F482457
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 825 | 425 | 712 | 280 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2937877337|2937884099 |
| Length | 287 |
| Sequence | MPNTSSGSLAAFLKDRRTRLDPSSFGFSGRRRTPGLRREEVAQRANISPTWYTWLEQGRGGAPSADVLNRIAKGLLLTEAEREHLFMLGLGRPPEVRYLRADGVSPRLQRLIDTLEASPALIKTATWDVVAWNSAAQVVMTDSTLPHGQRNILRFMFLSPTIRAKQHDWENLARFVVGAFRADAARAGAVSEVAQLVDELCGASPEFATLWRENDVLAHGDGTKRLKHPELGDIELEYSAFAVDGRPDLSLTVYNPVDAAVADRIRDLARRRKERDATDPSTKPTTP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 3 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 4 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 5 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 6 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 7 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 8 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 9 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 10 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 11 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 12 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 13 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 14 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 15 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 16 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 17 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 18 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 19 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 20 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 21 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 22 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 23 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 24 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 25 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 26 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 27 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 28 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 29 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 30 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 31 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 32 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 33 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 34 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 35 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 36 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 37 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 38 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 39 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 40 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 41 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 42 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 43 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 44 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 45 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 46 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 47 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 48 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 49 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 50 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 51 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 52 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 53 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 54 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 55 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 56 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 57 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 58 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 59 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 60 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 61 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 62 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 63 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 64 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 65 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 66 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 67 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 68 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 69 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 70 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 71 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 72 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 73 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 74 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 75 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 76 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 77 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 78 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 79 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 80 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 81 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 82 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 83 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 84 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 85 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 86 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 87 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 88 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 89 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 90 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 91 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 92 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 93 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 94 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 95 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 96 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 97 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 98 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 99 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 100 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 101 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 102 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 103 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 104 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 105 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 106 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 107 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 108 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 109 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 110 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 111 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 112 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 113 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 114 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 115 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 116 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 117 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 118 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 119 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 120 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 121 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 122 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 123 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 124 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 125 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 126 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 127 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 128 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 130 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 133 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 136 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 145 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 146 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 147 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 150 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 151 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 152 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 153 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 154 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 155 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 156 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 157 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 158 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 160 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 161 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 162 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 163 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 164 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 165 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 166 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 167 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 182 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 184 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 185 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 186 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 187 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 194 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 195 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 198 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 238 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 239 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 242 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 243 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 247 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 248 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 249 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 250 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 251 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 253 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 254 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 255 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 256 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 257 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 258 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 259 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 260 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 261 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 262 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 263 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 264 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 265 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 266 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 267 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 268 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 269 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 270 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 271 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 272 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 273 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 274 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 275 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 276 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 277 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 341 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 342 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 343 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 344 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 345 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 346 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 347 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 348 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 349 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 350 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 351 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 352 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 353 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 354 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 355 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 356 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 357 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 358 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 359 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 392 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 393 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 394 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 395 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 396 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 397 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 398 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 399 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 400 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 401 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 402 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 403 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 404 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 405 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 406 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 407 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 408 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 409 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 410 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 411 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 413 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 415 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 416 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 417 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 418 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 419 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 420 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 421 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 422 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 423 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 424 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 425 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.06 |
| Metatranscriptomes | 0.24 |
| Isolates | 13.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.42 |
| Nodule | 11.39 |
| Rhizoplane | 2.42 |
| Rhizosphere | 60.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1001546 | 3300001904 | Bacteria | 4188 |
| 2 | JGI24736J21556_1006811 | 3300001904 | Bacteria | 1922 |
