Ga0436364_0669598_438_1298 275
516 3300038443 Ga0395901_0000001 Ga0395901_0000001_722279_723124 275
517 3300038443 Ga0395901_0008360 Ga0395901_0008360_2252_3085 275
518 3300038443 Ga0395901_0014150 Ga0395901_0014150_5945_6778 275
519 3300038443 Ga0395901_0084393 Ga0395901_0084393_393_1223 275
520 3300038705 Ga0237819_00668 Ga0237819_00668_9216_10100 275
521 3300041456 Ga0451795_0775736 Ga0451795_0775736_472_1302 275
522 3300042157 Ga0439458_0004032 Ga0439458_0004032_425_1309 275
523 3300044658 Ga0466972_0087225 Ga0466972_0087225_234_1073 275
524 3300044683 Ga0466965_0104928 Ga0466965_0104928_530_1369 275
525 3300044735 Ga0466968_0027748 Ga0466968_0027748_1133_1978 275
526 3300044901 Ga0466960_0075796 Ga0466960_0075796_226_1059 275
527 3300046453 Ga0495627_000082 Ga0495627_000082_14909_15745 275
528 3300046453 Ga0495627_016270 Ga0495627_016270_1059_1895 275
529 3300046459 Ga0495629_0047480 Ga0495629_0047480_2132_2974 275
530 3300046460 Ga0495638_0007585 Ga0495638_0007585_4384_5229 275
531 3300046471 Ga0495650_0000616 Ga0495650_0000616_32580_33416 275
532 3300046471 Ga0495650_0053687 Ga0495650_0053687_679_1509 275
533 3300046474 Ga0495605_0000050 Ga0495605_0000050_75016_75852 275
534 3300046474 Ga0495605_0119065 Ga0495605_0119065_179_1042 275
535 3300046491 Ga0495584_0050095 Ga0495584_0050095_130_960 275
536 3300046491 Ga0495584_0058559 Ga0495584_0058559_428_1258 275
537 3300046492 Ga0495585_0003969 Ga0495585_0003969_1102_1932 275
538 3300046492 Ga0495585_0008789 Ga0495585_0008789_4882_5712 275
539 3300046492 Ga0495585_0212604 Ga0495585_0212604_32_862 275
540 3300046499 Ga0495594_0000310 Ga0495594_0000310_8980_9816 275
541 3300046500 Ga0495596_0001637 Ga0495596_0001637_5434_6264 275
542 3300046501 Ga0495607_0000006 Ga0495607_0000006_138117_138971 275
543 3300046501 Ga0495607_0008757 Ga0495607_0008757_907_1746 275
544 3300046506 Ga0495583_0000002 Ga0495583_0000002_524185_525042 275
545 3300046506 Ga0495583_0000007 Ga0495583_0000007_391529_392365 275
546 3300046506 Ga0495583_0005931 Ga0495583_0005931_1728_2558 275
547 3300046507 Ga0495606_0000092 Ga0495606_0000092_120029_120859 275
548 3300046507 Ga0495606_0000281 Ga0495606_0000281_53718_54548 275
549 3300046507 Ga0495606_0002734 Ga0495606_0002734_18091_18927 275
550 3300046507 Ga0495606_0091812 Ga0495606_0091812_856_1692 275
551 3300046507 Ga0495606_0169829 Ga0495606_0169829_235_1092 275
552 3300046512 Ga0495610_0000525 Ga0495610_0000525_34223_35092 275
553 3300046512 Ga0495610_0000606 Ga0495610_0000606_22414_23250 275
554 3300046512 Ga0495610_0055474 Ga0495610_0055474_283_1113 275
555 3300046513 Ga0495616_0000286 Ga0495616_0000286_34222_35124 275
556 3300046513 Ga0495616_0040799 Ga0495616_0040799_481_1311 275
557 3300046513 Ga0495616_0089173 Ga0495616_0089173_104_934 275
558 3300046515 Ga0495620_0000017 Ga0495620_0000017_61377_62213 275
559 3300046515 Ga0495620_0001200 Ga0495620_0001200_14915_15775 275
560 3300046518 Ga0495631_0034996 Ga0495631_0034996_644_1474 275
561 3300046519 Ga0495632_0000096 Ga0495632_0000096_15944_16780 275
562 3300046519 Ga0495632_0000196 Ga0495632_0000196_14847_15680 275
563 3300046519 Ga0495632_0004529 Ga0495632_0004529_6063_6899 275
564 3300046519 Ga0495632_0009425 Ga0495632_0009425_2175_3098 275
565 3300046519 Ga0495632_0037413 Ga0495632_0037413_679_1509 275
