F482409

General Info

Members Datasets Scaffolds Average Seq Length
824 506 663 298

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2517572143|2517891144
Length 332
Sequence FSSEVDTGSRKENASKQESGAPFRFHRNGKGSRLPQIALLPDGKRLHLQDGPIDLVIEAKGRDEDVSAAYQAAAERFTGLLDELCAELAELRTAADPERCALKGVVARRMHAAVAPFAADCFITPMAAVAGSVAEEILGAMLEAAPLDRAYVNNGGDIALHLSDGEQFTVGLMDRPDRHGVMRAMTVDADMPVRGIATSGRHGRSFSLGIADAVTVLARTASQADAAATVIANAVDLPDHPAILRVPASELQPDSDLGARLVTRDVGPLAEHEIEQALEAGSARARDLLMPGLIEGAALRLLGETRIVGATGIGASASHALQGQTTEHMLRA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
14 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
15 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
16 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
17 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
18 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
19 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
20 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
21 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
22 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
23 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
24 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
25 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
26 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
27 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
28 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
29 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
30 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
31 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
32 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
33 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
34 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
35 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
36 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
37 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
38 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
39 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
40 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
41 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
42 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
43 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
44 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
45 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
46 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
47 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
48 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
49 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
50 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
51 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
52 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
53 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
54 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
55 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
56 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
57 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
58 2904699407
59 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
60 2906610324
61 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
62 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
63 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
64 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
65 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
66 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
67 2922368715
68 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
69 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
70 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
71 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
72 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
73 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
74 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
75 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
76 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
77 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
78 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
79 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
80 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
81 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
82 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
83 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
84 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
85 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
86 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
87 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
88 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
89 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
90 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
91 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
92 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
93 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
94 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
95 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
96 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
97 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
98 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
99 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
100 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
101 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
102 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
103 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
104 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
105 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
106 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
107 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
108 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
109 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
110 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
111 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
112 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
113 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
114 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
115 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
116 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
117 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
118 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
119 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
120 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
121 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
122 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
123 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
124 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
125 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
126 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
127 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
128 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
129 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
130 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
131 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
132 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
133 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
134 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
135 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
136 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
137 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
138 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
139 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
140 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
141 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
142 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
143 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
144 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
145 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
146 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
147 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
148 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
149 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
150 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
151 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
152 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
153 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
154 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
155 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
156 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
157 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
158 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
159 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
160 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
161 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
162 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
163 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
164 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
165 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
166 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
167 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
168 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
169 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
170 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
171 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
172 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
173 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
174 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
175 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
176 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
177 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
178 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
179 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
180 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
181 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
182 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
183 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
184 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
185 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
186 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
187 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
188 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
189 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
190 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
191 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
192 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
193 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
194 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
195 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
196 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
197 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
198 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
199 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
200 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
201 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
202 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
203 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
204 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
205 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
206 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
207 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
208 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
209 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
210 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
211 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
212 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
213 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
214 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
215 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
216 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
217 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
218 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
219 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
220 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
221 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
222 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
223 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
224 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
225 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
226 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
227 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
228 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
229 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
230 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
231 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
232 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
234 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
236 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
237 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
238 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
286 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