| 3 | JGI24741J21665_1012915 | 3300001915 | Bacteria | 1425 |
| 4 | JGI24740J21852_10031332 | 3300001979 | Bacteria | 1716 |
| 5 | JGI24739J22299_10009539 | 3300001989 | Bacteria | 3614 |
| 6 | JGI24739J22299_10011259 | 3300001989 | Bacteria | 3304 |
| 7 | JGI24739J22299_10023269 | 3300001989 | Bacteria | 2191 |
| 8 | JGI24739J22299_10038737 | 3300001989 | Bacteria | 1601 |
| 9 | JGI24737J22298_10004299 | 3300001990 | Bacteria | 4975 |
| 10 | JGI24737J22298_10032342 | 3300001990 | Bacteria | 1629 |
| 11 | JGI24735J21928_10003343 | 3300002067 | Bacteria | 5473 |
| 12 | JGI24735J21928_10005340 | 3300002067 | Bacteria | 4263 |
| 13 | JGI24735J21928_10023509 | 3300002067 | Bacteria | 1869 |
| 14 | JGI24735J21928_10038041 | 3300002067 | Bacteria | 1409 |
| 15 | JGI24738J21930_10007946 | 3300002075 | Bacteria | 2426 |
| 16 | JGI24742J22300_10005287 | 3300002244 | Bacteria | 2121 |
| 17 | JGI25156J39149_1000430 | 3300002705 | Bacteria | 25973 |
| 18 | JGI25156J39149_1005097 | 3300002705 | Bacteria | 3869 |
| 19 | JGI25156J39149_1006965 | 3300002705 | Bacteria | 3029 |
| 20 | JGI25154J39366_1000018 | 3300002738 | Bacteria | 251612 |
| 21 | JGI25157J39369_1000074 | 3300002741 | Bacteria | 88240 |
| 22 | JGI25157J39369_1000564 | 3300002741 | Bacteria | 22170 |
| 23 | JGI25157J39369_1000921 | 3300002741 | Bacteria | 14002 |
| 24 | JGI25165J46597_1000020 | 3300003214 | Bacteria | 370477 |
| 25 | JGI25165J46597_1000021 | 3300003214 | Bacteria | 359288 |
| 26 | JGI25153J46596_10000070 | 3300003215 | Bacteria | 117125 |
| 27 | rootH1_10012195 | 3300003316 | Bacteria | 8969 |
| 28 | Ga0055539_1001378 | 3300003752 | Bacteria | 4615 |
| 29 | Ga0055533_1004286 | 3300003756 | Bacteria | 2598 |
| 30 | Ga0055525_1000013 | 3300003759 | Bacteria | 440870 |
| 31 | Ga0055525_1000203 | 3300003759 | Bacteria | 68926 |
| 32 | Ga0055527_1000190 | 3300003760 | Bacteria | 40884 |
| 33 | Ga0055535_1000397 | 3300003761 | Bacteria | 40876 |
| 34 | Ga0055542_1000040 | 3300003762 | Bacteria | 214035 |
| 35 | Ga0055542_1000043 | 3300003762 | Bacteria | 207531 |
| 36 | Ga0055542_1000546 | 3300003762 | Bacteria | 33448 |
| 37 | Ga0055529_1000037 | 3300003763 | Bacteria | 237307 |
| 38 | Ga0055529_1000380 | 3300003763 | Bacteria | 48083 |
| 39 | Ga0055536_1001410 | 3300003781 | Bacteria | 14516 |
| 40 | Ga0055540_1001153 | 3300003792 | Bacteria | 16440 |
| 41 | Ga0055531_10006682 | 3300003794 | Bacteria | 6467 |
| 42 | Ga0055543_1008796 | 3300004625 | Bacteria | 2213 |
| 43 | Ga0055543_1009840 | 3300004625 | Bacteria | 2033 |
| 44 | Ga0065165_1000214 | 3300005262 | Bacteria | 100283 |
| 45 | Ga0065165_1005328 | 3300005262 | Bacteria | 7309 |
| 46 | Ga0070658_10003583 | 3300005327 | Bacteria | 12732 |
| 47 | Ga0070658_10014451 | 3300005327 | Bacteria | 6335 |
| 48 | Ga0070658_10045429 | 3300005327 | Bacteria | 3552 |
| 49 | Ga0070658_10125565 | 3300005327 | Bacteria | 2135 |
| 50 | Ga0070658_10214783 | 3300005327 | Bacteria | 1625 |
| 51 | Ga0070683_100285764 | 3300005329 | Bacteria | 1569 |
| 52 | Ga0070670_100089110 | 3300005331 | Bacteria | 2652 |
| 53 | Ga0070670_100161730 | 3300005331 | Bacteria | 1940 |
| 54 | Ga0070666_10000046 | 3300005335 | Bacteria | 107525 |
| 55 | Ga0070666_10097645 | 3300005335 | Bacteria | 2022 |
| 56 | Ga0070682_100048577 | 3300005337 | Bacteria | 2642 |
| 57 | Ga0070660_100009935 | 3300005339 | Bacteria | 6714 |
| 58 | Ga0070661_100008770 | 3300005344 | Bacteria | 6997 |
| 59 | Ga0070661_100051676 | 3300005344 | Bacteria | 3008 |
| 60 | Ga0070661_100181882 | 3300005344 | Bacteria | 1600 |
| 61 | Ga0070692_10216655 | 3300005345 | Bacteria | 1129 |
| 62 | Ga0070675_100222429 | 3300005354 | Bacteria | 1644 |
| 63 | Ga0070674_100015015 | 3300005356 | Bacteria | 4826 |
| 64 | Ga0070674_100098110 | 3300005356 | Bacteria | 2129 |
| 65 | Ga0070659_100000274 | 3300005366 | Bacteria | 40352 |
| 66 | Ga0070659_100126875 | 3300005366 | Bacteria | 2070 |
| 67 | Ga0070667_100074476 | 3300005367 | Bacteria | 2897 |
| 68 | Ga0070667_100181404 | 3300005367 | Bacteria | 1862 |
| 69 | Ga0070714_100199881 | 3300005435 | Bacteria | 1828 |
| 70 | Ga0070663_100003022 | 3300005455 | Bacteria | 9606 |
| 71 | Ga0070663_100045480 | 3300005455 | Bacteria | 3101 |
| 72 | Ga0070663_100188735 | 3300005455 | Bacteria | 1603 |
| 73 | Ga0070663_100388932 | 3300005455 | Bacteria | 1137 |
| 74 | Ga0070678_100000523 | 3300005456 | Bacteria | 18610 |
| 75 | Ga0070662_100064143 | 3300005457 | Bacteria | 2689 |
| 76 | Ga0070662_100079136 | 3300005457 | Bacteria | 2443 |
| 77 | Ga0068867_100292692 | 3300005459 | Bacteria | 1339 |
| 78 | Ga0070684_100105147 | 3300005535 | Bacteria | 2526 |
| 79 | Ga0068853_100140670 | 3300005539 | Bacteria | 2166 |
| 80 | Ga0068853_100174820 | 3300005539 | Bacteria | 1944 |
| 81 | Ga0068853_100179669 | 3300005539 | Bacteria | 1918 |
| 82 | Ga0070672_100283192 | 3300005543 | Bacteria | 1402 |
| 83 | Ga0070665_100057418 | 3300005548 | Bacteria | 3901 |
| 84 | Ga0070665_100177577 | 3300005548 | Bacteria | 2130 |
| 85 | Ga0068855_100003956 | 3300005563 | Bacteria | 18093 |
| 86 | Ga0068855_100020329 | 3300005563 | Bacteria | 7965 |
| 87 | Ga0068855_100035135 | 3300005563 | Bacteria | 5971 |
| 88 | Ga0068855_100219778 | 3300005563 | Bacteria | 2131 |
| 89 | Ga0068855_100370110 | 3300005563 | Bacteria | 1575 |
| 90 | Ga0068857_100008515 | 3300005577 | Bacteria | 8868 |
| 91 | Ga0068857_100112429 | 3300005577 | Bacteria | 2448 |
| 92 | Ga0068854_100066352 | 3300005578 | Bacteria | 2626 |
| 93 | Ga0068854_100131105 | 3300005578 | Bacteria | 1914 |
| 94 | Ga0068854_100408605 | 3300005578 | Bacteria | 1125 |
| 95 | Ga0068856_100001457 | 3300005614 | Bacteria | 24824 |
| 96 | Ga0068856_100021865 | 3300005614 | Bacteria | 6217 |
| 97 | Ga0068856_100026353 | 3300005614 | Bacteria | 5669 |
| 98 | Ga0068856_100106768 | 3300005614 | Bacteria | 2795 |
| 99 | Ga0068856_100465744 | 3300005614 | Bacteria | 1284 |
| 100 | Ga0068852_100011426 | 3300005616 | Bacteria | 6684 |
| 101 | Ga0068852_100015364 | 3300005616 | Bacteria | 5934 |
| 102 | Ga0068863_100152267 | 3300005841 | Bacteria | 2213 |
| 103 | Ga0068860_100000274 | 3300005843 | Bacteria | 75310 |
| 104 | Ga0068860_100409261 | 3300005843 | Bacteria | 1343 |
| 105 | Ga0081540_1026589 | 3300005983 | Bacteria | 3299 |
| 106 | Ga0081539_10008834 | 3300005985 | Bacteria | 8620 |
| 107 | Ga0070717_10133670 | 3300006028 | Bacteria | 2135 |
| 108 | Ga0075365_10012007 | 3300006038 | Bacteria | 5120 |
| 109 | Ga0075368_10083092 | 3300006042 | Bacteria | 1305 |
| 110 | Ga0075364_10100396 | 3300006051 | Bacteria | 1926 |
| 111 | Ga0068871_100260598 | 3300006358 | Bacteria | 1512 |
| 112 | Ga0075434_100007651 | 3300006871 | Bacteria | 9994 |
| 113 | Ga0068865_100001677 | 3300006881 | Bacteria | 12969 |
| 114 | Ga0075435_100004917 | 3300007076 | Bacteria | 9266 |
| 115 | Ga0099794_10060084 | 3300007265 | Bacteria | 1845 |
| 116 | Ga0105251_10046708 | 3300009011 | Bacteria | 2083 |
| 117 | Ga0105240_10000005 | 3300009093 | Bacteria | 702630 |
| 118 | Ga0105240_10004777 | 3300009093 | Bacteria | 20435 |
| 119 | Ga0105240_10005953 | 3300009093 | Bacteria | 18040 |
| 120 | Ga0105240_10178901 | 3300009093 | Bacteria | 2505 |
| 121 | Ga0105240_10180163 | 3300009093 | Bacteria | 2494 |
| 122 | Ga0105240_10254023 | 3300009093 | Bacteria | 2031 |
| 123 | Ga0105240_10418966 | 3300009093 | Bacteria | 1505 |
| 124 | Ga0105240_10571677 | 3300009093 | Bacteria | 1248 |
| 125 | Ga0105247_10341220 | 3300009101 | Bacteria | 1051 |
| 126 | Ga0105243_10000913 | 3300009148 | Bacteria | 27723 |
| 127 | Ga0105241_10014367 | 3300009174 | Bacteria | 5798 |
| 128 | Ga0105241_10015541 | 3300009174 | Bacteria | 5579 |
| 129 | Ga0105241_10558228 | 3300009174 | Bacteria | 1029 |
| 130 | Ga0105248_10302657 | 3300009177 | Bacteria | 1800 |
| 131 | Ga0105237_10002112 | 3300009545 | Bacteria | 25083 |
| 132 | Ga0105237_10010055 | 3300009545 | Bacteria | 10090 |
| 133 | Ga0105237_10267651 | 3300009545 | Bacteria | 1712 |
| 134 | Ga0105238_10000521 | 3300009551 | Bacteria | 40372 |
| 135 | Ga0105238_10001346 | 3300009551 | Bacteria | 24704 |
| 136 | Ga0105238_10060936 | 3300009551 | Bacteria | 3777 |
| 137 | Ga0105238_10061613 | 3300009551 | Bacteria | 3754 |
| 138 | Ga0105238_10125893 | 3300009551 | Bacteria | 2541 |
| 139 | Ga0105239_10002672 | 3300010375 | Bacteria | 22471 |
| 140 | Ga0105239_10007523 | 3300010375 | Bacteria | 12489 |
| 141 | Ga0105239_10014042 | 3300010375 | Bacteria | 8891 |
| 142 | Ga0105239_10016174 | 3300010375 | Bacteria | 8254 |
| 143 | Ga0105239_10057743 | 3300010375 | Bacteria | 4257 |
| 144 | Ga0105239_10079994 | 3300010375 | Bacteria | 3596 |
| 145 | Ga0105239_10096883 | 3300010375 | Bacteria | 3259 |
| 146 | Ga0105239_10164843 | 3300010375 | Bacteria | 2478 |
| 147 | Ga0105239_10461165 | 3300010375 | Bacteria | 1442 |
| 148 | Ga0105239_10602137 | 3300010375 | Bacteria | 1253 |
| 149 | Ga0105239_10640324 | 3300010375 | Bacteria | 1214 |
| 150 | Ga0105239_10836098 | 3300010375 | Bacteria | 1055 |
| 151 | Ga0157373_10031474 | 3300013100 | Bacteria | 3819 |
| 152 | Ga0157373_10064685 | 3300013100 | Bacteria | 2589 |
| 153 | Ga0157373_10088611 | 3300013100 | Bacteria | 2180 |
| 154 | Ga0157370_10000163 | 3300013104 | Bacteria | 81428 |
| 155 | Ga0157370_10001660 | 3300013104 | Bacteria | 27428 |
| 156 | Ga0157370_10011892 | 3300013104 | Bacteria | 9078 |
| 157 | Ga0157370_10024273 | 3300013104 | Bacteria | 6006 |
| 158 | Ga0157370_10084264 | 3300013104 | Bacteria | 2988 |
| 159 | Ga0157369_10169296 | 3300013105 | Bacteria | 2302 |
| 160 | Ga0157369_10179974 | 3300013105 | Bacteria | 2225 |
| 161 | Ga0157369_10223096 | 3300013105 | Bacteria | 1972 |
| 162 | Ga0157369_10368046 | 3300013105 | Bacteria | 1492 |
| 163 | Ga0163162_10002496 | 3300013306 | Bacteria | 17387 |
| 164 | Ga0163162_10127536 | 3300013306 | Bacteria | 2652 |
| 165 | Ga0163162_10698990 | 3300013306 | Bacteria | 1136 |
| 166 | Ga0157372_10031478 | 3300013307 | Bacteria | 5808 |
| 167 | Ga0157372_10186993 | 3300013307 | Bacteria | 2399 |
| 168 | Ga0182008_10069423 | 3300014497 | Bacteria | 1733 |
| 169 | Ga0157376_10204192 | 3300014969 | Bacteria | 1820 |
| 170 | Ga0182005_1000027 | 3300015265 | Bacteria | 223652 |
| 171 | Ga0213872_10000106 | 3300021361 | Bacteria | 77503 |
| 172 | Ga0213876_10010245 | 3300021384 | Bacteria | 5034 |
| 173 | Ga0209435_100044 | 3300025206 | Bacteria | 99051 |
| 174 | Ga0209674_100170 | 3300025226 | Bacteria | 81718 |
| 175 | Ga0209674_100393 | 3300025226 | Bacteria | 22498 |
| 176 | Ga0209674_101002 | 3300025226 | Bacteria | 8705 |
| 177 | Ga0209672_100009 | 3300025228 | Bacteria | 883623 |
| 178 | Ga0209563_100025 | 3300025230 | Bacteria | 596456 |
| 179 | Ga0209563_100147 | 3300025230 | Bacteria | 69021 |
| 180 | Ga0207427_105671 | 3300025231 | Bacteria | 1713 |
| 181 | Ga0209437_101211 | 3300025233 | Bacteria | 7443 |
| 182 | Ga0209258_100011 | 3300025242 | Bacteria | 867542 |
| 183 | Ga0209646_1000151 | 3300025246 | Bacteria | 99050 |
| 184 | Ga0209026_1000005 | 3300025250 | Bacteria | 731387 |
| 185 | Ga0209026_1000070 | 3300025250 | Bacteria | 205861 |
| 186 | Ga0209026_1000170 | 3300025250 | Bacteria | 99050 |
| 187 | Ga0209677_109016 | 3300025253 | Bacteria | 1844 |
| 188 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 189 | Ga0209148_1000013 | 3300025254 | Bacteria | 956684 |
| 190 | Ga0209148_1000686 | 3300025254 | Bacteria | 28101 |
| 191 | Ga0209759_1000111 | 3300025256 | Bacteria | 143545 |
| 192 | Ga0209759_1000186 | 3300025256 | Bacteria | 100413 |
| 193 | Ga0209759_1000285 | 3300025256 | Bacteria | 70420 |
| 194 | Ga0209233_1000047 | 3300025261 | Bacteria | 459614 |
| 195 | Ga0209233_1000065 | 3300025261 | Bacteria | 387195 |
| 196 | Ga0209565_1000100 | 3300025263 | Bacteria | 130380 |
| 197 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 198 | Ga0209455_1000012 | 3300025272 | Bacteria | 867234 |
| 199 | Ga0209676_1000115 | 3300025292 | Bacteria | 205183 |
| 200 | Ga0209025_1000044 | 3300025294 | Bacteria | 349480 |
| 201 | Ga0209758_1000023 | 3300025297 | Bacteria | 612453 |
| 202 | Ga0209758_1011384 | 3300025297 | Bacteria | 5160 |
| 203 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 204 | Ga0209050_1004592 | 3300025298 | Bacteria | 9248 |
| 205 | Ga0207426_1002612 | 3300025302 | Bacteria | 11173 |
| 206 | Ga0207426_1007314 | 3300025302 | Bacteria | 4639 |
| 207 | Ga0207426_1053787 | 3300025302 | Bacteria | 1187 |
| 208 | Ga0209051_1000279 | 3300025303 | Bacteria | 83677 |
| 209 | Ga0209051_1006951 | 3300025303 | Bacteria | 6278 |
| 210 | Ga0209257_1000090 | 3300025304 | Bacteria | 274746 |
| 211 | Ga0209257_1001934 | 3300025304 | Bacteria | 22347 |
| 212 | Ga0209257_1011200 | 3300025304 | Bacteria | 4360 |
| 213 | Ga0207680_10000003 | 3300025903 | Bacteria | 925264 |
| 214 | Ga0207680_10028915 | 3300025903 | Bacteria | 3107 |
| 215 | Ga0207647_10000007 | 3300025904 | Bacteria | 209754 |
| 216 | Ga0207647_10004336 | 3300025904 | Bacteria | 10518 |
| 217 | Ga0207647_10004518 | 3300025904 | Bacteria | 10306 |
| 218 | Ga0207647_10085466 | 3300025904 | Bacteria | 1887 |
| 219 | Ga0207647_10088924 | 3300025904 | Bacteria | 1844 |
| 220 | Ga0207643_10126526 | 3300025908 | Bacteria | 1517 |
| 221 | Ga0207705_10000891 | 3300025909 | Bacteria | 24453 |
| 222 | Ga0207705_10005791 | 3300025909 | Bacteria | 9205 |
| 223 | Ga0207654_10074846 | 3300025911 | Bacteria | 2022 |
| 224 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 225 | Ga0207695_10000015 | 3300025913 | Bacteria | 803205 |
| 226 | Ga0207695_10030300 | 3300025913 | Bacteria | 5958 |
| 227 | Ga0207695_10366167 | 3300025913 | Bacteria | 1328 |
| 228 | Ga0207695_10401380 | 3300025913 | Bacteria | 1255 |
| 229 | Ga0207671_10012369 | 3300025914 | Bacteria | 6867 |
| 230 | Ga0207671_10015930 | 3300025914 | Bacteria | 5862 |
| 231 | Ga0207671_10076929 | 3300025914 | Bacteria | 2498 |
| 232 | Ga0207657_10023163 | 3300025919 | Bacteria | 5788 |
| 233 | Ga0207649_10005284 | 3300025920 | Bacteria | 6983 |
| 234 | Ga0207694_10015326 | 3300025924 | Bacteria | 5783 |
| 235 | Ga0207694_10057256 | 3300025924 | Bacteria | 3030 |
| 236 | Ga0207694_10114313 | 3300025924 | Bacteria | 2150 |
| 237 | Ga0207694_10596134 | 3300025924 | Bacteria | 929 |
| 238 | Ga0207650_10273003 | 3300025925 | Bacteria | 1374 |
| 239 | Ga0207644_10094502 | 3300025931 | Bacteria | 2234 |
| 240 | Ga0207690_10000092 | 3300025932 | Bacteria | 74832 |
| 241 | Ga0207709_10000039 | 3300025935 | Bacteria | 260127 |
| 242 | Ga0207669_10000117 | 3300025937 | Bacteria | 39781 |
| 243 | Ga0207704_10000796 | 3300025938 | Bacteria | 13941 |
| 244 | Ga0207711_10231928 | 3300025941 | Bacteria | 1691 |
| 245 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 246 | Ga0207667_10012423 | 3300025949 | Bacteria | 9813 |
| 247 | Ga0207667_10018525 | 3300025949 | Bacteria | 7805 |
| 248 | Ga0207651_10092633 | 3300025960 | Bacteria | 2217 |