566 3300046520 Ga0495637_0000259 Ga0495637_0000259_25918_26748 275
567 3300046520 Ga0495637_0001690 Ga0495637_0001690_5799_6635 275
568 3300046520 Ga0495637_0019620 Ga0495637_0019620_2102_2932 275
569 3300046522 Ga0495643_0001606 Ga0495643_0001606_2619_3455 275
570 3300046522 Ga0495643_0001832 Ga0495643_0001832_5452_6282 275
571 3300046522 Ga0495643_0008189 Ga0495643_0008189_3080_3910 275
572 3300046522 Ga0495643_0009366 Ga0495643_0009366_5043_5879 275
573 3300046522 Ga0495643_0023276 Ga0495643_0023276_1907_2737 275
574 3300046522 Ga0495643_0023396 Ga0495643_0023396_2189_3019 275
575 3300046522 Ga0495643_0055918 Ga0495643_0055918_825_1661 275
576 3300046523 Ga0495644_0023659 Ga0495644_0023659_910_1740 275
577 3300046524 Ga0495648_0000146 Ga0495648_0000146_56760_57590 275
578 3300046524 Ga0495648_0007691 Ga0495648_0007691_4838_5674 275
579 3300046524 Ga0495648_0077532 Ga0495648_0077532_981_1817 275
580 3300046525 Ga0495663_0000016 Ga0495663_0000016_31331_32167 275
581 3300046525 Ga0495663_0000968 Ga0495663_0000968_8020_8856 275
582 3300046528 Ga0495642_0032028 Ga0495642_0032028_394_1224 275
583 3300046530 Ga0495654_0001157 Ga0495654_0001157_8710_9540 275
584 3300046530 Ga0495654_0010980 Ga0495654_0010980_786_1622 275
585 3300046530 Ga0495654_0021519 Ga0495654_0021519_375_1211 275
586 3300046538 Ga0495609_0000004 Ga0495609_0000004_440640_441476 275
587 3300046538 Ga0495609_0000243 Ga0495609_0000243_35157_35987 275
588 3300046542 Ga0495597_0077369 Ga0495597_0077369_442_1272 275
589 3300046557 Ga0495622_0000811 Ga0495622_0000811_910_1752 275
590 3300046557 Ga0495622_0079556 Ga0495622_0079556_349_1179 275
591 3300046558 Ga0495633_0000051 Ga0495633_0000051_42352_43188 275
592 3300046558 Ga0495633_0001313 Ga0495633_0001313_1073_1927 275
593 3300046558 Ga0495633_0001331 Ga0495633_0001331_1308_2144 275
594 3300046558 Ga0495633_0159054 Ga0495633_0159054_174_1019 275
595 3300046616 Ga0495668_0000056 Ga0495668_0000056_166900_167730 275
596 3300046616 Ga0495668_0044700 Ga0495668_0044700_1026_1856 275
597 3300046616 Ga0495668_0177738 Ga0495668_0177738_260_1090 275
598 3300046648 Ga0495611_0001518 Ga0495611_0001518_9108_9944 275
599 3300046648 Ga0495611_0014485 Ga0495611_0014485_2482_3342 275
600 3300046648 Ga0495611_0016497 Ga0495611_0016497_2296_3126 275
601 3300046648 Ga0495611_0113967 Ga0495611_0113967_15_851 275
602 3300046660 Ga0495625_0000004 Ga0495625_0000004_564809_565639 275
603 3300046660 Ga0495625_0000255 Ga0495625_0000255_5479_6315 275
604 3300046660 Ga0495625_0010467 Ga0495625_0010467_6770_7600 275
605 3300046660 Ga0495625_0022116 Ga0495625_0022116_1938_2768 275
606 3300046660 Ga0495625_0212629 Ga0495625_0212629_45_881 275
607 3300046665 Ga0495661_0000005 Ga0495661_0000005_405534_406370 275
608 3300046665 Ga0495661_0000006 Ga0495661_0000006_317555_318385 275
609 3300046665 Ga0495661_0062264 Ga0495661_0062264_859_1698 275
610 3300046684 Ga0495669_0000140 Ga0495669_0000140_20511_21341 275
611 3300046691 Ga0495670_0016590 Ga0495670_0016590_479_1315 275
612 3300046692 Ga0495671_0000974 Ga0495671_0000974_16551_17387 275
613 3300046694 Ga0495649_0001686 Ga0495649_0001686_9774_10616 275
614 3300046694 Ga0495649_0016249 Ga0495649_0016249_3241_4077 275
615 3300046694 Ga0495649_0051539 Ga0495649_0051539_613_1443 275