287 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
288 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
289 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
294 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
295 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
296 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
297 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
298 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
299 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
300 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
301 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
302 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
303 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
304 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
305 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
306 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
307 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
308 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
309 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
310 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
311 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
312 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
313 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
314 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
315 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
316 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
317 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
318 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
319 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
320 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
321 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
322 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
323 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
324 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
325 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
326 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
327 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
328 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
329 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
330 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
331 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
332 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
333 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
334 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
335 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
336 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
337 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
338 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
339 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
340 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
341 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
342 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
343 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
344 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
345 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
346 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
347 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
348 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
349 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
350 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
351 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
352 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
353 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
354 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
355 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
356 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
357 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
358 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
359 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
360 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
361 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
362 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
363 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
364 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
365 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
366 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
367 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
368 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
369 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
370 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
371 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
372 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
373 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
374 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
375 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
376 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
377 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
378 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
379 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
380 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
381 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
382 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
383 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
384 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
385 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
386 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
387 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
388 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
389 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
390 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
391 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
392 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
393 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
394 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
395 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
396 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
397 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
398 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
399 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
400 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
401 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
402 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
403 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
404 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
405 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
406 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
407 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
408 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
409 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
410 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
411 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
412 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
413 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
414 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
415 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
416 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
417 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
418 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
419 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
420 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
421 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
422 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
423 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
424 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
436 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
437 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
438 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
440 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
441 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
442 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
443 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
444 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
445 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
446 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
447 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
448 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
449 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
450 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
451 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
452 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
453 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
454 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
455 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
456 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
457 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
458 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
459 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
460 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
461 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
462 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
463 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
464 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
465 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
466 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
467 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
468 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
469 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
470 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
471 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
472 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
473 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
474 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
475 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
476 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
477 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
478 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
479 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
480 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
481 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
482 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
483 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
484 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
485 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
486 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
487 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
488 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
489 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
490 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
491 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
492 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
493 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
494 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
495 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
496 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
497 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
498 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
499 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
500 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
501 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
502 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
503 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
504 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
505 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
506 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.63
Metatranscriptomes 0.12
Isolates 19.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.95
Nodule 16.26
Rhizoplane 8.37
Rhizosphere 54.98
Stem 0
Stem Tuber 0
Unclassified 10.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000019 3300003203 Bacteria 87589
2 JGI25406J46586_10000318 3300003203 Bacteria 21736
3 JGI25406J46586_10012828 3300003203 Bacteria 3621
4 JGI25153J46596_10006245 3300003215 Bacteria 6092
5 rootH2_10176532 3300003320 Bacteria 1479
6 JGI25160J50197_1007770 3300003354 Bacteria 4157
7 JGI25160J50197_1008566 3300003354 Bacteria 3886
8 JGI25404J52841_10008171 3300003659 Bacteria 2224
9 JGI25404J52841_10008986 3300003659 Bacteria 2135
10 JGI25404J52841_10012809 3300003659 Bacteria 1819
11 JGI25404J52841_10015588 3300003659 Bacteria 1649
12 Ga0055531_10004023 3300003794 Bacteria 9120
13 Ga0055543_1002866 3300004625 Bacteria 5433
14 Ga0065165_1002034 3300005262 Bacteria 18805
15 Ga0065165_1002156 3300005262 Bacteria 17812
16 Ga0070658_10222921 3300005327 Bacteria 1595
17 Ga0070658_10224446 3300005327 Bacteria 1589
18 Ga0070658_10313858 3300005327 Bacteria 1338
19 Ga0070683_100025031 3300005329 Bacteria 5354
20 Ga0070683_100141992 3300005329 Bacteria 2275
21 Ga0070680_100053378 3300005336 Bacteria 3300
22 Ga0070680_100070194 3300005336 Bacteria 2877
23 Ga0068868_100009673 3300005338 Bacteria 6958
24 Ga0070660_100152696 3300005339 Bacteria 1857
25 Ga0070661_100046142 3300005344 Bacteria 3187
26 Ga0070661_100051701 3300005344 Bacteria 3007
27 Ga0070661_100104658 3300005344 Bacteria 2109