| 249 | Ga0207640_10041502 | 3300025981 | Bacteria | 2927 |
| 250 | Ga0207640_10042590 | 3300025981 | Bacteria | 2896 |
| 251 | Ga0207640_10206011 | 3300025981 | Bacteria | 1494 |
| 252 | Ga0207658_10453650 | 3300025986 | Bacteria | 1135 |
| 253 | Ga0207703_10216921 | 3300026035 | Bacteria | 1709 |
| 254 | Ga0207639_10034085 | 3300026041 | Bacteria | 3760 |
| 255 | Ga0207639_10047677 | 3300026041 | Bacteria | 3239 |
| 256 | Ga0207678_10017343 | 3300026067 | Bacteria | 6321 |
| 257 | Ga0207678_10126428 | 3300026067 | Bacteria | 2181 |
| 258 | Ga0207678_10217866 | 3300026067 | Bacteria | 1634 |
| 259 | Ga0207678_10572964 | 3300026067 | Bacteria | 988 |
| 260 | Ga0207702_10011648 | 3300026078 | Bacteria | 7326 |
| 261 | Ga0207702_10028184 | 3300026078 | Bacteria | 4666 |
| 262 | Ga0207702_10120372 | 3300026078 | Bacteria | 2348 |
| 263 | Ga0207648_10199901 | 3300026089 | Bacteria | 1772 |
| 264 | Ga0207674_10009769 | 3300026116 | Bacteria | 10931 |
| 265 | Ga0207674_10136354 | 3300026116 | Bacteria | 2416 |
| 266 | Ga0207674_10360958 | 3300026116 | Bacteria | 1404 |
| 267 | Ga0207683_10008488 | 3300026121 | Bacteria | 8791 |
| 268 | Ga0207698_10199835 | 3300026142 | Bacteria | 1789 |
| 269 | Ga0207698_10247253 | 3300026142 | Bacteria | 1630 |
| 270 | Ga0265354_1001446 | 3300028016 | Bacteria | 3398 |
| 271 | Ga0265356_1000405 | 3300028017 | Bacteria | 7824 |
| 272 | Ga0268266_10000011 | 3300028379 | Bacteria | 757403 |
| 273 | Ga0268264_10000058 | 3300028381 | Bacteria | 308956 |
| 274 | Ga0268264_10000060 | 3300028381 | Bacteria | 305056 |
| 275 | Ga0268264_10013032 | 3300028381 | Bacteria | 6834 |
| 276 | Ga0307517_10044986 | 3300028786 | Bacteria | 4651 |
| 277 | Ga0307515_10013091 | 3300028794 | Bacteria | 15528 |
| 278 | Ga0307515_10021681 | 3300028794 | Bacteria | 11371 |
| 279 | Ga0265338_10017529 | 3300028800 | Bacteria | 7713 |
| 280 | Ga0265770_1000128 | 3300030878 | Bacteria | 9195 |
| 281 | Ga0265760_10018201 | 3300031090 | Bacteria | 2021 |
| 282 | Ga0265331_10034213 | 3300031250 | Bacteria | 2508 |
| 283 | Ga0307406_10021673 | 3300031901 | Bacteria | 3804 |
| 284 | Ga0307412_10000751 | 3300031911 | Bacteria | 18811 |
| 285 | Ga0307414_10000835 | 3300032004 | Bacteria | 15717 |
| 286 | Ga0307510_10008938 | 3300033180 | Bacteria | 11932 |
| 287 | Ga0307510_10038241 | 3300033180 | Bacteria | 5307 |
| 288 | Ga0307510_10129345 | 3300033180 | Bacteria | 2204 |
| 289 | Ga0307510_10159368 | 3300033180 | Bacteria | 1857 |
| 290 | Ga0373925_0106780 | 3300037068 | Bacteria | 2159 |
| 291 | Ga0395899_0000004 | 3300037312 | Bacteria | 874267 |
| 292 | Ga0395899_0000228 | 3300037312 | Bacteria | 76251 |
| 293 | Ga0395899_0012532 | 3300037312 | Bacteria | 6498 |
| 294 | Ga0395900_0000052 | 3300037418 | Bacteria | 223910 |
| 295 | Ga0395900_0000070 | 3300037418 | Bacteria | 188320 |
| 296 | Ga0395898_0000501 | 3300037466 | Bacteria | 76264 |
| 297 | Ga0395898_0012979 | 3300037466 | Bacteria | 8590 |
| 298 | Ga0395905_0000622 | 3300037471 | Bacteria | 47376 |
| 299 | Ga0395905_0015761 | 3300037471 | Bacteria | 7180 |
| 300 | Ga0395905_0022154 | 3300037471 | Bacteria | 6011 |
| 301 | Ga0395905_0060948 | 3300037471 | Bacteria | 3528 |
| 302 | Ga0395905_0520845 | 3300037471 | Bacteria | 1090 |
| 303 | Ga0436364_0097704 | 3300037853 | Bacteria | 1000 |
| 304 | Ga0436364_0237048 | 3300037853 | Bacteria | 2994 |
| 305 | Ga0436364_0669598 | 3300037853 | Bacteria | 1490 |
| 306 | Ga0436364_0968346 | 3300037853 | Bacteria | 19925 |
| 307 | Ga0395901_0000001 | 3300038443 | Bacteria | 800383 |
| 308 | Ga0395901_0008360 | 3300038443 | Bacteria | 10462 |
| 309 | Ga0395901_0014150 | 3300038443 | Bacteria | 8122 |
| 310 | Ga0395901_0084393 | 3300038443 | Bacteria | 3320 |
| 311 | Ga0395901_0502247 | 3300038443 | Bacteria | 1234 |
| 312 | Ga0237819_00668 | 3300038705 | Bacteria | 11148 |
| 313 | Ga0436365_0178523 | 3300039437 | Bacteria | 11582 |
| 314 | Ga0436365_1181455 | 3300039437 | Bacteria | 2492 |
| 315 | Ga0436361_0152690 | 3300039447 | Bacteria | 36214 |
| 316 | Ga0436362_1099931 | 3300039453 | Bacteria | 1062 |
| 317 | Ga0451795_0775736 | 3300041456 | Bacteria | 1365 |
| 318 | Ga0439448_0022430 | 3300042005 | Bacteria | 1962 |
| 319 | Ga0439458_0004032 | 3300042157 | Bacteria | 3390 |
| 320 | Ga0466972_0087225 | 3300044658 | Bacteria | 1482 |
| 321 | Ga0466965_0104928 | 3300044683 | Bacteria | 1448 |
| 322 | Ga0466965_0147726 | 3300044683 | Bacteria | 1227 |
| 323 | Ga0466966_0000076 | 3300044684 | Bacteria | 62856 |
| 324 | Ga0466966_0013501 | 3300044684 | Bacteria | 5407 |
| 325 | Ga0466966_0081547 | 3300044684 | Bacteria | 2014 |
| 326 | Ga0466961_0010995 | 3300044693 | Bacteria | 5783 |
| 327 | Ga0466961_0119707 | 3300044693 | Bacteria | 1653 |
| 328 | Ga0466963_0136094 | 3300044694 | Bacteria | 1700 |
| 329 | Ga0466971_0028955 | 3300044719 | Bacteria | 2477 |
| 330 | Ga0466968_0027748 | 3300044735 | Bacteria | 2330 |
| 331 | Ga0466970_0012421 | 3300044765 | Bacteria | 4352 |
| 332 | Ga0466970_0110734 | 3300044765 | Bacteria | 1499 |
| 333 | Ga0466970_0118932 | 3300044765 | Bacteria | 1446 |
| 334 | Ga0466957_0013567 | 3300044842 | Bacteria | 4729 |
| 335 | Ga0466960_0075796 | 3300044901 | Bacteria | 1683 |
| 336 | Ga0466959_0000058 | 3300045049 | Bacteria | 77145 |
| 337 | Ga0466959_0000994 | 3300045049 | Bacteria | 16893 |
| 338 | Ga0466959_0047784 | 3300045049 | Bacteria | 3147 |
| 339 | Ga0466959_0198036 | 3300045049 | Bacteria | 1399 |
| 340 | Ga0466958_0000754 | 3300045836 | Bacteria | 14207 |
| 341 | Ga0466958_0161111 | 3300045836 | Bacteria | 1417 |
| 342 | Ga0495627_000082 | 3300046453 | Bacteria | 113641 |
| 343 | Ga0495627_016270 | 3300046453 | Bacteria | 2550 |
| 344 | Ga0495629_0004264 | 3300046459 | Bacteria | 10723 |
| 345 | Ga0495629_0047480 | 3300046459 | Bacteria | 3012 |
| 346 | Ga0495638_0005941 | 3300046460 | Bacteria | 8960 |
| 347 | Ga0495638_0007585 | 3300046460 | Bacteria | 7762 |
| 348 | Ga0495651_0003944 | 3300046462 | Bacteria | 11347 |
| 349 | Ga0495651_0114085 | 3300046462 | Bacteria | 1994 |
| 350 | Ga0495653_0129879 | 3300046463 | Bacteria | 1785 |
| 351 | Ga0495650_0000470 | 3300046471 | Bacteria | 62114 |
| 352 | Ga0495650_0000616 | 3300046471 | Bacteria | 48324 |
| 353 | Ga0495650_0036072 | 3300046471 | Bacteria | 2169 |
| 354 | Ga0495650_0053687 | 3300046471 | Bacteria | 1648 |
| 355 | Ga0495605_0000050 | 3300046474 | Bacteria | 165667 |
| 356 | Ga0495605_0119065 | 3300046474 | Bacteria | 1198 |
| 357 | Ga0495584_0050095 | 3300046491 | Bacteria | 2103 |
| 358 | Ga0495584_0058559 | 3300046491 | Bacteria | 1938 |
| 359 | Ga0495585_0003969 | 3300046492 | Bacteria | 9763 |
| 360 | Ga0495585_0008789 | 3300046492 | Bacteria | 6099 |
| 361 | Ga0495585_0212604 | 3300046492 | Bacteria | 979 |
| 362 | Ga0495594_0000310 | 3300046499 | Bacteria | 23931 |
| 363 | Ga0495596_0001637 | 3300046500 | Bacteria | 12721 |
| 364 | Ga0495596_0110054 | 3300046500 | Bacteria | 1070 |
| 365 | Ga0495607_0000006 | 3300046501 | Bacteria | 281664 |
| 366 | Ga0495607_0008757 | 3300046501 | Bacteria | 6894 |
| 367 | Ga0495583_0000002 | 3300046506 | Bacteria | 782521 |
| 368 | Ga0495583_0000007 | 3300046506 | Bacteria | 434661 |
| 369 | Ga0495583_0001366 | 3300046506 | Bacteria | 25162 |
| 370 | Ga0495583_0002053 | 3300046506 | Bacteria | 18245 |
| 371 | Ga0495583_0005931 | 3300046506 | Bacteria | 8117 |
| 372 | Ga0495606_0000092 | 3300046507 | Bacteria | 152369 |
| 373 | Ga0495606_0000281 | 3300046507 | Bacteria | 88474 |
| 374 | Ga0495606_0002734 | 3300046507 | Bacteria | 19853 |
| 375 | Ga0495606_0091812 | 3300046507 | Bacteria | 1866 |
| 376 | Ga0495606_0169829 | 3300046507 | Bacteria | 1266 |
| 377 | Ga0495606_0221039 | 3300046507 | Bacteria | 1067 |
| 378 | Ga0495608_0035426 | 3300046511 | Bacteria | 3366 |
| 379 | Ga0495610_0000013 | 3300046512 | Bacteria | 465872 |
| 380 | Ga0495610_0000157 | 3300046512 | Bacteria | 75701 |
| 381 | Ga0495610_0000525 | 3300046512 | Bacteria | 38499 |
| 382 | Ga0495610_0000606 | 3300046512 | Bacteria | 35491 |
| 383 | Ga0495610_0005531 | 3300046512 | Bacteria | 8948 |
| 384 | Ga0495610_0055474 | 3300046512 | Bacteria | 1909 |
| 385 | Ga0495616_0000286 | 3300046513 | Bacteria | 40792 |
| 386 | Ga0495616_0040799 | 3300046513 | Bacteria | 2370 |
| 387 | Ga0495616_0089173 | 3300046513 | Bacteria | 1463 |
| 388 | Ga0495620_0000017 | 3300046515 | Bacteria | 153019 |
| 389 | Ga0495620_0001200 | 3300046515 | Bacteria | 15851 |
| 390 | Ga0495620_0001880 | 3300046515 | Bacteria | 12349 |
| 391 | Ga0495628_0020854 | 3300046516 | Bacteria | 5399 |
| 392 | Ga0495631_0034996 | 3300046518 | Bacteria | 2249 |
| 393 | Ga0495632_0000096 | 3300046519 | Bacteria | 89284 |
| 394 | Ga0495632_0000196 | 3300046519 | Bacteria | 61287 |
| 395 | Ga0495632_0004529 | 3300046519 | Bacteria | 9423 |
| 396 | Ga0495632_0006724 | 3300046519 | Bacteria | 7354 |
| 397 | Ga0495632_0009425 | 3300046519 | Bacteria | 5891 |
| 398 | Ga0495632_0037413 | 3300046519 | Bacteria | 2462 |
| 399 | Ga0495637_0000259 | 3300046520 | Bacteria | 41761 |
| 400 | Ga0495637_0001690 | 3300046520 | Bacteria | 12740 |
| 401 | Ga0495637_0019620 | 3300046520 | Bacteria | 3123 |
| 402 | Ga0495643_0001606 | 3300046522 | Bacteria | 20005 |
| 403 | Ga0495643_0001832 | 3300046522 | Bacteria | 18081 |
| 404 | Ga0495643_0008189 | 3300046522 | Bacteria | 6645 |
| 405 | Ga0495643_0009366 | 3300046522 | Bacteria | 6088 |
| 406 | Ga0495643_0023276 | 3300046522 | Bacteria | 3523 |
| 407 | Ga0495643_0023396 | 3300046522 | Bacteria | 3513 |
| 408 | Ga0495643_0055918 | 3300046522 | Bacteria | 2108 |
| 409 | Ga0495644_0023659 | 3300046523 | Bacteria | 2338 |
| 410 | Ga0495648_0000146 | 3300046524 | Bacteria | 84443 |
| 411 | Ga0495648_0007691 | 3300046524 | Bacteria | 8590 |
| 412 | Ga0495648_0077532 | 3300046524 | Bacteria | 1904 |
| 413 | Ga0495663_0000016 | 3300046525 | Bacteria | 142125 |
| 414 | Ga0495663_0000968 | 3300046525 | Bacteria | 9553 |
| 415 | Ga0495642_0032028 | 3300046528 | Bacteria | 2108 |
| 416 | Ga0495652_0014444 | 3300046529 | Bacteria | 7087 |
| 417 | Ga0495652_0128861 | 3300046529 | Bacteria | 2006 |
| 418 | Ga0495654_0001157 | 3300046530 | Bacteria | 18885 |
| 419 | Ga0495654_0010980 | 3300046530 | Bacteria | 4919 |
| 420 | Ga0495654_0021519 | 3300046530 | Bacteria | 3354 |
| 421 | Ga0495640_0120853 | 3300046533 | Bacteria | 1703 |
| 422 | Ga0495587_0010466 | 3300046536 | Bacteria | 5902 |
| 423 | Ga0495609_0000004 | 3300046538 | Bacteria | 697346 |
| 424 | Ga0495609_0000243 | 3300046538 | Bacteria | 51423 |
| 425 | Ga0495597_0077369 | 3300046542 | Bacteria | 1426 |
| 426 | Ga0495645_0039537 | 3300046543 | Bacteria | 3440 |
| 427 | Ga0495622_0000811 | 3300046557 | Bacteria | 17289 |
| 428 | Ga0495622_0079556 | 3300046557 | Bacteria | 1508 |
| 429 | Ga0495633_0000051 | 3300046558 | Bacteria | 154944 |
| 430 | Ga0495633_0001313 | 3300046558 | Bacteria | 19617 |
| 431 | Ga0495633_0001331 | 3300046558 | Bacteria | 19380 |
| 432 | Ga0495633_0159054 | 3300046558 | Bacteria | 1042 |
| 433 | Ga0495668_0000056 | 3300046616 | Bacteria | 197862 |
| 434 | Ga0495668_0005967 | 3300046616 | Bacteria | 8093 |
| 435 | Ga0495668_0044700 | 3300046616 | Bacteria | 2461 |
| 436 | Ga0495668_0177738 | 3300046616 | Bacteria | 1166 |
| 437 | Ga0495611_0001518 | 3300046648 | Bacteria | 11425 |
| 438 | Ga0495611_0014485 | 3300046648 | Bacteria | 3369 |
| 439 | Ga0495611_0016497 | 3300046648 | Bacteria | 3157 |
| 440 | Ga0495611_0113967 | 3300046648 | Bacteria | 1259 |
| 441 | Ga0495625_0000004 | 3300046660 | Bacteria | 611314 |
| 442 | Ga0495625_0000255 | 3300046660 | Bacteria | 82750 |
| 443 | Ga0495625_0010467 | 3300046660 | Bacteria | 7673 |
| 444 | Ga0495625_0022116 | 3300046660 | Bacteria | 4881 |
| 445 | Ga0495625_0212629 | 3300046660 | Bacteria | 1270 |
| 446 | Ga0495635_0137854 | 3300046663 | Bacteria | 1662 |
| 447 | Ga0495661_0000005 | 3300046665 | Bacteria | 433622 |
| 448 | Ga0495661_0000006 | 3300046665 | Bacteria | 427288 |
| 449 | Ga0495661_0062264 | 3300046665 | Bacteria | 2211 |
| 450 | Ga0495657_0012056 | 3300046675 | Bacteria | 6432 |
| 451 | Ga0495599_0033179 | 3300046678 | Bacteria | 3243 |
| 452 | Ga0495669_0000140 | 3300046684 | Bacteria | 45734 |
| 453 | Ga0495613_0076608 | 3300046689 | Bacteria | 2434 |
| 454 | Ga0495670_0016590 | 3300046691 | Bacteria | 3621 |
| 455 | Ga0495671_0000974 | 3300046692 | Bacteria | 20005 |
| 456 | Ga0495671_0087473 | 3300046692 | Bacteria | 1526 |
| 457 | Ga0495649_0001686 | 3300046694 | Bacteria | 16376 |
| 458 | Ga0495649_0016249 | 3300046694 | Bacteria | 4220 |
| 459 | Ga0495649_0051539 | 3300046694 | Bacteria | 2231 |
| 460 | Ga0495649_0052354 | 3300046694 | Bacteria | 2212 |
| 461 | Ga0495649_0106009 | 3300046694 | Bacteria | 1492 |
| 462 | Ga0495589_0001000 | 3300046794 | Bacteria | 17151 |
| 463 | Ga0495600_0000238 | 3300046809 | Bacteria | 30249 |
| 464 | Ga0495600_0004612 | 3300046809 | Bacteria | 8257 |
| 465 | Ga0495600_0019775 | 3300046809 | Bacteria | 4303 |
| 466 | Ga0495660_0007985 | 3300046810 | Bacteria | 6215 |
| 467 | Ga0495660_0044671 | 3300046810 | Bacteria | 2436 |
| 468 | Ga0495660_0045673 | 3300046810 | Bacteria | 2403 |
| 469 | Ga0495604_0002725 | 3300047317 | Bacteria | 14169 |
| 470 | Ga0495604_0067248 | 3300047317 | Bacteria | 2723 |
| 471 | Ga0495683_0000004 | 3300047323 | Bacteria | 321136 |
| 472 | Ga0495683_0002838 | 3300047323 | Bacteria | 10258 |
| 473 | Ga0495683_0009713 | 3300047323 | Bacteria | 5116 |
| 474 | Ga0495687_000323 | 3300047443 | Bacteria | 62186 |
| 475 | Ga0495687_000353 | 3300047443 | Bacteria | 58833 |
| 476 | Ga0495677_0004893 | 3300047445 | Bacteria | 5108 |
| 477 | Ga0495679_000015 | 3300047446 | Bacteria | 287256 |
| 478 | Ga0495679_008355 | 3300047446 | Bacteria | 4217 |
| 479 | Ga0495673_0000118 | 3300047469 | Bacteria | 147670 |
| 480 | Ga0495673_0000186 | 3300047469 | Bacteria | 100563 |
| 481 | Ga0495673_0011223 | 3300047469 | Bacteria | 4832 |
| 482 | Ga0495673_0011733 | 3300047469 | Bacteria | 4691 |
| 483 | Ga0495681_0000030 | 3300047470 | Bacteria | 129910 |
| 484 | Ga0495681_0002539 | 3300047470 | Bacteria | 13002 |
| 485 | Ga0495681_0010402 | 3300047470 | Bacteria | 5632 |
| 486 | Ga0495681_0019035 | 3300047470 | Bacteria | 3763 |
| 487 | Ga0495681_0079228 | 3300047470 | Bacteria | 1470 |
| 488 | Ga0495684_0124217 | 3300047471 | Bacteria | 1942 |
| 489 | Ga0495686_0000092 | 3300047472 | Bacteria | 189292 |
| 490 | Ga0495686_0000262 | 3300047472 | Bacteria | 94462 |
| 491 | Ga0495686_0054626 | 3300047472 | Bacteria | 2500 |
| 492 | Ga0495686_0079969 | 3300047472 | Bacteria | 1999 |
| 493 | Ga0495686_0085601 | 3300047472 | Bacteria | 1919 |
| 494 | Ga0495686_0103186 | 3300047472 | Bacteria | 1718 |
| 495 | Ga0495686_0210278 | 3300047472 | Unclassified | 1112 |
| 496 | Ga0495615_0000250 | 3300048090 | Bacteria | 10525 |