616 3300046694 Ga0495649_0052354 Ga0495649_0052354_337_1173 275
617 3300046794 Ga0495589_0001000 Ga0495589_0001000_4505_5341 275
618 3300046809 Ga0495600_0000238 Ga0495600_0000238_21383_22228 275
619 3300046810 Ga0495660_0007985 Ga0495660_0007985_3414_4250 275
620 3300046810 Ga0495660_0044671 Ga0495660_0044671_1418_2248 275
621 3300046810 Ga0495660_0045673 Ga0495660_0045673_654_1484 275
622 3300047323 Ga0495683_0000004 Ga0495683_0000004_231088_231924 275
623 3300047323 Ga0495683_0002838 Ga0495683_0002838_6172_7008 275
624 3300047323 Ga0495683_0009713 Ga0495683_0009713_1188_2018 275
625 3300047443 Ga0495687_000323 Ga0495687_000323_5462_6292 275
626 3300047443 Ga0495687_000353 Ga0495687_000353_5850_6680 275
627 3300047445 Ga0495677_0004893 Ga0495677_0004893_2679_3509 275
628 3300047446 Ga0495679_000015 Ga0495679_000015_35967_36797 275
629 3300047446 Ga0495679_008355 Ga0495679_008355_1408_2244 275
630 3300047469 Ga0495673_0000118 Ga0495673_0000118_108934_109794 275
631 3300047469 Ga0495673_0011223 Ga0495673_0011223_2609_3439 275
632 3300047469 Ga0495673_0011733 Ga0495673_0011733_3652_4488 275
633 3300047470 Ga0495681_0000030 Ga0495681_0000030_14907_15743 275
634 3300047470 Ga0495681_0002539 Ga0495681_0002539_10817_11647 275
635 3300047470 Ga0495681_0010402 Ga0495681_0010402_913_1749 275
636 3300047470 Ga0495681_0019035 Ga0495681_0019035_917_1753 275
637 3300047470 Ga0495681_0079228 Ga0495681_0079228_125_955 275
638 3300047472 Ga0495686_0000092 Ga0495686_0000092_86529_87359 275
639 3300047472 Ga0495686_0103186 Ga0495686_0103186_394_1239 275
640 3300048090 Ga0495615_0000250 Ga0495615_0000250_8288_9157 275
641 3300048091 Ga0495626_0000201 Ga0495626_0000201_28530_29360 275
642 3300048905 Ga0496102_0000163 Ga0496102_0000163_65574_66410 275
643 3300048906 Ga0496103_0000052 Ga0496103_0000052_133973_134809 275
644 3300048908 Ga0496105_0001540 Ga0496105_0001540_869_1705 275
645 3300048909 Ga0496106_0067736 Ga0496106_0067736_513_1346 275
646 3300048914 Ga0496111_0053896 Ga0496111_0053896_2004_2855 275
647 3300048917 Ga0496114_0035807 Ga0496114_0035807_2695_3531 275
648 3300048918 Ga0496115_0000078 Ga0496115_0000078_23297_24133 275
649 3300048918 Ga0496115_0001140 Ga0496115_0001140_9040_9879 275
650 3300048918 Ga0496115_0035167 Ga0496115_0035167_3003_3839 275
651 3300048919 Ga0496116_0002348 Ga0496116_0002348_14619_15455 275
652 3300048919 Ga0496116_0118327 Ga0496116_0118327_221_1066 275
653 3300048920 Ga0496117_0000141 Ga0496117_0000141_23232_24068 275
654 3300048920 Ga0496117_0014772 Ga0496117_0014772_5226_6059 275
655 3300048920 Ga0496117_0072252 Ga0496117_0072252_970_1809 275
656 3300048920 Ga0496117_0139092 Ga0496117_0139092_178_1023 275
657 3300048921 Ga0496118_0000103 Ga0496118_0000103_23290_24126 275
658 3300048921 Ga0496118_0001211 Ga0496118_0001211_27663_28493 275
659 3300048921 Ga0496118_0007258 Ga0496118_0007258_2428_3273 275
660 3300048921 Ga0496118_0007966 Ga0496118_0007966_1066_1899 275
661 3300048921 Ga0496118_0229625 Ga0496118_0229625_27_866 275
662 3300048922 Ga0496119_0149911 Ga0496119_0149911_191_1036 275
663 3300048923 Ga0496120_0001560 Ga0496120_0001560_22762_23613 275
664 3300048923 Ga0496120_0003845 Ga0496120_0003845_3700_4536 275
665 3300048923 Ga0496120_0029940 Ga0496120_0029940_2345_3187 275