28 Ga0070668_100227548 3300005347 Bacteria 1540
29 Ga0070668_100266628 3300005347 Bacteria 1426
30 Ga0070668_100365894 3300005347 Bacteria 1224
31 Ga0070675_100421215 3300005354 Bacteria 1194
32 Ga0070671_100199647 3300005355 Bacteria 1696
33 Ga0070671_100222650 3300005355 Bacteria 1600
34 Ga0070659_100062805 3300005366 Bacteria 2937
35 Ga0070667_100029892 3300005367 Bacteria 4542
36 Ga0070667_100178997 3300005367 Bacteria 1875
37 Ga0070709_10001083 3300005434 Bacteria 15083
38 Ga0070709_10002717 3300005434 Bacteria 9561
39 Ga0070714_100015456 3300005435 Bacteria 6142
40 Ga0070714_100101373 3300005435 Bacteria 2537
41 Ga0070713_100118871 3300005436 Bacteria 2315
42 Ga0070713_100127150 3300005436 Bacteria 2243
43 Ga0070713_100182802 3300005436 Bacteria 1885
44 Ga0070713_100184286 3300005436 Bacteria 1877
45 Ga0070713_100355606 3300005436 Bacteria 1360
46 Ga0070710_10000726 3300005437 Bacteria 15703
47 Ga0070710_10039694 3300005437 Bacteria 2591
48 Ga0070710_10056197 3300005437 Bacteria 2227
49 Ga0070711_100006561 3300005439 Bacteria 7020
50 Ga0070711_100017822 3300005439 Bacteria 4525
51 Ga0070711_100205740 3300005439 Bacteria 1521
52 Ga0070700_100194296 3300005441 Bacteria 1421
53 Ga0070663_100012111 3300005455 Bacteria 5444
54 Ga0070663_100080316 3300005455 Bacteria 2395
55 Ga0070663_100163169 3300005455 Bacteria 1717
56 Ga0070678_100060846 3300005456 Bacteria 2781
57 Ga0070681_10011285 3300005458 Bacteria 8837
58 Ga0070681_10119263 3300005458 Bacteria 2574
59 Ga0068867_100304920 3300005459 Bacteria 1314
60 Ga0070707_100294789 3300005468 Bacteria 1576
61 Ga0070698_100014123 3300005471 Bacteria 8445
62 Ga0070698_100130074 3300005471 Bacteria 2473
63 Ga0070679_100035187 3300005530 Bacteria 4968
64 Ga0070679_100066794 3300005530 Bacteria 3585
65 Ga0070684_100364289 3300005535 Bacteria 1330
66 Ga0068853_100089035 3300005539 Bacteria 2710
67 Ga0068853_100177222 3300005539 Bacteria 1932
68 Ga0068853_100495582 3300005539 Bacteria 1153
69 Ga0068853_100576684 3300005539 Bacteria 1067
70 Ga0070693_100260776 3300005547 Bacteria 1153
71 Ga0070665_100020157 3300005548 Bacteria 6694
72 Ga0070665_100112936 3300005548 Bacteria 2720
73 Ga0068855_100052317 3300005563 Bacteria 4808
74 Ga0068855_100066996 3300005563 Bacteria 4185
75 Ga0068855_100348543 3300005563 Bacteria 1631
76 Ga0068855_100526638 3300005563 Bacteria 1282
77 Ga0070664_100254621 3300005564 Bacteria 1579
78 Ga0068857_100084315 3300005577 Bacteria 2839
79 Ga0068857_100100949 3300005577 Bacteria 2589
80 Ga0068856_100004533 3300005614 Bacteria 13815
81 Ga0068852_100006500 3300005616 Bacteria 8450
82 Ga0068852_100010249 3300005616 Bacteria 6990
83 Ga0068852_100063394 3300005616 Bacteria 3218
84 Ga0068859_100156041 3300005617 Bacteria 2360
85 Ga0068859_100166183 3300005617 Bacteria 2286
86 Ga0068859_100456494 3300005617 Bacteria 1374
87 Ga0068859_100572864 3300005617 Bacteria 1223
88 Ga0068864_100290307 3300005618 Bacteria 1529
89 Ga0068866_10087797 3300005718 Bacteria 1686
90 Ga0068861_100479711 3300005719 Bacteria 1120
91 Ga0068858_100265715 3300005842 Bacteria 1632
92 Ga0068860_100000213 3300005843 Bacteria 91105
93 Ga0068860_100158090 3300005843 Bacteria 2185
94 Ga0068862_100477570 3300005844 Bacteria 1179
95 Ga0081455_10005931 3300005937 Bacteria 13260
96 Ga0081455_10007164 3300005937 Bacteria 11793
97 Ga0081455_10077607 3300005937 Bacteria 2732
98 Ga0081455_10175135 3300005937 Bacteria 1630
99 Ga0081540_1005943 3300005983 Bacteria 9008
100 Ga0081540_1008063 3300005983 Bacteria 7404
101 Ga0081540_1010718 3300005983 Bacteria 6177
102 Ga0081540_1026578 3300005983 Bacteria 3300
103 Ga0081540_1028376 3300005983 Bacteria 3144
104 Ga0081540_1037129 3300005983 Bacteria 2587
105 Ga0081540_1042937 3300005983 Bacteria 2326
106 Ga0081540_1047534 3300005983 Bacteria 2157
107 Ga0081540_1068230 3300005983 Bacteria 1658
108 Ga0081539_10000003 3300005985 Bacteria 594833
109 Ga0081539_10000199 3300005985 Bacteria 139305
110 Ga0081539_10001962 3300005985 Bacteria 31338
111 Ga0070717_10022714 3300006028 Bacteria 4960
112 Ga0070717_10081904 3300006028 Bacteria 2711
113 Ga0070717_10087773 3300006028 Bacteria 2620
114 Ga0070717_10303401 3300006028 Bacteria 1420
115 Ga0075365_10008592 3300006038 Bacteria 5813
116 Ga0075368_10020037 3300006042 Bacteria 2529
117 Ga0075363_100035848 3300006048 Bacteria 2598
118 Ga0070715_10007524 3300006163 Bacteria 3753
119 Ga0070716_100006597 3300006173 Bacteria 5674
120 Ga0070716_100049215 3300006173 Bacteria 2387
121 Ga0070712_100002958 3300006175 Bacteria 10518
122 Ga0070712_100259656 3300006175 Bacteria 1392
123 Ga0075362_10029433 3300006177 Bacteria 2366
124 Ga0075367_10025647 3300006178 Bacteria 3335
125 Ga0075367_10060008 3300006178 Bacteria 2266
126 Ga0075369_10090876 3300006186 Bacteria 1362
127 Ga0075370_10040554 3300006353 Bacteria 2626
128 Ga0075434_100008890 3300006871 Bacteria 9350
129 Ga0075434_100259227 3300006871 Bacteria 1758
130 Ga0068865_100012399 3300006881 Bacteria 5365
131 Ga0097620_100156040 3300006931 Bacteria 2360
132 Ga0097620_100166187 3300006931 Bacteria 2286
133 Ga0097620_100456466 3300006931 Bacteria 1374
134 Ga0097620_100572955 3300006931 Bacteria 1223
135 Ga0099824_1025369 3300006942 Bacteria 3256
136 Ga0099822_1003531 3300006943 Bacteria 20044
137 Ga0075435_100054879 3300007076 Bacteria 3217
138 Ga0099794_10037901 3300007265 Bacteria 2283
139 Ga0099795_10064034 3300007788 Bacteria 1372
140 Ga0105240_10165300 3300009093 Bacteria 2625
141 Ga0105243_10028802 3300009148 Bacteria 4267
142 Ga0105243_10487270 3300009148 Bacteria 1165
143 Ga0105241_10061117 3300009174 Bacteria 2900
144 Ga0105241_10136918 3300009174 Bacteria 1989
145 Ga0105242_10246729 3300009176 Bacteria 1607
146 Ga0105248_10199139 3300009177 Bacteria 2256
147 Ga0105248_10324368 3300009177 Bacteria 1734
148 Ga0105237_10003966 3300009545 Bacteria 17317
149 Ga0105237_10021235 3300009545 Bacteria 6678
150 Ga0105237_10037340 3300009545 Bacteria 4912
151 Ga0105237_10115717 3300009545 Bacteria 2675
152 Ga0105237_10128323 3300009545 Bacteria 2530
153 Ga0105237_10144015 3300009545 Bacteria 2378
154 Ga0105237_10293386 3300009545 Bacteria 1629
155 Ga0105238_10072156 3300009551 Bacteria 3449
156 Ga0105238_10081331 3300009551 Bacteria 3229
157 Ga0105238_10130968 3300009551 Bacteria 2486
158 Ga0105238_10190362 3300009551 Bacteria 2028
159 Ga0105238_10290035 3300009551 Bacteria 1618
160 Ga0105238_10425174 3300009551 Bacteria 1323
161 Ga0099796_10053280 3300010159 Bacteria 1411
162 Ga0099796_10068039 3300010159 Bacteria 1279
163 Ga0105239_10068406 3300010375 Bacteria 3903
164 Ga0105239_10070205 3300010375 Bacteria 3847
165 Ga0105239_10077996 3300010375 Bacteria 3646
166 Ga0105239_10085098 3300010375 Bacteria 3484
167 Ga0105239_10410850 3300010375 Bacteria 1533
168 Ga0105246_10042239 3300011119 Bacteria 3087
169 Ga0105246_10078068 3300011119 Bacteria 2350
170 Ga0157369_10002009 3300013105 Bacteria 24521
171 Ga0157369_10065211 3300013105 Bacteria 3920
172 Ga0157369_10205229 3300013105 Bacteria 2067
173 Ga0157369_10251995 3300013105 Bacteria 1842
174 Ga0157369_10312654 3300013105 Bacteria 1633
175 Ga0157372_10247008 3300013307 Bacteria 2071
176 Ga0157372_10354736 3300013307 Bacteria 1709
177 Ga0157375_10030198 3300013308 Bacteria 5108
178 Ga0157375_10386730 3300013308 Bacteria 1566
179 Ga0157375_10404464 3300013308 Bacteria 1532
180 Ga0163163_10016615 3300014325 Bacteria 6842
181 Ga0163163_10056064 3300014325 Bacteria 3895
182 Ga0163163_10278639 3300014325 Bacteria 1724
183 Ga0163163_10387578 3300014325 Bacteria 1455
184 Ga0163163_10525131 3300014325 Bacteria 1246
185 Ga0157380_10006347 3300014326 Bacteria 8315
186 Ga0157380_10390589 3300014326 Bacteria 1316
187 Ga0157379_10308055 3300014968 Bacteria 1444
188 Ga0157379_10501051 3300014968 Bacteria 1126
189 Ga0157376_10105608 3300014969 Bacteria 2470
190 Ga0163161_10279004 3300017792 Bacteria 1310
191 Ga0206353_10577094 3300020082 Bacteria 2489
192 Ga0214544_1000002 3300021320 Bacteria 753857
193 Ga0214542_1000001 3300021321 Bacteria 1018696
194 Ga0214545_1000001 3300021324 Bacteria 1092817
195 Ga0214543_1000001 3300021327 Bacteria 776921
196 Ga0213872_10036968 3300021361 Bacteria 2230
197 Ga0213876_10033823 3300021384 Bacteria 2695
198 Ga0213871_10045965 3300021441 Bacteria 1184
199 Ga0207425_1003455 3300025245 Bacteria 5053
200 Ga0209148_1000500 3300025254 Bacteria 39994
201 Ga0209233_1018269 3300025261 Bacteria 1890
202 Ga0209233_1027990 3300025261 Bacteria 1358
203 Ga0209455_1004034 3300025272 Bacteria 4967
204 Ga0209758_1000024 3300025297 Bacteria 591966
205 Ga0209758_1000068 3300025297 Bacteria 286488
206 Ga0209758_1002409 3300025297 Bacteria 19162
207 Ga0209758_1011950 3300025297 Bacteria 4938
208 Ga0209758_1051180 3300025297 Bacteria 1440
209 Ga0209256_1027020 3300025299 Bacteria 1642
210 Ga0207426_1000238 3300025302 Bacteria 124393
211 Ga0207426_1002351 3300025302 Bacteria 12330
212 Ga0207426_1006588 3300025302 Bacteria 5011
213 Ga0207426_1021892 3300025302 Bacteria 2202
214 Ga0209257_1001699 3300025304 Bacteria 24723
215 Ga0209257_1010441 3300025304 Bacteria 4698
216 Ga0207692_10000763 3300025898 Bacteria 11404
217 Ga0207692_10000845 3300025898 Bacteria 10979
218 Ga0207692_10043469 3300025898 Bacteria 2236
219 Ga0207688_10063418 3300025901 Bacteria 2084
220 Ga0207647_10006516 3300025904 Bacteria 8486
221 Ga0207647_10136119 3300025904 Bacteria 1442
222 Ga0207685_10052499 3300025905 Bacteria 1580
223 Ga0207699_10000406 3300025906 Bacteria 22137
224 Ga0207645_10076723 3300025907 Bacteria 2141
225 Ga0207705_10234754 3300025909 Bacteria 1396
226 Ga0207705_10302729 3300025909 Bacteria 1226
227 Ga0207654_10021290 3300025911 Bacteria 3446
228 Ga0207707_10000173 3300025912 Bacteria 67122
229 Ga0207707_10011453 3300025912 Bacteria 7724
230 Ga0207707_10043008 3300025912 Bacteria 3942
231 Ga0207695_10000008 3300025913 Bacteria 1058268
232 Ga0207695_10033658 3300025913 Bacteria 5584
233 Ga0207695_10049084 3300025913 Bacteria 4452
234 Ga0207671_10006585 3300025914 Bacteria 10311
235 Ga0207671_10011165 3300025914 Bacteria 7335
236 Ga0207671_10054532 3300025914 Bacteria 2962
237 Ga0207693_10001388 3300025915 Bacteria 21472
238 Ga0207693_10002846 3300025915 Bacteria 14982
239 Ga0207693_10043859 3300025915 Bacteria 3516
240 Ga0207663_10000515 3300025916 Bacteria 16967
241 Ga0207663_10027987 3300025916 Bacteria 3293
242 Ga0207663_10067588 3300025916 Bacteria 2292
243 Ga0207660_10047666 3300025917 Bacteria 3031
244 Ga0207660_10072299 3300025917 Bacteria 2511
245 Ga0207662_10052842 3300025918 Bacteria 2418
246 Ga0207657_10004866 3300025919 Bacteria 14133
247 Ga0207657_10066317 3300025919 Bacteria 3073
248 Ga0207652_10034398 3300025921 Bacteria 4270
249 Ga0207646_10283086 3300025922 Bacteria 1498
250 Ga0207681_10246603 3300025923 Bacteria 1393
251 Ga0207694_10080549 3300025924 Bacteria 2556
252 Ga0207694_10234485 3300025924 Bacteria 1499
253 Ga0207700_10016062 3300025928 Bacteria 4963
254 Ga0207700_10036858 3300025928 Bacteria 3536
255 Ga0207700_10101425 3300025928 Bacteria 2296
256 Ga0207700_10148493 3300025928 Bacteria 1935
257 Ga0207664_10103952 3300025929 Bacteria 2351
258 Ga0207664_10245356 3300025929 Bacteria 1561
259 Ga0207644_10093767 3300025931 Bacteria 2242
260 Ga0207644_10173938 3300025931 Bacteria 1683
261 Ga0207690_10086011 3300025932 Bacteria 2208
262 Ga0207686_10425400 3300025934 Bacteria 1017
263 Ga0207704_10081926 3300025938 Bacteria 2089
264 Ga0207665_10000874 3300025939 Bacteria 20343
265 Ga0207665_10007378 3300025939 Bacteria 7268
266 Ga0207665_10100714 3300025939 Bacteria 2016
267 Ga0207711_10070516 3300025941 Bacteria 3031
268 Ga0207711_10106198 3300025941 Bacteria 2491
269 Ga0207689_10346793 3300025942 Bacteria 1234
270 Ga0207689_10423864 3300025942 Bacteria 1111
271 Ga0207661_10000210 3300025944 Bacteria 37700
272 Ga0207661_10013093 3300025944 Bacteria 6052
273 Ga0207667_10092380 3300025949 Bacteria 3125
274 Ga0207667_10252623 3300025949 Bacteria 1804
275 Ga0207668_10208694 3300025972 Bacteria 1561
276 Ga0207640_10069975 3300025981 Bacteria 2358
277 Ga0207658_10128551 3300025986 Bacteria 2032
278 Ga0207658_10231279 3300025986 Bacteria 1561
279 Ga0207677_10010738 3300026023 Bacteria 5191
280 Ga0207703_10100425 3300026035 Bacteria 2451
281 Ga0207639_10158993 3300026041 Bacteria 1902
282 Ga0207678_10031260 3300026067 Bacteria 4644
283 Ga0207678_10177926 3300026067 Bacteria 1816
284 Ga0207678_10218993 3300026067 Bacteria 1629
285 Ga0207678_10397758 3300026067 Bacteria 1193
286 Ga0207708_10365150 3300026075 Bacteria 1187
287 Ga0207702_10001309 3300026078 Bacteria 24941
288 Ga0207702_10165413 3300026078 Bacteria 2023
289 Ga0207702_10710223 3300026078 Bacteria 991
290 Ga0207641_10297308 3300026088 Bacteria 1524
291 Ga0207676_10505132 3300026095 Bacteria 1149
292 Ga0207674_10042222 3300026116 Bacteria 4712
293 Ga0207675_100352124 3300026118 Bacteria 1443
294 Ga0207683_10250652 3300026121 Bacteria 1616
295 Ga0207698_10220911 3300026142 Bacteria 1712
296 Ga0209389_1000107 3300027296 Bacteria 74129
297 Ga0209389_1002563 3300027296 Bacteria 14077
298 Ga0209589_1000011 3300027357 Bacteria 236981
299 Ga0209589_1000036 3300027357 Bacteria 131278
300 Ga0209489_100006 3300027361 Bacteria 475698
301 Ga0209489_100012 3300027361 Bacteria 236981
302 Ga0209489_115889 3300027361 Bacteria 4339
303 Ga0209489_115890 3300027361 Bacteria 4339
304 Ga0209700_100005 3300027363 Bacteria 573969
305 Ga0209700_100019 3300027363 Bacteria 236981