| 497 | Ga0495626_0000201 | 3300048091 | Bacteria | 72576 |
| 498 | Ga0496102_0000163 | 3300048905 | Bacteria | 89673 |
| 499 | Ga0496102_0465179 | 3300048905 | Bacteria | 1186 |
| 500 | Ga0496103_0000052 | 3300048906 | Bacteria | 149437 |
| 501 | Ga0496104_0001022 | 3300048907 | Bacteria | 23940 |
| 502 | Ga0496104_0004010 | 3300048907 | Bacteria | 12763 |
| 503 | Ga0496105_0001540 | 3300048908 | Bacteria | 16320 |
| 504 | Ga0496105_0004645 | 3300048908 | Bacteria | 10353 |
| 505 | Ga0496105_0017709 | 3300048908 | Bacteria | 5716 |
| 506 | Ga0496106_0037370 | 3300048909 | Bacteria | 3633 |
| 507 | Ga0496106_0067736 | 3300048909 | Bacteria | 2722 |
| 508 | Ga0496110_0022048 | 3300048913 | Bacteria | 5402 |
| 509 | Ga0496110_0308696 | 3300048913 | Bacteria | 1441 |
| 510 | Ga0496111_0053896 | 3300048914 | Bacteria | 2906 |
| 511 | Ga0496114_0012792 | 3300048917 | Bacteria | 6718 |
| 512 | Ga0496114_0035807 | 3300048917 | Bacteria | 4100 |
| 513 | Ga0496115_0000078 | 3300048918 | Bacteria | 89817 |
| 514 | Ga0496115_0001140 | 3300048918 | Bacteria | 19184 |
| 515 | Ga0496115_0035167 | 3300048918 | Bacteria | 3962 |
| 516 | Ga0496115_0199874 | 3300048918 | Bacteria | 1651 |
| 517 | Ga0496116_0002348 | 3300048919 | Bacteria | 20011 |
| 518 | Ga0496116_0022840 | 3300048919 | Bacteria | 4673 |
| 519 | Ga0496116_0118327 | 3300048919 | Bacteria | 1539 |
| 520 | Ga0496117_0000141 | 3300048920 | Bacteria | 158041 |
| 521 | Ga0496117_0014772 | 3300048920 | Bacteria | 6702 |
| 522 | Ga0496117_0072252 | 3300048920 | Bacteria | 2308 |
| 523 | Ga0496117_0139092 | 3300048920 | Bacteria | 1457 |
| 524 | Ga0496118_0000103 | 3300048921 | Bacteria | 158099 |
| 525 | Ga0496118_0001211 | 3300048921 | Bacteria | 39688 |
| 526 | Ga0496118_0007258 | 3300048921 | Bacteria | 11817 |
| 527 | Ga0496118_0007966 | 3300048921 | Bacteria | 11076 |
| 528 | Ga0496118_0013683 | 3300048921 | Bacteria | 7656 |
| 529 | Ga0496118_0229625 | 3300048921 | Bacteria | 1072 |
| 530 | Ga0496119_0000450 | 3300048922 | Bacteria | 56283 |
| 531 | Ga0496119_0008606 | 3300048922 | Bacteria | 8934 |
| 532 | Ga0496119_0009469 | 3300048922 | Bacteria | 8352 |
| 533 | Ga0496119_0012222 | 3300048922 | Bacteria | 6999 |
| 534 | Ga0496119_0149911 | 3300048922 | Bacteria | 1251 |
| 535 | Ga0496120_0001560 | 3300048923 | Bacteria | 26816 |
| 536 | Ga0496120_0003845 | 3300048923 | Bacteria | 13194 |
| 537 | Ga0496120_0029940 | 3300048923 | Bacteria | 3317 |
| 538 | Ga0496120_0030120 | 3300048923 | Bacteria | 3304 |
| 539 | Ga0496120_0034189 | 3300048923 | Bacteria | 3048 |
| 540 | Ga0496120_0052615 | 3300048923 | Bacteria | 2318 |
| 541 | Ga0496120_0062119 | 3300048923 | Bacteria | 2082 |
| 542 | Ga0496121_0000075 | 3300048924 | Bacteria | 240437 |
| 543 | Ga0496121_0000156 | 3300048924 | Bacteria | 149376 |
| 544 | Ga0496121_0002278 | 3300048924 | Bacteria | 29851 |
| 545 | Ga0496121_0067986 | 3300048924 | Bacteria | 2885 |
| 546 | Ga0496121_0074242 | 3300048924 | Bacteria | 2721 |
| 547 | Ga0496121_0081216 | 3300048924 | Bacteria | 2567 |
| 548 | Ga0496121_0203303 | 3300048924 | Bacteria | 1410 |
| 549 | Ga0496121_0208179 | 3300048924 | Bacteria | 1388 |
| 550 | Ga0496122_0001025 | 3300048925 | Bacteria | 49395 |
| 551 | Ga0496122_0001717 | 3300048925 | Bacteria | 33994 |
| 552 | Ga0496122_0003081 | 3300048925 | Bacteria | 22440 |
| 553 | Ga0496122_0011237 | 3300048925 | Bacteria | 9098 |
| 554 | Ga0496122_0048796 | 3300048925 | Bacteria | 3250 |
| 555 | Ga0496122_0058091 | 3300048925 | Bacteria | 2867 |
| 556 | Ga0496122_0217345 | 3300048925 | Bacteria | 1100 |
| 557 | Ga0496123_0000018 | 3300048926 | Bacteria | 404553 |
| 558 | Ga0496123_0000211 | 3300048926 | Bacteria | 118697 |
| 559 | Ga0496123_0000949 | 3300048926 | Bacteria | 45130 |
| 560 | Ga0496123_0004603 | 3300048926 | Bacteria | 14356 |
| 561 | Ga0496123_0005769 | 3300048926 | Bacteria | 12308 |
| 562 | Ga0496123_0011302 | 3300048926 | Bacteria | 7759 |
| 563 | Ga0496123_0015413 | 3300048926 | Bacteria | 6270 |
| 564 | Ga0496123_0017459 | 3300048926 | Bacteria | 5770 |
| 565 | Ga0496123_0029034 | 3300048926 | Bacteria | 4083 |
| 566 | Ga0496123_0070185 | 3300048926 | Bacteria | 2194 |
| 567 | Ga0496123_0075212 | 3300048926 | Bacteria | 2086 |
| 568 | Ga0496123_0102025 | 3300048926 | Bacteria | 1666 |
| 569 | Ga0496123_0189934 | 3300048926 | Bacteria | 1063 |
| 570 | Ga0496124_0000041 | 3300048927 | Bacteria | 303887 |
| 571 | Ga0496124_0000110 | 3300048927 | Bacteria | 166321 |
| 572 | Ga0496124_0000175 | 3300048927 | Bacteria | 128785 |
| 573 | Ga0496124_0002880 | 3300048927 | Bacteria | 21737 |
| 574 | Ga0496124_0007902 | 3300048927 | Bacteria | 11204 |
| 575 | Ga0496124_0035212 | 3300048927 | Bacteria | 4382 |
| 576 | Ga0496124_0044957 | 3300048927 | Bacteria | 3787 |
| 577 | Ga0496124_0100876 | 3300048927 | Bacteria | 2339 |
| 578 | Ga0496124_0111555 | 3300048927 | Bacteria | 2200 |
| 579 | Ga0496125_0000215 | 3300048928 | Bacteria | 118487 |
| 580 | Ga0496125_0000238 | 3300048928 | Bacteria | 113252 |
| 581 | Ga0496125_0004460 | 3300048928 | Bacteria | 16141 |
| 582 | Ga0496125_0005040 | 3300048928 | Bacteria | 14904 |
| 583 | Ga0496125_0022996 | 3300048928 | Bacteria | 5770 |
| 584 | Ga0496125_0116286 | 3300048928 | Bacteria | 1921 |
| 585 | Ga0496125_0118046 | 3300048928 | Bacteria | 1901 |
| 586 | Ga0496125_0127714 | 3300048928 | Bacteria | 1798 |
| 587 | Ga0496126_0000155 | 3300048929 | Bacteria | 158816 |
| 588 | Ga0496126_0007407 | 3300048929 | Bacteria | 12040 |
| 589 | Ga0496126_0015879 | 3300048929 | Bacteria | 7560 |
| 590 | Ga0496126_0035447 | 3300048929 | Bacteria | 4677 |
| 591 | Ga0496126_0069759 | 3300048929 | Bacteria | 3133 |
| 592 | Ga0496126_0074200 | 3300048929 | Bacteria | 3022 |
| 593 | Ga0496126_0483172 | 3300048929 | Bacteria | 992 |
| 594 | Ga0495678_000014 | 3300049459 | Bacteria | 313755 |
| 595 | Ga0495678_008882 | 3300049459 | Bacteria | 5024 |
| 596 | Ga0495682_0016391 | 3300049460 | Bacteria | 2805 |
| 597 | Ga0501031_0054455 | 3300049568 | Bacteria | 2607 |
| 598 | Ga0501031_0083117 | 3300049568 | Bacteria | 2087 |
| 599 | Ga0501032_0000683 | 3300049569 | Bacteria | 27581 |
| 600 | Ga0501032_0004574 | 3300049569 | Bacteria | 10409 |
| 601 | Ga0501032_0017514 | 3300049569 | Bacteria | 5029 |
| 602 | Ga0501032_0098198 | 3300049569 | Bacteria | 1941 |
| 603 | Ga0501032_0255287 | 3300049569 | Bacteria | 1137 |
| 604 | Ga0501033_0000645 | 3300049570 | Bacteria | 32274 |
| 605 | Ga0501033_0001599 | 3300049570 | Bacteria | 19914 |
| 606 | Ga0501033_0068587 | 3300049570 | Bacteria | 2607 |
| 607 | Ga0501033_0126332 | 3300049570 | Bacteria | 1854 |
| 608 | Ga0501034_0004311 | 3300049571 | Bacteria | 15861 |
| 609 | Ga0501034_0053703 | 3300049571 | Bacteria | 4057 |
| 610 | Ga0501034_0139707 | 3300049571 | Bacteria | 2403 |
| 611 | Ga0501034_0235958 | 3300049571 | Bacteria | 1776 |
| 612 | Ga0501034_0419690 | 3300049571 | Bacteria | 1259 |
| 613 | Ga0501034_0429289 | 3300049571 | Bacteria | 1241 |
| 614 | Ga0501036_0003715 | 3300049572 | Bacteria | 12236 |
| 615 | Ga0501036_0099212 | 3300049572 | Bacteria | 2463 |
| 616 | Ga0501036_0216120 | 3300049572 | Bacteria | 1610 |
| 617 | Ga0501037_0000484 | 3300049573 | Bacteria | 32262 |
| 618 | Ga0501037_0000967 | 3300049573 | Bacteria | 21322 |
| 619 | Ga0501038_0002722 | 3300049574 | Bacteria | 16485 |
| 620 | Ga0501038_0114465 | 3300049574 | Bacteria | 2231 |
| 621 | Ga0501038_0206323 | 3300049574 | Bacteria | 1575 |
| 622 | Ga0501038_0301561 | 3300049574 | Bacteria | 1257 |
| 623 | Ga0501038_0443049 | 3300049574 | Bacteria | 1000 |
| 624 | Ga0501039_0001996 | 3300049575 | Bacteria | 15093 |
| 625 | Ga0501042_0033225 | 3300049578 | Bacteria | 3657 |
| 626 | Ga0501043_0000593 | 3300049579 | Bacteria | 32115 |
| 627 | Ga0501043_0001016 | 3300049579 | Bacteria | 24650 |
| 628 | Ga0501043_0071079 | 3300049579 | Bacteria | 2734 |
| 629 | Ga0501043_0119814 | 3300049579 | Bacteria | 2064 |
| 630 | Ga0501046_0000499 | 3300049580 | Bacteria | 39177 |
| 631 | Ga0501046_0010181 | 3300049580 | Bacteria | 8091 |
| 632 | Ga0501046_0105770 | 3300049580 | Bacteria | 2155 |
| 633 | Ga0501046_0231119 | 3300049580 | Bacteria | 1366 |
| 634 | Ga0501047_0001042 | 3300049581 | Bacteria | 27709 |
| 635 | Ga0501047_0011495 | 3300049581 | Bacteria | 8380 |
| 636 | Ga0501047_0106929 | 3300049581 | Bacteria | 2679 |
| 637 | Ga0501047_0249106 | 3300049581 | Bacteria | 1625 |
| 638 | Ga0501048_0022882 | 3300049582 | Bacteria | 4569 |
| 639 | Ga0501048_0032973 | 3300049582 | Bacteria | 3743 |
| 640 | Ga0501067_0007605 | 3300049583 | Bacteria | 6026 |
| 641 | Ga0501068_0001651 | 3300049584 | Bacteria | 11922 |
| 642 | Ga0501068_0059779 | 3300049584 | Bacteria | 2314 |
| 643 | Ga0501069_0000331 | 3300049585 | Bacteria | 21342 |
| 644 | Ga0501069_0008815 | 3300049585 | Bacteria | 5314 |
| 645 | Ga0501070_0001433 | 3300049586 | Bacteria | 21342 |
| 646 | Ga0501070_0003020 | 3300049586 | Bacteria | 14651 |
| 647 | Ga0501070_0067679 | 3300049586 | Bacteria | 2958 |
| 648 | Ga0501071_0045104 | 3300049587 | Bacteria | 3164 |
| 649 | Ga0501071_0128530 | 3300049587 | Bacteria | 1881 |
| 650 | Ga0501072_0542031 | 3300049588 | Bacteria | 919 |
| 651 | Ga0501073_0014323 | 3300049589 | Bacteria | 5761 |
| 652 | Ga0501073_0148255 | 3300049589 | Bacteria | 1626 |
| 653 | Ga0501074_0001744 | 3300049590 | Bacteria | 14869 |
| 654 | Ga0501074_0004226 | 3300049590 | Bacteria | 10257 |
| 655 | Ga0501079_0070522 | 3300049741 | Bacteria | 2699 |
| 656 | Ga0501080_0000326 | 3300049742 | Bacteria | 36467 |
| 657 | Ga0501080_0010446 | 3300049742 | Bacteria | 8498 |
| 658 | Ga0501083_0000748 | 3300049744 | Bacteria | 21231 |
| 659 | Ga0501083_0023811 | 3300049744 | Bacteria | 4246 |
| 660 | Ga0501083_0158829 | 3300049744 | Bacteria | 1479 |
| 661 | Ga0501035_0001846 | 3300049822 | Bacteria | 21326 |
| 662 | Ga0501035_0003801 | 3300049822 | Bacteria | 14387 |
| 663 | Ga0501035_0075200 | 3300049822 | Bacteria | 2987 |
| 664 | Ga0501035_0096409 | 3300049822 | Bacteria | 2599 |
| 665 | Ga0501035_0228851 | 3300049822 | Bacteria | 1585 |
| 666 | Ga0501044_0011279 | 3300049823 | Bacteria | 9684 |
| 667 | Ga0501044_0029503 | 3300049823 | Bacteria | 5783 |
| 668 | Ga0501044_0033544 | 3300049823 | Bacteria | 5394 |
| 669 | Ga0501044_0113430 | 3300049823 | Bacteria | 2718 |
| 670 | Ga0501044_0121158 | 3300049823 | Bacteria | 2617 |
| 671 | Ga0501044_0155576 | 3300049823 | Bacteria | 2266 |
| 672 | Ga0501044_0200826 | 3300049823 | Bacteria | 1952 |
| 673 | Ga0501044_0278169 | 3300049823 | Bacteria | 1608 |
| 674 | Ga0501044_0436134 | 3300049823 | Bacteria | 1218 |
| 675 | Ga0501045_0014252 | 3300049824 | Bacteria | 5635 |
| 676 | nmdc:mga0n895_8184_c1 | 3300050512 | Bacteria | 9038 |
| 677 | nmdc:mga0rr50_3298_c1 | 3300050513 | Bacteria | 9266 |
| 678 | nmdc:mga0a205_10744_c1 | 3300050515 | Bacteria | 8416 |
| 679 | Ga0500610_0000018 | 3300053079 | Bacteria | 72777 |
| 680 | Ga0500610_0048511 | 3300053079 | Bacteria | 2208 |
| 681 | Ga0500643_000225 | 3300053087 | Bacteria | 52825 |
| 682 | Ga0500643_002359 | 3300053087 | Bacteria | 9861 |
| 683 | Ga0500646_0017153 | 3300053090 | Bacteria | 1896 |
| 684 | Ga0500651_0010027 | 3300053093 | Bacteria | 5659 |
| 685 | Ga0500641_0001522 | 3300053096 | Bacteria | 8271 |
| 686 | Ga0500555_001252 | 3300053103 | Bacteria | 8149 |
| 687 | Ga0500562_022854 | 3300053108 | Bacteria | 1630 |
| 688 | Ga0500592_007028 | 3300053116 | Bacteria | 1790 |
| 689 | Ga0500595_002053 | 3300053119 | Bacteria | 10287 |
| 690 | Ga0500595_027264 | 3300053119 | Bacteria | 1958 |
| 691 | Ga0500595_029014 | 3300053119 | Bacteria | 1881 |
| 692 | Ga0500597_000551 | 3300053120 | Bacteria | 8071 |
| 693 | Ga0500607_036360 | 3300053121 | Bacteria | 2689 |
| 694 | Ga0500608_013669 | 3300053122 | Bacteria | 3603 |
| 695 | Ga0500642_0000178 | 3300053130 | Bacteria | 26342 |
| 696 | Ga0500642_0052048 | 3300053130 | Bacteria | 1811 |
| 697 | Ga0500559_0000468 | 3300053136 | Bacteria | 28756 |
| 698 | Ga0500559_0133345 | 3300053136 | Bacteria | 1161 |
| 699 | Ga0500573_0009877 | 3300053140 | Bacteria | 5314 |
| 700 | Ga0500616_0005043 | 3300053153 | Bacteria | 9130 |
| 701 | Ga0500616_0026387 | 3300053153 | Bacteria | 3216 |
| 702 | Ga0500616_0026860 | 3300053153 | Bacteria | 3183 |
| 703 | Ga0500616_0142154 | 3300053153 | Bacteria | 1120 |
| 704 | Ga0500622_0021616 | 3300053156 | Bacteria | 3414 |
| 705 | Ga0500625_002064 | 3300053729 | Bacteria | 7336 |
| 706 | Ga0500645_000073 | 3300053730 | Bacteria | 79133 |
| 707 | Ga0500596_008393 | 3300053735 | Bacteria | 1649 |
| 708 | Ga0501084_0297086 | 3300054114 | Bacteria | 1364 |
| 709 | Ga0501084_0455952 | 3300054114 | Bacteria | 1081 |
| 710 | Ga0500661_000041 | 3300055283 | Bacteria | 19487 |
| 711 | Ga0501082_0214741 | 3300060353 | Bacteria | 1673 |
| 712 | Ga0466962_0054966 | 3300061719 | Bacteria | 1902 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2977907340 | 2977907586 | 238 |
| 2 | iso_pu_bacteria | 2643221719 | 2644657109 | 267 |
| 3 | 3300013100 | Ga0157373_10088611 | Ga0157373_100886112 | 268 |
| 4 | 3300042005 | Ga0439448_0022430 | Ga0439448_0022430_982_1842 | 268 |
| 5 | iso_pu_bacteria | 2747842428 | 2747949770 | 268 |
| 6 | iso_pu_bacteria | 2765235840 | 2765579157 | 268 |
| 7 | iso_pu_bacteria | 2919100787 | 2919106411 | 268 |
| 8 | 3300003759 | Ga0055525_1000013 | Ga0055525_1000013308 | 269 |
| 9 | 3300025230 | Ga0209563_100025 | Ga0209563_100025278 | 269 |
| 10 | iso_pu_bacteria | 2503198000 | 2503201169 | 269 |
| 11 | iso_pu_bacteria | 2509276022 | 2509395926 | 269 |
| 12 | iso_pu_bacteria | 2856320880 | 2856326966 | 269 |
| 13 | iso_pu_bacteria | 2869278585 | 2869283490 | 269 |
| 14 | iso_pu_bacteria | 2874139085 | 2874143822 | 269 |
| 15 | 3300025298 | Ga0209050_1004592 | Ga0209050_10045926 | 270 |
| 16 | 3300025924 | Ga0207694_10596134 | Ga0207694_105961341 | 270 |
| 17 | 3300028800 | Ga0265338_10017529 | Ga0265338_100175293 | 270 |
| 18 | 3300044683 | Ga0466965_0147726 | Ga0466965_0147726_258_1091 | 270 |
| 19 | 3300044684 | Ga0466966_0000076 | Ga0466966_0000076_48977_49825 | 270 |
| 20 | 3300044684 | Ga0466966_0081547 | Ga0466966_0081547_521_1354 | 270 |
| 21 | 3300044694 | Ga0466963_0136094 | Ga0466963_0136094_469_1317 | 270 |
| 22 | 3300044719 | Ga0466971_0028955 | Ga0466971_0028955_1538_2386 | 270 |
| 23 | 3300044765 | Ga0466970_0110734 | Ga0466970_0110734_265_1113 | 270 |
| 24 | 3300044842 | Ga0466957_0013567 | Ga0466957_0013567_3518_4366 | 270 |
| 25 | 3300045049 | Ga0466959_0000994 | Ga0466959_0000994_1528_2376 | 270 |
| 26 | 3300045049 | Ga0466959_0198036 | Ga0466959_0198036_43_876 | 270 |
| 27 | 3300045836 | Ga0466958_0000754 | Ga0466958_0000754_7210_8058 | 270 |
| 28 | 3300046512 | Ga0495610_0005531 | Ga0495610_0005531_4995_5825 | 270 |
| 29 | 3300047472 | Ga0495686_0210278 | Ga0495686_0210278_209_1039 | 270 |