666 3300048923 Ga0496120_0052615 Ga0496120_0052615_142_987 275
667 3300048924 Ga0496121_0000075 Ga0496121_0000075_183157_183990 275
668 3300048924 Ga0496121_0000156 Ga0496121_0000156_133955_134791 275
669 3300048924 Ga0496121_0203303 Ga0496121_0203303_366_1199 275
670 3300048925 Ga0496122_0001025 Ga0496122_0001025_18653_19510 275
671 3300048925 Ga0496122_0001717 Ga0496122_0001717_1161_2006 275
672 3300048925 Ga0496122_0003081 Ga0496122_0003081_4201_5052 275
673 3300048925 Ga0496122_0011237 Ga0496122_0011237_5791_6624 275
674 3300048925 Ga0496122_0048796 Ga0496122_0048796_2282_3133 275
675 3300048925 Ga0496122_0058091 Ga0496122_0058091_1122_1973 275
676 3300048926 Ga0496123_0000211 Ga0496123_0000211_1321_2166 275
677 3300048926 Ga0496123_0000949 Ga0496123_0000949_3884_4741 275
678 3300048926 Ga0496123_0004603 Ga0496123_0004603_11362_12213 275
679 3300048926 Ga0496123_0005769 Ga0496123_0005769_9263_10099 275
680 3300048926 Ga0496123_0011302 Ga0496123_0011302_1677_2528 275
681 3300048926 Ga0496123_0015413 Ga0496123_0015413_4319_5170 275
682 3300048926 Ga0496123_0017459 Ga0496123_0017459_2663_3496 275
683 3300048926 Ga0496123_0029034 Ga0496123_0029034_1045_1881 275
684 3300048926 Ga0496123_0102025 Ga0496123_0102025_352_1188 275
685 3300048927 Ga0496124_0000041 Ga0496124_0000041_135846_136682 275
686 3300048927 Ga0496124_0000110 Ga0496124_0000110_107569_108405 275
687 3300048927 Ga0496124_0000175 Ga0496124_0000175_8770_9612 275
688 3300048927 Ga0496124_0002880 Ga0496124_0002880_20134_20985 275
689 3300048927 Ga0496124_0035212 Ga0496124_0035212_1497_2348 275
690 3300048927 Ga0496124_0044957 Ga0496124_0044957_1075_1920 275
691 3300048927 Ga0496124_0111555 Ga0496124_0111555_1104_1958 275
692 3300048928 Ga0496125_0000238 Ga0496125_0000238_55106_55942 275
693 3300048928 Ga0496125_0004460 Ga0496125_0004460_3432_4265 275
694 3300048928 Ga0496125_0005040 Ga0496125_0005040_11420_12265 275
695 3300048928 Ga0496125_0116286 Ga0496125_0116286_73_921 275
696 3300048929 Ga0496126_0000155 Ga0496126_0000155_23284_24120 275
697 3300048929 Ga0496126_0007407 Ga0496126_0007407_138_995 275
698 3300048929 Ga0496126_0015879 Ga0496126_0015879_373_1266 275
699 3300048929 Ga0496126_0035447 Ga0496126_0035447_750_1583 275
700 3300048929 Ga0496126_0069759 Ga0496126_0069759_1399_2235 275
701 3300048929 Ga0496126_0074200 Ga0496126_0074200_989_1849 275
702 3300048929 Ga0496126_0483172 Ga0496126_0483172_55_885 275
703 3300049459 Ga0495678_000014 Ga0495678_000014_89795_90631 275
704 3300049459 Ga0495678_008882 Ga0495678_008882_2517_3353 275
705 3300049568 Ga0501031_0083117 Ga0501031_0083117_1142_1978 275
706 3300049569 Ga0501032_0000683 Ga0501032_0000683_24998_25870 275
707 3300049569 Ga0501032_0004574 Ga0501032_0004574_5838_6710 275
708 3300049569 Ga0501032_0017514 Ga0501032_0017514_1988_2824 275
709 3300049570 Ga0501033_0000645 Ga0501033_0000645_29691_30563 275
710 3300049570 Ga0501033_0001599 Ga0501033_0001599_3235_4107 275
711 3300049570 Ga0501033_0126332 Ga0501033_0126332_973_1821 275
712 3300049571 Ga0501034_0004311 Ga0501034_0004311_168_1040 275
713 3300049571 Ga0501034_0053703 Ga0501034_0053703_2508_3350 275
714 3300049571 Ga0501034_0235958 Ga0501034_0235958_303_1151 275
715 3300049571 Ga0501034_0419690 Ga0501034_0419690_207_1046 275
716 3300049572 Ga0501036_0003715 Ga0501036_0003715_9658_10530 275