306 Ga0209179_1016803 3300027512 Bacteria 1377
307 Ga0209588_1016287 3300027671 Bacteria 2293
308 Ga0268266_10002874 3300028379 Bacteria 17897
309 Ga0268266_10013866 3300028379 Bacteria 6938
310 Ga0268266_10072145 3300028379 Bacteria 2993
311 Ga0268264_10000065 3300028381 Bacteria 298403
312 Ga0268264_10210291 3300028381 Bacteria 1785
313 Ga0265334_10009956 3300028573 Bacteria 4018
314 Ga0307517_10000279 3300028786 Bacteria 88025
315 Ga0265332_10011140 3300031238 Bacteria 3995
316 Ga0265332_10056874 3300031238 Bacteria 1676
317 Ga0265325_10010622 3300031241 Bacteria 5322
318 Ga0265340_10001234 3300031247 Bacteria 14646
319 Ga0265339_10010858 3300031249 Bacteria 5633
320 Ga0265339_10129202 3300031249 Bacteria 1293
321 Ga0265316_10052801 3300031344 Bacteria 3187
322 Ga0307513_10198080 3300031456 Bacteria 1852
323 Ga0307509_10019751 3300031507 Bacteria 7671
324 Ga0307509_10105981 3300031507 Bacteria 2831
325 Ga0307508_10028758 3300031616 Bacteria 5026
326 Ga0307508_10103398 3300031616 Bacteria 2445
327 Ga0307508_10135265 3300031616 Bacteria 2068
328 Ga0265314_10000412 3300031711 Bacteria 57508
329 Ga0265342_10042929 3300031712 Bacteria 2730
330 Ga0307516_10014449 3300031730 Bacteria 8350
331 Ga0307516_10017791 3300031730 Bacteria 7403
332 Ga0307516_10116424 3300031730 Bacteria 2468
333 Ga0307510_10048801 3300033180 Bacteria 4511
334 Ga0307510_10063240 3300033180 Bacteria 3771
335 Ga0307510_10096666 3300033180 Bacteria 2768
336 Ga0307510_10189248 3300033180 Bacteria 1608
337 Ga0315911_1000003 3300033442 Bacteria 502217
338 Ga0373926_0014548 3300035083 Bacteria 2676
339 Ga0373929_0010713 3300035085 Bacteria 1718
340 Ga0373934_0038811 3300035086 Bacteria 1876
341 Ga0373934_0070487 3300035086 Bacteria 1398
342 Ga0373932_0010230 3300035112 Bacteria 2267
343 Ga0373936_0026538 3300035113 Bacteria 2268
344 Ga0373953_0095057 3300035117 Bacteria 1250
345 Ga0373954_0010944 3300035118 Bacteria 4012
346 Ga0373956_0009384 3300035119 Bacteria 3980
347 Ga0373957_0000546 3300035120 Bacteria 9543
348 Ga0373943_0108685 3300035170 Bacteria 1460
349 Ga0373961_0016775 3300035241 Bacteria 1890
350 Ga0373962_0023916 3300035242 Bacteria 1630
351 Ga0373924_0016752 3300035410 Bacteria 2802
352 Ga0373931_0015025 3300035691 Bacteria 3794
353 Ga0373931_0022903 3300035691 Bacteria 3148
354 Ga0373931_0105874 3300035691 Bacteria 1589
355 Ga0373935_0081185 3300035692 Bacteria 2107
356 Ga0373935_0121240 3300035692 Bacteria 1747
357 Ga0373927_0029888 3300035695 Bacteria 3554
358 Ga0373927_0038537 3300035695 Bacteria 3103
359 Ga0373927_0043468 3300035695 Bacteria 2908
360 Ga0373927_0074918 3300035695 Bacteria 2191
361 Ga0373933_0074105 3300035724 Bacteria 2075
362 Ga0373947_0006447 3300035725 Bacteria 6815
363 Ga0373937_0057708 3300036401 Bacteria 3566
364 Ga0373925_0032350 3300037068 Bacteria 3850
365 Ga0373925_0066047 3300037068 Bacteria 2726
366 Ga0373925_0098681 3300037068 Bacteria 2242
367 Ga0395900_0001586 3300037418 Bacteria 26897
368 Ga0395900_0017960 3300037418 Bacteria 7221
369 Ga0395900_0311269 3300037418 Bacteria 1558
370 Ga0395898_0045960 3300037466 Bacteria 4290
371 Ga0395898_0206514 3300037466 Bacteria 1874
372 Ga0395898_0277238 3300037466 Bacteria 1599
373 Ga0395905_0002364 3300037471 Bacteria 21019
374 Ga0395905_0092992 3300037471 Bacteria 2828
375 Ga0395905_0094419 3300037471 Bacteria 2806
376 Ga0395905_0307449 3300037471 Bacteria 1474
377 Ga0395901_0033905 3300038443 Bacteria 5272
378 Ga0395901_0034663 3300038443 Bacteria 5214
379 Ga0395901_0600882 3300038443 Bacteria 1109
380 Ga0436365_0518465 3300039437 Bacteria 2927
381 Ga0436365_0935505 3300039437 Bacteria 29785
382 Ga0436365_0962701 3300039437 Bacteria 3132
383 Ga0436365_1198843 3300039437 Bacteria 1880
384 Ga0436360_0216274 3300039438 Bacteria 3512
385 Ga0436361_0327683 3300039447 Bacteria 2262
386 Ga0436361_0553282 3300039447 Bacteria 5181
387 Ga0436362_0058908 3300039453 Bacteria 2258
388 Ga0436362_1191906 3300039453 Bacteria 3118
389 Ga0451800_0677031 3300041459 Bacteria 1119
390 Ga0466969_0006735 3300044656 Bacteria 6111
391 Ga0466972_0000122 3300044658 Bacteria 65679
392 Ga0466972_0039062 3300044658 Bacteria 2317
393 Ga0466966_0020376 3300044684 Bacteria 4361
394 Ga0466961_0000038 3300044693 Bacteria 80721
395 Ga0466968_0021463 3300044735 Bacteria 2616
396 Ga0466960_0105830 3300044901 Bacteria 1455
397 Ga0466967_0046202 3300045976 Bacteria 3789
398 Ga0466967_0084499 3300045976 Bacteria 2872
399 Ga0466967_0250626 3300045976 Bacteria 1691
400 Ga0466967_0473230 3300045976 Bacteria 1227
401 Ga0495592_0060328 3300046454 Bacteria 2790
402 Ga0495603_0002054 3300046455 Bacteria 11838
403 Ga0495603_0052443 3300046455 Bacteria 2422
404 Ga0495603_0076851 3300046455 Bacteria 1959
405 Ga0495590_0079111 3300046457 Bacteria 1157
406 Ga0495629_0003217 3300046459 Bacteria 12360
407 Ga0495651_0006245 3300046462 Bacteria 9112
408 Ga0495651_0078004 3300046462 Bacteria 2506
409 Ga0495651_0102828 3300046462 Bacteria 2124
410 Ga0495653_0007949 3300046463 Bacteria 8683
411 Ga0495580_0003657 3300046472 Bacteria 13031
412 Ga0495582_0027266 3300046473 Bacteria 3130
413 Ga0495582_0148154 3300046473 Bacteria 1332
414 Ga0495582_0259560 3300046473 Bacteria 997
415 Ga0495639_0018700 3300046475 Bacteria 3019
416 Ga0495664_0003617 3300046477 Bacteria 8425
417 Ga0495664_0013305 3300046477 Bacteria 4667
418 Ga0495585_0011478 3300046492 Bacteria 5241
419 Ga0495606_0132161 3300046507 Bacteria 1483
420 Ga0495606_0189479 3300046507 Bacteria 1180
421 Ga0495608_0003691 3300046511 Bacteria 11008
422 Ga0495608_0043300 3300046511 Bacteria 3008
423 Ga0495610_0093164 3300046512 Bacteria 1362
424 Ga0495610_0095158 3300046512 Bacteria 1343
425 Ga0495616_0062781 3300046513 Bacteria 1818
426 Ga0495618_0065708 3300046514 Bacteria 2305
427 Ga0495618_0204913 3300046514 Bacteria 1248
428 Ga0495628_0009637 3300046516 Bacteria 8239
429 Ga0495628_0225701 3300046516 Bacteria 1405
430 Ga0495632_0081478 3300046519 Bacteria 1543
431 Ga0495643_0017469 3300046522 Bacteria 4192
432 Ga0495648_0088224 3300046524 Bacteria 1744
433 Ga0495648_0114945 3300046524 Bacteria 1457
434 Ga0495652_0013965 3300046529 Bacteria 7218
435 Ga0495665_0066247 3300046531 Bacteria 1906
436 Ga0495640_0017440 3300046533 Bacteria 5352
437 Ga0495640_0086095 3300046533 Bacteria 2081
438 Ga0495587_0159396 3300046536 Bacteria 1284
439 Ga0495597_0038281 3300046542 Bacteria 2150
440 Ga0495645_0008361 3300046543 Bacteria 7224
441 Ga0495645_0095822 3300046543 Bacteria 2115
442 Ga0495622_0017465 3300046557 Bacteria 3340
443 Ga0495667_0025996 3300046559 Bacteria 3943
444 Ga0495667_0067757 3300046559 Bacteria 2332
445 Ga0495667_0076418 3300046559 Bacteria 2179
446 Ga0495668_0074265 3300046616 Bacteria 1867
447 Ga0495668_0205347 3300046616 Bacteria 1079
448 Ga0495634_0018688 3300046642 Bacteria 4931
449 Ga0495634_0213848 3300046642 Bacteria 1192
450 Ga0495635_0003851 3300046663 Bacteria 10423
451 Ga0495635_0005522 3300046663 Bacteria 8796
452 Ga0495635_0039940 3300046663 Bacteria 3245
453 Ga0495588_0060051 3300046674 Bacteria 1968
454 Ga0495588_0103314 3300046674 Bacteria 1498
455 Ga0495657_0004230 3300046675 Bacteria 11484
456 Ga0495657_0005377 3300046675 Bacteria 10127
457 Ga0495599_0004042 3300046678 Bacteria 8637
458 Ga0495599_0062448 3300046678 Bacteria 2328
459 Ga0495623_0006266 3300046679 Bacteria 7733
460 Ga0495646_0061456 3300046680 Bacteria 2237
461 Ga0495646_0135513 3300046680 Bacteria 1382
462 Ga0495658_0018566 3300046683 Bacteria 3618
463 Ga0495658_0078802 3300046683 Bacteria 1929
464 Ga0495669_0112330 3300046684 Bacteria 1273
465 Ga0495613_0019527 3300046689 Bacteria 5051
466 Ga0495613_0123948 3300046689 Bacteria 1854
467 Ga0495613_0181305 3300046689 Bacteria 1491
468 Ga0495624_0007215 3300046690 Bacteria 7814
469 Ga0495670_0053234 3300046691 Bacteria 2027
470 Ga0495671_0124382 3300046692 Bacteria 1258
471 Ga0495649_0098431 3300046694 Bacteria 1556
472 Ga0495600_0003420 3300046809 Bacteria 9334
473 Ga0495600_0032711 3300046809 Bacteria 3375
474 Ga0495600_0066753 3300046809 Bacteria 2351
475 Ga0495581_0056549 3300047315 Bacteria 2265
476 Ga0495604_0005841 3300047317 Bacteria 9756
477 Ga0495674_0008705 3300047319 Bacteria 9652
478 Ga0495674_0081652 3300047319 Bacteria 2773
479 Ga0495676_0096204 3300047321 Bacteria 2202
480 Ga0495676_0167162 3300047321 Bacteria 1551
481 Ga0495676_0263286 3300047321 Bacteria 1172
482 Ga0495676_0372270 3300047321 Bacteria 952
483 Ga0495680_0001849 3300047322 Bacteria 22313
484 Ga0495680_0012021 3300047322 Bacteria 7637
485 Ga0495683_0022488 3300047323 Bacteria 3242
486 Ga0495683_0066552 3300047323 Bacteria 1775
487 Ga0495687_034841 3300047443 Bacteria 2269
488 Ga0495673_0052908 3300047469 Bacteria 1773
489 Ga0495684_0029473 3300047471 Bacteria 4212
490 Ga0495593_0021422 3300047673 Bacteria 3611
491 Ga0495602_0010034 3300048088 Bacteria 9831
492 Ga0495602_0339244 3300048088 Bacteria 1087
493 Ga0496100_0045007 3300048903 Bacteria 2830
494 Ga0496100_0348526 3300048903 Bacteria 1118
495 Ga0496101_0000648 3300048904 Bacteria 20964
496 Ga0496101_0034163 3300048904 Bacteria 3590
497 Ga0496101_0222232 3300048904 Bacteria 1466
498 Ga0496102_0005693 3300048905 Bacteria 10582
499 Ga0496102_0299397 3300048905 Bacteria 1516
500 Ga0496103_0020553 3300048906 Bacteria 3967
501 Ga0496103_0105235 3300048906 Bacteria 1789
502 Ga0496103_0150001 3300048906 Bacteria 1493
503 Ga0496104_0003846 3300048907 Bacteria 12994
504 Ga0496104_0010866 3300048907 Bacteria 8142
505 Ga0496104_0184953 3300048907 Bacteria 1994
506 Ga0496104_0185510 3300048907 Bacteria 1991
507 Ga0496104_0399124 3300048907 Bacteria 1287
508 Ga0496105_0004124 3300048908 Bacteria 10892
509 Ga0496105_0047185 3300048908 Bacteria 3554
510 Ga0496105_0100507 3300048908 Bacteria 2388
511 Ga0496105_0125062 3300048908 Bacteria 2120
512 Ga0496106_0033959 3300048909 Bacteria 3808
513 Ga0496106_0175261 3300048909 Bacteria 1701
514 Ga0496106_0196868 3300048909 Bacteria 1603
515 Ga0496106_0283935 3300048909 Bacteria 1326
516 Ga0496107_0027901 3300048910 Bacteria 4010
517 Ga0496107_0099767 3300048910 Bacteria 2128
518 Ga0496107_0168242 3300048910 Bacteria 1626
519 Ga0496108_0048242 3300048911 Bacteria 3560
520 Ga0496108_0184989 3300048911 Bacteria 1804
521 Ga0496108_0228576 3300048911 Bacteria 1617
522 Ga0496108_0337434 3300048911 Bacteria 1315
523 Ga0496108_0545047 3300048911 Bacteria 1012
524 Ga0496109_0132643 3300048912 Bacteria 2326
525 Ga0496109_0152961 3300048912 Bacteria 2160
526 Ga0496109_0245267 3300048912 Bacteria 1686
527 Ga0496109_0290110 3300048912 Bacteria 1542
528 Ga0496110_0058595 3300048913 Bacteria 3392
529 Ga0496110_0071937 3300048913 Bacteria 3068
530 Ga0496110_0200282 3300048913 Bacteria 1814
531 Ga0496110_0220740 3300048913 Bacteria 1724
532 Ga0496110_0309435 3300048913 Bacteria 1439
533 Ga0496111_0069319 3300048914 Bacteria 2564
534 Ga0496111_0092430 3300048914 Bacteria 2218
535 Ga0496111_0182785 3300048914 Bacteria 1559
536 Ga0496111_0374046 3300048914 Bacteria 1054
537 Ga0496112_0020839 3300048915 Bacteria 6221
538 Ga0496112_0057096 3300048915 Bacteria 3843
539 Ga0496112_0063694 3300048915 Bacteria 3637
540 Ga0496112_0096051 3300048915 Bacteria 2934
541 Ga0496112_0106666 3300048915 Bacteria 2771
542 Ga0496112_0549658 3300048915 Bacteria 1088
543 Ga0496112_0584270 3300048915 Bacteria 1049
544 Ga0496113_0044199 3300048916 Bacteria 3299
545 Ga0496113_0073839 3300048916 Bacteria 2599
546 Ga0496113_0074614 3300048916 Bacteria 2586
547 Ga0496113_0079588 3300048916 Bacteria 2509
548 Ga0496113_0147081 3300048916 Bacteria 1857
549 Ga0496113_0157823 3300048916 Bacteria 1792
550 Ga0496113_0469797 3300048916 Bacteria 1011
551 Ga0496114_0020318 3300048917 Bacteria 5389
552 Ga0496114_0303865 3300048917 Bacteria 1409
553 Ga0496115_0013729 3300048918 Bacteria 6133
554 Ga0496115_0043847 3300048918 Bacteria 3567
555 Ga0496115_0111755 3300048918 Bacteria 2245
556 Ga0496115_0156336 3300048918 Bacteria 1884
557 Ga0496115_0161520 3300048918 Bacteria 1851
558 Ga0496115_0261142 3300048918 Bacteria 1424
559 Ga0496115_0490480 3300048918 Bacteria 988
560 Ga0496116_0009705 3300048919 Bacteria 8179
561 Ga0496117_0064911 3300048920 Bacteria 2485
562 Ga0496118_0006064 3300048921 Bacteria 13465
563 Ga0496119_0043726 3300048922 Bacteria 2827
564 Ga0496119_0103052 3300048922 Bacteria 1598
565 Ga0496120_0011600 3300048923 Bacteria 6051
566 Ga0496121_0001157 3300048924 Bacteria 46239
567 Ga0496121_0050969 3300048924 Bacteria 3490
568 Ga0496121_0090761 3300048924 Bacteria 2387
569 Ga0496121_0092561 3300048924 Bacteria 2356
570 Ga0496121_0109820 3300048924 Bacteria 2106
571 Ga0496121_0146381 3300048924 Bacteria 1745
572 Ga0496124_0021056 3300048927 Bacteria 6013
573 Ga0496124_0168541 3300048927 Bacteria 1699
574 Ga0496124_0239553 3300048927 Bacteria 1350
575 Ga0496125_0035390 3300048928 Bacteria 4381
576 Ga0496125_0038850 3300048928 Bacteria 4110
577 Ga0496125_0257020 3300048928 Bacteria 1097
578 Ga0496126_0002588 3300048929 Bacteria 24124
579 Ga0496126_0007487 3300048929 Bacteria 11959
580 Ga0496126_0045817 3300048929 Bacteria 4016
581 Ga0496126_0096446 3300048929 Bacteria 2592
582 Ga0496126_0169312 3300048929 Bacteria 1862
583 Ga0496126_0245953 3300048929 Bacteria 1492
584 Ga0496126_0380569 3300048929 Bacteria 1149
585 Ga0496126_0430081 3300048929 Bacteria 1066
586 Ga0501033_0026010 3300049570 Bacteria 4404
587 Ga0501033_0111598 3300049570 Bacteria 1990
588 Ga0501034_0242093 3300049571 Bacteria 1750