| 30 | 3300048922 | Ga0496119_0000450 | Ga0496119_0000450_31213_32055 | 270 |
| 31 | 3300048923 | Ga0496120_0034189 | Ga0496120_0034189_264_1106 | 270 |
| 32 | 3300053153 | Ga0500616_0142154 | Ga0500616_0142154_72_914 | 270 |
| 33 | iso_pu_bacteria | 2977986579 | 2977989556 | 270 |
| 34 | iso_pu_bacteria | 8054002106 | 8054008268 | 270 |
| 35 | 3300009093 | Ga0105240_10254023 | Ga0105240_102540232 | 271 |
| 36 | 3300037853 | Ga0436364_0097704 | Ga0436364_0097704_48_878 | 271 |
| 37 | 3300037853 | Ga0436364_0968346 | Ga0436364_0968346_6107_6943 | 271 |
| 38 | 3300039453 | Ga0436362_1099931 | Ga0436362_1099931_119_958 | 271 |
| 39 | 3300046506 | Ga0495583_0002053 | Ga0495583_0002053_16207_17037 | 271 |
| 40 | 3300046507 | Ga0495606_0221039 | Ga0495606_0221039_14_850 | 271 |
| 41 | 3300048907 | Ga0496104_0001022 | Ga0496104_0001022_8296_9213 | 271 |
| 42 | 3300048908 | Ga0496105_0004645 | Ga0496105_0004645_2238_3155 | 271 |
| 43 | 3300048909 | Ga0496106_0037370 | Ga0496106_0037370_571_1488 | 271 |
| 44 | 3300048913 | Ga0496110_0022048 | Ga0496110_0022048_2110_3027 | 271 |
| 45 | 3300048917 | Ga0496114_0012792 | Ga0496114_0012792_226_1068 | 271 |
| 46 | 3300048919 | Ga0496116_0022840 | Ga0496116_0022840_1240_2157 | 271 |
| 47 | 3300048922 | Ga0496119_0012222 | Ga0496119_0012222_3973_4890 | 271 |
| 48 | 3300048924 | Ga0496121_0208179 | Ga0496121_0208179_133_1050 | 271 |
| 49 | 3300048925 | Ga0496122_0217345 | Ga0496122_0217345_70_987 | 271 |
| 50 | 3300048926 | Ga0496123_0070185 | Ga0496123_0070185_1241_2158 | 271 |
| 51 | 3300048927 | Ga0496124_0007902 | Ga0496124_0007902_2108_3025 | 271 |
| 52 | 3300048928 | Ga0496125_0022996 | Ga0496125_0022996_3223_4140 | 271 |
| 53 | iso_pu_bacteria | 2756170246 | 2756672175 | 271 |
| 54 | iso_pu_bacteria | 2844002411 | 2844007874 | 271 |
| 55 | iso_pu_bacteria | 2871466892 | 2871471598 | 271 |
| 56 | iso_pu_bacteria | 2906378014 | 2906384906 | 271 |
| 57 | iso_pu_bacteria | 2924733363 | 2924737229 | 271 |
| 58 | iso_pu_bacteria | 2937877337 | 2937884099 | 271 |
| 59 | iso_pu_bacteria | 2958084443 | 2958091410 | 271 |
| 60 | 3300003762 | Ga0055542_1000546 | Ga0055542_10005467 | 272 |
| 61 | 3300005327 | Ga0070658_10045429 | Ga0070658_100454294 | 272 |
| 62 | 3300005335 | Ga0070666_10097645 | Ga0070666_100976453 | 272 |
| 63 | 3300005455 | Ga0070663_100388932 | Ga0070663_1003889322 | 272 |
| 64 | 3300005539 | Ga0068853_100174820 | Ga0068853_1001748202 | 272 |
| 65 | 3300005578 | Ga0068854_100408605 | Ga0068854_1004086051 | 272 |
| 66 | 3300005614 | Ga0068856_100106768 | Ga0068856_1001067683 | 272 |
| 67 | 3300005841 | Ga0068863_100152267 | Ga0068863_1001522672 | 272 |
| 68 | 3300005843 | Ga0068860_100000274 | Ga0068860_1000002746 | 272 |
| 69 | 3300006038 | Ga0075365_10012007 | Ga0075365_100120072 | 272 |
| 70 | 3300006042 | Ga0075368_10083092 | Ga0075368_100830921 | 272 |
| 71 | 3300006051 | Ga0075364_10100396 | Ga0075364_101003962 | 272 |
| 72 | 3300009101 | Ga0105247_10341220 | Ga0105247_103412201 | 272 |
| 73 | 3300010375 | Ga0105239_10602137 | Ga0105239_106021372 | 272 |
| 74 | 3300025903 | Ga0207680_10028915 | Ga0207680_100289153 | 272 |
| 75 | 3300025904 | Ga0207647_10085466 | Ga0207647_100854662 | 272 |
| 76 | 3300026067 | Ga0207678_10017343 | Ga0207678_100173433 | 272 |
| 77 | 3300028381 | Ga0268264_10000058 | Ga0268264_10000058257 | 272 |
| 78 | 3300028381 | Ga0268264_10000060 | Ga0268264_10000060251 | 272 |
| 79 | 3300028794 | Ga0307515_10021681 | Ga0307515_100216817 | 272 |
| 80 | 3300046694 | Ga0495649_0106009 | Ga0495649_0106009_179_1009 | 272 |
| 81 | 3300047469 | Ga0495673_0000186 | Ga0495673_0000186_16459_17289 | 272 |
| 82 | 3300047472 | Ga0495686_0054626 | Ga0495686_0054626_1352_2206 | 272 |
| 83 | 3300049569 | Ga0501032_0255287 | Ga0501032_0255287_278_1117 | 272 |
| 84 | 3300049580 | Ga0501046_0231119 | Ga0501046_0231119_30_869 | 272 |
| 85 | 3300053093 | Ga0500651_0010027 | Ga0500651_0010027_4609_5475 | 272 |
| 86 | 3300053153 | Ga0500616_0026387 | Ga0500616_0026387_1015_1896 | 272 |
| 87 | 3300054114 | Ga0501084_0455952 | Ga0501084_0455952_169_1008 | 272 |
| 88 | iso_pu_bacteria | 2593339238 | 2595448859 | 272 |
| 89 | iso_pu_bacteria | 2643221605 | 2644039892 | 272 |
| 90 | iso_pu_bacteria | 2643221674 | 2644412703 | 272 |
| 91 | iso_pu_bacteria | 2671180139 | 2671694744 | 272 |
| 92 | iso_pu_bacteria | 2842914999 | 2842915764 | 272 |
| 93 | iso_pu_bacteria | 2924776078 | 2924776444 | 272 |
| 94 | iso_pu_bacteria | 2937868953 | 2937877152 | 272 |
| 95 | iso_pu_bacteria | 2937972304 | 2937979795 | 272 |
| 96 | iso_pu_bacteria | 2958041894 | 2958054346 | 272 |
| 97 | iso_pu_bacteria | 2958144490 | 2958146663 | 272 |
| 98 | iso_pu_bacteria | 2968016561 | 2968018845 | 272 |
| 99 | iso_pu_bacteria | 2970469710 | 2970470982 | 272 |
| 100 | iso_pu_bacteria | 2970593180 | 2970598085 | 272 |
| 101 | iso_pu_bacteria | 2996348954 | 2996349703 | 272 |
| 102 | iso_pu_bacteria | 3004275668 | 3004276409 | 272 |
| 103 | iso_pu_bacteria | 3004289098 | 3004295080 | 272 |
| 104 | 3300002705 | JGI25156J39149_1000430 | JGI25156J39149_100043017 | 273 |
| 105 | 3300002738 | JGI25154J39366_1000018 | JGI25154J39366_1000018246 | 273 |
| 106 | 3300002741 | JGI25157J39369_1000074 | JGI25157J39369_100007472 | 273 |
| 107 | 3300004625 | Ga0055543_1009840 | Ga0055543_10098402 | 273 |
| 108 | 3300005262 | Ga0065165_1005328 | Ga0065165_10053283 | 273 |
| 109 | 3300005344 | Ga0070661_100181882 | Ga0070661_1001818823 | 273 |
| 110 | 3300006881 | Ga0068865_100001677 | Ga0068865_10000167712 | 273 |
| 111 | 3300009174 | Ga0105241_10558228 | Ga0105241_105582281 | 273 |
| 112 | 3300009551 | Ga0105238_10061613 | Ga0105238_100616132 | 273 |
| 113 | 3300021361 | Ga0213872_10000106 | Ga0213872_1000010616 | 273 |
| 114 | 3300025206 | Ga0209435_100044 | Ga0209435_10004483 | 273 |
| 115 | 3300025246 | Ga0209646_1000151 | Ga0209646_100015183 | 273 |
| 116 | 3300025250 | Ga0209026_1000170 | Ga0209026_100017083 | 273 |
| 117 | 3300025256 | Ga0209759_1000186 | Ga0209759_100018685 | 273 |
| 118 | 3300025302 | Ga0207426_1002612 | Ga0207426_10026127 | 273 |
| 119 | 3300025924 | Ga0207694_10114313 | Ga0207694_101143132 | 273 |
| 120 | 3300025931 | Ga0207644_10094502 | Ga0207644_100945022 | 273 |
| 121 | 3300025938 | Ga0207704_10000796 | Ga0207704_100007964 | 273 |
| 122 | 3300026067 | Ga0207678_10572964 | Ga0207678_105729641 | 273 |
| 123 | 3300028016 | Ga0265354_1001446 | Ga0265354_10014462 | 273 |
| 124 | 3300028017 | Ga0265356_1000405 | Ga0265356_100040510 | 273 |
| 125 | 3300030878 | Ga0265770_1000128 | Ga0265770_10001285 | 273 |
| 126 | 3300037312 | Ga0395899_0000004 | Ga0395899_0000004_742454_743287 | 273 |
| 127 | 3300039447 | Ga0436361_0152690 | Ga0436361_0152690_14634_15482 | 273 |
| 128 | 3300046460 | Ga0495638_0005941 | Ga0495638_0005941_4199_5032 | 273 |
| 129 | 3300046500 | Ga0495596_0110054 | Ga0495596_0110054_59_889 | 273 |
| 130 | 3300046512 | Ga0495610_0000157 | Ga0495610_0000157_30873_31706 | 273 |
| 131 | 3300046519 | Ga0495632_0006724 | Ga0495632_0006724_2798_3640 | 273 |
| 132 | 3300046616 | Ga0495668_0005967 | Ga0495668_0005967_6107_6949 | 273 |
| 133 | 3300046692 | Ga0495671_0087473 | Ga0495671_0087473_255_1088 | 273 |
| 134 | 3300048922 | Ga0496119_0008606 | Ga0496119_0008606_5201_6037 | 273 |
| 135 | 3300048923 | Ga0496120_0062119 | Ga0496120_0062119_874_1710 | 273 |
| 136 | 3300048926 | Ga0496123_0189934 | Ga0496123_0189934_116_961 | 273 |
| 137 | 3300048927 | Ga0496124_0100876 | Ga0496124_0100876_947_1780 | 273 |
| 138 | 3300048928 | Ga0496125_0127714 | Ga0496125_0127714_480_1313 | 273 |
| 139 | 3300049568 | Ga0501031_0054455 | Ga0501031_0054455_913_1743 | 273 |
| 140 | 3300049569 | Ga0501032_0098198 | Ga0501032_0098198_139_975 | 273 |
| 141 | 3300049570 | Ga0501033_0068587 | Ga0501033_0068587_800_1630 | 273 |
| 142 | 3300049571 | Ga0501034_0139707 | Ga0501034_0139707_890_1723 | 273 |
| 143 | 3300049571 | Ga0501034_0429289 | Ga0501034_0429289_362_1192 | 273 |
| 144 | 3300049574 | Ga0501038_0206323 | Ga0501038_0206323_27_863 | 273 |
| 145 | 3300049574 | Ga0501038_0443049 | Ga0501038_0443049_130_960 | 273 |
| 146 | 3300049581 | Ga0501047_0011495 | Ga0501047_0011495_6441_7280 | 273 |
| 147 | 3300049822 | Ga0501035_0075200 | Ga0501035_0075200_139_975 | 273 |
| 148 | 3300049823 | Ga0501044_0121158 | Ga0501044_0121158_858_1688 | 273 |
| 149 | 3300049823 | Ga0501044_0278169 | Ga0501044_0278169_467_1306 | 273 |
| 150 | 3300049823 | Ga0501044_0436134 | Ga0501044_0436134_154_984 | 273 |
| 151 | 3300053140 | Ga0500573_0009877 | Ga0500573_0009877_3460_4317 | 273 |
| 152 | iso_pu_bacteria | 2509276018 | 2509368191 | 273 |
| 153 | iso_pu_bacteria | 2513237084 | 2513573993 | 273 |
| 154 | iso_pu_bacteria | 2516653077 | 2517036449 | 273 |
| 155 | iso_pu_bacteria | 2687453392 | 2688598084 | 273 |
| 156 | iso_pu_bacteria | 2958122699 | 2958127468 | 273 |
| 157 | iso_pu_bacteria | 2958137437 | 2958139420 | 273 |
| 158 | iso_pu_bacteria | 2958158011 | 2958158116 | 273 |
| 159 | iso_pu_bacteria | 2961136820 | 2961138357 | 273 |
| 160 | iso_pu_bacteria | 2965025482 | 2965026089 | 273 |
| 161 | iso_pu_bacteria | 2965032056 | 2965034981 | 273 |
| 162 | iso_pu_bacteria | 2965040258 | 2965047536 | 273 |
| 163 | iso_pu_bacteria | 2965047637 | 2965051737 | 273 |
| 164 | iso_pu_bacteria | 2965089291 | 2965091916 | 273 |
| 165 | iso_pu_bacteria | 2965102966 | 2965104137 | 273 |
| 166 | iso_pu_bacteria | 2965110997 | 2965112200 | 273 |
| 167 | iso_pu_bacteria | 2970547951 | 2970551783 | 273 |
| 168 | iso_pu_bacteria | 2977872689 | 2977877807 | 273 |
| 169 | iso_pu_bacteria | 2977915119 | 2977915703 | 273 |
| 170 | iso_pu_bacteria | 2977935797 | 2977936673 | 273 |
| 171 | iso_pu_bacteria | 2977950692 | 2977951286 | 273 |
| 172 | iso_pu_bacteria | 2977957713 | 2977958629 | 273 |
| 173 | iso_pu_bacteria | 2979793036 | 2979794681 | 273 |
| 174 | iso_pu_bacteria | 2987673487 | 2987678399 | 273 |
| 175 | iso_pu_bacteria | 649633066 | 649872618 | 273 |
| 176 | iso_pu_bacteria | 8004300914 | 8004306901 | 273 |
| 177 | iso_pu_bacteria | 8004361976 | 8004369311 | 273 |
| 178 | iso_pu_bacteria | 8004695233 | 8004702020 | 273 |
| 179 | 3300001989 | JGI24739J22299_10009539 | JGI24739J22299_100095392 | 274 |
| 180 | 3300001990 | JGI24737J22298_10004299 | JGI24737J22298_100042993 | 274 |
| 181 | 3300002067 | JGI24735J21928_10005340 | JGI24735J21928_100053402 | 274 |
| 182 | 3300002705 | JGI25156J39149_1005097 | JGI25156J39149_10050973 | 274 |
| 183 | 3300002741 | JGI25157J39369_1000564 | JGI25157J39369_100056419 | 274 |
| 184 | 3300003752 | Ga0055539_1001378 | Ga0055539_10013782 | 274 |
| 185 | 3300003756 | Ga0055533_1004286 | Ga0055533_10042863 | 274 |
| 186 | 3300003760 | Ga0055527_1000190 | Ga0055527_100019038 | 274 |
| 187 | 3300003761 | Ga0055535_1000397 | Ga0055535_10003972 | 274 |
| 188 | 3300003762 | Ga0055542_1000043 | Ga0055542_1000043128 | 274 |
| 189 | 3300003763 | Ga0055529_1000380 | Ga0055529_100038043 | 274 |
| 190 | 3300003792 | Ga0055540_1001153 | Ga0055540_10011535 | 274 |
| 191 | 3300003794 | Ga0055531_10006682 | Ga0055531_100066824 | 274 |
| 192 | 3300005327 | Ga0070658_10214783 | Ga0070658_102147832 | 274 |
| 193 | 3300005435 | Ga0070714_100199881 | Ga0070714_1001998813 | 274 |
| 194 | 3300005455 | Ga0070663_100045480 | Ga0070663_1000454803 | 274 |
| 195 | 3300005457 | Ga0070662_100064143 | Ga0070662_1000641432 | 274 |
| 196 | 3300005539 | Ga0068853_100179669 | Ga0068853_1001796692 | 274 |
| 197 | 3300005563 | Ga0068855_100020329 | Ga0068855_1000203297 | 274 |
| 198 | 3300005563 | Ga0068855_100219778 | Ga0068855_1002197782 | 274 |
| 199 | 3300005577 | Ga0068857_100008515 | Ga0068857_1000085154 | 274 |
| 200 | 3300005614 | Ga0068856_100001457 | Ga0068856_10000145715 | 274 |
| 201 | 3300005614 | Ga0068856_100026353 | Ga0068856_1000263532 | 274 |
| 202 | 3300005616 | Ga0068852_100015364 | Ga0068852_1000153644 | 274 |
| 203 | 3300005983 | Ga0081540_1026589 | Ga0081540_10265893 | 274 |
| 204 | 3300009093 | Ga0105240_10004777 | Ga0105240_1000477718 | 274 |
| 205 | 3300009093 | Ga0105240_10005953 | Ga0105240_100059539 | 274 |
| 206 | 3300009174 | Ga0105241_10014367 | Ga0105241_100143675 | 274 |
| 207 | 3300009174 | Ga0105241_10015541 | Ga0105241_100155413 | 274 |
| 208 | 3300009545 | Ga0105237_10002112 | Ga0105237_1000211214 | 274 |
| 209 | 3300009551 | Ga0105238_10060936 | Ga0105238_100609363 | 274 |
| 210 | 3300010375 | Ga0105239_10007523 | Ga0105239_100075237 | 274 |
| 211 | 3300010375 | Ga0105239_10096883 | Ga0105239_100968833 | 274 |
| 212 | 3300010375 | Ga0105239_10164843 | Ga0105239_101648432 | 274 |
| 213 | 3300021384 | Ga0213876_10010245 | Ga0213876_100102453 | 274 |
| 214 | 3300025226 | Ga0209674_100170 | Ga0209674_10017036 | 274 |
| 215 | 3300025226 | Ga0209674_101002 | Ga0209674_10100211 | 274 |
| 216 | 3300025228 | Ga0209672_100009 | Ga0209672_100009602 | 274 |
| 217 | 3300025242 | Ga0209258_100011 | Ga0209258_10001142 | 274 |
| 218 | 3300025250 | Ga0209026_1000070 | Ga0209026_100007079 | 274 |
| 219 | 3300025254 | Ga0209148_1000013 | Ga0209148_100001342 | 274 |
| 220 | 3300025256 | Ga0209759_1000285 | Ga0209759_100028511 | 274 |
| 221 | 3300025263 | Ga0209565_1000100 | Ga0209565_1000100119 | 274 |
| 222 | 3300025272 | Ga0209455_1000012 | Ga0209455_100001242 | 274 |
| 223 | 3300025294 | Ga0209025_1000044 | Ga0209025_100004480 | 274 |
| 224 | 3300025297 | Ga0209758_1011384 | Ga0209758_10113844 | 274 |
| 225 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000012795 | 274 |
| 226 | 3300025302 | Ga0207426_1007314 | Ga0207426_10073141 | 274 |
| 227 | 3300025303 | Ga0209051_1000279 | Ga0209051_10002797 | 274 |
| 228 | 3300025304 | Ga0209257_1001934 | Ga0209257_100193420 | 274 |
| 229 | 3300025904 | Ga0207647_10004518 | Ga0207647_100045186 | 274 |
| 230 | 3300025911 | Ga0207654_10074846 | Ga0207654_100748463 | 274 |
| 231 | 3300025913 | Ga0207695_10000015 | Ga0207695_10000015169 | 274 |
| 232 | 3300025913 | Ga0207695_10030300 | Ga0207695_100303004 | 274 |
| 233 | 3300025914 | Ga0207671_10012369 | Ga0207671_100123695 | 274 |
| 234 | 3300025924 | Ga0207694_10057256 | Ga0207694_100572562 | 274 |
| 235 | 3300025949 | Ga0207667_10012423 | Ga0207667_100124232 | 274 |
| 236 | 3300025981 | Ga0207640_10041502 | Ga0207640_100415022 | 274 |
| 237 | 3300025981 | Ga0207640_10042590 | Ga0207640_100425903 | 274 |
| 238 | 3300025981 | Ga0207640_10206011 | Ga0207640_102060112 | 274 |
| 239 | 3300026041 | Ga0207639_10034085 | Ga0207639_100340852 | 274 |
| 240 | 3300026067 | Ga0207678_10126428 | Ga0207678_101264282 | 274 |
| 241 | 3300026078 | Ga0207702_10011648 | Ga0207702_100116486 | 274 |
| 242 | 3300026078 | Ga0207702_10028184 | Ga0207702_100281843 | 274 |
| 243 | 3300026116 | Ga0207674_10009769 | Ga0207674_100097693 | 274 |
| 244 | 3300031250 | Ga0265331_10034213 | Ga0265331_100342132 | 274 |
| 245 | 3300032004 | Ga0307414_10000835 | Ga0307414_1000083515 | 274 |