717 3300049572 Ga0501036_0099212 Ga0501036_0099212_1430_2302 275
718 3300049572 Ga0501036_0216120 Ga0501036_0216120_475_1323 275
719 3300049573 Ga0501037_0000484 Ga0501037_0000484_29691_30563 275
720 3300049573 Ga0501037_0000967 Ga0501037_0000967_4354_5226 275
721 3300049574 Ga0501038_0002722 Ga0501038_0002722_3104_3976 275
722 3300049574 Ga0501038_0114465 Ga0501038_0114465_1131_1979 275
723 3300049574 Ga0501038_0301561 Ga0501038_0301561_154_996 275
724 3300049575 Ga0501039_0001996 Ga0501039_0001996_1712_2584 275
725 3300049578 Ga0501042_0033225 Ga0501042_0033225_1618_2490 275
726 3300049579 Ga0501043_0000593 Ga0501043_0000593_1049_1921 275
727 3300049579 Ga0501043_0001016 Ga0501043_0001016_16117_16989 275
728 3300049579 Ga0501043_0071079 Ga0501043_0071079_976_1812 275
729 3300049580 Ga0501046_0000499 Ga0501046_0000499_4108_4980 275
730 3300049580 Ga0501046_0010181 Ga0501046_0010181_6720_7556 275
731 3300049580 Ga0501046_0105770 Ga0501046_0105770_1094_1930 275
732 3300049581 Ga0501047_0001042 Ga0501047_0001042_1712_2584 275
733 3300049581 Ga0501047_0106929 Ga0501047_0106929_152_1000 275
734 3300049581 Ga0501047_0249106 Ga0501047_0249106_394_1230 275
735 3300049582 Ga0501048_0022882 Ga0501048_0022882_1082_1954 275
736 3300049582 Ga0501048_0032973 Ga0501048_0032973_2740_3594 275
737 3300049583 Ga0501067_0007605 Ga0501067_0007605_3378_4250 275
738 3300049584 Ga0501068_0001651 Ga0501068_0001651_1712_2584 275
739 3300049584 Ga0501068_0059779 Ga0501068_0059779_1119_1991 275
740 3300049585 Ga0501069_0000331 Ga0501069_0000331_16117_16989 275
741 3300049585 Ga0501069_0008815 Ga0501069_0008815_2759_3631 275
742 3300049586 Ga0501070_0001433 Ga0501070_0001433_4354_5226 275
743 3300049586 Ga0501070_0003020 Ga0501070_0003020_12074_12946 275
744 3300049586 Ga0501070_0067679 Ga0501070_0067679_1355_2212 275
745 3300049587 Ga0501071_0045104 Ga0501071_0045104_1502_2374 275
746 3300049587 Ga0501071_0128530 Ga0501071_0128530_866_1738 275
747 3300049588 Ga0501072_0542031 Ga0501072_0542031_18_890 275
748 3300049589 Ga0501073_0014323 Ga0501073_0014323_1411_2283 275
749 3300049589 Ga0501073_0148255 Ga0501073_0148255_288_1136 275
750 3300049590 Ga0501074_0001744 Ga0501074_0001744_4531_5403 275
751 3300049590 Ga0501074_0004226 Ga0501074_0004226_2706_3578 275
752 3300049741 Ga0501079_0070522 Ga0501079_0070522_1380_2252 275
753 3300049742 Ga0501080_0000326 Ga0501080_0000326_33889_34761 275
754 3300049742 Ga0501080_0010446 Ga0501080_0010446_3062_3934 275
755 3300049744 Ga0501083_0000748 Ga0501083_0000748_4243_5115 275
756 3300049744 Ga0501083_0023811 Ga0501083_0023811_2719_3567 275
757 3300049744 Ga0501083_0158829 Ga0501083_0158829_256_1098 275
758 3300049822 Ga0501035_0001846 Ga0501035_0001846_16101_16973 275
759 3300049822 Ga0501035_0003801 Ga0501035_0003801_11804_12676 275
760 3300049822 Ga0501035_0096409 Ga0501035_0096409_568_1425 275
761 3300049822 Ga0501035_0228851 Ga0501035_0228851_339_1187 275
762 3300049823 Ga0501044_0011279 Ga0501044_0011279_4354_5226 275
763 3300049823 Ga0501044_0029503 Ga0501044_0029503_1661_2509 275
764 3300049823 Ga0501044_0033544 Ga0501044_0033544_1712_2584 275
765 3300049823 Ga0501044_0113430 Ga0501044_0113430_1406_2248 275
766 3300049823 Ga0501044_0155576 Ga0501044_0155576_736_1593 275