589 Ga0501036_0174359 3300049572 Bacteria 1811
590 Ga0501037_0092548 3300049573 Bacteria 2187
591 Ga0501038_0254420 3300049574 Bacteria 1390
592 Ga0501039_0110699 3300049575 Bacteria 2147
593 Ga0501040_0083694 3300049576 Bacteria 2213
594 Ga0501043_0088222 3300049579 Bacteria 2437
595 Ga0501046_0064839 3300049580 Bacteria 2851
596 Ga0501047_0287716 3300049581 Bacteria 1487
597 Ga0501048_0209357 3300049582 Bacteria 1383
598 Ga0501067_0038236 3300049583 Bacteria 2665
599 Ga0501080_0053502 3300049742 Bacteria 3759
600 Ga0501081_0329751 3300049743 Bacteria 1123
601 Ga0501035_0156715 3300049822 Bacteria 1973
602 Ga0501044_0052312 3300049823 Bacteria 4209
603 Ga0501044_0079171 3300049823 Bacteria 3330
604 nmdc:mga03n38_8874_c1 3300050490 Bacteria 3629
605 nmdc:mga00v17_198947_c1 3300050491 Bacteria 1295
606 nmdc:mga0yw44_34723_c1 3300050492 Bacteria 2957
607 nmdc:mga0yw44_42449_c1 3300050492 Bacteria 2712
608 nmdc:mga06z11_5930_c1 3300050494 Bacteria 4935
609 nmdc:mga0n895_470832_c1 3300050512 Bacteria 1267
610 nmdc:mga0n895_9753_c1 3300050512 Bacteria 8425
611 nmdc:mga0rr50_17170_c1 3300050513 Bacteria 4825
612 nmdc:mga0sz30_33134_c1 3300050516 Bacteria 2146
613 Ga0495601_0012431 3300053077 Bacteria 5108
614 Ga0495612_0039972 3300053078 Bacteria 1909
615 Ga0495612_0096784 3300053078 Bacteria 1254
616 Ga0500635_0001194 3300053080 Bacteria 6219
617 Ga0500635_0001309 3300053080 Bacteria 5949
618 Ga0495595_0006178 3300053084 Bacteria 4871
619 Ga0495619_0022036 3300053085 Bacteria 4072
620 Ga0495619_0126728 3300053085 Bacteria 1753
621 Ga0500644_0017699 3300053088 Bacteria 2074
622 Ga0500647_0006809 3300053091 Bacteria 4865
623 Ga0500647_0135667 3300053091 Bacteria 1158
624 Ga0500566_0000003 3300053094 Bacteria 166820
625 Ga0500566_0001155 3300053094 Bacteria 15356
626 Ga0500566_0039034 3300053094 Bacteria 2746
627 Ga0500640_000579 3300053095 Bacteria 9420
628 Ga0500557_000052 3300053105 Bacteria 50636
629 Ga0500572_003949 3300053111 Bacteria 3368
630 Ga0500595_000395 3300053119 Bacteria 28044
631 Ga0500595_030009 3300053119 Bacteria 1837
632 Ga0500595_055398 3300053119 Bacteria 1215
633 Ga0500597_120508 3300053120 Bacteria 1137
634 Ga0500607_012093 3300053121 Bacteria 5081
635 Ga0500608_003401 3300053122 Bacteria 5958
636 Ga0500608_065863 3300053122 Bacteria 1728
637 Ga0500642_0000306 3300053130 Bacteria 17531
638 Ga0500559_0001626 3300053136 Bacteria 12489
639 Ga0500559_0002366 3300053136 Bacteria 9829
640 Ga0500559_0013274 3300053136 Bacteria 3490
641 Ga0500559_0069255 3300053136 Bacteria 1586
642 Ga0500564_121893 3300053138 Bacteria 1135
643 Ga0500573_0065364 3300053140 Bacteria 2079
644 Ga0500590_117171 3300053148 Bacteria 1254
645 Ga0500590_143927 3300053148 Bacteria 1085
646 Ga0500603_000184 3300053150 Bacteria 16166
647 Ga0500603_002335 3300053150 Bacteria 4169
648 Ga0500616_0028617 3300053153 Bacteria 3070
649 Ga0500627_0013117 3300053158 Bacteria 3129
650 Ga0500630_001089 3300053159 Bacteria 12674
651 Ga0500633_0088403 3300053160 Bacteria 1129
652 Ga0500638_016718 3300053162 Bacteria 3393
653 Ga0500638_061293 3300053162 Bacteria 1807
654 Ga0500639_000033 3300053163 Bacteria 68969
655 Ga0500639_036153 3300053163 Bacteria 2605
656 Ga0500636_0000042 3300053177 Bacteria 69412
657 Ga0500637_0000026 3300053178 Bacteria 59050
658 Ga0500637_0007084 3300053178 Bacteria 5584
659 Ga0500637_0074546 3300053178 Bacteria 1955
660 Ga0500596_001686 3300053735 Bacteria 4475
661 Ga0500599_011708 3300053736 Bacteria 1171
662 Ga0501084_0210855 3300054114 Bacteria 1639
663 Ga0500661_002036 3300055283 Bacteria 3816

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005718 Ga0068866_10087797 Ga0068866_100877971 257
2 3300005441 Ga0070700_100194296 Ga0070700_1001942962 258
3 3300005456 Ga0070678_100060846 Ga0070678_1000608463 258
4 3300005459 Ga0068867_100304920 Ga0068867_1003049202 258
5 3300006881 Ga0068865_100012399 Ga0068865_1000123993 258
6 3300009148 Ga0105243_10028802 Ga0105243_100288022 258
7 3300026075 Ga0207708_10365150 Ga0207708_103651502 258
8 3300028381 Ga0268264_10210291 Ga0268264_102102912 258
9 3300021361 Ga0213872_10036968 Ga0213872_100369683 259
10 3300039447 Ga0436361_0553282 Ga0436361_0553282_2870_3775 259
11 3300005617 Ga0068859_100156041 Ga0068859_1001560412 260
12 3300006931 Ga0097620_100156040 Ga0097620_1001560402 260
13 iso_pu_bacteria 2906610324 2906616324 260
14 3300053122 Ga0500608_065863 Ga0500608_065863_430_1326 262
15 3300053138 Ga0500564_121893 Ga0500564_121893_126_1022 262
16 3300007788 Ga0099795_10064034 Ga0099795_100640341 264
17 3300003203 JGI25406J46586_10000318 JGI25406J46586_1000031817 266
18 3300005985 Ga0081539_10001962 Ga0081539_100019621 266
19 3300014326 Ga0157380_10006347 Ga0157380_100063477 268
20 iso_pu_bacteria 2824696289 2824697125 270
21 iso_pu_bacteria 2894772417 2894773824 270
22 iso_pu_bacteria 8019586578 8019590978 270
23 3300046455 Ga0495603_0052443 Ga0495603_0052443_14_922 273
24 3300046674 Ga0495588_0060051 Ga0495588_0060051_328_1236 273
25 3300053088 Ga0500644_0017699 Ga0500644_0017699_43_930 277
26 3300005329 Ga0070683_100141992 Ga0070683_1001419922 279
27 3300009545 Ga0105237_10115717 Ga0105237_101157172 279
28 3300009551 Ga0105238_10072156 Ga0105238_100721563 279
29 3300049570 Ga0501033_0111598 Ga0501033_0111598_569_1462 279
30 3300048924 Ga0496121_0109820 Ga0496121_0109820_621_1565 280
31 iso_pu_bacteria 2884298095 2884301499 280
32 3300038443 Ga0395901_0600882 Ga0395901_0600882_108_1022 281
33 3300048929 Ga0496126_0169312 Ga0496126_0169312_197_1081 281
34 3300048929 Ga0496126_0430081 Ga0496126_0430081_143_1027 281
35 3300005614 Ga0068856_100004533 Ga0068856_1000045335 283
36 3300010375 Ga0105239_10077996 Ga0105239_100779964 283
37 3300025981 Ga0207640_10069975 Ga0207640_100699752 283
38 3300026078 Ga0207702_10001309 Ga0207702_100013098 283
39 3300044656 Ga0466969_0006735 Ga0466969_0006735_3710_4582 283
40 3300044684 Ga0466966_0020376 Ga0466966_0020376_2334_3206 283
41 3300044693 Ga0466961_0000038 Ga0466961_0000038_67020_67892 283
42 3300053148 Ga0500590_143927 Ga0500590_143927_200_1072 283
43 3300053736 Ga0500599_011708 Ga0500599_011708_286_1158 283
44 3300005539 Ga0068853_100177222 Ga0068853_1001772222 284
45 3300005563 Ga0068855_100052317 Ga0068855_1000523173 284
46 3300005617 Ga0068859_100456494 Ga0068859_1004564942 284
47 3300006931 Ga0097620_100456466 Ga0097620_1004564662 284
48 3300009545 Ga0105237_10144015 Ga0105237_101440152 284
49 3300013105 Ga0157369_10065211 Ga0157369_100652114 284
50 3300013105 Ga0157369_10205229 Ga0157369_102052292 284
51 3300013307 Ga0157372_10354736 Ga0157372_103547362 284
52 3300020082 Ga0206353_10577094 Ga0206353_105770943 284
53 3300021384 Ga0213876_10033823 Ga0213876_100338233 284
54 3300025913 Ga0207695_10049084 Ga0207695_100490844 284
55 3300025944 Ga0207661_10000210 Ga0207661_1000021035 284
56 3300037418 Ga0395900_0017960 Ga0395900_0017960_1136_2023 284
57 3300037466 Ga0395898_0277238 Ga0395898_0277238_307_1194 284
58 3300038443 Ga0395901_0034663 Ga0395901_0034663_3495_4382 284
59 3300039437 Ga0436365_0518465 Ga0436365_0518465_1548_2435 284
60 3300039437 Ga0436365_0962701 Ga0436365_0962701_731_1618 284
61 3300046477 Ga0495664_0013305 Ga0495664_0013305_1543_2430 284
62 3300046543 Ga0495645_0008361 Ga0495645_0008361_1278_2165 284
63 3300046678 Ga0495599_0062448 Ga0495599_0062448_1206_2093 284
64 3300048916 Ga0496113_0469797 Ga0496113_0469797_20_895 284
65 iso_pu_bacteria 2885383462 2885389809 284
66 iso_pu_bacteria 2903768456 2903775916 284
67 iso_pu_bacteria 8056681323 8056684262 284
68 3300005458 Ga0070681_10011285 Ga0070681_100112854 285
69 3300009545 Ga0105237_10293386 Ga0105237_102933862 285
70 3300013105 Ga0157369_10251995 Ga0157369_102519952 285
71 3300025912 Ga0207707_10011453 Ga0207707_100114533 285
72 3300025944 Ga0207661_10013093 Ga0207661_100130932 285
73 iso_pu_bacteria 2513237101 2513693741 285
74 iso_pu_bacteria 2513237137 2513863159 285
75 iso_pu_bacteria 2524023228 2524533672 285
76 iso_pu_bacteria 2667528175 2671123254 285
77 iso_pu_bacteria 2728368998 2728755511 285
78 iso_pu_bacteria 2791355197 2793066487 285
79 iso_pu_bacteria 2885374607 2885378226 285
80 iso_pu_bacteria 2903748898 2903752235 285
81 iso_pu_bacteria 2904690495 2904698956 285
82 iso_pu_bacteria 2904699407 2904701023 285
83 iso_pu_bacteria 2906635258 2906641529 285
84 iso_pu_bacteria 2906660503 2906662893 285
85 iso_pu_bacteria 2908739725 2908741464 285
86 iso_pu_bacteria 2908756301 2908758753 285
87 iso_pu_bacteria 3005474847 3005481477 285
88 iso_pu_bacteria 8006933436 8006939240 285
89 iso_pu_bacteria 8006973647 8006978898 285
90 iso_pu_bacteria 8056689827 8056690604 285
91 3300003320 rootH2_10176532 rootH2_101765322 286
92 3300005327 Ga0070658_10313858 Ga0070658_103138582 286
93 3300005468 Ga0070707_100294789 Ga0070707_1002947892 286
94 3300005471 Ga0070698_100014123 Ga0070698_1000141233 286
95 3300005577 Ga0068857_100100949 Ga0068857_1001009492 286
96 3300006871 Ga0075434_100008890 Ga0075434_1000088904 286
97 3300007076 Ga0075435_100054879 Ga0075435_1000548793 286
98 3300009551 Ga0105238_10081331 Ga0105238_100813312 286
99 3300025918 Ga0207662_10052842 Ga0207662_100528422 286
100 3300025922 Ga0207646_10283086 Ga0207646_102830862 286
101 3300025924 Ga0207694_10080549 Ga0207694_100805492 286
102 3300035113 Ga0373936_0026538 Ga0373936_0026538_1282_2184 286
103 3300037068 Ga0373925_0066047 Ga0373925_0066047_993_1910 286
104 3300050512 nmdc:mga0n895_9753_c1 nmdc:mga0n895_9753_c1_5057_5941 286
105 3300050513 nmdc:mga0rr50_17170_c1 nmdc:mga0rr50_17170_c1_1629_2513 286
106 3300053080 Ga0500635_0001194 Ga0500635_0001194_3446_4348 286
107 3300053091 Ga0500647_0006809 Ga0500647_0006809_2711_3613 286
108 3300053094 Ga0500566_0000003 Ga0500566_0000003_125468_126370 286
109 3300053095 Ga0500640_000579 Ga0500640_000579_802_1704 286
110 3300053111 Ga0500572_003949 Ga0500572_003949_1849_2751 286
111 3300053122 Ga0500608_003401 Ga0500608_003401_4065_4967 286
112 3300053136 Ga0500559_0002366 Ga0500559_0002366_7474_8376 286
113 3300053150 Ga0500603_000184 Ga0500603_000184_4387_5289 286
114 3300053159 Ga0500630_001089 Ga0500630_001089_1963_2865 286
115 3300053162 Ga0500638_061293 Ga0500638_061293_835_1737 286
116 3300053163 Ga0500639_000033 Ga0500639_000033_27735_28637 286
117 3300053178 Ga0500637_0074546 Ga0500637_0074546_205_1107 286
118 3300053735 Ga0500596_001686 Ga0500596_001686_1481_2383 286
119 iso_pu_bacteria 2824600985 2824602355 286
120 iso_pu_bacteria 2824609381 2824610551 286
121 iso_pu_bacteria 2824653114 2824654324 286
122 iso_pu_bacteria 2857509624 2857515913 286
123 iso_pu_bacteria 2888419890 2888424926 286
124 3300005329 Ga0070683_100025031 Ga0070683_1000250312 287
125 3300005338 Ga0068868_100009673 Ga0068868_1000096733 287
126 3300005434 Ga0070709_10001083 Ga0070709_100010839 287
127 3300005435 Ga0070714_100101373 Ga0070714_1001013732 287
128 3300005436 Ga0070713_100182802 Ga0070713_1001828022 287
129 3300005437 Ga0070710_10000726 Ga0070710_1000072612 287
130 3300005439 Ga0070711_100006561 Ga0070711_1000065617 287
131 3300005530 Ga0070679_100035187 Ga0070679_1000351872 287
132 3300005539 Ga0068853_100576684 Ga0068853_1005766841 287
133 3300005618 Ga0068864_100290307 Ga0068864_1002903072 287
134 3300006028 Ga0070717_10081904 Ga0070717_100819042 287
135 3300006173 Ga0070716_100049215 Ga0070716_1000492152 287
136 3300006175 Ga0070712_100002958 Ga0070712_1000029587 287
137 3300010375 Ga0105239_10085098 Ga0105239_100850982 287
138 3300011119 Ga0105246_10042239 Ga0105246_100422392 287
139 3300013308 Ga0157375_10030198 Ga0157375_100301983 287
140 3300014969 Ga0157376_10105608 Ga0157376_101056083 287
141 3300025898 Ga0207692_10000763 Ga0207692_100007635 287
142 3300025906 Ga0207699_10000406 Ga0207699_100004069 287
143 3300025915 Ga0207693_10002846 Ga0207693_100028463 287
144 3300025917 Ga0207660_10072299 Ga0207660_100722992 287
145 3300025928 Ga0207700_10148493 Ga0207700_101484932 287
146 3300025939 Ga0207665_10007378 Ga0207665_100073785 287
147 3300026023 Ga0207677_10010738 Ga0207677_100107384 287
148 3300031616 Ga0307508_10103398 Ga0307508_101033982 287
149 3300035083 Ga0373926_0014548 Ga0373926_0014548_654_1550 287
150 3300035086 Ga0373934_0038811 Ga0373934_0038811_441_1337 287
151 3300035410 Ga0373924_0016752 Ga0373924_0016752_1154_2050 287
152 3300035692 Ga0373935_0081185 Ga0373935_0081185_829_1725 287
153 3300035695 Ga0373927_0043468 Ga0373927_0043468_606_1502 287
154 3300035724 Ga0373933_0074105 Ga0373933_0074105_1066_1962 287
155 3300035725 Ga0373947_0006447 Ga0373947_0006447_3500_4396 287
156 3300046472 Ga0495580_0003657 Ga0495580_0003657_6897_7793 287
157 3300046473 Ga0495582_0027266 Ga0495582_0027266_838_1734 287
158 3300046492 Ga0495585_0011478 Ga0495585_0011478_3408_4310 287
159 3300046514 Ga0495618_0065708 Ga0495618_0065708_878_1774 287
160 3300046531 Ga0495665_0066247 Ga0495665_0066247_451_1347 287
161 3300046559 Ga0495667_0076418 Ga0495667_0076418_1127_2023 287
162 3300046642 Ga0495634_0018688 Ga0495634_0018688_682_1578 287
163 3300046683 Ga0495658_0018566 Ga0495658_0018566_2116_3012 287
164 3300046684 Ga0495669_0112330 Ga0495669_0112330_256_1155 287
165 3300046689 Ga0495613_0123948 Ga0495613_0123948_261_1157 287
166 3300047319 Ga0495674_0008705 Ga0495674_0008705_8017_8913 287
167 3300047321 Ga0495676_0096204 Ga0495676_0096204_279_1175 287
168 3300047321 Ga0495676_0263286 Ga0495676_0263286_282_1160 287
169 3300047471 Ga0495684_0029473 Ga0495684_0029473_2289_3185 287
170 3300048903 Ga0496100_0045007 Ga0496100_0045007_509_1408 287
171 3300048904 Ga0496101_0000648 Ga0496101_0000648_5824_6723 287
172 3300048905 Ga0496102_0005693 Ga0496102_0005693_8401_9300 287
173 3300048907 Ga0496104_0010866 Ga0496104_0010866_2639_3538 287
174 3300048908 Ga0496105_0004124 Ga0496105_0004124_1938_2837 287
175 3300048915 Ga0496112_0549658 Ga0496112_0549658_135_1034 287
176 3300048916 Ga0496113_0074614 Ga0496113_0074614_1253_2152 287
177 3300048918 Ga0496115_0013729 Ga0496115_0013729_2200_3099 287
178 3300048924 Ga0496121_0146381 Ga0496121_0146381_520_1425 287
179 3300053077 Ga0495601_0012431 Ga0495601_0012431_2903_3799 287
180 3300053078 Ga0495612_0039972 Ga0495612_0039972_360_1256 287
181 iso_pu_bacteria 2507262055 2507508222 287
182 iso_pu_bacteria 2508501009 2508542291 287
183 iso_pu_bacteria 2511231028 2511397522 287
184 iso_pu_bacteria 2513237092 2513622351 287
185 iso_pu_bacteria 2513237094 2513640528 287
186 iso_pu_bacteria 2513237102 2513701718 287
187 iso_pu_bacteria 2513237139 2513873136 287
188 iso_pu_bacteria 2517093001 2517102625 287
189 iso_pu_bacteria 2524023205 2524437735 287
190 iso_pu_bacteria 2528768022 2528848704 287
191 iso_pu_bacteria 2617270741 2617375413 287
192 iso_pu_bacteria 2744054633 2745081202 287
193 iso_pu_bacteria 2802429603 2805914965 287
194 iso_pu_bacteria 2824617872 2824618111 287
195 iso_pu_bacteria 2824626560 2824626779 287
196 iso_pu_bacteria 2824635225 2824636586 287
197 iso_pu_bacteria 2824644064 2824645120 287
198 iso_pu_bacteria 2824661429 2824661591 287
199 iso_pu_bacteria 2824679649 2824679864 287
200 iso_pu_bacteria 2824714736 2824715719 287
201 iso_pu_bacteria 2824723954 2824725202 287
202 iso_pu_bacteria 2824732956 2824733426 287
203 iso_pu_bacteria 2824746037 2824746447 287
204 iso_pu_bacteria 2841957949 2841960977 287
205 iso_pu_bacteria 2874612657 2874619377 287
206 iso_pu_bacteria 2874628541 2874632270 287
207 iso_pu_bacteria 2874645413 2874652537 287
208 iso_pu_bacteria 2879083081 2879088073 287
209 iso_pu_bacteria 2879099564 2879108344 287
210 iso_pu_bacteria 2906643746 2906646193 287
211 iso_pu_bacteria 2908775508 2908780529 287
212 iso_pu_bacteria 2922368715 2922374888 287
213 iso_pu_bacteria 2922393267 2922400427 287
214 iso_pu_bacteria 2929615660 2929621932 287
215 iso_pu_bacteria 2929624759 2929629761 287
216 iso_pu_bacteria 2932784394 2932788799 287
217 iso_pu_bacteria 2932794094 2932797996 287
218 iso_pu_bacteria 2932801729 2932807162 287
219 iso_pu_bacteria 2932818245 2932819135 287
220 iso_pu_bacteria 2932828146 2932830465 287
221 iso_pu_bacteria 2933577622 2933583792 287
222 iso_pu_bacteria 2935608549 2935609295 287
223 iso_pu_bacteria 2935616580 2935616759 287
224 iso_pu_bacteria 2935638405 2935641911 287
225 iso_pu_bacteria 2935665750 2935673042 287
226 iso_pu_bacteria 2935675223 2935675847 287
227 iso_pu_bacteria 2935684952 2935685844 287
228 iso_pu_bacteria 2935694250 2935697910 287
229 iso_pu_bacteria 2935703347 2935705684 287
230 iso_pu_bacteria 2935713505 2935714396 287
231 iso_pu_bacteria 2935722832 2935725015 287
232 iso_pu_bacteria 2935732158 2935732626 287
233 iso_pu_bacteria 2935741537 2935742005 287
234 iso_pu_bacteria 2935750917 2935751809 287
235 iso_pu_bacteria 2935760218 2935765066 287
236 iso_pu_bacteria 2935801545 2935802662 287
237 iso_pu_bacteria 2935810662 2935813508 287
238 iso_pu_bacteria 2935819856 2935822455 287
239 iso_pu_bacteria 2935827899 2935830078 287
240 iso_pu_bacteria 2935837841 2935837996 287
241 iso_pu_bacteria 2935847175 2935848038 287
242 iso_pu_bacteria 2935855204 2935855383 287
243 iso_pu_bacteria 2935864058 2935867373 287
244 iso_pu_bacteria 2935873716 2935875808 287
245 iso_pu_bacteria 2935883170 2935886723 287
246 iso_pu_bacteria 2935908558 2935908739 287
247 iso_pu_bacteria 2935916978 2935917884 287
248 iso_pu_bacteria 2935926038 2935926687 287
249 iso_pu_bacteria 2935934488 2935935137 287
250 iso_pu_bacteria 2935942939 2935943587 287
251 iso_pu_bacteria 2935951376 2935952025 287
252 iso_pu_bacteria 2935967501 2935968150 287
253 iso_pu_bacteria 2935975950 2935978766 287
254 iso_pu_bacteria 2935992306 2935996472 287
255 iso_pu_bacteria 2936002035 2936003752 287
256 iso_pu_bacteria 2936037263 2936042457 287
257 iso_pu_bacteria 2940556831 2940557388 287
258 iso_pu_bacteria 2941531003 2941533179 287
259 iso_pu_bacteria 2941538514 2941539338 287
260 iso_pu_bacteria 3005483717 3005484659 287
261 iso_pu_bacteria 3005506211 3005510671 287
262 iso_pu_bacteria 3005587118 3005587690 287
263 iso_pu_bacteria 3005594810 3005599608 287
264 iso_pu_bacteria 3005718088 3005722645 287
265 iso_pu_bacteria 8016511872 8016521828 287
266 iso_pu_bacteria 8017057580 8017063826 287
267 iso_pu_bacteria 8019576017 8019583175 287
268 iso_pu_bacteria 8019597564 8019600367 287
269 iso_pu_bacteria 8019608314 8019618176 287
270 iso_pu_bacteria 8019629233 8019634063 287
271 iso_pu_bacteria 8019638758 8019645666 287
272 iso_pu_bacteria 8019648815 8019658929 287
273 iso_pu_bacteria 8019659431 8019661942 287
274 iso_pu_bacteria 8019687851 8019690461 287
275 iso_pu_bacteria 8055742211 8055745902 287
276 3300005336 Ga0070680_100070194 Ga0070680_1000701942 288
277 3300005436 Ga0070713_100118871 Ga0070713_1001188712 288
278 3300005437 Ga0070710_10039694 Ga0070710_100396941 288
279 3300005439 Ga0070711_100017822 Ga0070711_1000178222 288
280 3300005455 Ga0070663_100080316 Ga0070663_1000803162 288
281 3300005458 Ga0070681_10119263 Ga0070681_101192633 288
282 3300005530 Ga0070679_100066794 Ga0070679_1000667943 288
283 3300005539 Ga0068853_100495582 Ga0068853_1004955821 288
284 3300009551 Ga0105238_10130968 Ga0105238_101309682 288
285 3300009551 Ga0105238_10190362 Ga0105238_101903622 288
286 3300013307 Ga0157372_10247008 Ga0157372_102470082 288
287 3300025904 Ga0207647_10136119 Ga0207647_101361192 288
288 3300025912 Ga0207707_10000173 Ga0207707_1000017363 288
289 3300025916 Ga0207663_10067588 Ga0207663_100675882 288
290 3300025919 Ga0207657_10004866 Ga0207657_100048669 288
291 3300025928 Ga0207700_10016062 Ga0207700_100160622 288
292 3300025949 Ga0207667_10252623 Ga0207667_102526232 288
293 3300031456 Ga0307513_10198080 Ga0307513_101980802 288
294 3300037466 Ga0395898_0206514 Ga0395898_0206514_685_1578 288
295 3300038443 Ga0395901_0033905 Ga0395901_0033905_490_1383 288
296 3300039437 Ga0436365_0935505 Ga0436365_0935505_23681_24589 288
297 3300039437 Ga0436365_1198843 Ga0436365_1198843_137_1036 288
298 3300039453 Ga0436362_1191906 Ga0436362_1191906_547_1455 288
299 3300045976 Ga0466967_0046202 Ga0466967_0046202_2804_3703 288
300 3300045976 Ga0466967_0250626 Ga0466967_0250626_747_1661 288
301 3300045976 Ga0466967_0473230 Ga0466967_0473230_160_1059 288
302 3300048911 Ga0496108_0337434 Ga0496108_0337434_48_953 288
303 3300048912 Ga0496109_0132643 Ga0496109_0132643_312_1217 288
304 3300048913 Ga0496110_0220740 Ga0496110_0220740_307_1212 288
305 3300048915 Ga0496112_0106666 Ga0496112_0106666_965_1870 288
306 3300048929 Ga0496126_0045817 Ga0496126_0045817_771_1670 288
307 3300048929 Ga0496126_0096446 Ga0496126_0096446_568_1467 288
308 3300049570 Ga0501033_0026010 Ga0501033_0026010_1281_2204 288
309 3300049571 Ga0501034_0242093 Ga0501034_0242093_399_1322 288
310 3300049572 Ga0501036_0174359 Ga0501036_0174359_614_1537 288
311 3300049575 Ga0501039_0110699 Ga0501039_0110699_282_1205 288
312 3300049579 Ga0501043_0088222 Ga0501043_0088222_132_1049 288
313 3300049580 Ga0501046_0064839 Ga0501046_0064839_1704_2603 288
314 3300049581 Ga0501047_0287716 Ga0501047_0287716_349_1248 288
315 3300049742 Ga0501080_0053502 Ga0501080_0053502_936_1835 288
316 3300049822 Ga0501035_0156715 Ga0501035_0156715_450_1373 288
317 3300049823 Ga0501044_0052312 Ga0501044_0052312_462_1361 288
318 3300049823 Ga0501044_0079171 Ga0501044_0079171_1465_2388 288
319 iso_pu_bacteria 2508501042 2508691947 288
320 iso_pu_bacteria 2513237095 2513645446 288
321 iso_pu_bacteria 2513237104 2513718394 288
322 iso_pu_bacteria 2816332527 2818239673 288
323 iso_pu_bacteria 2844315083 2844319407 288
324 iso_pu_bacteria 2888378607 2888384476 288
325 iso_pu_bacteria 2888388044 2888393434 288
326 iso_pu_bacteria 2903727486 2903734349 288
327 iso_pu_bacteria 2906602504 2906605593 288
328 iso_pu_bacteria 2935648319 2935650915 288
329 iso_pu_bacteria 2935656913 2935659096 288
330 iso_pu_bacteria 2935769743 2935771681 288
331 iso_pu_bacteria 2935777560 2935778904 288
332 iso_pu_bacteria 2935785616 2935791175 288
333 iso_pu_bacteria 2935793552 2935795496 288
334 iso_pu_bacteria 2935959822 2935960788 288
335 iso_pu_bacteria 2935984226 2935987365 288
336 iso_pu_bacteria 2936011229 2936013511 288
337 iso_pu_bacteria 2936019824 2936022362 288
338 iso_pu_bacteria 2936028420 2936030808 288
339 iso_pu_bacteria 2936046547 2936048621 288
340 iso_pu_bacteria 2936055302 2936058835 288
341 iso_pu_bacteria 3005710791 3005715265 288
342 iso_pu_bacteria 8006926726 8006933114 288
343 iso_pu_bacteria 8016530956 8016534447 288
344 iso_pu_bacteria 8016539877 8016547670 288
345 iso_pu_bacteria 8016566248 8016572789 288
346 iso_pu_bacteria 8016575299 8016576947 288
347 iso_pu_bacteria 8016583857 8016593271 288
348 iso_pu_bacteria 8016595262 8016600616 288
349 iso_pu_bacteria 8016613128 8016614810 288
350 iso_pu_bacteria 8016622563 8016626164 288
351 iso_pu_bacteria 8019530166 8019534209 288
352 iso_pu_bacteria 8019538911 8019545250 288
353 3300003203 JGI25406J46586_10012828 JGI25406J46586_100128283 289
354 3300003659 JGI25404J52841_10008171 JGI25404J52841_100081711 289
355 3300003659 JGI25404J52841_10008986 JGI25404J52841_100089862 289
356 3300003659 JGI25404J52841_10012809 JGI25404J52841_100128092 289
357 3300003659 JGI25404J52841_10015588 JGI25404J52841_100155882 289
358 3300005344 Ga0070661_100046142 Ga0070661_1000461422 289
359 3300005347 Ga0070668_100227548 Ga0070668_1002275481 289
360 3300005347 Ga0070668_100266628 Ga0070668_1002666282 289
361 3300005354 Ga0070675_100421215 Ga0070675_1004212152 289
362 3300005355 Ga0070671_100199647 Ga0070671_1001996472 289
363 3300005355 Ga0070671_100222650 Ga0070671_1002226502 289
364 3300005367 Ga0070667_100178997 Ga0070667_1001789973 289
365 3300005434 Ga0070709_10002717 Ga0070709_100027173 289
366 3300005435 Ga0070714_100015456 Ga0070714_1000154562 289
367 3300005436 Ga0070713_100127150 Ga0070713_1001271502 289
368 3300005436 Ga0070713_100355606 Ga0070713_1003556062 289
369 3300005437 Ga0070710_10056197 Ga0070710_100561973 289
370 3300005439 Ga0070711_100205740 Ga0070711_1002057401 289
371 3300005455 Ga0070663_100012111 Ga0070663_1000121114 289
372 3300005471 Ga0070698_100130074 Ga0070698_1001300742 289
373 3300005547 Ga0070693_100260776 Ga0070693_1002607762 289
374 3300005548 Ga0070665_100020157 Ga0070665_1000201572 289
375 3300005548 Ga0070665_100112936 Ga0070665_1001129362 289
376 3300005563 Ga0068855_100066996 Ga0068855_1000669964 289
377 3300005617 Ga0068859_100166183 Ga0068859_1001661832 289
378 3300005842 Ga0068858_100265715 Ga0068858_1002657151 289
379 3300005843 Ga0068860_100158090 Ga0068860_1001580902 289
380 3300005844 Ga0068862_100477570 Ga0068862_1004775701 289
381 3300005937 Ga0081455_10005931 Ga0081455_100059315 289
382 3300005937 Ga0081455_10007164 Ga0081455_100071642 289
383 3300005937 Ga0081455_10077607 Ga0081455_100776072 289
384 3300005937 Ga0081455_10175135 Ga0081455_101751352 289
385 3300005983 Ga0081540_1005943 Ga0081540_10059435 289
386 3300005983 Ga0081540_1008063 Ga0081540_10080636 289
387 3300005983 Ga0081540_1010718 Ga0081540_10107185 289
388 3300005983 Ga0081540_1026578 Ga0081540_10265782 289
389 3300005983 Ga0081540_1028376 Ga0081540_10283763 289
390 3300005983 Ga0081540_1037129 Ga0081540_10371292 289
391 3300005983 Ga0081540_1042937 Ga0081540_10429372 289
392 3300005983 Ga0081540_1068230 Ga0081540_10682302 289
393 3300005985 Ga0081539_10000199 Ga0081539_10000199139 289
394 3300006028 Ga0070717_10087773 Ga0070717_100877732 289
395 3300006028 Ga0070717_10303401 Ga0070717_103034012 289
396 3300006163 Ga0070715_10007524 Ga0070715_100075242 289
397 3300006173 Ga0070716_100006597 Ga0070716_1000065973 289
398 3300006175 Ga0070712_100259656 Ga0070712_1002596562 289
399 3300006178 Ga0075367_10025647 Ga0075367_100256473 289
400 3300006871 Ga0075434_100259227 Ga0075434_1002592272 289
401 3300006931 Ga0097620_100166187 Ga0097620_1001661873 289
402 3300006942 Ga0099824_1025369 Ga0099824_10253692 289
403 3300006943 Ga0099822_1003531 Ga0099822_10035319 289
404 3300009176 Ga0105242_10246729 Ga0105242_102467292 289
405 3300009177 Ga0105248_10199139 Ga0105248_101991393 289
406 3300009545 Ga0105237_10128323 Ga0105237_101283233 289
407 3300010159 Ga0099796_10068039 Ga0099796_100680391 289
408 3300010375 Ga0105239_10068406 Ga0105239_100684062 289
409 3300013308 Ga0157375_10386730 Ga0157375_103867302 289
410 3300014325 Ga0163163_10016615 Ga0163163_100166157 289
411 3300014325 Ga0163163_10278639 Ga0163163_102786393 289
412 3300014325 Ga0163163_10387578 Ga0163163_103875782 289
413 3300014325 Ga0163163_10525131 Ga0163163_105251311 289
414 3300014326 Ga0157380_10390589 Ga0157380_103905892 289
415 3300017792 Ga0163161_10279004 Ga0163161_102790042 289
416 3300025898 Ga0207692_10000845 Ga0207692_100008452 289
417 3300025898 Ga0207692_10043469 Ga0207692_100434693 289
418 3300025905 Ga0207685_10052499 Ga0207685_100524992 289
419 3300025907 Ga0207645_10076723 Ga0207645_100767233 289
420 3300025915 Ga0207693_10001388 Ga0207693_1000138812 289
421 3300025915 Ga0207693_10043859 Ga0207693_100438593 289
422 3300025916 Ga0207663_10000515 Ga0207663_1000051515 289
423 3300025916 Ga0207663_10027987 Ga0207663_100279872 289
424 3300025919 Ga0207657_10066317 Ga0207657_100663171 289
425 3300025928 Ga0207700_10036858 Ga0207700_100368582 289
426 3300025929 Ga0207664_10103952 Ga0207664_101039522 289
427 3300025929 Ga0207664_10245356 Ga0207664_102453562 289
428 3300025931 Ga0207644_10093767 Ga0207644_100937672 289
429 3300025931 Ga0207644_10173938 Ga0207644_101739382 289
430 3300025934 Ga0207686_10425400 Ga0207686_104254001 289
431 3300025938 Ga0207704_10081926 Ga0207704_100819262 289
432 3300025939 Ga0207665_10000874 Ga0207665_1000087411 289
433 3300025941 Ga0207711_10106198 Ga0207711_101061982 289
434 3300025942 Ga0207689_10423864 Ga0207689_104238642 289
435 3300025949 Ga0207667_10092380 Ga0207667_100923802 289
436 3300025972 Ga0207668_10208694 Ga0207668_102086942 289
437 3300025986 Ga0207658_10128551 Ga0207658_101285513 289
438 3300026067 Ga0207678_10031260 Ga0207678_100312604 289
439 3300026067 Ga0207678_10397758 Ga0207678_103977581 289
440 3300026118 Ga0207675_100352124 Ga0207675_1003521242 289
441 3300026121 Ga0207683_10250652 Ga0207683_102506521 289
442 3300027357 Ga0209589_1000011 Ga0209589_100001126 289
443 3300027361 Ga0209489_100012 Ga0209489_10001226 289
444 3300027363 Ga0209700_100019 Ga0209700_10001926 289
445 3300028379 Ga0268266_10002874 Ga0268266_1000287414 289
446 3300028379 Ga0268266_10013866 Ga0268266_100138663 289
447 3300028379 Ga0268266_10072145 Ga0268266_100721453 289
448 3300028786 Ga0307517_10000279 Ga0307517_1000027938 289
449 3300031238 Ga0265332_10056874 Ga0265332_100568742 289
450 3300031507 Ga0307509_10019751 Ga0307509_100197514 289
451 3300031616 Ga0307508_10028758 Ga0307508_100287582 289
452 3300031730 Ga0307516_10014449 Ga0307516_100144496 289
453 3300031730 Ga0307516_10116424 Ga0307516_101164242 289
454 3300033180 Ga0307510_10048801 Ga0307510_100488014 289
455 3300033180 Ga0307510_10189248 Ga0307510_101892482 289
456 3300033442 Ga0315911_1000003 Ga0315911_1000003432 289
457 3300035085 Ga0373929_0010713 Ga0373929_0010713_576_1481 289
458 3300035112 Ga0373932_0010230 Ga0373932_0010230_692_1597 289
459 3300035170 Ga0373943_0108685 Ga0373943_0108685_524_1432 289
460 3300035241 Ga0373961_0016775 Ga0373961_0016775_918_1823 289
461 3300035691 Ga0373931_0015025 Ga0373931_0015025_1006_1911 289
462 3300035695 Ga0373927_0029888 Ga0373927_0029888_1531_2439 289
463 3300035695 Ga0373927_0038537 Ga0373927_0038537_1224_2129 289
464 3300035695 Ga0373927_0074918 Ga0373927_0074918_520_1425 289
465 3300037068 Ga0373925_0098681 Ga0373925_0098681_1114_2022 289
466 3300037471 Ga0395905_0092992 Ga0395905_0092992_55_963 289
467 3300039438 Ga0436360_0216274 Ga0436360_0216274_459_1343 289
468 3300041459 Ga0451800_0677031 Ga0451800_0677031_133_1041 289
469 3300046455 Ga0495603_0002054 Ga0495603_0002054_1390_2298 289
470 3300046457 Ga0495590_0079111 Ga0495590_0079111_133_1041 289
471 3300046462 Ga0495651_0102828 Ga0495651_0102828_455_1357 289
472 3300046473 Ga0495582_0148154 Ga0495582_0148154_318_1226 289
473 3300046512 Ga0495610_0095158 Ga0495610_0095158_450_1319 289
474 3300046519 Ga0495632_0081478 Ga0495632_0081478_526_1428 289
475 3300046557 Ga0495622_0017465 Ga0495622_0017465_1812_2720 289
476 3300046616 Ga0495668_0205347 Ga0495668_0205347_125_1033 289
477 3300046691 Ga0495670_0053234 Ga0495670_0053234_955_1863 289
478 3300047323 Ga0495683_0022488 Ga0495683_0022488_1311_2219 289
479 3300047469 Ga0495673_0052908 Ga0495673_0052908_584_1492 289
480 3300048904 Ga0496101_0034163 Ga0496101_0034163_1458_2363 289
481 3300048904 Ga0496101_0222232 Ga0496101_0222232_133_1041 289
482 3300048907 Ga0496104_0399124 Ga0496104_0399124_280_1185 289
483 3300048908 Ga0496105_0100507 Ga0496105_0100507_181_1086 289
484 3300048909 Ga0496106_0175261 Ga0496106_0175261_281_1189 289
485 3300048909 Ga0496106_0283935 Ga0496106_0283935_383_1291 289
486 3300048910 Ga0496107_0027901 Ga0496107_0027901_2449_3354 289
487 3300048911 Ga0496108_0048242 Ga0496108_0048242_793_1698 289
488 3300048911 Ga0496108_0545047 Ga0496108_0545047_85_990 289
489 3300048912 Ga0496109_0152961 Ga0496109_0152961_796_1701 289
490 3300048912 Ga0496109_0290110 Ga0496109_0290110_105_1013 289
491 3300048913 Ga0496110_0071937 Ga0496110_0071937_1014_1919 289
492 3300048913 Ga0496110_0200282 Ga0496110_0200282_528_1436 289
493 3300048914 Ga0496111_0069319 Ga0496111_0069319_1174_2079 289
494 3300048915 Ga0496112_0057096 Ga0496112_0057096_1176_2084 289
495 3300048915 Ga0496112_0063694 Ga0496112_0063694_1014_1919 289
496 3300048916 Ga0496113_0044199 Ga0496113_0044199_249_1154 289
497 3300048917 Ga0496114_0020318 Ga0496114_0020318_3327_4232 289
498 3300048917 Ga0496114_0303865 Ga0496114_0303865_101_1006 289
499 3300048918 Ga0496115_0111755 Ga0496115_0111755_674_1582 289
500 3300048918 Ga0496115_0161520 Ga0496115_0161520_895_1800 289
501 3300048918 Ga0496115_0490480 Ga0496115_0490480_39_947 289
502 3300048927 Ga0496124_0239553 Ga0496124_0239553_91_999 289
503 3300049573 Ga0501037_0092548 Ga0501037_0092548_402_1310 289
504 3300049574 Ga0501038_0254420 Ga0501038_0254420_178_1086 289
505 3300049582 Ga0501048_0209357 Ga0501048_0209357_78_986 289
506 3300049583 Ga0501067_0038236 Ga0501067_0038236_573_1475 289
507 3300049743 Ga0501081_0329751 Ga0501081_0329751_70_978 289
508 3300050490 nmdc:mga03n38_8874_c1 nmdc:mga03n38_8874_c1_1827_2735 289
509 3300050491 nmdc:mga00v17_198947_c1 nmdc:mga00v17_198947_c1_41_949 289
510 3300050494 nmdc:mga06z11_5930_c1 nmdc:mga06z11_5930_c1_2173_3081 289
511 3300050512 nmdc:mga0n895_470832_c1 nmdc:mga0n895_470832_c1_189_1091 289
512 3300053078 Ga0495612_0096784 Ga0495612_0096784_298_1203 289
513 3300053094 Ga0500566_0039034 Ga0500566_0039034_1577_2485 289
514 3300053119 Ga0500595_000395 Ga0500595_000395_6608_7516 289
515 3300053136 Ga0500559_0001626 Ga0500559_0001626_7433_8323 289
516 3300053162 Ga0500638_016718 Ga0500638_016718_1177_2085 289
517 3300053163 Ga0500639_036153 Ga0500639_036153_714_1604 289
518 3300053178 Ga0500637_0000026 Ga0500637_0000026_17410_18318 289
519 3300054114 Ga0501084_0210855 Ga0501084_0210855_652_1560 289
520 3300055283 Ga0500661_002036 Ga0500661_002036_700_1608 289
521 iso_pu_bacteria 2517572143 2517891144 289
522 3300005327 Ga0070658_10222921 Ga0070658_102229212 290
523 3300005336 Ga0070680_100053378 Ga0070680_1000533782 290
524 3300005339 Ga0070660_100152696 Ga0070660_1001526962 290
525 3300005344 Ga0070661_100051701 Ga0070661_1000517013 290
526 3300005366 Ga0070659_100062805 Ga0070659_1000628052 290
527 3300005535 Ga0070684_100364289 Ga0070684_1003642891 290
528 3300005539 Ga0068853_100089035 Ga0068853_1000890352 290
529 3300005577 Ga0068857_100084315 Ga0068857_1000843153 290
530 3300005616 Ga0068852_100010249 Ga0068852_1000102494 290
531 3300007265 Ga0099794_10037901 Ga0099794_100379012 290
532 3300009093 Ga0105240_10165300 Ga0105240_101653002 290
533 3300009545 Ga0105237_10021235 Ga0105237_100212352 290
534 3300009551 Ga0105238_10425174 Ga0105238_104251742 290
535 3300010159 Ga0099796_10053280 Ga0099796_100532802 290
536 3300010375 Ga0105239_10070205 Ga0105239_100702054 290
537 3300013105 Ga0157369_10002009 Ga0157369_1000200916 290
538 3300013105 Ga0157369_10312654 Ga0157369_103126542 290
539 3300025302 Ga0207426_1021892 Ga0207426_10218922 290
540 3300025909 Ga0207705_10302729 Ga0207705_103027292 290
541 3300025912 Ga0207707_10043008 Ga0207707_100430082 290
542 3300025913 Ga0207695_10033658 Ga0207695_100336583 290
543 3300025914 Ga0207671_10054532 Ga0207671_100545323 290
544 3300025917 Ga0207660_10047666 Ga0207660_100476663 290
545 3300025921 Ga0207652_10034398 Ga0207652_100343984 290
546 3300025932 Ga0207690_10086011 Ga0207690_100860113 290
547 3300026116 Ga0207674_10042222 Ga0207674_100422224 290
548 3300026142 Ga0207698_10220911 Ga0207698_102209112 290
549 3300027512 Ga0209179_1016803 Ga0209179_10168032 290
550 3300027671 Ga0209588_1016287 Ga0209588_10162872 290
551 3300028573 Ga0265334_10009956 Ga0265334_100099562 290
552 3300031238 Ga0265332_10011140 Ga0265332_100111403 290
553 3300031241 Ga0265325_10010622 Ga0265325_100106224 290
554 3300031247 Ga0265340_10001234 Ga0265340_1000123411 290
555 3300031249 Ga0265339_10010858 Ga0265339_100108582 290
556 3300031249 Ga0265339_10129202 Ga0265339_101292022 290
557 3300031344 Ga0265316_10052801 Ga0265316_100528012 290
558 3300035086 Ga0373934_0070487 Ga0373934_0070487_158_1072 290
559 3300035118 Ga0373954_0010944 Ga0373954_0010944_1308_2219 290
560 3300035119 Ga0373956_0009384 Ga0373956_0009384_503_1414 290
561 3300035120 Ga0373957_0000546 Ga0373957_0000546_1352_2263 290
562 3300035242 Ga0373962_0023916 Ga0373962_0023916_247_1158 290
563 3300035691 Ga0373931_0022903 Ga0373931_0022903_1024_1935 290
564 3300035691 Ga0373931_0105874 Ga0373931_0105874_176_1087 290
565 3300036401 Ga0373937_0057708 Ga0373937_0057708_980_1891 290
566 3300037471 Ga0395905_0307449 Ga0395905_0307449_344_1255 290
567 3300046463 Ga0495653_0007949 Ga0495653_0007949_7755_8666 290
568 3300046473 Ga0495582_0259560 Ga0495582_0259560_62_973 290
569 3300046511 Ga0495608_0003691 Ga0495608_0003691_2302_3213 290
570 3300046536 Ga0495587_0159396 Ga0495587_0159396_46_957 290
571 3300046543 Ga0495645_0095822 Ga0495645_0095822_610_1521 290
572 3300046559 Ga0495667_0067757 Ga0495667_0067757_114_1025 290
573 3300046663 Ga0495635_0005522 Ga0495635_0005522_7864_8775 290
574 3300046675 Ga0495657_0005377 Ga0495657_0005377_980_1891 290
575 3300046678 Ga0495599_0004042 Ga0495599_0004042_145_1056 290
576 3300046680 Ga0495646_0061456 Ga0495646_0061456_19_930 290
577 3300046809 Ga0495600_0066753 Ga0495600_0066753_133_1044 290
578 3300047322 Ga0495680_0012021 Ga0495680_0012021_4733_5644 290
579 3300047673 Ga0495593_0021422 Ga0495593_0021422_1870_2781 290
580 3300048088 Ga0495602_0339244 Ga0495602_0339244_44_955 290
581 3300048911 Ga0496108_0184989 Ga0496108_0184989_656_1567 290
582 3300048913 Ga0496110_0309435 Ga0496110_0309435_74_988 290
583 3300048914 Ga0496111_0092430 Ga0496111_0092430_13_927 290
584 3300048915 Ga0496112_0020839 Ga0496112_0020839_4331_5242 290
585 3300048916 Ga0496113_0079588 Ga0496113_0079588_1125_2036 290
586 3300048918 Ga0496115_0156336 Ga0496115_0156336_761_1672 290
587 3300048918 Ga0496115_0261142 Ga0496115_0261142_484_1395 290
588 3300049576 Ga0501040_0083694 Ga0501040_0083694_574_1509 290
589 3300053084 Ga0495595_0006178 Ga0495595_0006178_1980_2891 290
590 3300053085 Ga0495619_0022036 Ga0495619_0022036_2834_3745 290
591 3300003215 JGI25153J46596_10006245 JGI25153J46596_100062454 291
592 3300003354 JGI25160J50197_1007770 JGI25160J50197_10077703 291
593 3300003354 JGI25160J50197_1008566 JGI25160J50197_10085662 291
594 3300003794 Ga0055531_10004023 Ga0055531_100040239 291
595 3300005262 Ga0065165_1002156 Ga0065165_100215610 291
596 3300005436 Ga0070713_100184286 Ga0070713_1001842862 291
597 3300005563 Ga0068855_100526638 Ga0068855_1005266382 291
598 3300005564 Ga0070664_100254621 Ga0070664_1002546212 291
599 3300005616 Ga0068852_100006500 Ga0068852_1000065005 291
600 3300005719 Ga0068861_100479711 Ga0068861_1004797112 291
601 3300005983 Ga0081540_1047534 Ga0081540_10475342 291
602 3300006028 Ga0070717_10022714 Ga0070717_100227144 291
603 3300006038 Ga0075365_10008592 Ga0075365_100085923 291
604 3300006186 Ga0075369_10090876 Ga0075369_100908762 291
605 3300009148 Ga0105243_10487270 Ga0105243_104872702 291
606 3300009174 Ga0105241_10061117 Ga0105241_100611172 291
607 3300009545 Ga0105237_10003966 Ga0105237_1000396618 291
608 3300009551 Ga0105238_10290035 Ga0105238_102900352 291
609 3300014968 Ga0157379_10501051 Ga0157379_105010512 291
610 3300021320 Ga0214544_1000002 Ga0214544_100000291 291
611 3300021321 Ga0214542_1000001 Ga0214542_1000001441 291
612 3300021324 Ga0214545_1000001 Ga0214545_1000001507 291
613 3300021327 Ga0214543_1000001 Ga0214543_1000001689 291
614 3300025245 Ga0207425_1003455 Ga0207425_10034553 291
615 3300025254 Ga0209148_1000500 Ga0209148_100050027 291
616 3300025272 Ga0209455_1004034 Ga0209455_10040343 291
617 3300025297 Ga0209758_1000024 Ga0209758_100002485 291
618 3300025297 Ga0209758_1000068 Ga0209758_100006844 291
619 3300025297 Ga0209758_1002409 Ga0209758_100240916 291
620 3300025297 Ga0209758_1011950 Ga0209758_10119504 291
621 3300025302 Ga0207426_1000238 Ga0207426_100023826 291
622 3300025302 Ga0207426_1002351 Ga0207426_10023515 291
623 3300025302 Ga0207426_1006588 Ga0207426_10065881 291
624 3300025304 Ga0209257_1001699 Ga0209257_100169917 291
625 3300025901 Ga0207688_10063418 Ga0207688_100634182 291
626 3300025911 Ga0207654_10021290 Ga0207654_100212903 291
627 3300025913 Ga0207695_10000008 Ga0207695_10000008159 291
628 3300025914 Ga0207671_10011165 Ga0207671_100111654 291
629 3300025924 Ga0207694_10234485 Ga0207694_102344852 291
630 3300025928 Ga0207700_10101425 Ga0207700_101014252 291
631 3300025939 Ga0207665_10100714 Ga0207665_101007144 291
632 3300025942 Ga0207689_10346793 Ga0207689_103467931 291
633 3300026067 Ga0207678_10218993 Ga0207678_102189932 291
634 3300026078 Ga0207702_10165413 Ga0207702_101654132 291
635 3300027296 Ga0209389_1000107 Ga0209389_100010758 291
636 3300027296 Ga0209389_1002563 Ga0209389_10025638 291
637 3300027357 Ga0209589_1000036 Ga0209589_1000036124 291
638 3300027361 Ga0209489_100006 Ga0209489_100006452 291
639 3300027361 Ga0209489_115889 Ga0209489_1158892 291
640 3300027361 Ga0209489_115890 Ga0209489_1158902 291
641 3300027363 Ga0209700_100005 Ga0209700_100005321 291
642 3300031616 Ga0307508_10135265 Ga0307508_101352651 291
643 3300031711 Ga0265314_10000412 Ga0265314_100004124 291
644 3300031712 Ga0265342_10042929 Ga0265342_100429292 291
645 3300035117 Ga0373953_0095057 Ga0373953_0095057_166_1062 291
646 3300037418 Ga0395900_0311269 Ga0395900_0311269_271_1167 291
647 3300037471 Ga0395905_0002364 Ga0395905_0002364_15753_16649 291
648 3300044658 Ga0466972_0000122 Ga0466972_0000122_6941_7837 291
649 3300044901 Ga0466960_0105830 Ga0466960_0105830_397_1293 291
650 3300046454 Ga0495592_0060328 Ga0495592_0060328_1330_2226 291
651 3300046459 Ga0495629_0003217 Ga0495629_0003217_179_1075 291
652 3300046462 Ga0495651_0006245 Ga0495651_0006245_1720_2616 291
653 3300046462 Ga0495651_0078004 Ga0495651_0078004_916_1812 291
654 3300046475 Ga0495639_0018700 Ga0495639_0018700_532_1428 291
655 3300046477 Ga0495664_0003617 Ga0495664_0003617_825_1721 291
656 3300046507 Ga0495606_0132161 Ga0495606_0132161_403_1299 291
657 3300046507 Ga0495606_0189479 Ga0495606_0189479_85_999 291
658 3300046511 Ga0495608_0043300 Ga0495608_0043300_404_1300 291
659 3300046514 Ga0495618_0204913 Ga0495618_0204913_142_1038 291
660 3300046516 Ga0495628_0009637 Ga0495628_0009637_1056_1952 291
661 3300046516 Ga0495628_0225701 Ga0495628_0225701_414_1310 291
662 3300046524 Ga0495648_0088224 Ga0495648_0088224_150_1046 291
663 3300046524 Ga0495648_0114945 Ga0495648_0114945_177_1073 291
664 3300046529 Ga0495652_0013965 Ga0495652_0013965_4842_5738 291
665 3300046533 Ga0495640_0017440 Ga0495640_0017440_4114_5010 291
666 3300046533 Ga0495640_0086095 Ga0495640_0086095_601_1497 291
667 3300046559 Ga0495667_0025996 Ga0495667_0025996_28_924 291
668 3300046642 Ga0495634_0213848 Ga0495634_0213848_72_968 291
669 3300046663 Ga0495635_0003851 Ga0495635_0003851_8337_9233 291
670 3300046663 Ga0495635_0039940 Ga0495635_0039940_918_1814 291
671 3300046674 Ga0495588_0103314 Ga0495588_0103314_428_1324 291
672 3300046675 Ga0495657_0004230 Ga0495657_0004230_6166_7062 291
673 3300046679 Ga0495623_0006266 Ga0495623_0006266_5266_6162 291
674 3300046680 Ga0495646_0135513 Ga0495646_0135513_104_1000 291
675 3300046683 Ga0495658_0078802 Ga0495658_0078802_301_1197 291
676 3300046689 Ga0495613_0019527 Ga0495613_0019527_2967_3863 291
677 3300046689 Ga0495613_0181305 Ga0495613_0181305_447_1343 291
678 3300046690 Ga0495624_0007215 Ga0495624_0007215_4023_4919 291
679 3300046692 Ga0495671_0124382 Ga0495671_0124382_295_1191 291
680 3300046694 Ga0495649_0098431 Ga0495649_0098431_102_998 291
681 3300046809 Ga0495600_0003420 Ga0495600_0003420_4098_4994 291
682 3300046809 Ga0495600_0032711 Ga0495600_0032711_729_1625 291
683 3300047315 Ga0495581_0056549 Ga0495581_0056549_808_1704 291
684 3300047317 Ga0495604_0005841 Ga0495604_0005841_2131_3027 291
685 3300047319 Ga0495674_0081652 Ga0495674_0081652_1862_2758 291
686 3300047321 Ga0495676_0167162 Ga0495676_0167162_168_1064 291
687 3300047321 Ga0495676_0372270 Ga0495676_0372270_33_929 291
688 3300047322 Ga0495680_0001849 Ga0495680_0001849_20191_21087 291
689 3300048088 Ga0495602_0010034 Ga0495602_0010034_2205_3101 291
690 3300048903 Ga0496100_0348526 Ga0496100_0348526_10_906 291
691 3300048905 Ga0496102_0299397 Ga0496102_0299397_195_1091 291
692 3300048906 Ga0496103_0105235 Ga0496103_0105235_27_923 291
693 3300048907 Ga0496104_0003846 Ga0496104_0003846_8419_9315 291
694 3300048907 Ga0496104_0185510 Ga0496104_0185510_698_1594 291
695 3300048908 Ga0496105_0047185 Ga0496105_0047185_1083_1979 291
696 3300048909 Ga0496106_0196868 Ga0496106_0196868_220_1116 291
697 3300048910 Ga0496107_0099767 Ga0496107_0099767_759_1655 291
698 3300048914 Ga0496111_0182785 Ga0496111_0182785_486_1382 291
699 3300048916 Ga0496113_0147081 Ga0496113_0147081_872_1768 291
700 3300048916 Ga0496113_0157823 Ga0496113_0157823_303_1199 291
701 3300048918 Ga0496115_0043847 Ga0496115_0043847_1557_2453 291
702 3300048919 Ga0496116_0009705 Ga0496116_0009705_1749_2645 291
703 3300048922 Ga0496119_0043726 Ga0496119_0043726_585_1481 291
704 3300048923 Ga0496120_0011600 Ga0496120_0011600_4153_5049 291
705 3300048924 Ga0496121_0090761 Ga0496121_0090761_802_1698 291
706 3300048924 Ga0496121_0092561 Ga0496121_0092561_867_1763 291
707 3300048928 Ga0496125_0038850 Ga0496125_0038850_3000_3896 291
708 3300048929 Ga0496126_0002588 Ga0496126_0002588_9807_10712 291
709 3300048929 Ga0496126_0007487 Ga0496126_0007487_8259_9155 291
710 3300048929 Ga0496126_0245953 Ga0496126_0245953_18_914 291
711 3300050492 nmdc:mga0yw44_42449_c1 nmdc:mga0yw44_42449_c1_529_1425 291
712 3300053085 Ga0495619_0126728 Ga0495619_0126728_573_1469 291
713 3300053091 Ga0500647_0135667 Ga0500647_0135667_121_1017 291
714 3300053094 Ga0500566_0001155 Ga0500566_0001155_1888_2784 291
715 3300053105 Ga0500557_000052 Ga0500557_000052_27395_28291 291
716 3300053119 Ga0500595_030009 Ga0500595_030009_647_1543 291
717 3300053121 Ga0500607_012093 Ga0500607_012093_3559_4455 291
718 3300053136 Ga0500559_0013274 Ga0500559_0013274_1884_2780 291
719 3300053136 Ga0500559_0069255 Ga0500559_0069255_588_1484 291
720 3300053153 Ga0500616_0028617 Ga0500616_0028617_1621_2517 291
721 3300053158 Ga0500627_0013117 Ga0500627_0013117_168_1064 291
722 3300053160 Ga0500633_0088403 Ga0500633_0088403_193_1089 291
723 3300053177 Ga0500636_0000042 Ga0500636_0000042_57694_58590 291
724 3300004625 Ga0055543_1002866 Ga0055543_10028664 292
725 3300005262 Ga0065165_1002034 Ga0065165_100203411 292
726 3300005327 Ga0070658_10224446 Ga0070658_102244461 292
727 3300005344 Ga0070661_100104658 Ga0070661_1001046582 292
728 3300005347 Ga0070668_100365894 Ga0070668_1003658941 292
729 3300005367 Ga0070667_100029892 Ga0070667_1000298923 292
730 3300005455 Ga0070663_100163169 Ga0070663_1001631692 292
731 3300005563 Ga0068855_100348543 Ga0068855_1003485432 292
732 3300005616 Ga0068852_100063394 Ga0068852_1000633942 292
733 3300005617 Ga0068859_100572864 Ga0068859_1005728642 292
734 3300005843 Ga0068860_100000213 Ga0068860_10000021347 292
735 3300006042 Ga0075368_10020037 Ga0075368_100200373 292
736 3300006048 Ga0075363_100035848 Ga0075363_1000358482 292
737 3300006177 Ga0075362_10029433 Ga0075362_100294332 292
738 3300006178 Ga0075367_10060008 Ga0075367_100600082 292
739 3300006353 Ga0075370_10040554 Ga0075370_100405542 292
740 3300006931 Ga0097620_100572955 Ga0097620_1005729552 292
741 3300009174 Ga0105241_10136918 Ga0105241_101369182 292
742 3300009177 Ga0105248_10324368 Ga0105248_103243682 292
743 3300009545 Ga0105237_10037340 Ga0105237_100373404 292
744 3300010375 Ga0105239_10410850 Ga0105239_104108501 292
745 3300011119 Ga0105246_10078068 Ga0105246_100780682 292
746 3300013308 Ga0157375_10404464 Ga0157375_104044642 292
747 3300014325 Ga0163163_10056064 Ga0163163_100560644 292
748 3300014968 Ga0157379_10308055 Ga0157379_103080552 292
749 3300021441 Ga0213871_10045965 Ga0213871_100459651 292
750 3300025261 Ga0209233_1018269 Ga0209233_10182692 292
751 3300025261 Ga0209233_1027990 Ga0209233_10279902 292
752 3300025297 Ga0209758_1051180 Ga0209758_10511802 292
753 3300025299 Ga0209256_1027020 Ga0209256_10270201 292
754 3300025304 Ga0209257_1010441 Ga0209257_10104414 292
755 3300025904 Ga0207647_10006516 Ga0207647_100065163 292
756 3300025909 Ga0207705_10234754 Ga0207705_102347542 292
757 3300025914 Ga0207671_10006585 Ga0207671_100065858 292
758 3300025923 Ga0207681_10246603 Ga0207681_102466032 292
759 3300025941 Ga0207711_10070516 Ga0207711_100705162 292
760 3300025986 Ga0207658_10231279 Ga0207658_102312792 292
761 3300026035 Ga0207703_10100425 Ga0207703_101004252 292
762 3300026041 Ga0207639_10158993 Ga0207639_101589932 292
763 3300026067 Ga0207678_10177926 Ga0207678_101779262 292
764 3300026078 Ga0207702_10710223 Ga0207702_107102231 292
765 3300026088 Ga0207641_10297308 Ga0207641_102973082 292
766 3300026095 Ga0207676_10505132 Ga0207676_105051322 292
767 3300028381 Ga0268264_10000065 Ga0268264_10000065184 292
768 3300031507 Ga0307509_10105981 Ga0307509_101059813 292
769 3300031730 Ga0307516_10017791 Ga0307516_100177914 292
770 3300033180 Ga0307510_10063240 Ga0307510_100632403 292
771 3300033180 Ga0307510_10096666 Ga0307510_100966662 292
772 3300035692 Ga0373935_0121240 Ga0373935_0121240_577_1479 292
773 3300037068 Ga0373925_0032350 Ga0373925_0032350_2188_3090 292
774 3300037418 Ga0395900_0001586 Ga0395900_0001586_4908_5807 292
775 3300037466 Ga0395898_0045960 Ga0395898_0045960_3175_4074 292
776 3300037471 Ga0395905_0094419 Ga0395905_0094419_492_1391 292
777 3300039447 Ga0436361_0327683 Ga0436361_0327683_664_1584 292
778 3300039453 Ga0436362_0058908 Ga0436362_0058908_512_1405 292
779 3300044658 Ga0466972_0039062 Ga0466972_0039062_1112_2011 292
780 3300044735 Ga0466968_0021463 Ga0466968_0021463_1165_2064 292
781 3300045976 Ga0466967_0084499 Ga0466967_0084499_643_1536 292
782 3300046455 Ga0495603_0076851 Ga0495603_0076851_959_1870 292
783 3300046512 Ga0495610_0093164 Ga0495610_0093164_274_1173 292
784 3300046513 Ga0495616_0062781 Ga0495616_0062781_310_1209 292
785 3300046522 Ga0495643_0017469 Ga0495643_0017469_2717_3616 292
786 3300046542 Ga0495597_0038281 Ga0495597_0038281_40_939 292
787 3300046616 Ga0495668_0074265 Ga0495668_0074265_518_1417 292
788 3300047323 Ga0495683_0066552 Ga0495683_0066552_225_1124 292
789 3300047443 Ga0495687_034841 Ga0495687_034841_1092_1991 292
790 3300048906 Ga0496103_0020553 Ga0496103_0020553_445_1344 292
791 3300048906 Ga0496103_0150001 Ga0496103_0150001_369_1271 292
792 3300048907 Ga0496104_0184953 Ga0496104_0184953_32_931 292
793 3300048908 Ga0496105_0125062 Ga0496105_0125062_847_1746 292
794 3300048909 Ga0496106_0033959 Ga0496106_0033959_1396_2298 292
795 3300048910 Ga0496107_0168242 Ga0496107_0168242_697_1599 292
796 3300048911 Ga0496108_0228576 Ga0496108_0228576_217_1116 292
797 3300048912 Ga0496109_0245267 Ga0496109_0245267_321_1220 292
798 3300048913 Ga0496110_0058595 Ga0496110_0058595_416_1315 292
799 3300048914 Ga0496111_0374046 Ga0496111_0374046_23_922 292
800 3300048915 Ga0496112_0096051 Ga0496112_0096051_1013_1912 292
801 3300048915 Ga0496112_0584270 Ga0496112_0584270_128_1027 292
802 3300048916 Ga0496113_0073839 Ga0496113_0073839_410_1309 292
803 3300048920 Ga0496117_0064911 Ga0496117_0064911_790_1692 292
804 3300048921 Ga0496118_0006064 Ga0496118_0006064_2071_2973 292
805 3300048922 Ga0496119_0103052 Ga0496119_0103052_94_993 292
806 3300048924 Ga0496121_0001157 Ga0496121_0001157_30769_31671 292
807 3300048924 Ga0496121_0050969 Ga0496121_0050969_1138_2037 292
808 3300048927 Ga0496124_0021056 Ga0496124_0021056_1457_2359 292
809 3300048927 Ga0496124_0168541 Ga0496124_0168541_783_1682 292
810 3300048928 Ga0496125_0035390 Ga0496125_0035390_397_1299 292
811 3300048928 Ga0496125_0257020 Ga0496125_0257020_144_1043 292
812 3300048929 Ga0496126_0380569 Ga0496126_0380569_42_941 292
813 3300050492 nmdc:mga0yw44_34723_c1 nmdc:mga0yw44_34723_c1_1986_2885 292
814 3300050516 nmdc:mga0sz30_33134_c1 nmdc:mga0sz30_33134_c1_955_1854 292
815 3300053080 Ga0500635_0001309 Ga0500635_0001309_725_1636 292
816 3300053119 Ga0500595_055398 Ga0500595_055398_121_1032 292
817 3300053120 Ga0500597_120508 Ga0500597_120508_147_1058 292
818 3300053130 Ga0500642_0000306 Ga0500642_0000306_1894_2793 292
819 3300053140 Ga0500573_0065364 Ga0500573_0065364_707_1609 292
820 3300053148 Ga0500590_117171 Ga0500590_117171_58_960 292
821 3300053150 Ga0500603_002335 Ga0500603_002335_2228_3139 292
822 3300053178 Ga0500637_0007084 Ga0500637_0007084_1063_1974 292
823 3300003203 JGI25406J46586_10000019 JGI25406J46586_1000001922 298
824 3300005985 Ga0081539_10000003 Ga0081539_10000003191 298

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o34-assembly2.cif.gz_B crystal structure of protein dvu1097 from desulfovibrio vulgaris hildenborough, pfam duf375 0.7356 9 279
2o34-assembly1.cif.gz_A crystal structure of protein dvu1097 from desulfovibrio vulgaris hildenborough, pfam duf375 0.7279 5 279
2o34-assembly2.cif.gz_B crystal structure of protein dvu1097 from desulfovibrio vulgaris hildenborough, pfam duf375 0.7131 9 279
2o34-assembly1.cif.gz_A crystal structure of protein dvu1097 from desulfovibrio vulgaris hildenborough, pfam duf375 0.701 5 279
8b9n-assembly2.cif.gz_C crystal structure of nei domain of mouse neil3 trapped in covalent complex with ssdna with abasic site 0.6671 7 33
ID Description Score Start End Superfamily
af_Q58921_1_229_3.10.520.10 Alpha Beta;Roll;T-fold;ApbE-like domains 0.7681 15 280 3.10.520.10
af_Q58921_1_229_3.10.520.10 Alpha Beta;Roll;T-fold;ApbE-like domains 0.7414 15 280 3.10.520.10
af_Q9P7N3_14_258_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7384 5 33 2.130.10.10
af_A0A1P8AW69_199_332_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7372 4 28 2.130.10.10
2wgqB01 Alpha Beta;2-Layer Sandwich;Copper Amine Oxidase; Chain A, domain 1;Copper amine oxidase-like, N-terminal domain 0.7333 5 33 3.30.457.10
ID Description Score Start End GO Terms
AF-A0A1Q3LJ29-F1-model_v4 Thiamine biosynthesis protein ApbE 0.9796 3 280
AF-A0A661JQT5-F1-model_v4 UPF0280 family protein 0.9779 179 278
AF-A0A1F3AHD4-F1-model_v4 Thiamine biosynthesis protein ApbE 0.9772 1 279
AF-A0A1H5I2R2-F1-model_v4 Thiamine biosynthesis protein ApbE 0.9757 1 286
AF-A0A6N6S952-F1-model_v4 UPF0280 family protein 0.9754 7 264

Feature Viewer

pLDDT pTM Quality
89.18 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map