| 246 | 3300033180 | Ga0307510_10129345 | Ga0307510_101293452 | 274 |
| 247 | 3300037312 | Ga0395899_0000228 | Ga0395899_0000228_57343_58197 | 274 |
| 248 | 3300037418 | Ga0395900_0000070 | Ga0395900_0000070_143406_144260 | 274 |
| 249 | 3300037466 | Ga0395898_0000501 | Ga0395898_0000501_57325_58179 | 274 |
| 250 | 3300037853 | Ga0436364_0237048 | Ga0436364_0237048_1017_1868 | 274 |
| 251 | 3300038443 | Ga0395901_0502247 | Ga0395901_0502247_314_1168 | 274 |
| 252 | 3300039437 | Ga0436365_0178523 | Ga0436365_0178523_4141_4971 | 274 |
| 253 | 3300039437 | Ga0436365_1181455 | Ga0436365_1181455_978_1829 | 274 |
| 254 | 3300044684 | Ga0466966_0013501 | Ga0466966_0013501_1636_2490 | 274 |
| 255 | 3300044693 | Ga0466961_0010995 | Ga0466961_0010995_2790_3644 | 274 |
| 256 | 3300044693 | Ga0466961_0119707 | Ga0466961_0119707_701_1543 | 274 |
| 257 | 3300044765 | Ga0466970_0012421 | Ga0466970_0012421_1934_2788 | 274 |
| 258 | 3300044765 | Ga0466970_0118932 | Ga0466970_0118932_117_959 | 274 |
| 259 | 3300045049 | Ga0466959_0000058 | Ga0466959_0000058_22334_23188 | 274 |
| 260 | 3300045049 | Ga0466959_0047784 | Ga0466959_0047784_1021_1857 | 274 |
| 261 | 3300045836 | Ga0466958_0161111 | Ga0466958_0161111_417_1271 | 274 |
| 262 | 3300046459 | Ga0495629_0004264 | Ga0495629_0004264_8752_9585 | 274 |
| 263 | 3300046462 | Ga0495651_0003944 | Ga0495651_0003944_10372_11205 | 274 |
| 264 | 3300046462 | Ga0495651_0114085 | Ga0495651_0114085_1094_1927 | 274 |
| 265 | 3300046463 | Ga0495653_0129879 | Ga0495653_0129879_48_881 | 274 |
| 266 | 3300046471 | Ga0495650_0000470 | Ga0495650_0000470_33564_34400 | 274 |
| 267 | 3300046471 | Ga0495650_0036072 | Ga0495650_0036072_903_1739 | 274 |
| 268 | 3300046506 | Ga0495583_0001366 | Ga0495583_0001366_2612_3448 | 274 |
| 269 | 3300046511 | Ga0495608_0035426 | Ga0495608_0035426_1187_2020 | 274 |
| 270 | 3300046512 | Ga0495610_0000013 | Ga0495610_0000013_43167_43997 | 274 |
| 271 | 3300046515 | Ga0495620_0001880 | Ga0495620_0001880_4873_5703 | 274 |
| 272 | 3300046516 | Ga0495628_0020854 | Ga0495628_0020854_1405_2238 | 274 |
| 273 | 3300046529 | Ga0495652_0014444 | Ga0495652_0014444_4244_5077 | 274 |
| 274 | 3300046529 | Ga0495652_0128861 | Ga0495652_0128861_181_1014 | 274 |
| 275 | 3300046533 | Ga0495640_0120853 | Ga0495640_0120853_845_1678 | 274 |
| 276 | 3300046536 | Ga0495587_0010466 | Ga0495587_0010466_4868_5701 | 274 |
| 277 | 3300046543 | Ga0495645_0039537 | Ga0495645_0039537_2246_3079 | 274 |
| 278 | 3300046663 | Ga0495635_0137854 | Ga0495635_0137854_198_1031 | 274 |
| 279 | 3300046675 | Ga0495657_0012056 | Ga0495657_0012056_2333_3166 | 274 |
| 280 | 3300046678 | Ga0495599_0033179 | Ga0495599_0033179_890_1723 | 274 |
| 281 | 3300046689 | Ga0495613_0076608 | Ga0495613_0076608_1028_1861 | 274 |
| 282 | 3300046809 | Ga0495600_0004612 | Ga0495600_0004612_443_1276 | 274 |
| 283 | 3300046809 | Ga0495600_0019775 | Ga0495600_0019775_669_1502 | 274 |
| 284 | 3300047317 | Ga0495604_0002725 | Ga0495604_0002725_7169_8002 | 274 |
| 285 | 3300047317 | Ga0495604_0067248 | Ga0495604_0067248_1308_2141 | 274 |
| 286 | 3300047471 | Ga0495684_0124217 | Ga0495684_0124217_1024_1857 | 274 |
| 287 | 3300047472 | Ga0495686_0000262 | Ga0495686_0000262_92424_93266 | 274 |
| 288 | 3300047472 | Ga0495686_0079969 | Ga0495686_0079969_476_1324 | 274 |
| 289 | 3300047472 | Ga0495686_0085601 | Ga0495686_0085601_942_1772 | 274 |
| 290 | 3300048905 | Ga0496102_0465179 | Ga0496102_0465179_242_1078 | 274 |
| 291 | 3300048907 | Ga0496104_0004010 | Ga0496104_0004010_5074_5907 | 274 |
| 292 | 3300048908 | Ga0496105_0017709 | Ga0496105_0017709_4359_5192 | 274 |
| 293 | 3300048913 | Ga0496110_0308696 | Ga0496110_0308696_114_947 | 274 |
| 294 | 3300048918 | Ga0496115_0199874 | Ga0496115_0199874_374_1207 | 274 |
| 295 | 3300048921 | Ga0496118_0013683 | Ga0496118_0013683_6214_7047 | 274 |
| 296 | 3300048922 | Ga0496119_0009469 | Ga0496119_0009469_1207_2040 | 274 |
| 297 | 3300048923 | Ga0496120_0030120 | Ga0496120_0030120_2051_2884 | 274 |
| 298 | 3300048924 | Ga0496121_0002278 | Ga0496121_0002278_3076_3909 | 274 |
| 299 | 3300048924 | Ga0496121_0067986 | Ga0496121_0067986_340_1194 | 274 |
| 300 | 3300048924 | Ga0496121_0074242 | Ga0496121_0074242_1354_2205 | 274 |
| 301 | 3300048924 | Ga0496121_0081216 | Ga0496121_0081216_77_910 | 274 |
| 302 | 3300048926 | Ga0496123_0000018 | Ga0496123_0000018_310966_311799 | 274 |
| 303 | 3300048926 | Ga0496123_0075212 | Ga0496123_0075212_421_1263 | 274 |
| 304 | 3300048928 | Ga0496125_0000215 | Ga0496125_0000215_88160_88993 | 274 |
| 305 | 3300048928 | Ga0496125_0118046 | Ga0496125_0118046_710_1543 | 274 |
| 306 | 3300049460 | Ga0495682_0016391 | Ga0495682_0016391_35_868 | 274 |
| 307 | 3300049579 | Ga0501043_0119814 | Ga0501043_0119814_977_1816 | 274 |
| 308 | 3300053079 | Ga0500610_0048511 | Ga0500610_0048511_896_1729 | 274 |
| 309 | 3300053119 | Ga0500595_029014 | Ga0500595_029014_818_1651 | 274 |
| 310 | 3300053121 | Ga0500607_036360 | Ga0500607_036360_856_1692 | 274 |
| 311 | 3300053122 | Ga0500608_013669 | Ga0500608_013669_1374_2246 | 274 |
| 312 | 3300053153 | Ga0500616_0005043 | Ga0500616_0005043_4950_5780 | 274 |
| 313 | 3300061719 | Ga0466962_0054966 | Ga0466962_0054966_896_1732 | 274 |
| 314 | iso_pu_bacteria | 2643221595 | 2643987696 | 274 |
| 315 | iso_pu_bacteria | 2643221627 | 2644156692 | 274 |
| 316 | iso_pu_bacteria | 2937980651 | 2937985594 | 274 |
| 317 | iso_pu_bacteria | 2958108152 | 2958114751 | 274 |
| 318 | iso_pu_bacteria | 2961183825 | 2961187429 | 274 |
| 319 | iso_pu_bacteria | 2968138860 | 2968145958 | 274 |
| 320 | iso_pu_bacteria | 2970489779 | 2970493242 | 274 |
| 321 | iso_pu_bacteria | 2970532167 | 2970538031 | 274 |
| 322 | iso_pu_bacteria | 2970619444 | 2970621688 | 274 |
| 323 | iso_pu_bacteria | 2970627176 | 2970628552 | 274 |
| 324 | iso_pu_bacteria | 2977851361 | 2977857319 | 274 |
| 325 | iso_pu_bacteria | 2979764755 | 2979770712 | 274 |
| 326 | iso_pu_bacteria | 2979772303 | 2979778371 | 274 |
| 327 | iso_pu_bacteria | 2996386984 | 2996388965 | 274 |
| 328 | iso_pu_bacteria | 3004167301 | 3004168404 | 274 |
| 329 | iso_pu_bacteria | 3004232784 | 3004234812 | 274 |
| 330 | iso_pu_bacteria | 3004248173 | 3004253577 | 274 |
| 331 | iso_pu_bacteria | 3004268573 | 3004273001 | 274 |
| 332 | iso_pu_bacteria | 8004312739 | 8004317984 | 274 |
| 333 | iso_pu_bacteria | 8004727605 | 8004729192 | 274 |
| 334 | 3300001904 | JGI24736J21556_1001546 | JGI24736J21556_10015462 | 275 |
| 335 | 3300001904 | JGI24736J21556_1006811 | JGI24736J21556_10068112 | 275 |
| 336 | 3300001915 | JGI24741J21665_1012915 | JGI24741J21665_10129152 | 275 |
| 337 | 3300001979 | JGI24740J21852_10031332 | JGI24740J21852_100313322 | 275 |
| 338 | 3300001989 | JGI24739J22299_10011259 | JGI24739J22299_100112591 | 275 |
| 339 | 3300001989 | JGI24739J22299_10023269 | JGI24739J22299_100232693 | 275 |
| 340 | 3300001989 | JGI24739J22299_10038737 | JGI24739J22299_100387372 | 275 |
| 341 | 3300001990 | JGI24737J22298_10032342 | JGI24737J22298_100323422 | 275 |
| 342 | 3300002067 | JGI24735J21928_10003343 | JGI24735J21928_100033432 | 275 |
| 343 | 3300002067 | JGI24735J21928_10023509 | JGI24735J21928_100235091 | 275 |
| 344 | 3300002067 | JGI24735J21928_10038041 | JGI24735J21928_100380412 | 275 |
| 345 | 3300002075 | JGI24738J21930_10007946 | JGI24738J21930_100079462 | 275 |
| 346 | 3300002244 | JGI24742J22300_10005287 | JGI24742J22300_100052873 | 275 |
| 347 | 3300002705 | JGI25156J39149_1006965 | JGI25156J39149_10069654 | 275 |
| 348 | 3300002741 | JGI25157J39369_1000921 | JGI25157J39369_10009214 | 275 |
| 349 | 3300003214 | JGI25165J46597_1000020 | JGI25165J46597_1000020259 | 275 |
| 350 | 3300003214 | JGI25165J46597_1000021 | JGI25165J46597_100002189 | 275 |
| 351 | 3300003215 | JGI25153J46596_10000070 | JGI25153J46596_1000007048 | 275 |
| 352 | 3300003316 | rootH1_10012195 | rootH1_100121959 | 275 |
| 353 | 3300003759 | Ga0055525_1000203 | Ga0055525_100020343 | 275 |
| 354 | 3300003762 | Ga0055542_1000040 | Ga0055542_1000040139 | 275 |
| 355 | 3300003763 | Ga0055529_1000037 | Ga0055529_100003782 | 275 |
| 356 | 3300003781 | Ga0055536_1001410 | Ga0055536_10014107 | 275 |
| 357 | 3300004625 | Ga0055543_1008796 | Ga0055543_10087962 | 275 |
| 358 | 3300005262 | Ga0065165_1000214 | Ga0065165_10002145 | 275 |
| 359 | 3300005327 | Ga0070658_10003583 | Ga0070658_100035835 | 275 |
| 360 | 3300005327 | Ga0070658_10014451 | Ga0070658_100144512 | 275 |
| 361 | 3300005327 | Ga0070658_10125565 | Ga0070658_101255653 | 275 |
| 362 | 3300005329 | Ga0070683_100285764 | Ga0070683_1002857641 | 275 |
| 363 | 3300005331 | Ga0070670_100089110 | Ga0070670_1000891104 | 275 |
| 364 | 3300005331 | Ga0070670_100161730 | Ga0070670_1001617301 | 275 |
| 365 | 3300005335 | Ga0070666_10000046 | Ga0070666_1000004620 | 275 |
| 366 | 3300005337 | Ga0070682_100048577 | Ga0070682_1000485772 | 275 |
| 367 | 3300005339 | Ga0070660_100009935 | Ga0070660_1000099355 | 275 |
| 368 | 3300005344 | Ga0070661_100008770 | Ga0070661_1000087705 | 275 |
| 369 | 3300005344 | Ga0070661_100051676 | Ga0070661_1000516762 | 275 |
| 370 | 3300005345 | Ga0070692_10216655 | Ga0070692_102166551 | 275 |
| 371 | 3300005354 | Ga0070675_100222429 | Ga0070675_1002224291 | 275 |
| 372 | 3300005356 | Ga0070674_100015015 | Ga0070674_1000150153 | 275 |
| 373 | 3300005356 | Ga0070674_100098110 | Ga0070674_1000981101 | 275 |
| 374 | 3300005366 | Ga0070659_100000274 | Ga0070659_10000027413 | 275 |
| 375 | 3300005366 | Ga0070659_100126875 | Ga0070659_1001268754 | 275 |
| 376 | 3300005367 | Ga0070667_100074476 | Ga0070667_1000744764 | 275 |
| 377 | 3300005367 | Ga0070667_100181404 | Ga0070667_1001814042 | 275 |
| 378 | 3300005455 | Ga0070663_100003022 | Ga0070663_10000302210 | 275 |
| 379 | 3300005455 | Ga0070663_100188735 | Ga0070663_1001887352 | 275 |
| 380 | 3300005456 | Ga0070678_100000523 | Ga0070678_1000005236 | 275 |
| 381 | 3300005457 | Ga0070662_100079136 | Ga0070662_1000791363 | 275 |
| 382 | 3300005459 | Ga0068867_100292692 | Ga0068867_1002926922 | 275 |
| 383 | 3300005535 | Ga0070684_100105147 | Ga0070684_1001051472 | 275 |
| 384 | 3300005539 | Ga0068853_100140670 | Ga0068853_1001406702 | 275 |
| 385 | 3300005543 | Ga0070672_100283192 | Ga0070672_1002831922 | 275 |
| 386 | 3300005548 | Ga0070665_100057418 | Ga0070665_1000574184 | 275 |
| 387 | 3300005548 | Ga0070665_100177577 | Ga0070665_1001775773 | 275 |
| 388 | 3300005563 | Ga0068855_100003956 | Ga0068855_1000039568 | 275 |
| 389 | 3300005563 | Ga0068855_100035135 | Ga0068855_1000351352 | 275 |
| 390 | 3300005563 | Ga0068855_100370110 | Ga0068855_1003701101 | 275 |
| 391 | 3300005577 | Ga0068857_100112429 | Ga0068857_1001124292 | 275 |
| 392 | 3300005578 | Ga0068854_100066352 | Ga0068854_1000663524 | 275 |
| 393 | 3300005578 | Ga0068854_100131105 | Ga0068854_1001311052 | 275 |
| 394 | 3300005614 | Ga0068856_100021865 | Ga0068856_1000218656 | 275 |
| 395 | 3300005614 | Ga0068856_100465744 | Ga0068856_1004657442 | 275 |
| 396 | 3300005616 | Ga0068852_100011426 | Ga0068852_1000114262 | 275 |
| 397 | 3300005843 | Ga0068860_100409261 | Ga0068860_1004092612 | 275 |
| 398 | 3300005985 | Ga0081539_10008834 | Ga0081539_100088347 | 275 |
| 399 | 3300006028 | Ga0070717_10133670 | Ga0070717_101336702 | 275 |
| 400 | 3300006358 | Ga0068871_100260598 | Ga0068871_1002605982 | 275 |
| 401 | 3300006871 | Ga0075434_100007651 | Ga0075434_10000765111 | 275 |
| 402 | 3300007076 | Ga0075435_100004917 | Ga0075435_10000491711 | 275 |
| 403 | 3300007265 | Ga0099794_10060084 | Ga0099794_100600842 | 275 |
| 404 | 3300009011 | Ga0105251_10046708 | Ga0105251_100467082 | 275 |
| 405 | 3300009093 | Ga0105240_10000005 | Ga0105240_10000005138 | 275 |
| 406 | 3300009093 | Ga0105240_10178901 | Ga0105240_101789013 | 275 |
| 407 | 3300009093 | Ga0105240_10180163 | Ga0105240_101801633 | 275 |
| 408 | 3300009093 | Ga0105240_10418966 | Ga0105240_104189662 | 275 |
| 409 | 3300009093 | Ga0105240_10571677 | Ga0105240_105716771 | 275 |
| 410 | 3300009148 | Ga0105243_10000913 | Ga0105243_1000091320 | 275 |
| 411 | 3300009177 | Ga0105248_10302657 | Ga0105248_103026572 | 275 |
| 412 | 3300009545 | Ga0105237_10010055 | Ga0105237_100100554 | 275 |
| 413 | 3300009545 | Ga0105237_10267651 | Ga0105237_102676512 | 275 |
| 414 | 3300009551 | Ga0105238_10000521 | Ga0105238_1000052113 | 275 |
| 415 | 3300009551 | Ga0105238_10001346 | Ga0105238_1000134612 | 275 |
| 416 | 3300009551 | Ga0105238_10125893 | Ga0105238_101258932 | 275 |
| 417 | 3300010375 | Ga0105239_10002672 | Ga0105239_100026724 | 275 |
| 418 | 3300010375 | Ga0105239_10014042 | Ga0105239_100140424 | 275 |
| 419 | 3300010375 | Ga0105239_10016174 | Ga0105239_100161747 | 275 |
| 420 | 3300010375 | Ga0105239_10057743 | Ga0105239_100577434 | 275 |
| 421 | 3300010375 | Ga0105239_10079994 | Ga0105239_100799941 | 275 |
| 422 | 3300010375 | Ga0105239_10461165 | Ga0105239_104611652 | 275 |
| 423 | 3300010375 | Ga0105239_10640324 | Ga0105239_106403242 | 275 |
| 424 | 3300010375 | Ga0105239_10836098 | Ga0105239_108360981 | 275 |
| 425 | 3300013100 | Ga0157373_10031474 | Ga0157373_100314744 | 275 |
| 426 | 3300013100 | Ga0157373_10064685 | Ga0157373_100646853 | 275 |
| 427 | 3300013104 | Ga0157370_10000163 | Ga0157370_1000016388 | 275 |
| 428 | 3300013104 | Ga0157370_10001660 | Ga0157370_100016602 | 275 |
| 429 | 3300013104 | Ga0157370_10011892 | Ga0157370_100118928 | 275 |
| 430 | 3300013104 | Ga0157370_10024273 | Ga0157370_100242735 | 275 |
| 431 | 3300013104 | Ga0157370_10084264 | Ga0157370_100842644 | 275 |
| 432 | 3300013105 | Ga0157369_10169296 | Ga0157369_101692962 | 275 |
| 433 | 3300013105 | Ga0157369_10179974 | Ga0157369_101799743 | 275 |
| 434 | 3300013105 | Ga0157369_10223096 | Ga0157369_102230961 | 275 |
| 435 | 3300013105 | Ga0157369_10368046 | Ga0157369_103680462 | 275 |
| 436 | 3300013306 | Ga0163162_10002496 | Ga0163162_100024962 | 275 |
| 437 | 3300013306 | Ga0163162_10127536 | Ga0163162_101275365 | 275 |
| 438 | 3300013306 | Ga0163162_10698990 | Ga0163162_106989902 | 275 |
| 439 | 3300013307 | Ga0157372_10031478 | Ga0157372_100314785 | 275 |
| 440 | 3300013307 | Ga0157372_10186993 | Ga0157372_101869932 | 275 |
| 441 | 3300014497 | Ga0182008_10069423 | Ga0182008_100694232 | 275 |
| 442 | 3300014969 | Ga0157376_10204192 | Ga0157376_102041922 | 275 |
| 443 | 3300015265 | Ga0182005_1000027 | Ga0182005_100002728 | 275 |
| 444 | 3300025226 | Ga0209674_100393 | Ga0209674_1003939 | 275 |
| 445 | 3300025230 | Ga0209563_100147 | Ga0209563_10014744 | 275 |
| 446 | 3300025231 | Ga0207427_105671 | Ga0207427_1056712 | 275 |
| 447 | 3300025233 | Ga0209437_101211 | Ga0209437_1012115 | 275 |
| 448 | 3300025250 | Ga0209026_1000005 | Ga0209026_1000005583 | 275 |
| 449 | 3300025253 | Ga0209677_109016 | Ga0209677_1090162 | 275 |
| 450 | 3300025254 | Ga0209148_1000011 | Ga0209148_10000111036 | 275 |