767 3300049823 Ga0501044_0200826 Ga0501044_0200826_966_1802 275
768 3300049824 Ga0501045_0014252 Ga0501045_0014252_4749_5621 275
769 3300050512 nmdc:mga0n895_8184_c1 nmdc:mga0n895_8184_c1_8044_8886 275
770 3300050513 nmdc:mga0rr50_3298_c1 nmdc:mga0rr50_3298_c1_134_976 275
771 3300050515 nmdc:mga0a205_10744_c1 nmdc:mga0a205_10744_c1_6452_7294 275
772 3300053079 Ga0500610_0000018 Ga0500610_0000018_56309_57139 275
773 3300053087 Ga0500643_000225 Ga0500643_000225_34054_34914 275
774 3300053087 Ga0500643_002359 Ga0500643_002359_4938_5774 275
775 3300053090 Ga0500646_0017153 Ga0500646_0017153_722_1552 275
776 3300053096 Ga0500641_0001522 Ga0500641_0001522_6302_7135 275
777 3300053103 Ga0500555_001252 Ga0500555_001252_2390_3226 275
778 3300053108 Ga0500562_022854 Ga0500562_022854_700_1545 275
779 3300053116 Ga0500592_007028 Ga0500592_007028_102_938 275
780 3300053119 Ga0500595_002053 Ga0500595_002053_6709_7551 275
781 3300053119 Ga0500595_027264 Ga0500595_027264_976_1818 275
782 3300053120 Ga0500597_000551 Ga0500597_000551_3640_4476 275
783 3300053130 Ga0500642_0000178 Ga0500642_0000178_22230_23066 275
784 3300053130 Ga0500642_0052048 Ga0500642_0052048_552_1388 275
785 3300053136 Ga0500559_0000468 Ga0500559_0000468_11481_12341 275
786 3300053136 Ga0500559_0133345 Ga0500559_0133345_156_989 275
787 3300053153 Ga0500616_0026860 Ga0500616_0026860_558_1403 275
788 3300053156 Ga0500622_0021616 Ga0500622_0021616_882_1730 275
789 3300053729 Ga0500625_002064 Ga0500625_002064_5009_5845 275
790 3300053730 Ga0500645_000073 Ga0500645_000073_54394_55224 275
791 3300053735 Ga0500596_008393 Ga0500596_008393_525_1370 275
792 3300054114 Ga0501084_0297086 Ga0501084_0297086_401_1273 275
793 3300055283 Ga0500661_000041 Ga0500661_000041_3178_4038 275
794 3300060353 Ga0501082_0214741 Ga0501082_0214741_24_866 275
795 iso_pu_bacteria 2693429783 2694632819 275
796 iso_pu_bacteria 2693429784 2694639452 275
797 iso_pu_bacteria 2871429161 2871434301 275
798 iso_pu_bacteria 2874155637 2874156442 275
799 iso_pu_bacteria 2876377896 2876383109 275
800 iso_pu_bacteria 2876413966 2876414630 275
801 iso_pu_bacteria 2878745973 2878747176 275
802 iso_pu_bacteria 2888350351 2888351242 275
803 iso_pu_bacteria 2889010040 2889013634 275
804 iso_pu_bacteria 2906308376 2906309348 275
805 iso_pu_bacteria 2906321335 2906326998 275
806 iso_pu_bacteria 2922130491 2922130815 275
807 iso_pu_bacteria 2922185730 2922186173 275
808 iso_pu_bacteria 2937813078 2937813707 275
809 iso_pu_bacteria 2938014810 2938018395 275
810 iso_pu_bacteria 2958041894 2958044372 275
811 iso_pu_bacteria 2958130278 2958131394 275
812 iso_pu_bacteria 2958172287 2958179900 275
813 iso_pu_bacteria 2958179912 2958181219 275
814 iso_pu_bacteria 2961077736 2961079057 275
815 iso_pu_bacteria 2965119406 2965121485 275
816 iso_pu_bacteria 2968117919 2968118810 275
817 iso_pu_bacteria 2977843712 2977843901 275
818 iso_pu_bacteria 2977942078 2977946372 275
819 iso_pu_bacteria 2977971508 2977975668 275
820 iso_pu_bacteria 2979710463 2979712733 275
821 iso_pu_bacteria 2987652177 2987654163 275
822 iso_pu_bacteria 8004387939 8004390413 275
823 iso_pu_bacteria 8004640170 8004642586 275
824 iso_pu_bacteria 8004714634 8004715606 275
825 iso_pu_bacteria 8056382006 8056386488 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13560

HTH_31

Helix-turn-helix domain

8

85

0.96

PF17765

MLTR_LBD

MmyB-like transcription regulator ligand binding domain

104

268

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yba-assembly1.cif.gz_A the structure of the c.kpn2i controller protein 0.913 36 76
3zkc-assembly1.cif.gz_B crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.8693 7 78
2xj3-assembly1.cif.gz_B high resolution structure of the t55c mutant of cylr2. 0.867 36 76
1y7y-assembly1.cif.gz_B high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.8658 8 82
1utx-assembly1.cif.gz_B regulation of cytolysin expression by enterococcus faecalis: role of cylr2 0.8649 37 76
ID Description Score Start End Superfamily
4ybaA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.913 36 76 1.10.260.40
3zkcB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8693 7 78 1.10.260.40
1y7yB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8658 8 82 1.10.260.40
3zkcA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8614 9 78 1.10.260.40
2gzuB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8418 36 76 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A7K2M030-F1-model_v4 Helix-turn-helix domain-containing protein 0.9721 6 89 GO:0003677
AF-A0A840FQM9-F1-model_v4 MmyB-like transcription regulator ligand binding domain-containing protein 0.9451 117 274
AF-A0A527D2N4-F1-model_v4 Transcriptional regulator 0.9406 96 273
AF-A0A4V2AW01-F1-model_v4 MmyB-like transcription regulator ligand binding domain-containing protein 0.9306 99 274
AF-A0A353U7Q5-F1-model_v4 deleted 0.9202 62 274

Feature Viewer

pLDDT pTM Quality
84.5 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map