| 451 | 3300025254 | Ga0209148_1000686 | Ga0209148_100068618 | 275 |
| 452 | 3300025256 | Ga0209759_1000111 | Ga0209759_100011150 | 275 |
| 453 | 3300025261 | Ga0209233_1000047 | Ga0209233_100004776 | 275 |
| 454 | 3300025261 | Ga0209233_1000065 | Ga0209233_100006590 | 275 |
| 455 | 3300025272 | Ga0209455_1000006 | Ga0209455_1000006156 | 275 |
| 456 | 3300025292 | Ga0209676_1000115 | Ga0209676_100011563 | 275 |
| 457 | 3300025297 | Ga0209758_1000023 | Ga0209758_1000023425 | 275 |
| 458 | 3300025302 | Ga0207426_1053787 | Ga0207426_10537872 | 275 |
| 459 | 3300025303 | Ga0209051_1006951 | Ga0209051_10069514 | 275 |
| 460 | 3300025304 | Ga0209257_1000090 | Ga0209257_100009045 | 275 |
| 461 | 3300025304 | Ga0209257_1011200 | Ga0209257_10112004 | 275 |
| 462 | 3300025903 | Ga0207680_10000003 | Ga0207680_10000003707 | 275 |
| 463 | 3300025904 | Ga0207647_10000007 | Ga0207647_10000007113 | 275 |
| 464 | 3300025904 | Ga0207647_10004336 | Ga0207647_1000433612 | 275 |
| 465 | 3300025904 | Ga0207647_10088924 | Ga0207647_100889242 | 275 |
| 466 | 3300025908 | Ga0207643_10126526 | Ga0207643_101265262 | 275 |
| 467 | 3300025909 | Ga0207705_10000891 | Ga0207705_100008915 | 275 |
| 468 | 3300025909 | Ga0207705_10005791 | Ga0207705_100057919 | 275 |
| 469 | 3300025913 | Ga0207695_10000011 | Ga0207695_10000011777 | 275 |
| 470 | 3300025913 | Ga0207695_10366167 | Ga0207695_103661672 | 275 |
| 471 | 3300025913 | Ga0207695_10401380 | Ga0207695_104013801 | 275 |
| 472 | 3300025914 | Ga0207671_10015930 | Ga0207671_100159304 | 275 |
| 473 | 3300025914 | Ga0207671_10076929 | Ga0207671_100769292 | 275 |
| 474 | 3300025919 | Ga0207657_10023163 | Ga0207657_100231635 | 275 |
| 475 | 3300025920 | Ga0207649_10005284 | Ga0207649_100052846 | 275 |
| 476 | 3300025924 | Ga0207694_10015326 | Ga0207694_100153266 | 275 |
| 477 | 3300025925 | Ga0207650_10273003 | Ga0207650_102730032 | 275 |
| 478 | 3300025932 | Ga0207690_10000092 | Ga0207690_1000009236 | 275 |
| 479 | 3300025935 | Ga0207709_10000039 | Ga0207709_10000039157 | 275 |
| 480 | 3300025937 | Ga0207669_10000117 | Ga0207669_100001177 | 275 |
| 481 | 3300025941 | Ga0207711_10231928 | Ga0207711_102319282 | 275 |
| 482 | 3300025949 | Ga0207667_10000002 | Ga0207667_10000002892 | 275 |
| 483 | 3300025949 | Ga0207667_10018525 | Ga0207667_100185258 | 275 |
| 484 | 3300025960 | Ga0207651_10092633 | Ga0207651_100926331 | 275 |
| 485 | 3300025986 | Ga0207658_10453650 | Ga0207658_104536502 | 275 |
| 486 | 3300026035 | Ga0207703_10216921 | Ga0207703_102169212 | 275 |
| 487 | 3300026041 | Ga0207639_10047677 | Ga0207639_100476773 | 275 |
| 488 | 3300026067 | Ga0207678_10217866 | Ga0207678_102178661 | 275 |
| 489 | 3300026078 | Ga0207702_10120372 | Ga0207702_101203722 | 275 |
| 490 | 3300026089 | Ga0207648_10199901 | Ga0207648_101999012 | 275 |
| 491 | 3300026116 | Ga0207674_10136354 | Ga0207674_101363543 | 275 |
| 492 | 3300026116 | Ga0207674_10360958 | Ga0207674_103609581 | 275 |
| 493 | 3300026121 | Ga0207683_10008488 | Ga0207683_1000848810 | 275 |
| 494 | 3300026142 | Ga0207698_10199835 | Ga0207698_101998352 | 275 |
| 495 | 3300026142 | Ga0207698_10247253 | Ga0207698_102472531 | 275 |
| 496 | 3300028379 | Ga0268266_10000011 | Ga0268266_10000011645 | 275 |
| 497 | 3300028381 | Ga0268264_10013032 | Ga0268264_100130322 | 275 |
| 498 | 3300028786 | Ga0307517_10044986 | Ga0307517_100449864 | 275 |
| 499 | 3300028794 | Ga0307515_10013091 | Ga0307515_1001309114 | 275 |
| 500 | 3300031090 | Ga0265760_10018201 | Ga0265760_100182012 | 275 |
| 501 | 3300031901 | Ga0307406_10021673 | Ga0307406_100216732 | 275 |
| 502 | 3300031911 | Ga0307412_10000751 | Ga0307412_100007518 | 275 |
| 503 | 3300033180 | Ga0307510_10008938 | Ga0307510_1000893816 | 275 |
| 504 | 3300033180 | Ga0307510_10038241 | Ga0307510_100382411 | 275 |
| 505 | 3300033180 | Ga0307510_10159368 | Ga0307510_101593682 | 275 |
| 506 | 3300037068 | Ga0373925_0106780 | Ga0373925_0106780_19_858 | 275 |
| 507 | 3300037312 | Ga0395899_0012532 | Ga0395899_0012532_1868_2713 | 275 |
| 508 | 3300037418 | Ga0395900_0000052 | Ga0395900_0000052_64876_65721 | 275 |
| 509 | 3300037466 | Ga0395898_0012979 | Ga0395898_0012979_1351_2196 | 275 |
| 510 | 3300037471 | Ga0395905_0000622 | Ga0395905_0000622_35461_36324 | 275 |
| 511 | 3300037471 | Ga0395905_0015761 | Ga0395905_0015761_2312_3157 | 275 |
| 512 | 3300037471 | Ga0395905_0022154 | Ga0395905_0022154_2296_3177 | 275 |
| 513 | 3300037471 | Ga0395905_0060948 | Ga0395905_0060948_466_1317 | 275 |
| 514 | 3300037471 | Ga0395905_0520845 | Ga0395905_0520845_89_946 | 275 |
| 515 | 3300037853 | Ga0436364_0669598 | Ga0436364_0669598_438_1298 | 275 |
| 516 | 3300038443 | Ga0395901_0000001 | Ga0395901_0000001_722279_723124 | 275 |
| 517 | 3300038443 | Ga0395901_0008360 | Ga0395901_0008360_2252_3085 | 275 |
| 518 | 3300038443 | Ga0395901_0014150 | Ga0395901_0014150_5945_6778 | 275 |
| 519 | 3300038443 | Ga0395901_0084393 | Ga0395901_0084393_393_1223 | 275 |
| 520 | 3300038705 | Ga0237819_00668 | Ga0237819_00668_9216_10100 | 275 |
| 521 | 3300041456 | Ga0451795_0775736 | Ga0451795_0775736_472_1302 | 275 |
| 522 | 3300042157 | Ga0439458_0004032 | Ga0439458_0004032_425_1309 | 275 |
| 523 | 3300044658 | Ga0466972_0087225 | Ga0466972_0087225_234_1073 | 275 |
| 524 | 3300044683 | Ga0466965_0104928 | Ga0466965_0104928_530_1369 | 275 |
| 525 | 3300044735 | Ga0466968_0027748 | Ga0466968_0027748_1133_1978 | 275 |
| 526 | 3300044901 | Ga0466960_0075796 | Ga0466960_0075796_226_1059 | 275 |
| 527 | 3300046453 | Ga0495627_000082 | Ga0495627_000082_14909_15745 | 275 |
| 528 | 3300046453 | Ga0495627_016270 | Ga0495627_016270_1059_1895 | 275 |
| 529 | 3300046459 | Ga0495629_0047480 | Ga0495629_0047480_2132_2974 | 275 |
| 530 | 3300046460 | Ga0495638_0007585 | Ga0495638_0007585_4384_5229 | 275 |
| 531 | 3300046471 | Ga0495650_0000616 | Ga0495650_0000616_32580_33416 | 275 |
| 532 | 3300046471 | Ga0495650_0053687 | Ga0495650_0053687_679_1509 | 275 |
| 533 | 3300046474 | Ga0495605_0000050 | Ga0495605_0000050_75016_75852 | 275 |
| 534 | 3300046474 | Ga0495605_0119065 | Ga0495605_0119065_179_1042 | 275 |
| 535 | 3300046491 | Ga0495584_0050095 | Ga0495584_0050095_130_960 | 275 |
| 536 | 3300046491 | Ga0495584_0058559 | Ga0495584_0058559_428_1258 | 275 |
| 537 | 3300046492 | Ga0495585_0003969 | Ga0495585_0003969_1102_1932 | 275 |
| 538 | 3300046492 | Ga0495585_0008789 | Ga0495585_0008789_4882_5712 | 275 |
| 539 | 3300046492 | Ga0495585_0212604 | Ga0495585_0212604_32_862 | 275 |
| 540 | 3300046499 | Ga0495594_0000310 | Ga0495594_0000310_8980_9816 | 275 |
| 541 | 3300046500 | Ga0495596_0001637 | Ga0495596_0001637_5434_6264 | 275 |
| 542 | 3300046501 | Ga0495607_0000006 | Ga0495607_0000006_138117_138971 | 275 |
| 543 | 3300046501 | Ga0495607_0008757 | Ga0495607_0008757_907_1746 | 275 |
| 544 | 3300046506 | Ga0495583_0000002 | Ga0495583_0000002_524185_525042 | 275 |
| 545 | 3300046506 | Ga0495583_0000007 | Ga0495583_0000007_391529_392365 | 275 |
| 546 | 3300046506 | Ga0495583_0005931 | Ga0495583_0005931_1728_2558 | 275 |
| 547 | 3300046507 | Ga0495606_0000092 | Ga0495606_0000092_120029_120859 | 275 |
| 548 | 3300046507 | Ga0495606_0000281 | Ga0495606_0000281_53718_54548 | 275 |
| 549 | 3300046507 | Ga0495606_0002734 | Ga0495606_0002734_18091_18927 | 275 |
| 550 | 3300046507 | Ga0495606_0091812 | Ga0495606_0091812_856_1692 | 275 |
| 551 | 3300046507 | Ga0495606_0169829 | Ga0495606_0169829_235_1092 | 275 |
| 552 | 3300046512 | Ga0495610_0000525 | Ga0495610_0000525_34223_35092 | 275 |
| 553 | 3300046512 | Ga0495610_0000606 | Ga0495610_0000606_22414_23250 | 275 |
| 554 | 3300046512 | Ga0495610_0055474 | Ga0495610_0055474_283_1113 | 275 |
| 555 | 3300046513 | Ga0495616_0000286 | Ga0495616_0000286_34222_35124 | 275 |
| 556 | 3300046513 | Ga0495616_0040799 | Ga0495616_0040799_481_1311 | 275 |
| 557 | 3300046513 | Ga0495616_0089173 | Ga0495616_0089173_104_934 | 275 |
| 558 | 3300046515 | Ga0495620_0000017 | Ga0495620_0000017_61377_62213 | 275 |
| 559 | 3300046515 | Ga0495620_0001200 | Ga0495620_0001200_14915_15775 | 275 |
| 560 | 3300046518 | Ga0495631_0034996 | Ga0495631_0034996_644_1474 | 275 |
| 561 | 3300046519 | Ga0495632_0000096 | Ga0495632_0000096_15944_16780 | 275 |
| 562 | 3300046519 | Ga0495632_0000196 | Ga0495632_0000196_14847_15680 | 275 |
| 563 | 3300046519 | Ga0495632_0004529 | Ga0495632_0004529_6063_6899 | 275 |
| 564 | 3300046519 | Ga0495632_0009425 | Ga0495632_0009425_2175_3098 | 275 |
| 565 | 3300046519 | Ga0495632_0037413 | Ga0495632_0037413_679_1509 | 275 |
| 566 | 3300046520 | Ga0495637_0000259 | Ga0495637_0000259_25918_26748 | 275 |
| 567 | 3300046520 | Ga0495637_0001690 | Ga0495637_0001690_5799_6635 | 275 |
| 568 | 3300046520 | Ga0495637_0019620 | Ga0495637_0019620_2102_2932 | 275 |
| 569 | 3300046522 | Ga0495643_0001606 | Ga0495643_0001606_2619_3455 | 275 |
| 570 | 3300046522 | Ga0495643_0001832 | Ga0495643_0001832_5452_6282 | 275 |
| 571 | 3300046522 | Ga0495643_0008189 | Ga0495643_0008189_3080_3910 | 275 |
| 572 | 3300046522 | Ga0495643_0009366 | Ga0495643_0009366_5043_5879 | 275 |
| 573 | 3300046522 | Ga0495643_0023276 | Ga0495643_0023276_1907_2737 | 275 |
| 574 | 3300046522 | Ga0495643_0023396 | Ga0495643_0023396_2189_3019 | 275 |
| 575 | 3300046522 | Ga0495643_0055918 | Ga0495643_0055918_825_1661 | 275 |
| 576 | 3300046523 | Ga0495644_0023659 | Ga0495644_0023659_910_1740 | 275 |
| 577 | 3300046524 | Ga0495648_0000146 | Ga0495648_0000146_56760_57590 | 275 |
| 578 | 3300046524 | Ga0495648_0007691 | Ga0495648_0007691_4838_5674 | 275 |
| 579 | 3300046524 | Ga0495648_0077532 | Ga0495648_0077532_981_1817 | 275 |
| 580 | 3300046525 | Ga0495663_0000016 | Ga0495663_0000016_31331_32167 | 275 |
| 581 | 3300046525 | Ga0495663_0000968 | Ga0495663_0000968_8020_8856 | 275 |
| 582 | 3300046528 | Ga0495642_0032028 | Ga0495642_0032028_394_1224 | 275 |
| 583 | 3300046530 | Ga0495654_0001157 | Ga0495654_0001157_8710_9540 | 275 |
| 584 | 3300046530 | Ga0495654_0010980 | Ga0495654_0010980_786_1622 | 275 |
| 585 | 3300046530 | Ga0495654_0021519 | Ga0495654_0021519_375_1211 | 275 |
| 586 | 3300046538 | Ga0495609_0000004 | Ga0495609_0000004_440640_441476 | 275 |
| 587 | 3300046538 | Ga0495609_0000243 | Ga0495609_0000243_35157_35987 | 275 |
| 588 | 3300046542 | Ga0495597_0077369 | Ga0495597_0077369_442_1272 | 275 |
| 589 | 3300046557 | Ga0495622_0000811 | Ga0495622_0000811_910_1752 | 275 |
| 590 | 3300046557 | Ga0495622_0079556 | Ga0495622_0079556_349_1179 | 275 |
| 591 | 3300046558 | Ga0495633_0000051 | Ga0495633_0000051_42352_43188 | 275 |
| 592 | 3300046558 | Ga0495633_0001313 | Ga0495633_0001313_1073_1927 | 275 |
| 593 | 3300046558 | Ga0495633_0001331 | Ga0495633_0001331_1308_2144 | 275 |
| 594 | 3300046558 | Ga0495633_0159054 | Ga0495633_0159054_174_1019 | 275 |
| 595 | 3300046616 | Ga0495668_0000056 | Ga0495668_0000056_166900_167730 | 275 |
| 596 | 3300046616 | Ga0495668_0044700 | Ga0495668_0044700_1026_1856 | 275 |
| 597 | 3300046616 | Ga0495668_0177738 | Ga0495668_0177738_260_1090 | 275 |
| 598 | 3300046648 | Ga0495611_0001518 | Ga0495611_0001518_9108_9944 | 275 |
| 599 | 3300046648 | Ga0495611_0014485 | Ga0495611_0014485_2482_3342 | 275 |
| 600 | 3300046648 | Ga0495611_0016497 | Ga0495611_0016497_2296_3126 | 275 |
| 601 | 3300046648 | Ga0495611_0113967 | Ga0495611_0113967_15_851 | 275 |
| 602 | 3300046660 | Ga0495625_0000004 | Ga0495625_0000004_564809_565639 | 275 |
| 603 | 3300046660 | Ga0495625_0000255 | Ga0495625_0000255_5479_6315 | 275 |
| 604 | 3300046660 | Ga0495625_0010467 | Ga0495625_0010467_6770_7600 | 275 |
| 605 | 3300046660 | Ga0495625_0022116 | Ga0495625_0022116_1938_2768 | 275 |
| 606 | 3300046660 | Ga0495625_0212629 | Ga0495625_0212629_45_881 | 275 |
| 607 | 3300046665 | Ga0495661_0000005 | Ga0495661_0000005_405534_406370 | 275 |
| 608 | 3300046665 | Ga0495661_0000006 | Ga0495661_0000006_317555_318385 | 275 |
| 609 | 3300046665 | Ga0495661_0062264 | Ga0495661_0062264_859_1698 | 275 |
| 610 | 3300046684 | Ga0495669_0000140 | Ga0495669_0000140_20511_21341 | 275 |
| 611 | 3300046691 | Ga0495670_0016590 | Ga0495670_0016590_479_1315 | 275 |
| 612 | 3300046692 | Ga0495671_0000974 | Ga0495671_0000974_16551_17387 | 275 |
| 613 | 3300046694 | Ga0495649_0001686 | Ga0495649_0001686_9774_10616 | 275 |
| 614 | 3300046694 | Ga0495649_0016249 | Ga0495649_0016249_3241_4077 | 275 |
| 615 | 3300046694 | Ga0495649_0051539 | Ga0495649_0051539_613_1443 | 275 |
| 616 | 3300046694 | Ga0495649_0052354 | Ga0495649_0052354_337_1173 | 275 |
| 617 | 3300046794 | Ga0495589_0001000 | Ga0495589_0001000_4505_5341 | 275 |
| 618 | 3300046809 | Ga0495600_0000238 | Ga0495600_0000238_21383_22228 | 275 |
| 619 | 3300046810 | Ga0495660_0007985 | Ga0495660_0007985_3414_4250 | 275 |
| 620 | 3300046810 | Ga0495660_0044671 | Ga0495660_0044671_1418_2248 | 275 |
| 621 | 3300046810 | Ga0495660_0045673 | Ga0495660_0045673_654_1484 | 275 |
| 622 | 3300047323 | Ga0495683_0000004 | Ga0495683_0000004_231088_231924 | 275 |
| 623 | 3300047323 | Ga0495683_0002838 | Ga0495683_0002838_6172_7008 | 275 |
| 624 | 3300047323 | Ga0495683_0009713 | Ga0495683_0009713_1188_2018 | 275 |
| 625 | 3300047443 | Ga0495687_000323 | Ga0495687_000323_5462_6292 | 275 |
| 626 | 3300047443 | Ga0495687_000353 | Ga0495687_000353_5850_6680 | 275 |
| 627 | 3300047445 | Ga0495677_0004893 | Ga0495677_0004893_2679_3509 | 275 |
| 628 | 3300047446 | Ga0495679_000015 | Ga0495679_000015_35967_36797 | 275 |
| 629 | 3300047446 | Ga0495679_008355 | Ga0495679_008355_1408_2244 | 275 |
| 630 | 3300047469 | Ga0495673_0000118 | Ga0495673_0000118_108934_109794 | 275 |
| 631 | 3300047469 | Ga0495673_0011223 | Ga0495673_0011223_2609_3439 | 275 |
| 632 | 3300047469 | Ga0495673_0011733 | Ga0495673_0011733_3652_4488 | 275 |
| 633 | 3300047470 | Ga0495681_0000030 | Ga0495681_0000030_14907_15743 | 275 |
| 634 | 3300047470 | Ga0495681_0002539 | Ga0495681_0002539_10817_11647 | 275 |
| 635 | 3300047470 | Ga0495681_0010402 | Ga0495681_0010402_913_1749 | 275 |
| 636 | 3300047470 | Ga0495681_0019035 | Ga0495681_0019035_917_1753 | 275 |
| 637 | 3300047470 | Ga0495681_0079228 | Ga0495681_0079228_125_955 | 275 |
| 638 | 3300047472 | Ga0495686_0000092 | Ga0495686_0000092_86529_87359 | 275 |
| 639 | 3300047472 | Ga0495686_0103186 | Ga0495686_0103186_394_1239 | 275 |
| 640 | 3300048090 | Ga0495615_0000250 | Ga0495615_0000250_8288_9157 | 275 |
| 641 | 3300048091 | Ga0495626_0000201 | Ga0495626_0000201_28530_29360 | 275 |
| 642 | 3300048905 | Ga0496102_0000163 | Ga0496102_0000163_65574_66410 | 275 |
| 643 | 3300048906 | Ga0496103_0000052 | Ga0496103_0000052_133973_134809 | 275 |
| 644 | 3300048908 | Ga0496105_0001540 | Ga0496105_0001540_869_1705 | 275 |
| 645 | 3300048909 | Ga0496106_0067736 | Ga0496106_0067736_513_1346 | 275 |
| 646 | 3300048914 | Ga0496111_0053896 | Ga0496111_0053896_2004_2855 | 275 |
| 647 | 3300048917 | Ga0496114_0035807 | Ga0496114_0035807_2695_3531 | 275 |
| 648 | 3300048918 | Ga0496115_0000078 | Ga0496115_0000078_23297_24133 | 275 |
| 649 | 3300048918 | Ga0496115_0001140 | Ga0496115_0001140_9040_9879 | 275 |
| 650 | 3300048918 | Ga0496115_0035167 | Ga0496115_0035167_3003_3839 | 275 |
| 651 | 3300048919 | Ga0496116_0002348 | Ga0496116_0002348_14619_15455 | 275 |
| 652 | 3300048919 | Ga0496116_0118327 | Ga0496116_0118327_221_1066 | 275 |
| 653 | 3300048920 | Ga0496117_0000141 | Ga0496117_0000141_23232_24068 | 275 |
| 654 | 3300048920 | Ga0496117_0014772 | Ga0496117_0014772_5226_6059 | 275 |
| 655 | 3300048920 | Ga0496117_0072252 | Ga0496117_0072252_970_1809 | 275 |
| 656 | 3300048920 | Ga0496117_0139092 | Ga0496117_0139092_178_1023 | 275 |
| 657 | 3300048921 | Ga0496118_0000103 | Ga0496118_0000103_23290_24126 | 275 |
| 658 | 3300048921 | Ga0496118_0001211 | Ga0496118_0001211_27663_28493 | 275 |
| 659 | 3300048921 | Ga0496118_0007258 | Ga0496118_0007258_2428_3273 | 275 |
| 660 | 3300048921 | Ga0496118_0007966 | Ga0496118_0007966_1066_1899 | 275 |
| 661 | 3300048921 | Ga0496118_0229625 | Ga0496118_0229625_27_866 | 275 |
| 662 | 3300048922 | Ga0496119_0149911 | Ga0496119_0149911_191_1036 | 275 |
| 663 | 3300048923 | Ga0496120_0001560 | Ga0496120_0001560_22762_23613 | 275 |
| 664 | 3300048923 | Ga0496120_0003845 | Ga0496120_0003845_3700_4536 | 275 |
| 665 | 3300048923 | Ga0496120_0029940 | Ga0496120_0029940_2345_3187 | 275 |
| 666 | 3300048923 | Ga0496120_0052615 | Ga0496120_0052615_142_987 | 275 |
| 667 | 3300048924 | Ga0496121_0000075 | Ga0496121_0000075_183157_183990 | 275 |
| 668 | 3300048924 | Ga0496121_0000156 | Ga0496121_0000156_133955_134791 | 275 |
| 669 | 3300048924 | Ga0496121_0203303 | Ga0496121_0203303_366_1199 | 275 |
| 670 | 3300048925 | Ga0496122_0001025 | Ga0496122_0001025_18653_19510 | 275 |
| 671 | 3300048925 | Ga0496122_0001717 | Ga0496122_0001717_1161_2006 | 275 |
| 672 | 3300048925 | Ga0496122_0003081 | Ga0496122_0003081_4201_5052 | 275 |
| 673 | 3300048925 | Ga0496122_0011237 | Ga0496122_0011237_5791_6624 | 275 |
| 674 | 3300048925 | Ga0496122_0048796 | Ga0496122_0048796_2282_3133 | 275 |
| 675 | 3300048925 | Ga0496122_0058091 | Ga0496122_0058091_1122_1973 | 275 |
| 676 | 3300048926 | Ga0496123_0000211 | Ga0496123_0000211_1321_2166 | 275 |
| 677 | 3300048926 | Ga0496123_0000949 | Ga0496123_0000949_3884_4741 | 275 |
| 678 | 3300048926 | Ga0496123_0004603 | Ga0496123_0004603_11362_12213 | 275 |
| 679 | 3300048926 | Ga0496123_0005769 | Ga0496123_0005769_9263_10099 | 275 |
| 680 | 3300048926 | Ga0496123_0011302 | Ga0496123_0011302_1677_2528 | 275 |
| 681 | 3300048926 | Ga0496123_0015413 | Ga0496123_0015413_4319_5170 | 275 |
| 682 | 3300048926 | Ga0496123_0017459 | Ga0496123_0017459_2663_3496 | 275 |
| 683 | 3300048926 | Ga0496123_0029034 | Ga0496123_0029034_1045_1881 | 275 |
| 684 | 3300048926 | Ga0496123_0102025 | Ga0496123_0102025_352_1188 | 275 |
| 685 | 3300048927 | Ga0496124_0000041 | Ga0496124_0000041_135846_136682 | 275 |
| 686 | 3300048927 | Ga0496124_0000110 | Ga0496124_0000110_107569_108405 | 275 |
| 687 | 3300048927 | Ga0496124_0000175 | Ga0496124_0000175_8770_9612 | 275 |
| 688 | 3300048927 | Ga0496124_0002880 | Ga0496124_0002880_20134_20985 | 275 |
| 689 | 3300048927 | Ga0496124_0035212 | Ga0496124_0035212_1497_2348 | 275 |
| 690 | 3300048927 | Ga0496124_0044957 | Ga0496124_0044957_1075_1920 | 275 |
| 691 | 3300048927 | Ga0496124_0111555 | Ga0496124_0111555_1104_1958 | 275 |
| 692 | 3300048928 | Ga0496125_0000238 | Ga0496125_0000238_55106_55942 | 275 |
| 693 | 3300048928 | Ga0496125_0004460 | Ga0496125_0004460_3432_4265 | 275 |
| 694 | 3300048928 | Ga0496125_0005040 | Ga0496125_0005040_11420_12265 | 275 |
| 695 | 3300048928 | Ga0496125_0116286 | Ga0496125_0116286_73_921 | 275 |
| 696 | 3300048929 | Ga0496126_0000155 | Ga0496126_0000155_23284_24120 | 275 |
| 697 | 3300048929 | Ga0496126_0007407 | Ga0496126_0007407_138_995 | 275 |
| 698 | 3300048929 | Ga0496126_0015879 | Ga0496126_0015879_373_1266 | 275 |
| 699 | 3300048929 | Ga0496126_0035447 | Ga0496126_0035447_750_1583 | 275 |
| 700 | 3300048929 | Ga0496126_0069759 | Ga0496126_0069759_1399_2235 | 275 |
| 701 | 3300048929 | Ga0496126_0074200 | Ga0496126_0074200_989_1849 | 275 |
| 702 | 3300048929 | Ga0496126_0483172 | Ga0496126_0483172_55_885 | 275 |
| 703 | 3300049459 | Ga0495678_000014 | Ga0495678_000014_89795_90631 | 275 |
| 704 | 3300049459 | Ga0495678_008882 | Ga0495678_008882_2517_3353 | 275 |
| 705 | 3300049568 | Ga0501031_0083117 | Ga0501031_0083117_1142_1978 | 275 |
| 706 | 3300049569 | Ga0501032_0000683 | Ga0501032_0000683_24998_25870 | 275 |
| 707 | 3300049569 | Ga0501032_0004574 | Ga0501032_0004574_5838_6710 | 275 |
| 708 | 3300049569 | Ga0501032_0017514 | Ga0501032_0017514_1988_2824 | 275 |
| 709 | 3300049570 | Ga0501033_0000645 | Ga0501033_0000645_29691_30563 | 275 |
| 710 | 3300049570 | Ga0501033_0001599 | Ga0501033_0001599_3235_4107 | 275 |
| 711 | 3300049570 | Ga0501033_0126332 | Ga0501033_0126332_973_1821 | 275 |
| 712 | 3300049571 | Ga0501034_0004311 | Ga0501034_0004311_168_1040 | 275 |
| 713 | 3300049571 | Ga0501034_0053703 | Ga0501034_0053703_2508_3350 | 275 |
| 714 | 3300049571 | Ga0501034_0235958 | Ga0501034_0235958_303_1151 | 275 |
| 715 | 3300049571 | Ga0501034_0419690 | Ga0501034_0419690_207_1046 | 275 |
| 716 | 3300049572 | Ga0501036_0003715 | Ga0501036_0003715_9658_10530 | 275 |
| 717 | 3300049572 | Ga0501036_0099212 | Ga0501036_0099212_1430_2302 | 275 |
| 718 | 3300049572 | Ga0501036_0216120 | Ga0501036_0216120_475_1323 | 275 |
| 719 | 3300049573 | Ga0501037_0000484 | Ga0501037_0000484_29691_30563 | 275 |
| 720 | 3300049573 | Ga0501037_0000967 | Ga0501037_0000967_4354_5226 | 275 |
| 721 | 3300049574 | Ga0501038_0002722 | Ga0501038_0002722_3104_3976 | 275 |
| 722 | 3300049574 | Ga0501038_0114465 | Ga0501038_0114465_1131_1979 | 275 |
| 723 | 3300049574 | Ga0501038_0301561 | Ga0501038_0301561_154_996 | 275 |
| 724 | 3300049575 | Ga0501039_0001996 | Ga0501039_0001996_1712_2584 | 275 |
| 725 | 3300049578 | Ga0501042_0033225 | Ga0501042_0033225_1618_2490 | 275 |
| 726 | 3300049579 | Ga0501043_0000593 | Ga0501043_0000593_1049_1921 | 275 |
| 727 | 3300049579 | Ga0501043_0001016 | Ga0501043_0001016_16117_16989 | 275 |
| 728 | 3300049579 | Ga0501043_0071079 | Ga0501043_0071079_976_1812 | 275 |
| 729 | 3300049580 | Ga0501046_0000499 | Ga0501046_0000499_4108_4980 | 275 |
| 730 | 3300049580 | Ga0501046_0010181 | Ga0501046_0010181_6720_7556 | 275 |
| 731 | 3300049580 | Ga0501046_0105770 | Ga0501046_0105770_1094_1930 | 275 |
| 732 | 3300049581 | Ga0501047_0001042 | Ga0501047_0001042_1712_2584 | 275 |
| 733 | 3300049581 | Ga0501047_0106929 | Ga0501047_0106929_152_1000 | 275 |
| 734 | 3300049581 | Ga0501047_0249106 | Ga0501047_0249106_394_1230 | 275 |
| 735 | 3300049582 | Ga0501048_0022882 | Ga0501048_0022882_1082_1954 | 275 |
| 736 | 3300049582 | Ga0501048_0032973 | Ga0501048_0032973_2740_3594 | 275 |
| 737 | 3300049583 | Ga0501067_0007605 | Ga0501067_0007605_3378_4250 | 275 |
| 738 | 3300049584 | Ga0501068_0001651 | Ga0501068_0001651_1712_2584 | 275 |
| 739 | 3300049584 | Ga0501068_0059779 | Ga0501068_0059779_1119_1991 | 275 |
| 740 | 3300049585 | Ga0501069_0000331 | Ga0501069_0000331_16117_16989 | 275 |
| 741 | 3300049585 | Ga0501069_0008815 | Ga0501069_0008815_2759_3631 | 275 |
| 742 | 3300049586 | Ga0501070_0001433 | Ga0501070_0001433_4354_5226 | 275 |
| 743 | 3300049586 | Ga0501070_0003020 | Ga0501070_0003020_12074_12946 | 275 |
| 744 | 3300049586 | Ga0501070_0067679 | Ga0501070_0067679_1355_2212 | 275 |
| 745 | 3300049587 | Ga0501071_0045104 | Ga0501071_0045104_1502_2374 | 275 |
| 746 | 3300049587 | Ga0501071_0128530 | Ga0501071_0128530_866_1738 | 275 |
| 747 | 3300049588 | Ga0501072_0542031 | Ga0501072_0542031_18_890 | 275 |
| 748 | 3300049589 | Ga0501073_0014323 | Ga0501073_0014323_1411_2283 | 275 |
| 749 | 3300049589 | Ga0501073_0148255 | Ga0501073_0148255_288_1136 | 275 |
| 750 | 3300049590 | Ga0501074_0001744 | Ga0501074_0001744_4531_5403 | 275 |
| 751 | 3300049590 | Ga0501074_0004226 | Ga0501074_0004226_2706_3578 | 275 |
| 752 | 3300049741 | Ga0501079_0070522 | Ga0501079_0070522_1380_2252 | 275 |
| 753 | 3300049742 | Ga0501080_0000326 | Ga0501080_0000326_33889_34761 | 275 |
| 754 | 3300049742 | Ga0501080_0010446 | Ga0501080_0010446_3062_3934 | 275 |
| 755 | 3300049744 | Ga0501083_0000748 | Ga0501083_0000748_4243_5115 | 275 |
| 756 | 3300049744 | Ga0501083_0023811 | Ga0501083_0023811_2719_3567 | 275 |
| 757 | 3300049744 | Ga0501083_0158829 | Ga0501083_0158829_256_1098 | 275 |
| 758 | 3300049822 | Ga0501035_0001846 | Ga0501035_0001846_16101_16973 | 275 |
| 759 | 3300049822 | Ga0501035_0003801 | Ga0501035_0003801_11804_12676 | 275 |
| 760 | 3300049822 | Ga0501035_0096409 | Ga0501035_0096409_568_1425 | 275 |
| 761 | 3300049822 | Ga0501035_0228851 | Ga0501035_0228851_339_1187 | 275 |
| 762 | 3300049823 | Ga0501044_0011279 | Ga0501044_0011279_4354_5226 | 275 |
| 763 | 3300049823 | Ga0501044_0029503 | Ga0501044_0029503_1661_2509 | 275 |
| 764 | 3300049823 | Ga0501044_0033544 | Ga0501044_0033544_1712_2584 | 275 |
| 765 | 3300049823 | Ga0501044_0113430 | Ga0501044_0113430_1406_2248 | 275 |
| 766 | 3300049823 | Ga0501044_0155576 | Ga0501044_0155576_736_1593 | 275 |
| 767 | 3300049823 | Ga0501044_0200826 | Ga0501044_0200826_966_1802 | 275 |
| 768 | 3300049824 | Ga0501045_0014252 | Ga0501045_0014252_4749_5621 | 275 |
| 769 | 3300050512 | nmdc:mga0n895_8184_c1 | nmdc:mga0n895_8184_c1_8044_8886 | 275 |
| 770 | 3300050513 | nmdc:mga0rr50_3298_c1 | nmdc:mga0rr50_3298_c1_134_976 | 275 |
| 771 | 3300050515 | nmdc:mga0a205_10744_c1 | nmdc:mga0a205_10744_c1_6452_7294 | 275 |
| 772 | 3300053079 | Ga0500610_0000018 | Ga0500610_0000018_56309_57139 | 275 |
| 773 | 3300053087 | Ga0500643_000225 | Ga0500643_000225_34054_34914 | 275 |
| 774 | 3300053087 | Ga0500643_002359 | Ga0500643_002359_4938_5774 | 275 |
| 775 | 3300053090 | Ga0500646_0017153 | Ga0500646_0017153_722_1552 | 275 |
| 776 | 3300053096 | Ga0500641_0001522 | Ga0500641_0001522_6302_7135 | 275 |
| 777 | 3300053103 | Ga0500555_001252 | Ga0500555_001252_2390_3226 | 275 |
| 778 | 3300053108 | Ga0500562_022854 | Ga0500562_022854_700_1545 | 275 |
| 779 | 3300053116 | Ga0500592_007028 | Ga0500592_007028_102_938 | 275 |
| 780 | 3300053119 | Ga0500595_002053 | Ga0500595_002053_6709_7551 | 275 |
| 781 | 3300053119 | Ga0500595_027264 | Ga0500595_027264_976_1818 | 275 |
| 782 | 3300053120 | Ga0500597_000551 | Ga0500597_000551_3640_4476 | 275 |
| 783 | 3300053130 | Ga0500642_0000178 | Ga0500642_0000178_22230_23066 | 275 |
| 784 | 3300053130 | Ga0500642_0052048 | Ga0500642_0052048_552_1388 | 275 |
| 785 | 3300053136 | Ga0500559_0000468 | Ga0500559_0000468_11481_12341 | 275 |
| 786 | 3300053136 | Ga0500559_0133345 | Ga0500559_0133345_156_989 | 275 |
| 787 | 3300053153 | Ga0500616_0026860 | Ga0500616_0026860_558_1403 | 275 |
| 788 | 3300053156 | Ga0500622_0021616 | Ga0500622_0021616_882_1730 | 275 |
| 789 | 3300053729 | Ga0500625_002064 | Ga0500625_002064_5009_5845 | 275 |
| 790 | 3300053730 | Ga0500645_000073 | Ga0500645_000073_54394_55224 | 275 |
| 791 | 3300053735 | Ga0500596_008393 | Ga0500596_008393_525_1370 | 275 |
| 792 | 3300054114 | Ga0501084_0297086 | Ga0501084_0297086_401_1273 | 275 |
| 793 | 3300055283 | Ga0500661_000041 | Ga0500661_000041_3178_4038 | 275 |
| 794 | 3300060353 | Ga0501082_0214741 | Ga0501082_0214741_24_866 | 275 |
| 795 | iso_pu_bacteria | 2693429783 | 2694632819 | 275 |
| 796 | iso_pu_bacteria | 2693429784 | 2694639452 | 275 |
| 797 | iso_pu_bacteria | 2871429161 | 2871434301 | 275 |
| 798 | iso_pu_bacteria | 2874155637 | 2874156442 | 275 |
| 799 | iso_pu_bacteria | 2876377896 | 2876383109 | 275 |
| 800 | iso_pu_bacteria | 2876413966 | 2876414630 | 275 |
| 801 | iso_pu_bacteria | 2878745973 | 2878747176 | 275 |
| 802 | iso_pu_bacteria | 2888350351 | 2888351242 | 275 |
| 803 | iso_pu_bacteria | 2889010040 | 2889013634 | 275 |
| 804 | iso_pu_bacteria | 2906308376 | 2906309348 | 275 |
| 805 | iso_pu_bacteria | 2906321335 | 2906326998 | 275 |
| 806 | iso_pu_bacteria | 2922130491 | 2922130815 | 275 |
| 807 | iso_pu_bacteria | 2922185730 | 2922186173 | 275 |
| 808 | iso_pu_bacteria | 2937813078 | 2937813707 | 275 |
| 809 | iso_pu_bacteria | 2938014810 | 2938018395 | 275 |
| 810 | iso_pu_bacteria | 2958041894 | 2958044372 | 275 |
| 811 | iso_pu_bacteria | 2958130278 | 2958131394 | 275 |
| 812 | iso_pu_bacteria | 2958172287 | 2958179900 | 275 |
| 813 | iso_pu_bacteria | 2958179912 | 2958181219 | 275 |
| 814 | iso_pu_bacteria | 2961077736 | 2961079057 | 275 |
| 815 | iso_pu_bacteria | 2965119406 | 2965121485 | 275 |
| 816 | iso_pu_bacteria | 2968117919 | 2968118810 | 275 |
| 817 | iso_pu_bacteria | 2977843712 | 2977843901 | 275 |
| 818 | iso_pu_bacteria | 2977942078 | 2977946372 | 275 |
| 819 | iso_pu_bacteria | 2977971508 | 2977975668 | 275 |
| 820 | iso_pu_bacteria | 2979710463 | 2979712733 | 275 |
| 821 | iso_pu_bacteria | 2987652177 | 2987654163 | 275 |
| 822 | iso_pu_bacteria | 8004387939 | 8004390413 | 275 |
| 823 | iso_pu_bacteria | 8004640170 | 8004642586 | 275 |
| 824 | iso_pu_bacteria | 8004714634 | 8004715606 | 275 |
| 825 | iso_pu_bacteria | 8056382006 | 8056386488 | 275 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4yba-assembly1.cif.gz_A | the structure of the c.kpn2i controller protein | 0.913 | 36 | 76 |
| 3zkc-assembly1.cif.gz_B | crystal structure of the master regulator for biofilm formation sinr in complex with dna. | 0.8693 | 7 | 78 |
| 2xj3-assembly1.cif.gz_B | high resolution structure of the t55c mutant of cylr2. | 0.867 | 36 | 76 |
| 1y7y-assembly1.cif.gz_B | high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila | 0.8658 | 8 | 82 |
| 1utx-assembly1.cif.gz_B | regulation of cytolysin expression by enterococcus faecalis: role of cylr2 | 0.8649 | 37 | 76 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ybaA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.913 | 36 | 76 | 1.10.260.40 |
| 3zkcB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8693 | 7 | 78 | 1.10.260.40 |
| 1y7yB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8658 | 8 | 82 | 1.10.260.40 |
| 3zkcA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8614 | 9 | 78 | 1.10.260.40 |
| 2gzuB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8418 | 36 | 76 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K2M030-F1-model_v4 | Helix-turn-helix domain-containing protein | 0.9721 | 6 | 89 |
GO:0003677
|
| AF-A0A840FQM9-F1-model_v4 | MmyB-like transcription regulator ligand binding domain-containing protein | 0.9451 | 117 | 274 |
|
| AF-A0A527D2N4-F1-model_v4 | Transcriptional regulator | 0.9406 | 96 | 273 |
|
| AF-A0A4V2AW01-F1-model_v4 | MmyB-like transcription regulator ligand binding domain-containing protein | 0.9306 | 99 | 274 |
|
| AF-A0A353U7Q5-F1-model_v4 | deleted | 0.9202 | 62 | 274 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar