F482409
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 824 | 506 | 663 | 298 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2517572143|2517891144 |
| Length | 332 |
| Sequence | FSSEVDTGSRKENASKQESGAPFRFHRNGKGSRLPQIALLPDGKRLHLQDGPIDLVIEAKGRDEDVSAAYQAAAERFTGLLDELCAELAELRTAADPERCALKGVVARRMHAAVAPFAADCFITPMAAVAGSVAEEILGAMLEAAPLDRAYVNNGGDIALHLSDGEQFTVGLMDRPDRHGVMRAMTVDADMPVRGIATSGRHGRSFSLGIADAVTVLARTASQADAAATVIANAVDLPDHPAILRVPASELQPDSDLGARLVTRDVGPLAEHEIEQALEAGSARARDLLMPGLIEGAALRLLGETRIVGATGIGASASHALQGQTTEHMLRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 12 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 13 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 14 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 15 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 16 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 17 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 18 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 19 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 20 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 21 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 22 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 23 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 24 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 25 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 26 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 27 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 28 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 29 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 30 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 31 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 32 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 33 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 34 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 35 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 36 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 37 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 38 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 39 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 40 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 41 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 42 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 43 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 44 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 45 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 46 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 47 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 48 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 49 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 50 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 51 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 52 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 53 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 54 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 55 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 56 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 57 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 58 | 2904699407 | |||
| 59 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 60 | 2906610324 | |||
| 61 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 62 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 63 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 64 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 65 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 66 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 67 | 2922368715 | |||
| 68 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 69 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 70 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 71 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 72 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 73 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 74 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 75 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 76 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 77 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 78 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 79 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 80 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 81 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 82 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 83 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 84 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 85 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 86 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 87 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 88 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 89 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 90 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 91 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 92 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 93 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 94 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 95 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 96 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 97 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 98 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 99 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 100 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 101 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 102 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 103 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 104 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 105 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 106 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 107 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 108 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 109 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 110 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 111 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 112 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 113 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 114 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 115 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 116 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 117 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 118 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 119 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 120 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 121 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 122 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 123 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 124 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 125 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 126 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 127 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 128 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 129 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 130 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 131 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 132 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 133 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 134 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 135 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 136 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 137 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 138 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 139 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 140 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 141 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 142 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 143 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 145 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 146 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 147 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 155 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 157 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 158 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 160 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 163 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 164 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 165 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 166 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 167 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 168 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 169 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 172 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 174 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 175 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 176 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 177 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 178 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 179 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 180 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 181 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 182 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 183 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 184 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 185 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 186 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 188 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 189 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 190 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 191 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 192 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 193 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 194 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 195 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 196 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 197 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 198 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 199 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 201 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 202 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 203 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 204 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 205 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 207 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 212 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 213 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 215 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 219 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 220 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 221 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 223 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 224 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 225 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 226 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 227 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 228 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 229 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 230 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 231 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 232 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 237 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 286 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 287 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 288 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 289 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 294 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 295 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 296 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 297 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 298 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 299 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 300 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 301 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 302 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 303 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 304 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 305 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 306 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 307 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 308 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 309 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 310 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 311 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 312 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 313 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 314 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 315 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 316 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 317 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 318 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 319 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 320 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 321 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 322 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 323 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 324 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 325 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 326 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 327 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 328 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 329 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 330 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 331 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 332 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 333 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 334 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 335 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 336 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 337 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 338 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 339 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 340 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 341 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 342 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 343 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 344 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 402 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 403 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 404 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 405 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 406 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 407 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 408 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 409 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 410 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 411 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 412 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 413 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 414 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 415 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 416 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 417 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 418 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 419 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 420 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 421 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 422 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 423 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 424 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 441 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 442 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 443 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 444 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 447 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 450 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 453 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 454 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 455 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 456 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 457 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 458 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 459 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 460 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 461 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 462 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 463 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 464 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 465 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 466 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 467 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 468 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 469 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 470 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 471 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 472 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 473 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 474 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 475 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 476 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 477 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 478 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 480 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 481 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 482 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 483 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 484 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 485 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 486 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 487 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 488 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 489 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 490 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 491 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 492 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 493 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 494 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 495 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 496 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 497 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 498 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 499 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 500 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 501 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 502 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 503 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 504 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 505 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 506 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.63 |
| Metatranscriptomes | 0.12 |
| Isolates | 19.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.95 |
| Nodule | 16.26 |
| Rhizoplane | 8.37 |
| Rhizosphere | 54.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000019 | 3300003203 | Bacteria | 87589 |
| 2 | JGI25406J46586_10000318 | 3300003203 | Bacteria | 21736 |
| 3 | JGI25406J46586_10012828 | 3300003203 | Bacteria | 3621 |
| 4 | JGI25153J46596_10006245 | 3300003215 | Bacteria | 6092 |
| 5 | rootH2_10176532 | 3300003320 | Bacteria | 1479 |
| 6 | JGI25160J50197_1007770 | 3300003354 | Bacteria | 4157 |
| 7 | JGI25160J50197_1008566 | 3300003354 | Bacteria | 3886 |
| 8 | JGI25404J52841_10008171 | 3300003659 | Bacteria | 2224 |
| 9 | JGI25404J52841_10008986 | 3300003659 | Bacteria | 2135 |
| 10 | JGI25404J52841_10012809 | 3300003659 | Bacteria | 1819 |
| 11 | JGI25404J52841_10015588 | 3300003659 | Bacteria | 1649 |
| 12 | Ga0055531_10004023 | 3300003794 | Bacteria | 9120 |
| 13 | Ga0055543_1002866 | 3300004625 | Bacteria | 5433 |
| 14 | Ga0065165_1002034 | 3300005262 | Bacteria | 18805 |
| 15 | Ga0065165_1002156 | 3300005262 | Bacteria | 17812 |
| 16 | Ga0070658_10222921 | 3300005327 | Bacteria | 1595 |
| 17 | Ga0070658_10224446 | 3300005327 | Bacteria | 1589 |
| 18 | Ga0070658_10313858 | 3300005327 | Bacteria | 1338 |
| 19 | Ga0070683_100025031 | 3300005329 | Bacteria | 5354 |
| 20 | Ga0070683_100141992 | 3300005329 | Bacteria | 2275 |
| 21 | Ga0070680_100053378 | 3300005336 | Bacteria | 3300 |
| 22 | Ga0070680_100070194 | 3300005336 | Bacteria | 2877 |
| 23 | Ga0068868_100009673 | 3300005338 | Bacteria | 6958 |
| 24 | Ga0070660_100152696 | 3300005339 | Bacteria | 1857 |
| 25 | Ga0070661_100046142 | 3300005344 | Bacteria | 3187 |
| 26 | Ga0070661_100051701 | 3300005344 | Bacteria | 3007 |
| 27 | Ga0070661_100104658 | 3300005344 | Bacteria | 2109 |
| 28 | Ga0070668_100227548 | 3300005347 | Bacteria | 1540 |
| 29 | Ga0070668_100266628 | 3300005347 | Bacteria | 1426 |
| 30 | Ga0070668_100365894 | 3300005347 | Bacteria | 1224 |
| 31 | Ga0070675_100421215 | 3300005354 | Bacteria | 1194 |
| 32 | Ga0070671_100199647 | 3300005355 | Bacteria | 1696 |
| 33 | Ga0070671_100222650 | 3300005355 | Bacteria | 1600 |
| 34 | Ga0070659_100062805 | 3300005366 | Bacteria | 2937 |
| 35 | Ga0070667_100029892 | 3300005367 | Bacteria | 4542 |
| 36 | Ga0070667_100178997 | 3300005367 | Bacteria | 1875 |
| 37 | Ga0070709_10001083 | 3300005434 | Bacteria | 15083 |
| 38 | Ga0070709_10002717 | 3300005434 | Bacteria | 9561 |
| 39 | Ga0070714_100015456 | 3300005435 | Bacteria | 6142 |
| 40 | Ga0070714_100101373 | 3300005435 | Bacteria | 2537 |
| 41 | Ga0070713_100118871 | 3300005436 | Bacteria | 2315 |
| 42 | Ga0070713_100127150 | 3300005436 | Bacteria | 2243 |
| 43 | Ga0070713_100182802 | 3300005436 | Bacteria | 1885 |
| 44 | Ga0070713_100184286 | 3300005436 | Bacteria | 1877 |
| 45 | Ga0070713_100355606 | 3300005436 | Bacteria | 1360 |
| 46 | Ga0070710_10000726 | 3300005437 | Bacteria | 15703 |
| 47 | Ga0070710_10039694 | 3300005437 | Bacteria | 2591 |
| 48 | Ga0070710_10056197 | 3300005437 | Bacteria | 2227 |
| 49 | Ga0070711_100006561 | 3300005439 | Bacteria | 7020 |
| 50 | Ga0070711_100017822 | 3300005439 | Bacteria | 4525 |
| 51 | Ga0070711_100205740 | 3300005439 | Bacteria | 1521 |
| 52 | Ga0070700_100194296 | 3300005441 | Bacteria | 1421 |
| 53 | Ga0070663_100012111 | 3300005455 | Bacteria | 5444 |
| 54 | Ga0070663_100080316 | 3300005455 | Bacteria | 2395 |
| 55 | Ga0070663_100163169 | 3300005455 | Bacteria | 1717 |
| 56 | Ga0070678_100060846 | 3300005456 | Bacteria | 2781 |
| 57 | Ga0070681_10011285 | 3300005458 | Bacteria | 8837 |
| 58 | Ga0070681_10119263 | 3300005458 | Bacteria | 2574 |
| 59 | Ga0068867_100304920 | 3300005459 | Bacteria | 1314 |
| 60 | Ga0070707_100294789 | 3300005468 | Bacteria | 1576 |
| 61 | Ga0070698_100014123 | 3300005471 | Bacteria | 8445 |
| 62 | Ga0070698_100130074 | 3300005471 | Bacteria | 2473 |
| 63 | Ga0070679_100035187 | 3300005530 | Bacteria | 4968 |
| 64 | Ga0070679_100066794 | 3300005530 | Bacteria | 3585 |
| 65 | Ga0070684_100364289 | 3300005535 | Bacteria | 1330 |
| 66 | Ga0068853_100089035 | 3300005539 | Bacteria | 2710 |
| 67 | Ga0068853_100177222 | 3300005539 | Bacteria | 1932 |
| 68 | Ga0068853_100495582 | 3300005539 | Bacteria | 1153 |
| 69 | Ga0068853_100576684 | 3300005539 | Bacteria | 1067 |
| 70 | Ga0070693_100260776 | 3300005547 | Bacteria | 1153 |
| 71 | Ga0070665_100020157 | 3300005548 | Bacteria | 6694 |
| 72 | Ga0070665_100112936 | 3300005548 | Bacteria | 2720 |
| 73 | Ga0068855_100052317 | 3300005563 | Bacteria | 4808 |
| 74 | Ga0068855_100066996 | 3300005563 | Bacteria | 4185 |
| 75 | Ga0068855_100348543 | 3300005563 | Bacteria | 1631 |
| 76 | Ga0068855_100526638 | 3300005563 | Bacteria | 1282 |
| 77 | Ga0070664_100254621 | 3300005564 | Bacteria | 1579 |
| 78 | Ga0068857_100084315 | 3300005577 | Bacteria | 2839 |
| 79 | Ga0068857_100100949 | 3300005577 | Bacteria | 2589 |
| 80 | Ga0068856_100004533 | 3300005614 | Bacteria | 13815 |
| 81 | Ga0068852_100006500 | 3300005616 | Bacteria | 8450 |
| 82 | Ga0068852_100010249 | 3300005616 | Bacteria | 6990 |
| 83 | Ga0068852_100063394 | 3300005616 | Bacteria | 3218 |
| 84 | Ga0068859_100156041 | 3300005617 | Bacteria | 2360 |
| 85 | Ga0068859_100166183 | 3300005617 | Bacteria | 2286 |
| 86 | Ga0068859_100456494 | 3300005617 | Bacteria | 1374 |
| 87 | Ga0068859_100572864 | 3300005617 | Bacteria | 1223 |
| 88 | Ga0068864_100290307 | 3300005618 | Bacteria | 1529 |
| 89 | Ga0068866_10087797 | 3300005718 | Bacteria | 1686 |
| 90 | Ga0068861_100479711 | 3300005719 | Bacteria | 1120 |
| 91 | Ga0068858_100265715 | 3300005842 | Bacteria | 1632 |
| 92 | Ga0068860_100000213 | 3300005843 | Bacteria | 91105 |
| 93 | Ga0068860_100158090 | 3300005843 | Bacteria | 2185 |
| 94 | Ga0068862_100477570 | 3300005844 | Bacteria | 1179 |
| 95 | Ga0081455_10005931 | 3300005937 | Bacteria | 13260 |
| 96 | Ga0081455_10007164 | 3300005937 | Bacteria | 11793 |
| 97 | Ga0081455_10077607 | 3300005937 | Bacteria | 2732 |
| 98 | Ga0081455_10175135 | 3300005937 | Bacteria | 1630 |
| 99 | Ga0081540_1005943 | 3300005983 | Bacteria | 9008 |
| 100 | Ga0081540_1008063 | 3300005983 | Bacteria | 7404 |
| 101 | Ga0081540_1010718 | 3300005983 | Bacteria | 6177 |
| 102 | Ga0081540_1026578 | 3300005983 | Bacteria | 3300 |
| 103 | Ga0081540_1028376 | 3300005983 | Bacteria | 3144 |
| 104 | Ga0081540_1037129 | 3300005983 | Bacteria | 2587 |
| 105 | Ga0081540_1042937 | 3300005983 | Bacteria | 2326 |
| 106 | Ga0081540_1047534 | 3300005983 | Bacteria | 2157 |
| 107 | Ga0081540_1068230 | 3300005983 | Bacteria | 1658 |
| 108 | Ga0081539_10000003 | 3300005985 | Bacteria | 594833 |
| 109 | Ga0081539_10000199 | 3300005985 | Bacteria | 139305 |
| 110 | Ga0081539_10001962 | 3300005985 | Bacteria | 31338 |
| 111 | Ga0070717_10022714 | 3300006028 | Bacteria | 4960 |
| 112 | Ga0070717_10081904 | 3300006028 | Bacteria | 2711 |
| 113 | Ga0070717_10087773 | 3300006028 | Bacteria | 2620 |
| 114 | Ga0070717_10303401 | 3300006028 | Bacteria | 1420 |
| 115 | Ga0075365_10008592 | 3300006038 | Bacteria | 5813 |
| 116 | Ga0075368_10020037 | 3300006042 | Bacteria | 2529 |
| 117 | Ga0075363_100035848 | 3300006048 | Bacteria | 2598 |
| 118 | Ga0070715_10007524 | 3300006163 | Bacteria | 3753 |
| 119 | Ga0070716_100006597 | 3300006173 | Bacteria | 5674 |
| 120 | Ga0070716_100049215 | 3300006173 | Bacteria | 2387 |
| 121 | Ga0070712_100002958 | 3300006175 | Bacteria | 10518 |
| 122 | Ga0070712_100259656 | 3300006175 | Bacteria | 1392 |
| 123 | Ga0075362_10029433 | 3300006177 | Bacteria | 2366 |
| 124 | Ga0075367_10025647 | 3300006178 | Bacteria | 3335 |
| 125 | Ga0075367_10060008 | 3300006178 | Bacteria | 2266 |
| 126 | Ga0075369_10090876 | 3300006186 | Bacteria | 1362 |
| 127 | Ga0075370_10040554 | 3300006353 | Bacteria | 2626 |
| 128 | Ga0075434_100008890 | 3300006871 | Bacteria | 9350 |
| 129 | Ga0075434_100259227 | 3300006871 | Bacteria | 1758 |
| 130 | Ga0068865_100012399 | 3300006881 | Bacteria | 5365 |
| 131 | Ga0097620_100156040 | 3300006931 | Bacteria | 2360 |
| 132 | Ga0097620_100166187 | 3300006931 | Bacteria | 2286 |
| 133 | Ga0097620_100456466 | 3300006931 | Bacteria | 1374 |
| 134 | Ga0097620_100572955 | 3300006931 | Bacteria | 1223 |
| 135 | Ga0099824_1025369 | 3300006942 | Bacteria | 3256 |
| 136 | Ga0099822_1003531 | 3300006943 | Bacteria | 20044 |
| 137 | Ga0075435_100054879 | 3300007076 | Bacteria | 3217 |
| 138 | Ga0099794_10037901 | 3300007265 | Bacteria | 2283 |
| 139 | Ga0099795_10064034 | 3300007788 | Bacteria | 1372 |
| 140 | Ga0105240_10165300 | 3300009093 | Bacteria | 2625 |
| 141 | Ga0105243_10028802 | 3300009148 | Bacteria | 4267 |
| 142 | Ga0105243_10487270 | 3300009148 | Bacteria | 1165 |
| 143 | Ga0105241_10061117 | 3300009174 | Bacteria | 2900 |
| 144 | Ga0105241_10136918 | 3300009174 | Bacteria | 1989 |
| 145 | Ga0105242_10246729 | 3300009176 | Bacteria | 1607 |
| 146 | Ga0105248_10199139 | 3300009177 | Bacteria | 2256 |
| 147 | Ga0105248_10324368 | 3300009177 | Bacteria | 1734 |
| 148 | Ga0105237_10003966 | 3300009545 | Bacteria | 17317 |
| 149 | Ga0105237_10021235 | 3300009545 | Bacteria | 6678 |
| 150 | Ga0105237_10037340 | 3300009545 | Bacteria | 4912 |
| 151 | Ga0105237_10115717 | 3300009545 | Bacteria | 2675 |
| 152 | Ga0105237_10128323 | 3300009545 | Bacteria | 2530 |
| 153 | Ga0105237_10144015 | 3300009545 | Bacteria | 2378 |
| 154 | Ga0105237_10293386 | 3300009545 | Bacteria | 1629 |
| 155 | Ga0105238_10072156 | 3300009551 | Bacteria | 3449 |
| 156 | Ga0105238_10081331 | 3300009551 | Bacteria | 3229 |
| 157 | Ga0105238_10130968 | 3300009551 | Bacteria | 2486 |
| 158 | Ga0105238_10190362 | 3300009551 | Bacteria | 2028 |
| 159 | Ga0105238_10290035 | 3300009551 | Bacteria | 1618 |
| 160 | Ga0105238_10425174 | 3300009551 | Bacteria | 1323 |
| 161 | Ga0099796_10053280 | 3300010159 | Bacteria | 1411 |
| 162 | Ga0099796_10068039 | 3300010159 | Bacteria | 1279 |
| 163 | Ga0105239_10068406 | 3300010375 | Bacteria | 3903 |
| 164 | Ga0105239_10070205 | 3300010375 | Bacteria | 3847 |
| 165 | Ga0105239_10077996 | 3300010375 | Bacteria | 3646 |
| 166 | Ga0105239_10085098 | 3300010375 | Bacteria | 3484 |
| 167 | Ga0105239_10410850 | 3300010375 | Bacteria | 1533 |
| 168 | Ga0105246_10042239 | 3300011119 | Bacteria | 3087 |
| 169 | Ga0105246_10078068 | 3300011119 | Bacteria | 2350 |
| 170 | Ga0157369_10002009 | 3300013105 | Bacteria | 24521 |
| 171 | Ga0157369_10065211 | 3300013105 | Bacteria | 3920 |
| 172 | Ga0157369_10205229 | 3300013105 | Bacteria | 2067 |
| 173 | Ga0157369_10251995 | 3300013105 | Bacteria | 1842 |
| 174 | Ga0157369_10312654 | 3300013105 | Bacteria | 1633 |
| 175 | Ga0157372_10247008 | 3300013307 | Bacteria | 2071 |
| 176 | Ga0157372_10354736 | 3300013307 | Bacteria | 1709 |
| 177 | Ga0157375_10030198 | 3300013308 | Bacteria | 5108 |
| 178 | Ga0157375_10386730 | 3300013308 | Bacteria | 1566 |
| 179 | Ga0157375_10404464 | 3300013308 | Bacteria | 1532 |
| 180 | Ga0163163_10016615 | 3300014325 | Bacteria | 6842 |
| 181 | Ga0163163_10056064 | 3300014325 | Bacteria | 3895 |
| 182 | Ga0163163_10278639 | 3300014325 | Bacteria | 1724 |
| 183 | Ga0163163_10387578 | 3300014325 | Bacteria | 1455 |
| 184 | Ga0163163_10525131 | 3300014325 | Bacteria | 1246 |
| 185 | Ga0157380_10006347 | 3300014326 | Bacteria | 8315 |
| 186 | Ga0157380_10390589 | 3300014326 | Bacteria | 1316 |
| 187 | Ga0157379_10308055 | 3300014968 | Bacteria | 1444 |
| 188 | Ga0157379_10501051 | 3300014968 | Bacteria | 1126 |
| 189 | Ga0157376_10105608 | 3300014969 | Bacteria | 2470 |
| 190 | Ga0163161_10279004 | 3300017792 | Bacteria | 1310 |
| 191 | Ga0206353_10577094 | 3300020082 | Bacteria | 2489 |
| 192 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 193 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 194 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 195 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 196 | Ga0213872_10036968 | 3300021361 | Bacteria | 2230 |
| 197 | Ga0213876_10033823 | 3300021384 | Bacteria | 2695 |
| 198 | Ga0213871_10045965 | 3300021441 | Bacteria | 1184 |
| 199 | Ga0207425_1003455 | 3300025245 | Bacteria | 5053 |
| 200 | Ga0209148_1000500 | 3300025254 | Bacteria | 39994 |
| 201 | Ga0209233_1018269 | 3300025261 | Bacteria | 1890 |
| 202 | Ga0209233_1027990 | 3300025261 | Bacteria | 1358 |
| 203 | Ga0209455_1004034 | 3300025272 | Bacteria | 4967 |
| 204 | Ga0209758_1000024 | 3300025297 | Bacteria | 591966 |
| 205 | Ga0209758_1000068 | 3300025297 | Bacteria | 286488 |
| 206 | Ga0209758_1002409 | 3300025297 | Bacteria | 19162 |
| 207 | Ga0209758_1011950 | 3300025297 | Bacteria | 4938 |
| 208 | Ga0209758_1051180 | 3300025297 | Bacteria | 1440 |
| 209 | Ga0209256_1027020 | 3300025299 | Bacteria | 1642 |
| 210 | Ga0207426_1000238 | 3300025302 | Bacteria | 124393 |
| 211 | Ga0207426_1002351 | 3300025302 | Bacteria | 12330 |
| 212 | Ga0207426_1006588 | 3300025302 | Bacteria | 5011 |
| 213 | Ga0207426_1021892 | 3300025302 | Bacteria | 2202 |
| 214 | Ga0209257_1001699 | 3300025304 | Bacteria | 24723 |
| 215 | Ga0209257_1010441 | 3300025304 | Bacteria | 4698 |
| 216 | Ga0207692_10000763 | 3300025898 | Bacteria | 11404 |
| 217 | Ga0207692_10000845 | 3300025898 | Bacteria | 10979 |
| 218 | Ga0207692_10043469 | 3300025898 | Bacteria | 2236 |
| 219 | Ga0207688_10063418 | 3300025901 | Bacteria | 2084 |
| 220 | Ga0207647_10006516 | 3300025904 | Bacteria | 8486 |
| 221 | Ga0207647_10136119 | 3300025904 | Bacteria | 1442 |
| 222 | Ga0207685_10052499 | 3300025905 | Bacteria | 1580 |
| 223 | Ga0207699_10000406 | 3300025906 | Bacteria | 22137 |
| 224 | Ga0207645_10076723 | 3300025907 | Bacteria | 2141 |
| 225 | Ga0207705_10234754 | 3300025909 | Bacteria | 1396 |
| 226 | Ga0207705_10302729 | 3300025909 | Bacteria | 1226 |
| 227 | Ga0207654_10021290 | 3300025911 | Bacteria | 3446 |
| 228 | Ga0207707_10000173 | 3300025912 | Bacteria | 67122 |
| 229 | Ga0207707_10011453 | 3300025912 | Bacteria | 7724 |
| 230 | Ga0207707_10043008 | 3300025912 | Bacteria | 3942 |
| 231 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 232 | Ga0207695_10033658 | 3300025913 | Bacteria | 5584 |
| 233 | Ga0207695_10049084 | 3300025913 | Bacteria | 4452 |
| 234 | Ga0207671_10006585 | 3300025914 | Bacteria | 10311 |
| 235 | Ga0207671_10011165 | 3300025914 | Bacteria | 7335 |
| 236 | Ga0207671_10054532 | 3300025914 | Bacteria | 2962 |
| 237 | Ga0207693_10001388 | 3300025915 | Bacteria | 21472 |
| 238 | Ga0207693_10002846 | 3300025915 | Bacteria | 14982 |
| 239 | Ga0207693_10043859 | 3300025915 | Bacteria | 3516 |
| 240 | Ga0207663_10000515 | 3300025916 | Bacteria | 16967 |
| 241 | Ga0207663_10027987 | 3300025916 | Bacteria | 3293 |
| 242 | Ga0207663_10067588 | 3300025916 | Bacteria | 2292 |
| 243 | Ga0207660_10047666 | 3300025917 | Bacteria | 3031 |
| 244 | Ga0207660_10072299 | 3300025917 | Bacteria | 2511 |
| 245 | Ga0207662_10052842 | 3300025918 | Bacteria | 2418 |
| 246 | Ga0207657_10004866 | 3300025919 | Bacteria | 14133 |
| 247 | Ga0207657_10066317 | 3300025919 | Bacteria | 3073 |
| 248 | Ga0207652_10034398 | 3300025921 | Bacteria | 4270 |
| 249 | Ga0207646_10283086 | 3300025922 | Bacteria | 1498 |
| 250 | Ga0207681_10246603 | 3300025923 | Bacteria | 1393 |
| 251 | Ga0207694_10080549 | 3300025924 | Bacteria | 2556 |
| 252 | Ga0207694_10234485 | 3300025924 | Bacteria | 1499 |
| 253 | Ga0207700_10016062 | 3300025928 | Bacteria | 4963 |
| 254 | Ga0207700_10036858 | 3300025928 | Bacteria | 3536 |
| 255 | Ga0207700_10101425 | 3300025928 | Bacteria | 2296 |
| 256 | Ga0207700_10148493 | 3300025928 | Bacteria | 1935 |
| 257 | Ga0207664_10103952 | 3300025929 | Bacteria | 2351 |
| 258 | Ga0207664_10245356 | 3300025929 | Bacteria | 1561 |
| 259 | Ga0207644_10093767 | 3300025931 | Bacteria | 2242 |
| 260 | Ga0207644_10173938 | 3300025931 | Bacteria | 1683 |
| 261 | Ga0207690_10086011 | 3300025932 | Bacteria | 2208 |
| 262 | Ga0207686_10425400 | 3300025934 | Bacteria | 1017 |
| 263 | Ga0207704_10081926 | 3300025938 | Bacteria | 2089 |
| 264 | Ga0207665_10000874 | 3300025939 | Bacteria | 20343 |
| 265 | Ga0207665_10007378 | 3300025939 | Bacteria | 7268 |
| 266 | Ga0207665_10100714 | 3300025939 | Bacteria | 2016 |
| 267 | Ga0207711_10070516 | 3300025941 | Bacteria | 3031 |
| 268 | Ga0207711_10106198 | 3300025941 | Bacteria | 2491 |
| 269 | Ga0207689_10346793 | 3300025942 | Bacteria | 1234 |
| 270 | Ga0207689_10423864 | 3300025942 | Bacteria | 1111 |
| 271 | Ga0207661_10000210 | 3300025944 | Bacteria | 37700 |
| 272 | Ga0207661_10013093 | 3300025944 | Bacteria | 6052 |
| 273 | Ga0207667_10092380 | 3300025949 | Bacteria | 3125 |
| 274 | Ga0207667_10252623 | 3300025949 | Bacteria | 1804 |
| 275 | Ga0207668_10208694 | 3300025972 | Bacteria | 1561 |
| 276 | Ga0207640_10069975 | 3300025981 | Bacteria | 2358 |
| 277 | Ga0207658_10128551 | 3300025986 | Bacteria | 2032 |
| 278 | Ga0207658_10231279 | 3300025986 | Bacteria | 1561 |
| 279 | Ga0207677_10010738 | 3300026023 | Bacteria | 5191 |
| 280 | Ga0207703_10100425 | 3300026035 | Bacteria | 2451 |
| 281 | Ga0207639_10158993 | 3300026041 | Bacteria | 1902 |
| 282 | Ga0207678_10031260 | 3300026067 | Bacteria | 4644 |
| 283 | Ga0207678_10177926 | 3300026067 | Bacteria | 1816 |
| 284 | Ga0207678_10218993 | 3300026067 | Bacteria | 1629 |
| 285 | Ga0207678_10397758 | 3300026067 | Bacteria | 1193 |
| 286 | Ga0207708_10365150 | 3300026075 | Bacteria | 1187 |
| 287 | Ga0207702_10001309 | 3300026078 | Bacteria | 24941 |
| 288 | Ga0207702_10165413 | 3300026078 | Bacteria | 2023 |
| 289 | Ga0207702_10710223 | 3300026078 | Bacteria | 991 |
| 290 | Ga0207641_10297308 | 3300026088 | Bacteria | 1524 |
| 291 | Ga0207676_10505132 | 3300026095 | Bacteria | 1149 |
| 292 | Ga0207674_10042222 | 3300026116 | Bacteria | 4712 |
| 293 | Ga0207675_100352124 | 3300026118 | Bacteria | 1443 |
| 294 | Ga0207683_10250652 | 3300026121 | Bacteria | 1616 |
| 295 | Ga0207698_10220911 | 3300026142 | Bacteria | 1712 |
| 296 | Ga0209389_1000107 | 3300027296 | Bacteria | 74129 |
| 297 | Ga0209389_1002563 | 3300027296 | Bacteria | 14077 |
| 298 | Ga0209589_1000011 | 3300027357 | Bacteria | 236981 |
| 299 | Ga0209589_1000036 | 3300027357 | Bacteria | 131278 |
| 300 | Ga0209489_100006 | 3300027361 | Bacteria | 475698 |
| 301 | Ga0209489_100012 | 3300027361 | Bacteria | 236981 |
| 302 | Ga0209489_115889 | 3300027361 | Bacteria | 4339 |
| 303 | Ga0209489_115890 | 3300027361 | Bacteria | 4339 |
| 304 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 305 | Ga0209700_100019 | 3300027363 | Bacteria | 236981 |
| 306 | Ga0209179_1016803 | 3300027512 | Bacteria | 1377 |
| 307 | Ga0209588_1016287 | 3300027671 | Bacteria | 2293 |
| 308 | Ga0268266_10002874 | 3300028379 | Bacteria | 17897 |
| 309 | Ga0268266_10013866 | 3300028379 | Bacteria | 6938 |
| 310 | Ga0268266_10072145 | 3300028379 | Bacteria | 2993 |
| 311 | Ga0268264_10000065 | 3300028381 | Bacteria | 298403 |
| 312 | Ga0268264_10210291 | 3300028381 | Bacteria | 1785 |
| 313 | Ga0265334_10009956 | 3300028573 | Bacteria | 4018 |
| 314 | Ga0307517_10000279 | 3300028786 | Bacteria | 88025 |
| 315 | Ga0265332_10011140 | 3300031238 | Bacteria | 3995 |
| 316 | Ga0265332_10056874 | 3300031238 | Bacteria | 1676 |
| 317 | Ga0265325_10010622 | 3300031241 | Bacteria | 5322 |
| 318 | Ga0265340_10001234 | 3300031247 | Bacteria | 14646 |
| 319 | Ga0265339_10010858 | 3300031249 | Bacteria | 5633 |
| 320 | Ga0265339_10129202 | 3300031249 | Bacteria | 1293 |
| 321 | Ga0265316_10052801 | 3300031344 | Bacteria | 3187 |
| 322 | Ga0307513_10198080 | 3300031456 | Bacteria | 1852 |
| 323 | Ga0307509_10019751 | 3300031507 | Bacteria | 7671 |
| 324 | Ga0307509_10105981 | 3300031507 | Bacteria | 2831 |
| 325 | Ga0307508_10028758 | 3300031616 | Bacteria | 5026 |
| 326 | Ga0307508_10103398 | 3300031616 | Bacteria | 2445 |
| 327 | Ga0307508_10135265 | 3300031616 | Bacteria | 2068 |
| 328 | Ga0265314_10000412 | 3300031711 | Bacteria | 57508 |
| 329 | Ga0265342_10042929 | 3300031712 | Bacteria | 2730 |
| 330 | Ga0307516_10014449 | 3300031730 | Bacteria | 8350 |
| 331 | Ga0307516_10017791 | 3300031730 | Bacteria | 7403 |
| 332 | Ga0307516_10116424 | 3300031730 | Bacteria | 2468 |
| 333 | Ga0307510_10048801 | 3300033180 | Bacteria | 4511 |
| 334 | Ga0307510_10063240 | 3300033180 | Bacteria | 3771 |
| 335 | Ga0307510_10096666 | 3300033180 | Bacteria | 2768 |
| 336 | Ga0307510_10189248 | 3300033180 | Bacteria | 1608 |
| 337 | Ga0315911_1000003 | 3300033442 | Bacteria | 502217 |
| 338 | Ga0373926_0014548 | 3300035083 | Bacteria | 2676 |
| 339 | Ga0373929_0010713 | 3300035085 | Bacteria | 1718 |
| 340 | Ga0373934_0038811 | 3300035086 | Bacteria | 1876 |
| 341 | Ga0373934_0070487 | 3300035086 | Bacteria | 1398 |
| 342 | Ga0373932_0010230 | 3300035112 | Bacteria | 2267 |
| 343 | Ga0373936_0026538 | 3300035113 | Bacteria | 2268 |
| 344 | Ga0373953_0095057 | 3300035117 | Bacteria | 1250 |
| 345 | Ga0373954_0010944 | 3300035118 | Bacteria | 4012 |
| 346 | Ga0373956_0009384 | 3300035119 | Bacteria | 3980 |
| 347 | Ga0373957_0000546 | 3300035120 | Bacteria | 9543 |
| 348 | Ga0373943_0108685 | 3300035170 | Bacteria | 1460 |
| 349 | Ga0373961_0016775 | 3300035241 | Bacteria | 1890 |
| 350 | Ga0373962_0023916 | 3300035242 | Bacteria | 1630 |
| 351 | Ga0373924_0016752 | 3300035410 | Bacteria | 2802 |
| 352 | Ga0373931_0015025 | 3300035691 | Bacteria | 3794 |
| 353 | Ga0373931_0022903 | 3300035691 | Bacteria | 3148 |
| 354 | Ga0373931_0105874 | 3300035691 | Bacteria | 1589 |
| 355 | Ga0373935_0081185 | 3300035692 | Bacteria | 2107 |
| 356 | Ga0373935_0121240 | 3300035692 | Bacteria | 1747 |
| 357 | Ga0373927_0029888 | 3300035695 | Bacteria | 3554 |
| 358 | Ga0373927_0038537 | 3300035695 | Bacteria | 3103 |
| 359 | Ga0373927_0043468 | 3300035695 | Bacteria | 2908 |
| 360 | Ga0373927_0074918 | 3300035695 | Bacteria | 2191 |
| 361 | Ga0373933_0074105 | 3300035724 | Bacteria | 2075 |
| 362 | Ga0373947_0006447 | 3300035725 | Bacteria | 6815 |
| 363 | Ga0373937_0057708 | 3300036401 | Bacteria | 3566 |
| 364 | Ga0373925_0032350 | 3300037068 | Bacteria | 3850 |
| 365 | Ga0373925_0066047 | 3300037068 | Bacteria | 2726 |
| 366 | Ga0373925_0098681 | 3300037068 | Bacteria | 2242 |
| 367 | Ga0395900_0001586 | 3300037418 | Bacteria | 26897 |
| 368 | Ga0395900_0017960 | 3300037418 | Bacteria | 7221 |
| 369 | Ga0395900_0311269 | 3300037418 | Bacteria | 1558 |
| 370 | Ga0395898_0045960 | 3300037466 | Bacteria | 4290 |
| 371 | Ga0395898_0206514 | 3300037466 | Bacteria | 1874 |
| 372 | Ga0395898_0277238 | 3300037466 | Bacteria | 1599 |
| 373 | Ga0395905_0002364 | 3300037471 | Bacteria | 21019 |
| 374 | Ga0395905_0092992 | 3300037471 | Bacteria | 2828 |
| 375 | Ga0395905_0094419 | 3300037471 | Bacteria | 2806 |
| 376 | Ga0395905_0307449 | 3300037471 | Bacteria | 1474 |
| 377 | Ga0395901_0033905 | 3300038443 | Bacteria | 5272 |
| 378 | Ga0395901_0034663 | 3300038443 | Bacteria | 5214 |
| 379 | Ga0395901_0600882 | 3300038443 | Bacteria | 1109 |
| 380 | Ga0436365_0518465 | 3300039437 | Bacteria | 2927 |
| 381 | Ga0436365_0935505 | 3300039437 | Bacteria | 29785 |
| 382 | Ga0436365_0962701 | 3300039437 | Bacteria | 3132 |
| 383 | Ga0436365_1198843 | 3300039437 | Bacteria | 1880 |
| 384 | Ga0436360_0216274 | 3300039438 | Bacteria | 3512 |
| 385 | Ga0436361_0327683 | 3300039447 | Bacteria | 2262 |
| 386 | Ga0436361_0553282 | 3300039447 | Bacteria | 5181 |
| 387 | Ga0436362_0058908 | 3300039453 | Bacteria | 2258 |
| 388 | Ga0436362_1191906 | 3300039453 | Bacteria | 3118 |
| 389 | Ga0451800_0677031 | 3300041459 | Bacteria | 1119 |
| 390 | Ga0466969_0006735 | 3300044656 | Bacteria | 6111 |
| 391 | Ga0466972_0000122 | 3300044658 | Bacteria | 65679 |
| 392 | Ga0466972_0039062 | 3300044658 | Bacteria | 2317 |
| 393 | Ga0466966_0020376 | 3300044684 | Bacteria | 4361 |
| 394 | Ga0466961_0000038 | 3300044693 | Bacteria | 80721 |
| 395 | Ga0466968_0021463 | 3300044735 | Bacteria | 2616 |
| 396 | Ga0466960_0105830 | 3300044901 | Bacteria | 1455 |
| 397 | Ga0466967_0046202 | 3300045976 | Bacteria | 3789 |
| 398 | Ga0466967_0084499 | 3300045976 | Bacteria | 2872 |
| 399 | Ga0466967_0250626 | 3300045976 | Bacteria | 1691 |
| 400 | Ga0466967_0473230 | 3300045976 | Bacteria | 1227 |
| 401 | Ga0495592_0060328 | 3300046454 | Bacteria | 2790 |
| 402 | Ga0495603_0002054 | 3300046455 | Bacteria | 11838 |
| 403 | Ga0495603_0052443 | 3300046455 | Bacteria | 2422 |
| 404 | Ga0495603_0076851 | 3300046455 | Bacteria | 1959 |
| 405 | Ga0495590_0079111 | 3300046457 | Bacteria | 1157 |
| 406 | Ga0495629_0003217 | 3300046459 | Bacteria | 12360 |
| 407 | Ga0495651_0006245 | 3300046462 | Bacteria | 9112 |
| 408 | Ga0495651_0078004 | 3300046462 | Bacteria | 2506 |
| 409 | Ga0495651_0102828 | 3300046462 | Bacteria | 2124 |
| 410 | Ga0495653_0007949 | 3300046463 | Bacteria | 8683 |
| 411 | Ga0495580_0003657 | 3300046472 | Bacteria | 13031 |
| 412 | Ga0495582_0027266 | 3300046473 | Bacteria | 3130 |
| 413 | Ga0495582_0148154 | 3300046473 | Bacteria | 1332 |
| 414 | Ga0495582_0259560 | 3300046473 | Bacteria | 997 |
| 415 | Ga0495639_0018700 | 3300046475 | Bacteria | 3019 |
| 416 | Ga0495664_0003617 | 3300046477 | Bacteria | 8425 |
| 417 | Ga0495664_0013305 | 3300046477 | Bacteria | 4667 |
| 418 | Ga0495585_0011478 | 3300046492 | Bacteria | 5241 |
| 419 | Ga0495606_0132161 | 3300046507 | Bacteria | 1483 |
| 420 | Ga0495606_0189479 | 3300046507 | Bacteria | 1180 |
| 421 | Ga0495608_0003691 | 3300046511 | Bacteria | 11008 |
| 422 | Ga0495608_0043300 | 3300046511 | Bacteria | 3008 |
| 423 | Ga0495610_0093164 | 3300046512 | Bacteria | 1362 |
| 424 | Ga0495610_0095158 | 3300046512 | Bacteria | 1343 |
| 425 | Ga0495616_0062781 | 3300046513 | Bacteria | 1818 |
| 426 | Ga0495618_0065708 | 3300046514 | Bacteria | 2305 |
| 427 | Ga0495618_0204913 | 3300046514 | Bacteria | 1248 |
| 428 | Ga0495628_0009637 | 3300046516 | Bacteria | 8239 |
| 429 | Ga0495628_0225701 | 3300046516 | Bacteria | 1405 |
| 430 | Ga0495632_0081478 | 3300046519 | Bacteria | 1543 |
| 431 | Ga0495643_0017469 | 3300046522 | Bacteria | 4192 |
| 432 | Ga0495648_0088224 | 3300046524 | Bacteria | 1744 |
| 433 | Ga0495648_0114945 | 3300046524 | Bacteria | 1457 |
| 434 | Ga0495652_0013965 | 3300046529 | Bacteria | 7218 |
| 435 | Ga0495665_0066247 | 3300046531 | Bacteria | 1906 |
| 436 | Ga0495640_0017440 | 3300046533 | Bacteria | 5352 |
| 437 | Ga0495640_0086095 | 3300046533 | Bacteria | 2081 |
| 438 | Ga0495587_0159396 | 3300046536 | Bacteria | 1284 |
| 439 | Ga0495597_0038281 | 3300046542 | Bacteria | 2150 |
| 440 | Ga0495645_0008361 | 3300046543 | Bacteria | 7224 |
| 441 | Ga0495645_0095822 | 3300046543 | Bacteria | 2115 |
| 442 | Ga0495622_0017465 | 3300046557 | Bacteria | 3340 |
| 443 | Ga0495667_0025996 | 3300046559 | Bacteria | 3943 |
| 444 | Ga0495667_0067757 | 3300046559 | Bacteria | 2332 |
| 445 | Ga0495667_0076418 | 3300046559 | Bacteria | 2179 |
| 446 | Ga0495668_0074265 | 3300046616 | Bacteria | 1867 |
| 447 | Ga0495668_0205347 | 3300046616 | Bacteria | 1079 |
| 448 | Ga0495634_0018688 | 3300046642 | Bacteria | 4931 |
| 449 | Ga0495634_0213848 | 3300046642 | Bacteria | 1192 |
| 450 | Ga0495635_0003851 | 3300046663 | Bacteria | 10423 |
| 451 | Ga0495635_0005522 | 3300046663 | Bacteria | 8796 |
| 452 | Ga0495635_0039940 | 3300046663 | Bacteria | 3245 |
| 453 | Ga0495588_0060051 | 3300046674 | Bacteria | 1968 |
| 454 | Ga0495588_0103314 | 3300046674 | Bacteria | 1498 |
| 455 | Ga0495657_0004230 | 3300046675 | Bacteria | 11484 |
| 456 | Ga0495657_0005377 | 3300046675 | Bacteria | 10127 |
| 457 | Ga0495599_0004042 | 3300046678 | Bacteria | 8637 |
| 458 | Ga0495599_0062448 | 3300046678 | Bacteria | 2328 |
| 459 | Ga0495623_0006266 | 3300046679 | Bacteria | 7733 |
| 460 | Ga0495646_0061456 | 3300046680 | Bacteria | 2237 |
| 461 | Ga0495646_0135513 | 3300046680 | Bacteria | 1382 |
| 462 | Ga0495658_0018566 | 3300046683 | Bacteria | 3618 |
| 463 | Ga0495658_0078802 | 3300046683 | Bacteria | 1929 |
| 464 | Ga0495669_0112330 | 3300046684 | Bacteria | 1273 |
| 465 | Ga0495613_0019527 | 3300046689 | Bacteria | 5051 |
| 466 | Ga0495613_0123948 | 3300046689 | Bacteria | 1854 |
| 467 | Ga0495613_0181305 | 3300046689 | Bacteria | 1491 |
| 468 | Ga0495624_0007215 | 3300046690 | Bacteria | 7814 |
| 469 | Ga0495670_0053234 | 3300046691 | Bacteria | 2027 |
| 470 | Ga0495671_0124382 | 3300046692 | Bacteria | 1258 |
| 471 | Ga0495649_0098431 | 3300046694 | Bacteria | 1556 |
| 472 | Ga0495600_0003420 | 3300046809 | Bacteria | 9334 |
| 473 | Ga0495600_0032711 | 3300046809 | Bacteria | 3375 |
| 474 | Ga0495600_0066753 | 3300046809 | Bacteria | 2351 |
| 475 | Ga0495581_0056549 | 3300047315 | Bacteria | 2265 |
| 476 | Ga0495604_0005841 | 3300047317 | Bacteria | 9756 |
| 477 | Ga0495674_0008705 | 3300047319 | Bacteria | 9652 |
| 478 | Ga0495674_0081652 | 3300047319 | Bacteria | 2773 |
| 479 | Ga0495676_0096204 | 3300047321 | Bacteria | 2202 |
| 480 | Ga0495676_0167162 | 3300047321 | Bacteria | 1551 |
| 481 | Ga0495676_0263286 | 3300047321 | Bacteria | 1172 |
| 482 | Ga0495676_0372270 | 3300047321 | Bacteria | 952 |
| 483 | Ga0495680_0001849 | 3300047322 | Bacteria | 22313 |
| 484 | Ga0495680_0012021 | 3300047322 | Bacteria | 7637 |
| 485 | Ga0495683_0022488 | 3300047323 | Bacteria | 3242 |
| 486 | Ga0495683_0066552 | 3300047323 | Bacteria | 1775 |
| 487 | Ga0495687_034841 | 3300047443 | Bacteria | 2269 |
| 488 | Ga0495673_0052908 | 3300047469 | Bacteria | 1773 |
| 489 | Ga0495684_0029473 | 3300047471 | Bacteria | 4212 |
| 490 | Ga0495593_0021422 | 3300047673 | Bacteria | 3611 |
| 491 | Ga0495602_0010034 | 3300048088 | Bacteria | 9831 |
| 492 | Ga0495602_0339244 | 3300048088 | Bacteria | 1087 |
| 493 | Ga0496100_0045007 | 3300048903 | Bacteria | 2830 |
| 494 | Ga0496100_0348526 | 3300048903 | Bacteria | 1118 |
| 495 | Ga0496101_0000648 | 3300048904 | Bacteria | 20964 |
| 496 | Ga0496101_0034163 | 3300048904 | Bacteria | 3590 |
| 497 | Ga0496101_0222232 | 3300048904 | Bacteria | 1466 |
| 498 | Ga0496102_0005693 | 3300048905 | Bacteria | 10582 |
| 499 | Ga0496102_0299397 | 3300048905 | Bacteria | 1516 |
| 500 | Ga0496103_0020553 | 3300048906 | Bacteria | 3967 |
| 501 | Ga0496103_0105235 | 3300048906 | Bacteria | 1789 |
| 502 | Ga0496103_0150001 | 3300048906 | Bacteria | 1493 |
| 503 | Ga0496104_0003846 | 3300048907 | Bacteria | 12994 |
| 504 | Ga0496104_0010866 | 3300048907 | Bacteria | 8142 |
| 505 | Ga0496104_0184953 | 3300048907 | Bacteria | 1994 |
| 506 | Ga0496104_0185510 | 3300048907 | Bacteria | 1991 |
| 507 | Ga0496104_0399124 | 3300048907 | Bacteria | 1287 |
| 508 | Ga0496105_0004124 | 3300048908 | Bacteria | 10892 |
| 509 | Ga0496105_0047185 | 3300048908 | Bacteria | 3554 |
| 510 | Ga0496105_0100507 | 3300048908 | Bacteria | 2388 |
| 511 | Ga0496105_0125062 | 3300048908 | Bacteria | 2120 |
| 512 | Ga0496106_0033959 | 3300048909 | Bacteria | 3808 |
| 513 | Ga0496106_0175261 | 3300048909 | Bacteria | 1701 |
| 514 | Ga0496106_0196868 | 3300048909 | Bacteria | 1603 |
| 515 | Ga0496106_0283935 | 3300048909 | Bacteria | 1326 |
| 516 | Ga0496107_0027901 | 3300048910 | Bacteria | 4010 |
| 517 | Ga0496107_0099767 | 3300048910 | Bacteria | 2128 |
| 518 | Ga0496107_0168242 | 3300048910 | Bacteria | 1626 |
| 519 | Ga0496108_0048242 | 3300048911 | Bacteria | 3560 |
| 520 | Ga0496108_0184989 | 3300048911 | Bacteria | 1804 |
| 521 | Ga0496108_0228576 | 3300048911 | Bacteria | 1617 |
| 522 | Ga0496108_0337434 | 3300048911 | Bacteria | 1315 |
| 523 | Ga0496108_0545047 | 3300048911 | Bacteria | 1012 |
| 524 | Ga0496109_0132643 | 3300048912 | Bacteria | 2326 |
| 525 | Ga0496109_0152961 | 3300048912 | Bacteria | 2160 |
| 526 | Ga0496109_0245267 | 3300048912 | Bacteria | 1686 |
| 527 | Ga0496109_0290110 | 3300048912 | Bacteria | 1542 |
| 528 | Ga0496110_0058595 | 3300048913 | Bacteria | 3392 |
| 529 | Ga0496110_0071937 | 3300048913 | Bacteria | 3068 |
| 530 | Ga0496110_0200282 | 3300048913 | Bacteria | 1814 |
| 531 | Ga0496110_0220740 | 3300048913 | Bacteria | 1724 |
| 532 | Ga0496110_0309435 | 3300048913 | Bacteria | 1439 |
| 533 | Ga0496111_0069319 | 3300048914 | Bacteria | 2564 |
| 534 | Ga0496111_0092430 | 3300048914 | Bacteria | 2218 |
| 535 | Ga0496111_0182785 | 3300048914 | Bacteria | 1559 |
| 536 | Ga0496111_0374046 | 3300048914 | Bacteria | 1054 |
| 537 | Ga0496112_0020839 | 3300048915 | Bacteria | 6221 |
| 538 | Ga0496112_0057096 | 3300048915 | Bacteria | 3843 |
| 539 | Ga0496112_0063694 | 3300048915 | Bacteria | 3637 |
| 540 | Ga0496112_0096051 | 3300048915 | Bacteria | 2934 |
| 541 | Ga0496112_0106666 | 3300048915 | Bacteria | 2771 |
| 542 | Ga0496112_0549658 | 3300048915 | Bacteria | 1088 |
| 543 | Ga0496112_0584270 | 3300048915 | Bacteria | 1049 |
| 544 | Ga0496113_0044199 | 3300048916 | Bacteria | 3299 |
| 545 | Ga0496113_0073839 | 3300048916 | Bacteria | 2599 |
| 546 | Ga0496113_0074614 | 3300048916 | Bacteria | 2586 |
| 547 | Ga0496113_0079588 | 3300048916 | Bacteria | 2509 |
| 548 | Ga0496113_0147081 | 3300048916 | Bacteria | 1857 |
| 549 | Ga0496113_0157823 | 3300048916 | Bacteria | 1792 |
| 550 | Ga0496113_0469797 | 3300048916 | Bacteria | 1011 |
| 551 | Ga0496114_0020318 | 3300048917 | Bacteria | 5389 |
| 552 | Ga0496114_0303865 | 3300048917 | Bacteria | 1409 |
| 553 | Ga0496115_0013729 | 3300048918 | Bacteria | 6133 |
| 554 | Ga0496115_0043847 | 3300048918 | Bacteria | 3567 |
| 555 | Ga0496115_0111755 | 3300048918 | Bacteria | 2245 |
| 556 | Ga0496115_0156336 | 3300048918 | Bacteria | 1884 |
| 557 | Ga0496115_0161520 | 3300048918 | Bacteria | 1851 |
| 558 | Ga0496115_0261142 | 3300048918 | Bacteria | 1424 |
| 559 | Ga0496115_0490480 | 3300048918 | Bacteria | 988 |
| 560 | Ga0496116_0009705 | 3300048919 | Bacteria | 8179 |
| 561 | Ga0496117_0064911 | 3300048920 | Bacteria | 2485 |
| 562 | Ga0496118_0006064 | 3300048921 | Bacteria | 13465 |
| 563 | Ga0496119_0043726 | 3300048922 | Bacteria | 2827 |
| 564 | Ga0496119_0103052 | 3300048922 | Bacteria | 1598 |
| 565 | Ga0496120_0011600 | 3300048923 | Bacteria | 6051 |
| 566 | Ga0496121_0001157 | 3300048924 | Bacteria | 46239 |
| 567 | Ga0496121_0050969 | 3300048924 | Bacteria | 3490 |
| 568 | Ga0496121_0090761 | 3300048924 | Bacteria | 2387 |
| 569 | Ga0496121_0092561 | 3300048924 | Bacteria | 2356 |
| 570 | Ga0496121_0109820 | 3300048924 | Bacteria | 2106 |
| 571 | Ga0496121_0146381 | 3300048924 | Bacteria | 1745 |
| 572 | Ga0496124_0021056 | 3300048927 | Bacteria | 6013 |
| 573 | Ga0496124_0168541 | 3300048927 | Bacteria | 1699 |
| 574 | Ga0496124_0239553 | 3300048927 | Bacteria | 1350 |
| 575 | Ga0496125_0035390 | 3300048928 | Bacteria | 4381 |
| 576 | Ga0496125_0038850 | 3300048928 | Bacteria | 4110 |
| 577 | Ga0496125_0257020 | 3300048928 | Bacteria | 1097 |
| 578 | Ga0496126_0002588 | 3300048929 | Bacteria | 24124 |
| 579 | Ga0496126_0007487 | 3300048929 | Bacteria | 11959 |
| 580 | Ga0496126_0045817 | 3300048929 | Bacteria | 4016 |
| 581 | Ga0496126_0096446 | 3300048929 | Bacteria | 2592 |
| 582 | Ga0496126_0169312 | 3300048929 | Bacteria | 1862 |
| 583 | Ga0496126_0245953 | 3300048929 | Bacteria | 1492 |
| 584 | Ga0496126_0380569 | 3300048929 | Bacteria | 1149 |
| 585 | Ga0496126_0430081 | 3300048929 | Bacteria | 1066 |
| 586 | Ga0501033_0026010 | 3300049570 | Bacteria | 4404 |
| 587 | Ga0501033_0111598 | 3300049570 | Bacteria | 1990 |
| 588 | Ga0501034_0242093 | 3300049571 | Bacteria | 1750 |
| 589 | Ga0501036_0174359 | 3300049572 | Bacteria | 1811 |
| 590 | Ga0501037_0092548 | 3300049573 | Bacteria | 2187 |
| 591 | Ga0501038_0254420 | 3300049574 | Bacteria | 1390 |
| 592 | Ga0501039_0110699 | 3300049575 | Bacteria | 2147 |
| 593 | Ga0501040_0083694 | 3300049576 | Bacteria | 2213 |
| 594 | Ga0501043_0088222 | 3300049579 | Bacteria | 2437 |
| 595 | Ga0501046_0064839 | 3300049580 | Bacteria | 2851 |
| 596 | Ga0501047_0287716 | 3300049581 | Bacteria | 1487 |
| 597 | Ga0501048_0209357 | 3300049582 | Bacteria | 1383 |
| 598 | Ga0501067_0038236 | 3300049583 | Bacteria | 2665 |
| 599 | Ga0501080_0053502 | 3300049742 | Bacteria | 3759 |
| 600 | Ga0501081_0329751 | 3300049743 | Bacteria | 1123 |
| 601 | Ga0501035_0156715 | 3300049822 | Bacteria | 1973 |
| 602 | Ga0501044_0052312 | 3300049823 | Bacteria | 4209 |
| 603 | Ga0501044_0079171 | 3300049823 | Bacteria | 3330 |
| 604 | nmdc:mga03n38_8874_c1 | 3300050490 | Bacteria | 3629 |
| 605 | nmdc:mga00v17_198947_c1 | 3300050491 | Bacteria | 1295 |
| 606 | nmdc:mga0yw44_34723_c1 | 3300050492 | Bacteria | 2957 |
| 607 | nmdc:mga0yw44_42449_c1 | 3300050492 | Bacteria | 2712 |
| 608 | nmdc:mga06z11_5930_c1 | 3300050494 | Bacteria | 4935 |
| 609 | nmdc:mga0n895_470832_c1 | 3300050512 | Bacteria | 1267 |
| 610 | nmdc:mga0n895_9753_c1 | 3300050512 | Bacteria | 8425 |
| 611 | nmdc:mga0rr50_17170_c1 | 3300050513 | Bacteria | 4825 |
| 612 | nmdc:mga0sz30_33134_c1 | 3300050516 | Bacteria | 2146 |
| 613 | Ga0495601_0012431 | 3300053077 | Bacteria | 5108 |
| 614 | Ga0495612_0039972 | 3300053078 | Bacteria | 1909 |
| 615 | Ga0495612_0096784 | 3300053078 | Bacteria | 1254 |
| 616 | Ga0500635_0001194 | 3300053080 | Bacteria | 6219 |
| 617 | Ga0500635_0001309 | 3300053080 | Bacteria | 5949 |
| 618 | Ga0495595_0006178 | 3300053084 | Bacteria | 4871 |
| 619 | Ga0495619_0022036 | 3300053085 | Bacteria | 4072 |
| 620 | Ga0495619_0126728 | 3300053085 | Bacteria | 1753 |
| 621 | Ga0500644_0017699 | 3300053088 | Bacteria | 2074 |
| 622 | Ga0500647_0006809 | 3300053091 | Bacteria | 4865 |
| 623 | Ga0500647_0135667 | 3300053091 | Bacteria | 1158 |
| 624 | Ga0500566_0000003 | 3300053094 | Bacteria | 166820 |
| 625 | Ga0500566_0001155 | 3300053094 | Bacteria | 15356 |
| 626 | Ga0500566_0039034 | 3300053094 | Bacteria | 2746 |
| 627 | Ga0500640_000579 | 3300053095 | Bacteria | 9420 |
| 628 | Ga0500557_000052 | 3300053105 | Bacteria | 50636 |
| 629 | Ga0500572_003949 | 3300053111 | Bacteria | 3368 |
| 630 | Ga0500595_000395 | 3300053119 | Bacteria | 28044 |
| 631 | Ga0500595_030009 | 3300053119 | Bacteria | 1837 |
| 632 | Ga0500595_055398 | 3300053119 | Bacteria | 1215 |
| 633 | Ga0500597_120508 | 3300053120 | Bacteria | 1137 |
| 634 | Ga0500607_012093 | 3300053121 | Bacteria | 5081 |
| 635 | Ga0500608_003401 | 3300053122 | Bacteria | 5958 |
| 636 | Ga0500608_065863 | 3300053122 | Bacteria | 1728 |
| 637 | Ga0500642_0000306 | 3300053130 | Bacteria | 17531 |
| 638 | Ga0500559_0001626 | 3300053136 | Bacteria | 12489 |
| 639 | Ga0500559_0002366 | 3300053136 | Bacteria | 9829 |
| 640 | Ga0500559_0013274 | 3300053136 | Bacteria | 3490 |
| 641 | Ga0500559_0069255 | 3300053136 | Bacteria | 1586 |
| 642 | Ga0500564_121893 | 3300053138 | Bacteria | 1135 |
| 643 | Ga0500573_0065364 | 3300053140 | Bacteria | 2079 |
| 644 | Ga0500590_117171 | 3300053148 | Bacteria | 1254 |
| 645 | Ga0500590_143927 | 3300053148 | Bacteria | 1085 |
| 646 | Ga0500603_000184 | 3300053150 | Bacteria | 16166 |
| 647 | Ga0500603_002335 | 3300053150 | Bacteria | 4169 |
| 648 | Ga0500616_0028617 | 3300053153 | Bacteria | 3070 |
| 649 | Ga0500627_0013117 | 3300053158 | Bacteria | 3129 |
| 650 | Ga0500630_001089 | 3300053159 | Bacteria | 12674 |
| 651 | Ga0500633_0088403 | 3300053160 | Bacteria | 1129 |
| 652 | Ga0500638_016718 | 3300053162 | Bacteria | 3393 |
| 653 | Ga0500638_061293 | 3300053162 | Bacteria | 1807 |
| 654 | Ga0500639_000033 | 3300053163 | Bacteria | 68969 |
| 655 | Ga0500639_036153 | 3300053163 | Bacteria | 2605 |
| 656 | Ga0500636_0000042 | 3300053177 | Bacteria | 69412 |
| 657 | Ga0500637_0000026 | 3300053178 | Bacteria | 59050 |
| 658 | Ga0500637_0007084 | 3300053178 | Bacteria | 5584 |
| 659 | Ga0500637_0074546 | 3300053178 | Bacteria | 1955 |
| 660 | Ga0500596_001686 | 3300053735 | Bacteria | 4475 |
| 661 | Ga0500599_011708 | 3300053736 | Bacteria | 1171 |
| 662 | Ga0501084_0210855 | 3300054114 | Bacteria | 1639 |
| 663 | Ga0500661_002036 | 3300055283 | Bacteria | 3816 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005718 | Ga0068866_10087797 | Ga0068866_100877971 | 257 |
| 2 | 3300005441 | Ga0070700_100194296 | Ga0070700_1001942962 | 258 |
| 3 | 3300005456 | Ga0070678_100060846 | Ga0070678_1000608463 | 258 |
| 4 | 3300005459 | Ga0068867_100304920 | Ga0068867_1003049202 | 258 |
| 5 | 3300006881 | Ga0068865_100012399 | Ga0068865_1000123993 | 258 |
| 6 | 3300009148 | Ga0105243_10028802 | Ga0105243_100288022 | 258 |
| 7 | 3300026075 | Ga0207708_10365150 | Ga0207708_103651502 | 258 |
| 8 | 3300028381 | Ga0268264_10210291 | Ga0268264_102102912 | 258 |
| 9 | 3300021361 | Ga0213872_10036968 | Ga0213872_100369683 | 259 |
| 10 | 3300039447 | Ga0436361_0553282 | Ga0436361_0553282_2870_3775 | 259 |
| 11 | 3300005617 | Ga0068859_100156041 | Ga0068859_1001560412 | 260 |
| 12 | 3300006931 | Ga0097620_100156040 | Ga0097620_1001560402 | 260 |
| 13 | iso_pu_bacteria | 2906610324 | 2906616324 | 260 |
| 14 | 3300053122 | Ga0500608_065863 | Ga0500608_065863_430_1326 | 262 |
| 15 | 3300053138 | Ga0500564_121893 | Ga0500564_121893_126_1022 | 262 |
| 16 | 3300007788 | Ga0099795_10064034 | Ga0099795_100640341 | 264 |
| 17 | 3300003203 | JGI25406J46586_10000318 | JGI25406J46586_1000031817 | 266 |
| 18 | 3300005985 | Ga0081539_10001962 | Ga0081539_100019621 | 266 |
| 19 | 3300014326 | Ga0157380_10006347 | Ga0157380_100063477 | 268 |
| 20 | iso_pu_bacteria | 2824696289 | 2824697125 | 270 |
| 21 | iso_pu_bacteria | 2894772417 | 2894773824 | 270 |
| 22 | iso_pu_bacteria | 8019586578 | 8019590978 | 270 |
| 23 | 3300046455 | Ga0495603_0052443 | Ga0495603_0052443_14_922 | 273 |
| 24 | 3300046674 | Ga0495588_0060051 | Ga0495588_0060051_328_1236 | 273 |
| 25 | 3300053088 | Ga0500644_0017699 | Ga0500644_0017699_43_930 | 277 |
| 26 | 3300005329 | Ga0070683_100141992 | Ga0070683_1001419922 | 279 |
| 27 | 3300009545 | Ga0105237_10115717 | Ga0105237_101157172 | 279 |
| 28 | 3300009551 | Ga0105238_10072156 | Ga0105238_100721563 | 279 |
| 29 | 3300049570 | Ga0501033_0111598 | Ga0501033_0111598_569_1462 | 279 |
| 30 | 3300048924 | Ga0496121_0109820 | Ga0496121_0109820_621_1565 | 280 |
| 31 | iso_pu_bacteria | 2884298095 | 2884301499 | 280 |
| 32 | 3300038443 | Ga0395901_0600882 | Ga0395901_0600882_108_1022 | 281 |
| 33 | 3300048929 | Ga0496126_0169312 | Ga0496126_0169312_197_1081 | 281 |
| 34 | 3300048929 | Ga0496126_0430081 | Ga0496126_0430081_143_1027 | 281 |
| 35 | 3300005614 | Ga0068856_100004533 | Ga0068856_1000045335 | 283 |
| 36 | 3300010375 | Ga0105239_10077996 | Ga0105239_100779964 | 283 |
| 37 | 3300025981 | Ga0207640_10069975 | Ga0207640_100699752 | 283 |
| 38 | 3300026078 | Ga0207702_10001309 | Ga0207702_100013098 | 283 |
| 39 | 3300044656 | Ga0466969_0006735 | Ga0466969_0006735_3710_4582 | 283 |
| 40 | 3300044684 | Ga0466966_0020376 | Ga0466966_0020376_2334_3206 | 283 |
| 41 | 3300044693 | Ga0466961_0000038 | Ga0466961_0000038_67020_67892 | 283 |
| 42 | 3300053148 | Ga0500590_143927 | Ga0500590_143927_200_1072 | 283 |
| 43 | 3300053736 | Ga0500599_011708 | Ga0500599_011708_286_1158 | 283 |
| 44 | 3300005539 | Ga0068853_100177222 | Ga0068853_1001772222 | 284 |
| 45 | 3300005563 | Ga0068855_100052317 | Ga0068855_1000523173 | 284 |
| 46 | 3300005617 | Ga0068859_100456494 | Ga0068859_1004564942 | 284 |
| 47 | 3300006931 | Ga0097620_100456466 | Ga0097620_1004564662 | 284 |
| 48 | 3300009545 | Ga0105237_10144015 | Ga0105237_101440152 | 284 |
| 49 | 3300013105 | Ga0157369_10065211 | Ga0157369_100652114 | 284 |
| 50 | 3300013105 | Ga0157369_10205229 | Ga0157369_102052292 | 284 |
| 51 | 3300013307 | Ga0157372_10354736 | Ga0157372_103547362 | 284 |
| 52 | 3300020082 | Ga0206353_10577094 | Ga0206353_105770943 | 284 |
| 53 | 3300021384 | Ga0213876_10033823 | Ga0213876_100338233 | 284 |
| 54 | 3300025913 | Ga0207695_10049084 | Ga0207695_100490844 | 284 |
| 55 | 3300025944 | Ga0207661_10000210 | Ga0207661_1000021035 | 284 |
| 56 | 3300037418 | Ga0395900_0017960 | Ga0395900_0017960_1136_2023 | 284 |
| 57 | 3300037466 | Ga0395898_0277238 | Ga0395898_0277238_307_1194 | 284 |
| 58 | 3300038443 | Ga0395901_0034663 | Ga0395901_0034663_3495_4382 | 284 |
| 59 | 3300039437 | Ga0436365_0518465 | Ga0436365_0518465_1548_2435 | 284 |
| 60 | 3300039437 | Ga0436365_0962701 | Ga0436365_0962701_731_1618 | 284 |
| 61 | 3300046477 | Ga0495664_0013305 | Ga0495664_0013305_1543_2430 | 284 |
| 62 | 3300046543 | Ga0495645_0008361 | Ga0495645_0008361_1278_2165 | 284 |
| 63 | 3300046678 | Ga0495599_0062448 | Ga0495599_0062448_1206_2093 | 284 |
| 64 | 3300048916 | Ga0496113_0469797 | Ga0496113_0469797_20_895 | 284 |
| 65 | iso_pu_bacteria | 2885383462 | 2885389809 | 284 |
| 66 | iso_pu_bacteria | 2903768456 | 2903775916 | 284 |
| 67 | iso_pu_bacteria | 8056681323 | 8056684262 | 284 |
| 68 | 3300005458 | Ga0070681_10011285 | Ga0070681_100112854 | 285 |
| 69 | 3300009545 | Ga0105237_10293386 | Ga0105237_102933862 | 285 |
| 70 | 3300013105 | Ga0157369_10251995 | Ga0157369_102519952 | 285 |
| 71 | 3300025912 | Ga0207707_10011453 | Ga0207707_100114533 | 285 |
| 72 | 3300025944 | Ga0207661_10013093 | Ga0207661_100130932 | 285 |
| 73 | iso_pu_bacteria | 2513237101 | 2513693741 | 285 |
| 74 | iso_pu_bacteria | 2513237137 | 2513863159 | 285 |
| 75 | iso_pu_bacteria | 2524023228 | 2524533672 | 285 |
| 76 | iso_pu_bacteria | 2667528175 | 2671123254 | 285 |
| 77 | iso_pu_bacteria | 2728368998 | 2728755511 | 285 |
| 78 | iso_pu_bacteria | 2791355197 | 2793066487 | 285 |
| 79 | iso_pu_bacteria | 2885374607 | 2885378226 | 285 |
| 80 | iso_pu_bacteria | 2903748898 | 2903752235 | 285 |
| 81 | iso_pu_bacteria | 2904690495 | 2904698956 | 285 |
| 82 | iso_pu_bacteria | 2904699407 | 2904701023 | 285 |
| 83 | iso_pu_bacteria | 2906635258 | 2906641529 | 285 |
| 84 | iso_pu_bacteria | 2906660503 | 2906662893 | 285 |
| 85 | iso_pu_bacteria | 2908739725 | 2908741464 | 285 |
| 86 | iso_pu_bacteria | 2908756301 | 2908758753 | 285 |
| 87 | iso_pu_bacteria | 3005474847 | 3005481477 | 285 |
| 88 | iso_pu_bacteria | 8006933436 | 8006939240 | 285 |
| 89 | iso_pu_bacteria | 8006973647 | 8006978898 | 285 |
| 90 | iso_pu_bacteria | 8056689827 | 8056690604 | 285 |
| 91 | 3300003320 | rootH2_10176532 | rootH2_101765322 | 286 |
| 92 | 3300005327 | Ga0070658_10313858 | Ga0070658_103138582 | 286 |
| 93 | 3300005468 | Ga0070707_100294789 | Ga0070707_1002947892 | 286 |
| 94 | 3300005471 | Ga0070698_100014123 | Ga0070698_1000141233 | 286 |
| 95 | 3300005577 | Ga0068857_100100949 | Ga0068857_1001009492 | 286 |
| 96 | 3300006871 | Ga0075434_100008890 | Ga0075434_1000088904 | 286 |
| 97 | 3300007076 | Ga0075435_100054879 | Ga0075435_1000548793 | 286 |
| 98 | 3300009551 | Ga0105238_10081331 | Ga0105238_100813312 | 286 |
| 99 | 3300025918 | Ga0207662_10052842 | Ga0207662_100528422 | 286 |
| 100 | 3300025922 | Ga0207646_10283086 | Ga0207646_102830862 | 286 |
| 101 | 3300025924 | Ga0207694_10080549 | Ga0207694_100805492 | 286 |
| 102 | 3300035113 | Ga0373936_0026538 | Ga0373936_0026538_1282_2184 | 286 |
| 103 | 3300037068 | Ga0373925_0066047 | Ga0373925_0066047_993_1910 | 286 |
| 104 | 3300050512 | nmdc:mga0n895_9753_c1 | nmdc:mga0n895_9753_c1_5057_5941 | 286 |
| 105 | 3300050513 | nmdc:mga0rr50_17170_c1 | nmdc:mga0rr50_17170_c1_1629_2513 | 286 |
| 106 | 3300053080 | Ga0500635_0001194 | Ga0500635_0001194_3446_4348 | 286 |
| 107 | 3300053091 | Ga0500647_0006809 | Ga0500647_0006809_2711_3613 | 286 |
| 108 | 3300053094 | Ga0500566_0000003 | Ga0500566_0000003_125468_126370 | 286 |
| 109 | 3300053095 | Ga0500640_000579 | Ga0500640_000579_802_1704 | 286 |
| 110 | 3300053111 | Ga0500572_003949 | Ga0500572_003949_1849_2751 | 286 |
| 111 | 3300053122 | Ga0500608_003401 | Ga0500608_003401_4065_4967 | 286 |
| 112 | 3300053136 | Ga0500559_0002366 | Ga0500559_0002366_7474_8376 | 286 |
| 113 | 3300053150 | Ga0500603_000184 | Ga0500603_000184_4387_5289 | 286 |
| 114 | 3300053159 | Ga0500630_001089 | Ga0500630_001089_1963_2865 | 286 |
| 115 | 3300053162 | Ga0500638_061293 | Ga0500638_061293_835_1737 | 286 |
| 116 | 3300053163 | Ga0500639_000033 | Ga0500639_000033_27735_28637 | 286 |
| 117 | 3300053178 | Ga0500637_0074546 | Ga0500637_0074546_205_1107 | 286 |
| 118 | 3300053735 | Ga0500596_001686 | Ga0500596_001686_1481_2383 | 286 |
| 119 | iso_pu_bacteria | 2824600985 | 2824602355 | 286 |
| 120 | iso_pu_bacteria | 2824609381 | 2824610551 | 286 |
| 121 | iso_pu_bacteria | 2824653114 | 2824654324 | 286 |
| 122 | iso_pu_bacteria | 2857509624 | 2857515913 | 286 |
| 123 | iso_pu_bacteria | 2888419890 | 2888424926 | 286 |
| 124 | 3300005329 | Ga0070683_100025031 | Ga0070683_1000250312 | 287 |
| 125 | 3300005338 | Ga0068868_100009673 | Ga0068868_1000096733 | 287 |
| 126 | 3300005434 | Ga0070709_10001083 | Ga0070709_100010839 | 287 |
| 127 | 3300005435 | Ga0070714_100101373 | Ga0070714_1001013732 | 287 |
| 128 | 3300005436 | Ga0070713_100182802 | Ga0070713_1001828022 | 287 |
| 129 | 3300005437 | Ga0070710_10000726 | Ga0070710_1000072612 | 287 |
| 130 | 3300005439 | Ga0070711_100006561 | Ga0070711_1000065617 | 287 |
| 131 | 3300005530 | Ga0070679_100035187 | Ga0070679_1000351872 | 287 |
| 132 | 3300005539 | Ga0068853_100576684 | Ga0068853_1005766841 | 287 |
| 133 | 3300005618 | Ga0068864_100290307 | Ga0068864_1002903072 | 287 |
| 134 | 3300006028 | Ga0070717_10081904 | Ga0070717_100819042 | 287 |
| 135 | 3300006173 | Ga0070716_100049215 | Ga0070716_1000492152 | 287 |
| 136 | 3300006175 | Ga0070712_100002958 | Ga0070712_1000029587 | 287 |
| 137 | 3300010375 | Ga0105239_10085098 | Ga0105239_100850982 | 287 |
| 138 | 3300011119 | Ga0105246_10042239 | Ga0105246_100422392 | 287 |
| 139 | 3300013308 | Ga0157375_10030198 | Ga0157375_100301983 | 287 |
| 140 | 3300014969 | Ga0157376_10105608 | Ga0157376_101056083 | 287 |
| 141 | 3300025898 | Ga0207692_10000763 | Ga0207692_100007635 | 287 |
| 142 | 3300025906 | Ga0207699_10000406 | Ga0207699_100004069 | 287 |
| 143 | 3300025915 | Ga0207693_10002846 | Ga0207693_100028463 | 287 |
| 144 | 3300025917 | Ga0207660_10072299 | Ga0207660_100722992 | 287 |
| 145 | 3300025928 | Ga0207700_10148493 | Ga0207700_101484932 | 287 |
| 146 | 3300025939 | Ga0207665_10007378 | Ga0207665_100073785 | 287 |
| 147 | 3300026023 | Ga0207677_10010738 | Ga0207677_100107384 | 287 |
| 148 | 3300031616 | Ga0307508_10103398 | Ga0307508_101033982 | 287 |
| 149 | 3300035083 | Ga0373926_0014548 | Ga0373926_0014548_654_1550 | 287 |
| 150 | 3300035086 | Ga0373934_0038811 | Ga0373934_0038811_441_1337 | 287 |
| 151 | 3300035410 | Ga0373924_0016752 | Ga0373924_0016752_1154_2050 | 287 |
| 152 | 3300035692 | Ga0373935_0081185 | Ga0373935_0081185_829_1725 | 287 |
| 153 | 3300035695 | Ga0373927_0043468 | Ga0373927_0043468_606_1502 | 287 |
| 154 | 3300035724 | Ga0373933_0074105 | Ga0373933_0074105_1066_1962 | 287 |
| 155 | 3300035725 | Ga0373947_0006447 | Ga0373947_0006447_3500_4396 | 287 |
| 156 | 3300046472 | Ga0495580_0003657 | Ga0495580_0003657_6897_7793 | 287 |
| 157 | 3300046473 | Ga0495582_0027266 | Ga0495582_0027266_838_1734 | 287 |
| 158 | 3300046492 | Ga0495585_0011478 | Ga0495585_0011478_3408_4310 | 287 |
| 159 | 3300046514 | Ga0495618_0065708 | Ga0495618_0065708_878_1774 | 287 |
| 160 | 3300046531 | Ga0495665_0066247 | Ga0495665_0066247_451_1347 | 287 |
| 161 | 3300046559 | Ga0495667_0076418 | Ga0495667_0076418_1127_2023 | 287 |
| 162 | 3300046642 | Ga0495634_0018688 | Ga0495634_0018688_682_1578 | 287 |
| 163 | 3300046683 | Ga0495658_0018566 | Ga0495658_0018566_2116_3012 | 287 |
| 164 | 3300046684 | Ga0495669_0112330 | Ga0495669_0112330_256_1155 | 287 |
| 165 | 3300046689 | Ga0495613_0123948 | Ga0495613_0123948_261_1157 | 287 |
| 166 | 3300047319 | Ga0495674_0008705 | Ga0495674_0008705_8017_8913 | 287 |
| 167 | 3300047321 | Ga0495676_0096204 | Ga0495676_0096204_279_1175 | 287 |
| 168 | 3300047321 | Ga0495676_0263286 | Ga0495676_0263286_282_1160 | 287 |
| 169 | 3300047471 | Ga0495684_0029473 | Ga0495684_0029473_2289_3185 | 287 |
| 170 | 3300048903 | Ga0496100_0045007 | Ga0496100_0045007_509_1408 | 287 |
| 171 | 3300048904 | Ga0496101_0000648 | Ga0496101_0000648_5824_6723 | 287 |
| 172 | 3300048905 | Ga0496102_0005693 | Ga0496102_0005693_8401_9300 | 287 |
| 173 | 3300048907 | Ga0496104_0010866 | Ga0496104_0010866_2639_3538 | 287 |
| 174 | 3300048908 | Ga0496105_0004124 | Ga0496105_0004124_1938_2837 | 287 |
| 175 | 3300048915 | Ga0496112_0549658 | Ga0496112_0549658_135_1034 | 287 |
| 176 | 3300048916 | Ga0496113_0074614 | Ga0496113_0074614_1253_2152 | 287 |
| 177 | 3300048918 | Ga0496115_0013729 | Ga0496115_0013729_2200_3099 | 287 |
| 178 | 3300048924 | Ga0496121_0146381 | Ga0496121_0146381_520_1425 | 287 |
| 179 | 3300053077 | Ga0495601_0012431 | Ga0495601_0012431_2903_3799 | 287 |
| 180 | 3300053078 | Ga0495612_0039972 | Ga0495612_0039972_360_1256 | 287 |
| 181 | iso_pu_bacteria | 2507262055 | 2507508222 | 287 |
| 182 | iso_pu_bacteria | 2508501009 | 2508542291 | 287 |
| 183 | iso_pu_bacteria | 2511231028 | 2511397522 | 287 |
| 184 | iso_pu_bacteria | 2513237092 | 2513622351 | 287 |
| 185 | iso_pu_bacteria | 2513237094 | 2513640528 | 287 |
| 186 | iso_pu_bacteria | 2513237102 | 2513701718 | 287 |
| 187 | iso_pu_bacteria | 2513237139 | 2513873136 | 287 |
| 188 | iso_pu_bacteria | 2517093001 | 2517102625 | 287 |
| 189 | iso_pu_bacteria | 2524023205 | 2524437735 | 287 |
| 190 | iso_pu_bacteria | 2528768022 | 2528848704 | 287 |
| 191 | iso_pu_bacteria | 2617270741 | 2617375413 | 287 |
| 192 | iso_pu_bacteria | 2744054633 | 2745081202 | 287 |
| 193 | iso_pu_bacteria | 2802429603 | 2805914965 | 287 |
| 194 | iso_pu_bacteria | 2824617872 | 2824618111 | 287 |
| 195 | iso_pu_bacteria | 2824626560 | 2824626779 | 287 |
| 196 | iso_pu_bacteria | 2824635225 | 2824636586 | 287 |
| 197 | iso_pu_bacteria | 2824644064 | 2824645120 | 287 |
| 198 | iso_pu_bacteria | 2824661429 | 2824661591 | 287 |
| 199 | iso_pu_bacteria | 2824679649 | 2824679864 | 287 |
| 200 | iso_pu_bacteria | 2824714736 | 2824715719 | 287 |
| 201 | iso_pu_bacteria | 2824723954 | 2824725202 | 287 |
| 202 | iso_pu_bacteria | 2824732956 | 2824733426 | 287 |
| 203 | iso_pu_bacteria | 2824746037 | 2824746447 | 287 |
| 204 | iso_pu_bacteria | 2841957949 | 2841960977 | 287 |
| 205 | iso_pu_bacteria | 2874612657 | 2874619377 | 287 |
| 206 | iso_pu_bacteria | 2874628541 | 2874632270 | 287 |
| 207 | iso_pu_bacteria | 2874645413 | 2874652537 | 287 |
| 208 | iso_pu_bacteria | 2879083081 | 2879088073 | 287 |
| 209 | iso_pu_bacteria | 2879099564 | 2879108344 | 287 |
| 210 | iso_pu_bacteria | 2906643746 | 2906646193 | 287 |
| 211 | iso_pu_bacteria | 2908775508 | 2908780529 | 287 |
| 212 | iso_pu_bacteria | 2922368715 | 2922374888 | 287 |
| 213 | iso_pu_bacteria | 2922393267 | 2922400427 | 287 |
| 214 | iso_pu_bacteria | 2929615660 | 2929621932 | 287 |
| 215 | iso_pu_bacteria | 2929624759 | 2929629761 | 287 |
| 216 | iso_pu_bacteria | 2932784394 | 2932788799 | 287 |
| 217 | iso_pu_bacteria | 2932794094 | 2932797996 | 287 |
| 218 | iso_pu_bacteria | 2932801729 | 2932807162 | 287 |
| 219 | iso_pu_bacteria | 2932818245 | 2932819135 | 287 |
| 220 | iso_pu_bacteria | 2932828146 | 2932830465 | 287 |
| 221 | iso_pu_bacteria | 2933577622 | 2933583792 | 287 |
| 222 | iso_pu_bacteria | 2935608549 | 2935609295 | 287 |
| 223 | iso_pu_bacteria | 2935616580 | 2935616759 | 287 |
| 224 | iso_pu_bacteria | 2935638405 | 2935641911 | 287 |
| 225 | iso_pu_bacteria | 2935665750 | 2935673042 | 287 |
| 226 | iso_pu_bacteria | 2935675223 | 2935675847 | 287 |
| 227 | iso_pu_bacteria | 2935684952 | 2935685844 | 287 |
| 228 | iso_pu_bacteria | 2935694250 | 2935697910 | 287 |
| 229 | iso_pu_bacteria | 2935703347 | 2935705684 | 287 |
| 230 | iso_pu_bacteria | 2935713505 | 2935714396 | 287 |
| 231 | iso_pu_bacteria | 2935722832 | 2935725015 | 287 |
| 232 | iso_pu_bacteria | 2935732158 | 2935732626 | 287 |
| 233 | iso_pu_bacteria | 2935741537 | 2935742005 | 287 |
| 234 | iso_pu_bacteria | 2935750917 | 2935751809 | 287 |
| 235 | iso_pu_bacteria | 2935760218 | 2935765066 | 287 |
| 236 | iso_pu_bacteria | 2935801545 | 2935802662 | 287 |
| 237 | iso_pu_bacteria | 2935810662 | 2935813508 | 287 |
| 238 | iso_pu_bacteria | 2935819856 | 2935822455 | 287 |
| 239 | iso_pu_bacteria | 2935827899 | 2935830078 | 287 |
| 240 | iso_pu_bacteria | 2935837841 | 2935837996 | 287 |
| 241 | iso_pu_bacteria | 2935847175 | 2935848038 | 287 |
| 242 | iso_pu_bacteria | 2935855204 | 2935855383 | 287 |
| 243 | iso_pu_bacteria | 2935864058 | 2935867373 | 287 |
| 244 | iso_pu_bacteria | 2935873716 | 2935875808 | 287 |
| 245 | iso_pu_bacteria | 2935883170 | 2935886723 | 287 |
| 246 | iso_pu_bacteria | 2935908558 | 2935908739 | 287 |
| 247 | iso_pu_bacteria | 2935916978 | 2935917884 | 287 |
| 248 | iso_pu_bacteria | 2935926038 | 2935926687 | 287 |
| 249 | iso_pu_bacteria | 2935934488 | 2935935137 | 287 |
| 250 | iso_pu_bacteria | 2935942939 | 2935943587 | 287 |
| 251 | iso_pu_bacteria | 2935951376 | 2935952025 | 287 |
| 252 | iso_pu_bacteria | 2935967501 | 2935968150 | 287 |
| 253 | iso_pu_bacteria | 2935975950 | 2935978766 | 287 |
| 254 | iso_pu_bacteria | 2935992306 | 2935996472 | 287 |
| 255 | iso_pu_bacteria | 2936002035 | 2936003752 | 287 |
| 256 | iso_pu_bacteria | 2936037263 | 2936042457 | 287 |
| 257 | iso_pu_bacteria | 2940556831 | 2940557388 | 287 |
| 258 | iso_pu_bacteria | 2941531003 | 2941533179 | 287 |
| 259 | iso_pu_bacteria | 2941538514 | 2941539338 | 287 |
| 260 | iso_pu_bacteria | 3005483717 | 3005484659 | 287 |
| 261 | iso_pu_bacteria | 3005506211 | 3005510671 | 287 |
| 262 | iso_pu_bacteria | 3005587118 | 3005587690 | 287 |
| 263 | iso_pu_bacteria | 3005594810 | 3005599608 | 287 |
| 264 | iso_pu_bacteria | 3005718088 | 3005722645 | 287 |
| 265 | iso_pu_bacteria | 8016511872 | 8016521828 | 287 |
| 266 | iso_pu_bacteria | 8017057580 | 8017063826 | 287 |
| 267 | iso_pu_bacteria | 8019576017 | 8019583175 | 287 |
| 268 | iso_pu_bacteria | 8019597564 | 8019600367 | 287 |
| 269 | iso_pu_bacteria | 8019608314 | 8019618176 | 287 |
| 270 | iso_pu_bacteria | 8019629233 | 8019634063 | 287 |
| 271 | iso_pu_bacteria | 8019638758 | 8019645666 | 287 |
| 272 | iso_pu_bacteria | 8019648815 | 8019658929 | 287 |
| 273 | iso_pu_bacteria | 8019659431 | 8019661942 | 287 |
| 274 | iso_pu_bacteria | 8019687851 | 8019690461 | 287 |
| 275 | iso_pu_bacteria | 8055742211 | 8055745902 | 287 |
| 276 | 3300005336 | Ga0070680_100070194 | Ga0070680_1000701942 | 288 |
| 277 | 3300005436 | Ga0070713_100118871 | Ga0070713_1001188712 | 288 |
| 278 | 3300005437 | Ga0070710_10039694 | Ga0070710_100396941 | 288 |
| 279 | 3300005439 | Ga0070711_100017822 | Ga0070711_1000178222 | 288 |
| 280 | 3300005455 | Ga0070663_100080316 | Ga0070663_1000803162 | 288 |
| 281 | 3300005458 | Ga0070681_10119263 | Ga0070681_101192633 | 288 |
| 282 | 3300005530 | Ga0070679_100066794 | Ga0070679_1000667943 | 288 |
| 283 | 3300005539 | Ga0068853_100495582 | Ga0068853_1004955821 | 288 |
| 284 | 3300009551 | Ga0105238_10130968 | Ga0105238_101309682 | 288 |
| 285 | 3300009551 | Ga0105238_10190362 | Ga0105238_101903622 | 288 |
| 286 | 3300013307 | Ga0157372_10247008 | Ga0157372_102470082 | 288 |
| 287 | 3300025904 | Ga0207647_10136119 | Ga0207647_101361192 | 288 |
| 288 | 3300025912 | Ga0207707_10000173 | Ga0207707_1000017363 | 288 |
| 289 | 3300025916 | Ga0207663_10067588 | Ga0207663_100675882 | 288 |
| 290 | 3300025919 | Ga0207657_10004866 | Ga0207657_100048669 | 288 |
| 291 | 3300025928 | Ga0207700_10016062 | Ga0207700_100160622 | 288 |
| 292 | 3300025949 | Ga0207667_10252623 | Ga0207667_102526232 | 288 |
| 293 | 3300031456 | Ga0307513_10198080 | Ga0307513_101980802 | 288 |
| 294 | 3300037466 | Ga0395898_0206514 | Ga0395898_0206514_685_1578 | 288 |
| 295 | 3300038443 | Ga0395901_0033905 | Ga0395901_0033905_490_1383 | 288 |
| 296 | 3300039437 | Ga0436365_0935505 | Ga0436365_0935505_23681_24589 | 288 |
| 297 | 3300039437 | Ga0436365_1198843 | Ga0436365_1198843_137_1036 | 288 |
| 298 | 3300039453 | Ga0436362_1191906 | Ga0436362_1191906_547_1455 | 288 |
| 299 | 3300045976 | Ga0466967_0046202 | Ga0466967_0046202_2804_3703 | 288 |
| 300 | 3300045976 | Ga0466967_0250626 | Ga0466967_0250626_747_1661 | 288 |
| 301 | 3300045976 | Ga0466967_0473230 | Ga0466967_0473230_160_1059 | 288 |
| 302 | 3300048911 | Ga0496108_0337434 | Ga0496108_0337434_48_953 | 288 |
| 303 | 3300048912 | Ga0496109_0132643 | Ga0496109_0132643_312_1217 | 288 |
| 304 | 3300048913 | Ga0496110_0220740 | Ga0496110_0220740_307_1212 | 288 |
| 305 | 3300048915 | Ga0496112_0106666 | Ga0496112_0106666_965_1870 | 288 |
| 306 | 3300048929 | Ga0496126_0045817 | Ga0496126_0045817_771_1670 | 288 |
| 307 | 3300048929 | Ga0496126_0096446 | Ga0496126_0096446_568_1467 | 288 |
| 308 | 3300049570 | Ga0501033_0026010 | Ga0501033_0026010_1281_2204 | 288 |
| 309 | 3300049571 | Ga0501034_0242093 | Ga0501034_0242093_399_1322 | 288 |
| 310 | 3300049572 | Ga0501036_0174359 | Ga0501036_0174359_614_1537 | 288 |
| 311 | 3300049575 | Ga0501039_0110699 | Ga0501039_0110699_282_1205 | 288 |
| 312 | 3300049579 | Ga0501043_0088222 | Ga0501043_0088222_132_1049 | 288 |
| 313 | 3300049580 | Ga0501046_0064839 | Ga0501046_0064839_1704_2603 | 288 |
| 314 | 3300049581 | Ga0501047_0287716 | Ga0501047_0287716_349_1248 | 288 |
| 315 | 3300049742 | Ga0501080_0053502 | Ga0501080_0053502_936_1835 | 288 |
| 316 | 3300049822 | Ga0501035_0156715 | Ga0501035_0156715_450_1373 | 288 |
| 317 | 3300049823 | Ga0501044_0052312 | Ga0501044_0052312_462_1361 | 288 |
| 318 | 3300049823 | Ga0501044_0079171 | Ga0501044_0079171_1465_2388 | 288 |
| 319 | iso_pu_bacteria | 2508501042 | 2508691947 | 288 |
| 320 | iso_pu_bacteria | 2513237095 | 2513645446 | 288 |
| 321 | iso_pu_bacteria | 2513237104 | 2513718394 | 288 |
| 322 | iso_pu_bacteria | 2816332527 | 2818239673 | 288 |
| 323 | iso_pu_bacteria | 2844315083 | 2844319407 | 288 |
| 324 | iso_pu_bacteria | 2888378607 | 2888384476 | 288 |
| 325 | iso_pu_bacteria | 2888388044 | 2888393434 | 288 |
| 326 | iso_pu_bacteria | 2903727486 | 2903734349 | 288 |
| 327 | iso_pu_bacteria | 2906602504 | 2906605593 | 288 |
| 328 | iso_pu_bacteria | 2935648319 | 2935650915 | 288 |
| 329 | iso_pu_bacteria | 2935656913 | 2935659096 | 288 |
| 330 | iso_pu_bacteria | 2935769743 | 2935771681 | 288 |
| 331 | iso_pu_bacteria | 2935777560 | 2935778904 | 288 |
| 332 | iso_pu_bacteria | 2935785616 | 2935791175 | 288 |
| 333 | iso_pu_bacteria | 2935793552 | 2935795496 | 288 |
| 334 | iso_pu_bacteria | 2935959822 | 2935960788 | 288 |
| 335 | iso_pu_bacteria | 2935984226 | 2935987365 | 288 |
| 336 | iso_pu_bacteria | 2936011229 | 2936013511 | 288 |
| 337 | iso_pu_bacteria | 2936019824 | 2936022362 | 288 |
| 338 | iso_pu_bacteria | 2936028420 | 2936030808 | 288 |
| 339 | iso_pu_bacteria | 2936046547 | 2936048621 | 288 |
| 340 | iso_pu_bacteria | 2936055302 | 2936058835 | 288 |
| 341 | iso_pu_bacteria | 3005710791 | 3005715265 | 288 |
| 342 | iso_pu_bacteria | 8006926726 | 8006933114 | 288 |
| 343 | iso_pu_bacteria | 8016530956 | 8016534447 | 288 |
| 344 | iso_pu_bacteria | 8016539877 | 8016547670 | 288 |
| 345 | iso_pu_bacteria | 8016566248 | 8016572789 | 288 |
| 346 | iso_pu_bacteria | 8016575299 | 8016576947 | 288 |
| 347 | iso_pu_bacteria | 8016583857 | 8016593271 | 288 |
| 348 | iso_pu_bacteria | 8016595262 | 8016600616 | 288 |
| 349 | iso_pu_bacteria | 8016613128 | 8016614810 | 288 |
| 350 | iso_pu_bacteria | 8016622563 | 8016626164 | 288 |
| 351 | iso_pu_bacteria | 8019530166 | 8019534209 | 288 |
| 352 | iso_pu_bacteria | 8019538911 | 8019545250 | 288 |
| 353 | 3300003203 | JGI25406J46586_10012828 | JGI25406J46586_100128283 | 289 |
| 354 | 3300003659 | JGI25404J52841_10008171 | JGI25404J52841_100081711 | 289 |
| 355 | 3300003659 | JGI25404J52841_10008986 | JGI25404J52841_100089862 | 289 |
| 356 | 3300003659 | JGI25404J52841_10012809 | JGI25404J52841_100128092 | 289 |
| 357 | 3300003659 | JGI25404J52841_10015588 | JGI25404J52841_100155882 | 289 |
| 358 | 3300005344 | Ga0070661_100046142 | Ga0070661_1000461422 | 289 |
| 359 | 3300005347 | Ga0070668_100227548 | Ga0070668_1002275481 | 289 |
| 360 | 3300005347 | Ga0070668_100266628 | Ga0070668_1002666282 | 289 |
| 361 | 3300005354 | Ga0070675_100421215 | Ga0070675_1004212152 | 289 |
| 362 | 3300005355 | Ga0070671_100199647 | Ga0070671_1001996472 | 289 |
| 363 | 3300005355 | Ga0070671_100222650 | Ga0070671_1002226502 | 289 |
| 364 | 3300005367 | Ga0070667_100178997 | Ga0070667_1001789973 | 289 |
| 365 | 3300005434 | Ga0070709_10002717 | Ga0070709_100027173 | 289 |
| 366 | 3300005435 | Ga0070714_100015456 | Ga0070714_1000154562 | 289 |
| 367 | 3300005436 | Ga0070713_100127150 | Ga0070713_1001271502 | 289 |
| 368 | 3300005436 | Ga0070713_100355606 | Ga0070713_1003556062 | 289 |
| 369 | 3300005437 | Ga0070710_10056197 | Ga0070710_100561973 | 289 |
| 370 | 3300005439 | Ga0070711_100205740 | Ga0070711_1002057401 | 289 |
| 371 | 3300005455 | Ga0070663_100012111 | Ga0070663_1000121114 | 289 |
| 372 | 3300005471 | Ga0070698_100130074 | Ga0070698_1001300742 | 289 |
| 373 | 3300005547 | Ga0070693_100260776 | Ga0070693_1002607762 | 289 |
| 374 | 3300005548 | Ga0070665_100020157 | Ga0070665_1000201572 | 289 |
| 375 | 3300005548 | Ga0070665_100112936 | Ga0070665_1001129362 | 289 |
| 376 | 3300005563 | Ga0068855_100066996 | Ga0068855_1000669964 | 289 |
| 377 | 3300005617 | Ga0068859_100166183 | Ga0068859_1001661832 | 289 |
| 378 | 3300005842 | Ga0068858_100265715 | Ga0068858_1002657151 | 289 |
| 379 | 3300005843 | Ga0068860_100158090 | Ga0068860_1001580902 | 289 |
| 380 | 3300005844 | Ga0068862_100477570 | Ga0068862_1004775701 | 289 |
| 381 | 3300005937 | Ga0081455_10005931 | Ga0081455_100059315 | 289 |
| 382 | 3300005937 | Ga0081455_10007164 | Ga0081455_100071642 | 289 |
| 383 | 3300005937 | Ga0081455_10077607 | Ga0081455_100776072 | 289 |
| 384 | 3300005937 | Ga0081455_10175135 | Ga0081455_101751352 | 289 |
| 385 | 3300005983 | Ga0081540_1005943 | Ga0081540_10059435 | 289 |
| 386 | 3300005983 | Ga0081540_1008063 | Ga0081540_10080636 | 289 |
| 387 | 3300005983 | Ga0081540_1010718 | Ga0081540_10107185 | 289 |
| 388 | 3300005983 | Ga0081540_1026578 | Ga0081540_10265782 | 289 |
| 389 | 3300005983 | Ga0081540_1028376 | Ga0081540_10283763 | 289 |
| 390 | 3300005983 | Ga0081540_1037129 | Ga0081540_10371292 | 289 |
| 391 | 3300005983 | Ga0081540_1042937 | Ga0081540_10429372 | 289 |
| 392 | 3300005983 | Ga0081540_1068230 | Ga0081540_10682302 | 289 |
| 393 | 3300005985 | Ga0081539_10000199 | Ga0081539_10000199139 | 289 |
| 394 | 3300006028 | Ga0070717_10087773 | Ga0070717_100877732 | 289 |
| 395 | 3300006028 | Ga0070717_10303401 | Ga0070717_103034012 | 289 |
| 396 | 3300006163 | Ga0070715_10007524 | Ga0070715_100075242 | 289 |
| 397 | 3300006173 | Ga0070716_100006597 | Ga0070716_1000065973 | 289 |
| 398 | 3300006175 | Ga0070712_100259656 | Ga0070712_1002596562 | 289 |
| 399 | 3300006178 | Ga0075367_10025647 | Ga0075367_100256473 | 289 |
| 400 | 3300006871 | Ga0075434_100259227 | Ga0075434_1002592272 | 289 |
| 401 | 3300006931 | Ga0097620_100166187 | Ga0097620_1001661873 | 289 |
| 402 | 3300006942 | Ga0099824_1025369 | Ga0099824_10253692 | 289 |
| 403 | 3300006943 | Ga0099822_1003531 | Ga0099822_10035319 | 289 |
| 404 | 3300009176 | Ga0105242_10246729 | Ga0105242_102467292 | 289 |
| 405 | 3300009177 | Ga0105248_10199139 | Ga0105248_101991393 | 289 |
| 406 | 3300009545 | Ga0105237_10128323 | Ga0105237_101283233 | 289 |
| 407 | 3300010159 | Ga0099796_10068039 | Ga0099796_100680391 | 289 |
| 408 | 3300010375 | Ga0105239_10068406 | Ga0105239_100684062 | 289 |
| 409 | 3300013308 | Ga0157375_10386730 | Ga0157375_103867302 | 289 |
| 410 | 3300014325 | Ga0163163_10016615 | Ga0163163_100166157 | 289 |
| 411 | 3300014325 | Ga0163163_10278639 | Ga0163163_102786393 | 289 |
| 412 | 3300014325 | Ga0163163_10387578 | Ga0163163_103875782 | 289 |
| 413 | 3300014325 | Ga0163163_10525131 | Ga0163163_105251311 | 289 |
| 414 | 3300014326 | Ga0157380_10390589 | Ga0157380_103905892 | 289 |
| 415 | 3300017792 | Ga0163161_10279004 | Ga0163161_102790042 | 289 |
| 416 | 3300025898 | Ga0207692_10000845 | Ga0207692_100008452 | 289 |
| 417 | 3300025898 | Ga0207692_10043469 | Ga0207692_100434693 | 289 |
| 418 | 3300025905 | Ga0207685_10052499 | Ga0207685_100524992 | 289 |
| 419 | 3300025907 | Ga0207645_10076723 | Ga0207645_100767233 | 289 |
| 420 | 3300025915 | Ga0207693_10001388 | Ga0207693_1000138812 | 289 |
| 421 | 3300025915 | Ga0207693_10043859 | Ga0207693_100438593 | 289 |
| 422 | 3300025916 | Ga0207663_10000515 | Ga0207663_1000051515 | 289 |
| 423 | 3300025916 | Ga0207663_10027987 | Ga0207663_100279872 | 289 |
| 424 | 3300025919 | Ga0207657_10066317 | Ga0207657_100663171 | 289 |
| 425 | 3300025928 | Ga0207700_10036858 | Ga0207700_100368582 | 289 |
| 426 | 3300025929 | Ga0207664_10103952 | Ga0207664_101039522 | 289 |
| 427 | 3300025929 | Ga0207664_10245356 | Ga0207664_102453562 | 289 |
| 428 | 3300025931 | Ga0207644_10093767 | Ga0207644_100937672 | 289 |
| 429 | 3300025931 | Ga0207644_10173938 | Ga0207644_101739382 | 289 |
| 430 | 3300025934 | Ga0207686_10425400 | Ga0207686_104254001 | 289 |
| 431 | 3300025938 | Ga0207704_10081926 | Ga0207704_100819262 | 289 |
| 432 | 3300025939 | Ga0207665_10000874 | Ga0207665_1000087411 | 289 |
| 433 | 3300025941 | Ga0207711_10106198 | Ga0207711_101061982 | 289 |
| 434 | 3300025942 | Ga0207689_10423864 | Ga0207689_104238642 | 289 |
| 435 | 3300025949 | Ga0207667_10092380 | Ga0207667_100923802 | 289 |
| 436 | 3300025972 | Ga0207668_10208694 | Ga0207668_102086942 | 289 |
| 437 | 3300025986 | Ga0207658_10128551 | Ga0207658_101285513 | 289 |
| 438 | 3300026067 | Ga0207678_10031260 | Ga0207678_100312604 | 289 |
| 439 | 3300026067 | Ga0207678_10397758 | Ga0207678_103977581 | 289 |
| 440 | 3300026118 | Ga0207675_100352124 | Ga0207675_1003521242 | 289 |
| 441 | 3300026121 | Ga0207683_10250652 | Ga0207683_102506521 | 289 |
| 442 | 3300027357 | Ga0209589_1000011 | Ga0209589_100001126 | 289 |
| 443 | 3300027361 | Ga0209489_100012 | Ga0209489_10001226 | 289 |
| 444 | 3300027363 | Ga0209700_100019 | Ga0209700_10001926 | 289 |
| 445 | 3300028379 | Ga0268266_10002874 | Ga0268266_1000287414 | 289 |
| 446 | 3300028379 | Ga0268266_10013866 | Ga0268266_100138663 | 289 |
| 447 | 3300028379 | Ga0268266_10072145 | Ga0268266_100721453 | 289 |
| 448 | 3300028786 | Ga0307517_10000279 | Ga0307517_1000027938 | 289 |
| 449 | 3300031238 | Ga0265332_10056874 | Ga0265332_100568742 | 289 |
| 450 | 3300031507 | Ga0307509_10019751 | Ga0307509_100197514 | 289 |
| 451 | 3300031616 | Ga0307508_10028758 | Ga0307508_100287582 | 289 |
| 452 | 3300031730 | Ga0307516_10014449 | Ga0307516_100144496 | 289 |
| 453 | 3300031730 | Ga0307516_10116424 | Ga0307516_101164242 | 289 |
| 454 | 3300033180 | Ga0307510_10048801 | Ga0307510_100488014 | 289 |
| 455 | 3300033180 | Ga0307510_10189248 | Ga0307510_101892482 | 289 |
| 456 | 3300033442 | Ga0315911_1000003 | Ga0315911_1000003432 | 289 |
| 457 | 3300035085 | Ga0373929_0010713 | Ga0373929_0010713_576_1481 | 289 |
| 458 | 3300035112 | Ga0373932_0010230 | Ga0373932_0010230_692_1597 | 289 |
| 459 | 3300035170 | Ga0373943_0108685 | Ga0373943_0108685_524_1432 | 289 |
| 460 | 3300035241 | Ga0373961_0016775 | Ga0373961_0016775_918_1823 | 289 |
| 461 | 3300035691 | Ga0373931_0015025 | Ga0373931_0015025_1006_1911 | 289 |
| 462 | 3300035695 | Ga0373927_0029888 | Ga0373927_0029888_1531_2439 | 289 |
| 463 | 3300035695 | Ga0373927_0038537 | Ga0373927_0038537_1224_2129 | 289 |
| 464 | 3300035695 | Ga0373927_0074918 | Ga0373927_0074918_520_1425 | 289 |
| 465 | 3300037068 | Ga0373925_0098681 | Ga0373925_0098681_1114_2022 | 289 |
| 466 | 3300037471 | Ga0395905_0092992 | Ga0395905_0092992_55_963 | 289 |
| 467 | 3300039438 | Ga0436360_0216274 | Ga0436360_0216274_459_1343 | 289 |
| 468 | 3300041459 | Ga0451800_0677031 | Ga0451800_0677031_133_1041 | 289 |
| 469 | 3300046455 | Ga0495603_0002054 | Ga0495603_0002054_1390_2298 | 289 |
| 470 | 3300046457 | Ga0495590_0079111 | Ga0495590_0079111_133_1041 | 289 |
| 471 | 3300046462 | Ga0495651_0102828 | Ga0495651_0102828_455_1357 | 289 |
| 472 | 3300046473 | Ga0495582_0148154 | Ga0495582_0148154_318_1226 | 289 |
| 473 | 3300046512 | Ga0495610_0095158 | Ga0495610_0095158_450_1319 | 289 |
| 474 | 3300046519 | Ga0495632_0081478 | Ga0495632_0081478_526_1428 | 289 |
| 475 | 3300046557 | Ga0495622_0017465 | Ga0495622_0017465_1812_2720 | 289 |
| 476 | 3300046616 | Ga0495668_0205347 | Ga0495668_0205347_125_1033 | 289 |
| 477 | 3300046691 | Ga0495670_0053234 | Ga0495670_0053234_955_1863 | 289 |
| 478 | 3300047323 | Ga0495683_0022488 | Ga0495683_0022488_1311_2219 | 289 |
| 479 | 3300047469 | Ga0495673_0052908 | Ga0495673_0052908_584_1492 | 289 |
| 480 | 3300048904 | Ga0496101_0034163 | Ga0496101_0034163_1458_2363 | 289 |
| 481 | 3300048904 | Ga0496101_0222232 | Ga0496101_0222232_133_1041 | 289 |
| 482 | 3300048907 | Ga0496104_0399124 | Ga0496104_0399124_280_1185 | 289 |
| 483 | 3300048908 | Ga0496105_0100507 | Ga0496105_0100507_181_1086 | 289 |
| 484 | 3300048909 | Ga0496106_0175261 | Ga0496106_0175261_281_1189 | 289 |
| 485 | 3300048909 | Ga0496106_0283935 | Ga0496106_0283935_383_1291 | 289 |
| 486 | 3300048910 | Ga0496107_0027901 | Ga0496107_0027901_2449_3354 | 289 |
| 487 | 3300048911 | Ga0496108_0048242 | Ga0496108_0048242_793_1698 | 289 |
| 488 | 3300048911 | Ga0496108_0545047 | Ga0496108_0545047_85_990 | 289 |
| 489 | 3300048912 | Ga0496109_0152961 | Ga0496109_0152961_796_1701 | 289 |
| 490 | 3300048912 | Ga0496109_0290110 | Ga0496109_0290110_105_1013 | 289 |
| 491 | 3300048913 | Ga0496110_0071937 | Ga0496110_0071937_1014_1919 | 289 |
| 492 | 3300048913 | Ga0496110_0200282 | Ga0496110_0200282_528_1436 | 289 |
| 493 | 3300048914 | Ga0496111_0069319 | Ga0496111_0069319_1174_2079 | 289 |
| 494 | 3300048915 | Ga0496112_0057096 | Ga0496112_0057096_1176_2084 | 289 |
| 495 | 3300048915 | Ga0496112_0063694 | Ga0496112_0063694_1014_1919 | 289 |
| 496 | 3300048916 | Ga0496113_0044199 | Ga0496113_0044199_249_1154 | 289 |
| 497 | 3300048917 | Ga0496114_0020318 | Ga0496114_0020318_3327_4232 | 289 |
| 498 | 3300048917 | Ga0496114_0303865 | Ga0496114_0303865_101_1006 | 289 |
| 499 | 3300048918 | Ga0496115_0111755 | Ga0496115_0111755_674_1582 | 289 |
| 500 | 3300048918 | Ga0496115_0161520 | Ga0496115_0161520_895_1800 | 289 |
| 501 | 3300048918 | Ga0496115_0490480 | Ga0496115_0490480_39_947 | 289 |
| 502 | 3300048927 | Ga0496124_0239553 | Ga0496124_0239553_91_999 | 289 |
| 503 | 3300049573 | Ga0501037_0092548 | Ga0501037_0092548_402_1310 | 289 |
| 504 | 3300049574 | Ga0501038_0254420 | Ga0501038_0254420_178_1086 | 289 |
| 505 | 3300049582 | Ga0501048_0209357 | Ga0501048_0209357_78_986 | 289 |
| 506 | 3300049583 | Ga0501067_0038236 | Ga0501067_0038236_573_1475 | 289 |
| 507 | 3300049743 | Ga0501081_0329751 | Ga0501081_0329751_70_978 | 289 |
| 508 | 3300050490 | nmdc:mga03n38_8874_c1 | nmdc:mga03n38_8874_c1_1827_2735 | 289 |
| 509 | 3300050491 | nmdc:mga00v17_198947_c1 | nmdc:mga00v17_198947_c1_41_949 | 289 |
| 510 | 3300050494 | nmdc:mga06z11_5930_c1 | nmdc:mga06z11_5930_c1_2173_3081 | 289 |
| 511 | 3300050512 | nmdc:mga0n895_470832_c1 | nmdc:mga0n895_470832_c1_189_1091 | 289 |
| 512 | 3300053078 | Ga0495612_0096784 | Ga0495612_0096784_298_1203 | 289 |
| 513 | 3300053094 | Ga0500566_0039034 | Ga0500566_0039034_1577_2485 | 289 |
| 514 | 3300053119 | Ga0500595_000395 | Ga0500595_000395_6608_7516 | 289 |
| 515 | 3300053136 | Ga0500559_0001626 | Ga0500559_0001626_7433_8323 | 289 |
| 516 | 3300053162 | Ga0500638_016718 | Ga0500638_016718_1177_2085 | 289 |
| 517 | 3300053163 | Ga0500639_036153 | Ga0500639_036153_714_1604 | 289 |
| 518 | 3300053178 | Ga0500637_0000026 | Ga0500637_0000026_17410_18318 | 289 |
| 519 | 3300054114 | Ga0501084_0210855 | Ga0501084_0210855_652_1560 | 289 |
| 520 | 3300055283 | Ga0500661_002036 | Ga0500661_002036_700_1608 | 289 |
| 521 | iso_pu_bacteria | 2517572143 | 2517891144 | 289 |
| 522 | 3300005327 | Ga0070658_10222921 | Ga0070658_102229212 | 290 |
| 523 | 3300005336 | Ga0070680_100053378 | Ga0070680_1000533782 | 290 |
| 524 | 3300005339 | Ga0070660_100152696 | Ga0070660_1001526962 | 290 |
| 525 | 3300005344 | Ga0070661_100051701 | Ga0070661_1000517013 | 290 |
| 526 | 3300005366 | Ga0070659_100062805 | Ga0070659_1000628052 | 290 |
| 527 | 3300005535 | Ga0070684_100364289 | Ga0070684_1003642891 | 290 |
| 528 | 3300005539 | Ga0068853_100089035 | Ga0068853_1000890352 | 290 |
| 529 | 3300005577 | Ga0068857_100084315 | Ga0068857_1000843153 | 290 |
| 530 | 3300005616 | Ga0068852_100010249 | Ga0068852_1000102494 | 290 |
| 531 | 3300007265 | Ga0099794_10037901 | Ga0099794_100379012 | 290 |
| 532 | 3300009093 | Ga0105240_10165300 | Ga0105240_101653002 | 290 |
| 533 | 3300009545 | Ga0105237_10021235 | Ga0105237_100212352 | 290 |
| 534 | 3300009551 | Ga0105238_10425174 | Ga0105238_104251742 | 290 |
| 535 | 3300010159 | Ga0099796_10053280 | Ga0099796_100532802 | 290 |
| 536 | 3300010375 | Ga0105239_10070205 | Ga0105239_100702054 | 290 |
| 537 | 3300013105 | Ga0157369_10002009 | Ga0157369_1000200916 | 290 |
| 538 | 3300013105 | Ga0157369_10312654 | Ga0157369_103126542 | 290 |
| 539 | 3300025302 | Ga0207426_1021892 | Ga0207426_10218922 | 290 |
| 540 | 3300025909 | Ga0207705_10302729 | Ga0207705_103027292 | 290 |
| 541 | 3300025912 | Ga0207707_10043008 | Ga0207707_100430082 | 290 |
| 542 | 3300025913 | Ga0207695_10033658 | Ga0207695_100336583 | 290 |
| 543 | 3300025914 | Ga0207671_10054532 | Ga0207671_100545323 | 290 |
| 544 | 3300025917 | Ga0207660_10047666 | Ga0207660_100476663 | 290 |
| 545 | 3300025921 | Ga0207652_10034398 | Ga0207652_100343984 | 290 |
| 546 | 3300025932 | Ga0207690_10086011 | Ga0207690_100860113 | 290 |
| 547 | 3300026116 | Ga0207674_10042222 | Ga0207674_100422224 | 290 |
| 548 | 3300026142 | Ga0207698_10220911 | Ga0207698_102209112 | 290 |
| 549 | 3300027512 | Ga0209179_1016803 | Ga0209179_10168032 | 290 |
| 550 | 3300027671 | Ga0209588_1016287 | Ga0209588_10162872 | 290 |
| 551 | 3300028573 | Ga0265334_10009956 | Ga0265334_100099562 | 290 |
| 552 | 3300031238 | Ga0265332_10011140 | Ga0265332_100111403 | 290 |
| 553 | 3300031241 | Ga0265325_10010622 | Ga0265325_100106224 | 290 |
| 554 | 3300031247 | Ga0265340_10001234 | Ga0265340_1000123411 | 290 |
| 555 | 3300031249 | Ga0265339_10010858 | Ga0265339_100108582 | 290 |
| 556 | 3300031249 | Ga0265339_10129202 | Ga0265339_101292022 | 290 |
| 557 | 3300031344 | Ga0265316_10052801 | Ga0265316_100528012 | 290 |
| 558 | 3300035086 | Ga0373934_0070487 | Ga0373934_0070487_158_1072 | 290 |
| 559 | 3300035118 | Ga0373954_0010944 | Ga0373954_0010944_1308_2219 | 290 |
| 560 | 3300035119 | Ga0373956_0009384 | Ga0373956_0009384_503_1414 | 290 |
| 561 | 3300035120 | Ga0373957_0000546 | Ga0373957_0000546_1352_2263 | 290 |
| 562 | 3300035242 | Ga0373962_0023916 | Ga0373962_0023916_247_1158 | 290 |
| 563 | 3300035691 | Ga0373931_0022903 | Ga0373931_0022903_1024_1935 | 290 |
| 564 | 3300035691 | Ga0373931_0105874 | Ga0373931_0105874_176_1087 | 290 |
| 565 | 3300036401 | Ga0373937_0057708 | Ga0373937_0057708_980_1891 | 290 |
| 566 | 3300037471 | Ga0395905_0307449 | Ga0395905_0307449_344_1255 | 290 |
| 567 | 3300046463 | Ga0495653_0007949 | Ga0495653_0007949_7755_8666 | 290 |
| 568 | 3300046473 | Ga0495582_0259560 | Ga0495582_0259560_62_973 | 290 |
| 569 | 3300046511 | Ga0495608_0003691 | Ga0495608_0003691_2302_3213 | 290 |
| 570 | 3300046536 | Ga0495587_0159396 | Ga0495587_0159396_46_957 | 290 |
| 571 | 3300046543 | Ga0495645_0095822 | Ga0495645_0095822_610_1521 | 290 |
| 572 | 3300046559 | Ga0495667_0067757 | Ga0495667_0067757_114_1025 | 290 |
| 573 | 3300046663 | Ga0495635_0005522 | Ga0495635_0005522_7864_8775 | 290 |
| 574 | 3300046675 | Ga0495657_0005377 | Ga0495657_0005377_980_1891 | 290 |
| 575 | 3300046678 | Ga0495599_0004042 | Ga0495599_0004042_145_1056 | 290 |
| 576 | 3300046680 | Ga0495646_0061456 | Ga0495646_0061456_19_930 | 290 |
| 577 | 3300046809 | Ga0495600_0066753 | Ga0495600_0066753_133_1044 | 290 |
| 578 | 3300047322 | Ga0495680_0012021 | Ga0495680_0012021_4733_5644 | 290 |
| 579 | 3300047673 | Ga0495593_0021422 | Ga0495593_0021422_1870_2781 | 290 |
| 580 | 3300048088 | Ga0495602_0339244 | Ga0495602_0339244_44_955 | 290 |
| 581 | 3300048911 | Ga0496108_0184989 | Ga0496108_0184989_656_1567 | 290 |
| 582 | 3300048913 | Ga0496110_0309435 | Ga0496110_0309435_74_988 | 290 |
| 583 | 3300048914 | Ga0496111_0092430 | Ga0496111_0092430_13_927 | 290 |
| 584 | 3300048915 | Ga0496112_0020839 | Ga0496112_0020839_4331_5242 | 290 |
| 585 | 3300048916 | Ga0496113_0079588 | Ga0496113_0079588_1125_2036 | 290 |
| 586 | 3300048918 | Ga0496115_0156336 | Ga0496115_0156336_761_1672 | 290 |
| 587 | 3300048918 | Ga0496115_0261142 | Ga0496115_0261142_484_1395 | 290 |
| 588 | 3300049576 | Ga0501040_0083694 | Ga0501040_0083694_574_1509 | 290 |
| 589 | 3300053084 | Ga0495595_0006178 | Ga0495595_0006178_1980_2891 | 290 |
| 590 | 3300053085 | Ga0495619_0022036 | Ga0495619_0022036_2834_3745 | 290 |
| 591 | 3300003215 | JGI25153J46596_10006245 | JGI25153J46596_100062454 | 291 |
| 592 | 3300003354 | JGI25160J50197_1007770 | JGI25160J50197_10077703 | 291 |
| 593 | 3300003354 | JGI25160J50197_1008566 | JGI25160J50197_10085662 | 291 |
| 594 | 3300003794 | Ga0055531_10004023 | Ga0055531_100040239 | 291 |
| 595 | 3300005262 | Ga0065165_1002156 | Ga0065165_100215610 | 291 |
| 596 | 3300005436 | Ga0070713_100184286 | Ga0070713_1001842862 | 291 |
| 597 | 3300005563 | Ga0068855_100526638 | Ga0068855_1005266382 | 291 |
| 598 | 3300005564 | Ga0070664_100254621 | Ga0070664_1002546212 | 291 |
| 599 | 3300005616 | Ga0068852_100006500 | Ga0068852_1000065005 | 291 |
| 600 | 3300005719 | Ga0068861_100479711 | Ga0068861_1004797112 | 291 |
| 601 | 3300005983 | Ga0081540_1047534 | Ga0081540_10475342 | 291 |
| 602 | 3300006028 | Ga0070717_10022714 | Ga0070717_100227144 | 291 |
| 603 | 3300006038 | Ga0075365_10008592 | Ga0075365_100085923 | 291 |
| 604 | 3300006186 | Ga0075369_10090876 | Ga0075369_100908762 | 291 |
| 605 | 3300009148 | Ga0105243_10487270 | Ga0105243_104872702 | 291 |
| 606 | 3300009174 | Ga0105241_10061117 | Ga0105241_100611172 | 291 |
| 607 | 3300009545 | Ga0105237_10003966 | Ga0105237_1000396618 | 291 |
| 608 | 3300009551 | Ga0105238_10290035 | Ga0105238_102900352 | 291 |
| 609 | 3300014968 | Ga0157379_10501051 | Ga0157379_105010512 | 291 |
| 610 | 3300021320 | Ga0214544_1000002 | Ga0214544_100000291 | 291 |
| 611 | 3300021321 | Ga0214542_1000001 | Ga0214542_1000001441 | 291 |
| 612 | 3300021324 | Ga0214545_1000001 | Ga0214545_1000001507 | 291 |
| 613 | 3300021327 | Ga0214543_1000001 | Ga0214543_1000001689 | 291 |
| 614 | 3300025245 | Ga0207425_1003455 | Ga0207425_10034553 | 291 |
| 615 | 3300025254 | Ga0209148_1000500 | Ga0209148_100050027 | 291 |
| 616 | 3300025272 | Ga0209455_1004034 | Ga0209455_10040343 | 291 |
| 617 | 3300025297 | Ga0209758_1000024 | Ga0209758_100002485 | 291 |
| 618 | 3300025297 | Ga0209758_1000068 | Ga0209758_100006844 | 291 |
| 619 | 3300025297 | Ga0209758_1002409 | Ga0209758_100240916 | 291 |
| 620 | 3300025297 | Ga0209758_1011950 | Ga0209758_10119504 | 291 |
| 621 | 3300025302 | Ga0207426_1000238 | Ga0207426_100023826 | 291 |
| 622 | 3300025302 | Ga0207426_1002351 | Ga0207426_10023515 | 291 |
| 623 | 3300025302 | Ga0207426_1006588 | Ga0207426_10065881 | 291 |
| 624 | 3300025304 | Ga0209257_1001699 | Ga0209257_100169917 | 291 |
| 625 | 3300025901 | Ga0207688_10063418 | Ga0207688_100634182 | 291 |
| 626 | 3300025911 | Ga0207654_10021290 | Ga0207654_100212903 | 291 |
| 627 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008159 | 291 |
| 628 | 3300025914 | Ga0207671_10011165 | Ga0207671_100111654 | 291 |
| 629 | 3300025924 | Ga0207694_10234485 | Ga0207694_102344852 | 291 |
| 630 | 3300025928 | Ga0207700_10101425 | Ga0207700_101014252 | 291 |
| 631 | 3300025939 | Ga0207665_10100714 | Ga0207665_101007144 | 291 |
| 632 | 3300025942 | Ga0207689_10346793 | Ga0207689_103467931 | 291 |
| 633 | 3300026067 | Ga0207678_10218993 | Ga0207678_102189932 | 291 |
| 634 | 3300026078 | Ga0207702_10165413 | Ga0207702_101654132 | 291 |
| 635 | 3300027296 | Ga0209389_1000107 | Ga0209389_100010758 | 291 |
| 636 | 3300027296 | Ga0209389_1002563 | Ga0209389_10025638 | 291 |
| 637 | 3300027357 | Ga0209589_1000036 | Ga0209589_1000036124 | 291 |
| 638 | 3300027361 | Ga0209489_100006 | Ga0209489_100006452 | 291 |
| 639 | 3300027361 | Ga0209489_115889 | Ga0209489_1158892 | 291 |
| 640 | 3300027361 | Ga0209489_115890 | Ga0209489_1158902 | 291 |
| 641 | 3300027363 | Ga0209700_100005 | Ga0209700_100005321 | 291 |
| 642 | 3300031616 | Ga0307508_10135265 | Ga0307508_101352651 | 291 |
| 643 | 3300031711 | Ga0265314_10000412 | Ga0265314_100004124 | 291 |
| 644 | 3300031712 | Ga0265342_10042929 | Ga0265342_100429292 | 291 |
| 645 | 3300035117 | Ga0373953_0095057 | Ga0373953_0095057_166_1062 | 291 |
| 646 | 3300037418 | Ga0395900_0311269 | Ga0395900_0311269_271_1167 | 291 |
| 647 | 3300037471 | Ga0395905_0002364 | Ga0395905_0002364_15753_16649 | 291 |
| 648 | 3300044658 | Ga0466972_0000122 | Ga0466972_0000122_6941_7837 | 291 |
| 649 | 3300044901 | Ga0466960_0105830 | Ga0466960_0105830_397_1293 | 291 |
| 650 | 3300046454 | Ga0495592_0060328 | Ga0495592_0060328_1330_2226 | 291 |
| 651 | 3300046459 | Ga0495629_0003217 | Ga0495629_0003217_179_1075 | 291 |
| 652 | 3300046462 | Ga0495651_0006245 | Ga0495651_0006245_1720_2616 | 291 |
| 653 | 3300046462 | Ga0495651_0078004 | Ga0495651_0078004_916_1812 | 291 |
| 654 | 3300046475 | Ga0495639_0018700 | Ga0495639_0018700_532_1428 | 291 |
| 655 | 3300046477 | Ga0495664_0003617 | Ga0495664_0003617_825_1721 | 291 |
| 656 | 3300046507 | Ga0495606_0132161 | Ga0495606_0132161_403_1299 | 291 |
| 657 | 3300046507 | Ga0495606_0189479 | Ga0495606_0189479_85_999 | 291 |
| 658 | 3300046511 | Ga0495608_0043300 | Ga0495608_0043300_404_1300 | 291 |
| 659 | 3300046514 | Ga0495618_0204913 | Ga0495618_0204913_142_1038 | 291 |
| 660 | 3300046516 | Ga0495628_0009637 | Ga0495628_0009637_1056_1952 | 291 |
| 661 | 3300046516 | Ga0495628_0225701 | Ga0495628_0225701_414_1310 | 291 |
| 662 | 3300046524 | Ga0495648_0088224 | Ga0495648_0088224_150_1046 | 291 |
| 663 | 3300046524 | Ga0495648_0114945 | Ga0495648_0114945_177_1073 | 291 |
| 664 | 3300046529 | Ga0495652_0013965 | Ga0495652_0013965_4842_5738 | 291 |
| 665 | 3300046533 | Ga0495640_0017440 | Ga0495640_0017440_4114_5010 | 291 |
| 666 | 3300046533 | Ga0495640_0086095 | Ga0495640_0086095_601_1497 | 291 |
| 667 | 3300046559 | Ga0495667_0025996 | Ga0495667_0025996_28_924 | 291 |
| 668 | 3300046642 | Ga0495634_0213848 | Ga0495634_0213848_72_968 | 291 |
| 669 | 3300046663 | Ga0495635_0003851 | Ga0495635_0003851_8337_9233 | 291 |
| 670 | 3300046663 | Ga0495635_0039940 | Ga0495635_0039940_918_1814 | 291 |
| 671 | 3300046674 | Ga0495588_0103314 | Ga0495588_0103314_428_1324 | 291 |
| 672 | 3300046675 | Ga0495657_0004230 | Ga0495657_0004230_6166_7062 | 291 |
| 673 | 3300046679 | Ga0495623_0006266 | Ga0495623_0006266_5266_6162 | 291 |
| 674 | 3300046680 | Ga0495646_0135513 | Ga0495646_0135513_104_1000 | 291 |
| 675 | 3300046683 | Ga0495658_0078802 | Ga0495658_0078802_301_1197 | 291 |
| 676 | 3300046689 | Ga0495613_0019527 | Ga0495613_0019527_2967_3863 | 291 |
| 677 | 3300046689 | Ga0495613_0181305 | Ga0495613_0181305_447_1343 | 291 |
| 678 | 3300046690 | Ga0495624_0007215 | Ga0495624_0007215_4023_4919 | 291 |
| 679 | 3300046692 | Ga0495671_0124382 | Ga0495671_0124382_295_1191 | 291 |
| 680 | 3300046694 | Ga0495649_0098431 | Ga0495649_0098431_102_998 | 291 |
| 681 | 3300046809 | Ga0495600_0003420 | Ga0495600_0003420_4098_4994 | 291 |
| 682 | 3300046809 | Ga0495600_0032711 | Ga0495600_0032711_729_1625 | 291 |
| 683 | 3300047315 | Ga0495581_0056549 | Ga0495581_0056549_808_1704 | 291 |
| 684 | 3300047317 | Ga0495604_0005841 | Ga0495604_0005841_2131_3027 | 291 |
| 685 | 3300047319 | Ga0495674_0081652 | Ga0495674_0081652_1862_2758 | 291 |
| 686 | 3300047321 | Ga0495676_0167162 | Ga0495676_0167162_168_1064 | 291 |
| 687 | 3300047321 | Ga0495676_0372270 | Ga0495676_0372270_33_929 | 291 |
| 688 | 3300047322 | Ga0495680_0001849 | Ga0495680_0001849_20191_21087 | 291 |
| 689 | 3300048088 | Ga0495602_0010034 | Ga0495602_0010034_2205_3101 | 291 |
| 690 | 3300048903 | Ga0496100_0348526 | Ga0496100_0348526_10_906 | 291 |
| 691 | 3300048905 | Ga0496102_0299397 | Ga0496102_0299397_195_1091 | 291 |
| 692 | 3300048906 | Ga0496103_0105235 | Ga0496103_0105235_27_923 | 291 |
| 693 | 3300048907 | Ga0496104_0003846 | Ga0496104_0003846_8419_9315 | 291 |
| 694 | 3300048907 | Ga0496104_0185510 | Ga0496104_0185510_698_1594 | 291 |
| 695 | 3300048908 | Ga0496105_0047185 | Ga0496105_0047185_1083_1979 | 291 |
| 696 | 3300048909 | Ga0496106_0196868 | Ga0496106_0196868_220_1116 | 291 |
| 697 | 3300048910 | Ga0496107_0099767 | Ga0496107_0099767_759_1655 | 291 |
| 698 | 3300048914 | Ga0496111_0182785 | Ga0496111_0182785_486_1382 | 291 |
| 699 | 3300048916 | Ga0496113_0147081 | Ga0496113_0147081_872_1768 | 291 |
| 700 | 3300048916 | Ga0496113_0157823 | Ga0496113_0157823_303_1199 | 291 |
| 701 | 3300048918 | Ga0496115_0043847 | Ga0496115_0043847_1557_2453 | 291 |
| 702 | 3300048919 | Ga0496116_0009705 | Ga0496116_0009705_1749_2645 | 291 |
| 703 | 3300048922 | Ga0496119_0043726 | Ga0496119_0043726_585_1481 | 291 |
| 704 | 3300048923 | Ga0496120_0011600 | Ga0496120_0011600_4153_5049 | 291 |
| 705 | 3300048924 | Ga0496121_0090761 | Ga0496121_0090761_802_1698 | 291 |
| 706 | 3300048924 | Ga0496121_0092561 | Ga0496121_0092561_867_1763 | 291 |
| 707 | 3300048928 | Ga0496125_0038850 | Ga0496125_0038850_3000_3896 | 291 |
| 708 | 3300048929 | Ga0496126_0002588 | Ga0496126_0002588_9807_10712 | 291 |
| 709 | 3300048929 | Ga0496126_0007487 | Ga0496126_0007487_8259_9155 | 291 |
| 710 | 3300048929 | Ga0496126_0245953 | Ga0496126_0245953_18_914 | 291 |
| 711 | 3300050492 | nmdc:mga0yw44_42449_c1 | nmdc:mga0yw44_42449_c1_529_1425 | 291 |
| 712 | 3300053085 | Ga0495619_0126728 | Ga0495619_0126728_573_1469 | 291 |
| 713 | 3300053091 | Ga0500647_0135667 | Ga0500647_0135667_121_1017 | 291 |
| 714 | 3300053094 | Ga0500566_0001155 | Ga0500566_0001155_1888_2784 | 291 |
| 715 | 3300053105 | Ga0500557_000052 | Ga0500557_000052_27395_28291 | 291 |
| 716 | 3300053119 | Ga0500595_030009 | Ga0500595_030009_647_1543 | 291 |
| 717 | 3300053121 | Ga0500607_012093 | Ga0500607_012093_3559_4455 | 291 |
| 718 | 3300053136 | Ga0500559_0013274 | Ga0500559_0013274_1884_2780 | 291 |
| 719 | 3300053136 | Ga0500559_0069255 | Ga0500559_0069255_588_1484 | 291 |
| 720 | 3300053153 | Ga0500616_0028617 | Ga0500616_0028617_1621_2517 | 291 |
| 721 | 3300053158 | Ga0500627_0013117 | Ga0500627_0013117_168_1064 | 291 |
| 722 | 3300053160 | Ga0500633_0088403 | Ga0500633_0088403_193_1089 | 291 |
| 723 | 3300053177 | Ga0500636_0000042 | Ga0500636_0000042_57694_58590 | 291 |
| 724 | 3300004625 | Ga0055543_1002866 | Ga0055543_10028664 | 292 |
| 725 | 3300005262 | Ga0065165_1002034 | Ga0065165_100203411 | 292 |
| 726 | 3300005327 | Ga0070658_10224446 | Ga0070658_102244461 | 292 |
| 727 | 3300005344 | Ga0070661_100104658 | Ga0070661_1001046582 | 292 |
| 728 | 3300005347 | Ga0070668_100365894 | Ga0070668_1003658941 | 292 |
| 729 | 3300005367 | Ga0070667_100029892 | Ga0070667_1000298923 | 292 |
| 730 | 3300005455 | Ga0070663_100163169 | Ga0070663_1001631692 | 292 |
| 731 | 3300005563 | Ga0068855_100348543 | Ga0068855_1003485432 | 292 |
| 732 | 3300005616 | Ga0068852_100063394 | Ga0068852_1000633942 | 292 |
| 733 | 3300005617 | Ga0068859_100572864 | Ga0068859_1005728642 | 292 |
| 734 | 3300005843 | Ga0068860_100000213 | Ga0068860_10000021347 | 292 |
| 735 | 3300006042 | Ga0075368_10020037 | Ga0075368_100200373 | 292 |
| 736 | 3300006048 | Ga0075363_100035848 | Ga0075363_1000358482 | 292 |
| 737 | 3300006177 | Ga0075362_10029433 | Ga0075362_100294332 | 292 |
| 738 | 3300006178 | Ga0075367_10060008 | Ga0075367_100600082 | 292 |
| 739 | 3300006353 | Ga0075370_10040554 | Ga0075370_100405542 | 292 |
| 740 | 3300006931 | Ga0097620_100572955 | Ga0097620_1005729552 | 292 |
| 741 | 3300009174 | Ga0105241_10136918 | Ga0105241_101369182 | 292 |
| 742 | 3300009177 | Ga0105248_10324368 | Ga0105248_103243682 | 292 |
| 743 | 3300009545 | Ga0105237_10037340 | Ga0105237_100373404 | 292 |
| 744 | 3300010375 | Ga0105239_10410850 | Ga0105239_104108501 | 292 |
| 745 | 3300011119 | Ga0105246_10078068 | Ga0105246_100780682 | 292 |
| 746 | 3300013308 | Ga0157375_10404464 | Ga0157375_104044642 | 292 |
| 747 | 3300014325 | Ga0163163_10056064 | Ga0163163_100560644 | 292 |
| 748 | 3300014968 | Ga0157379_10308055 | Ga0157379_103080552 | 292 |
| 749 | 3300021441 | Ga0213871_10045965 | Ga0213871_100459651 | 292 |
| 750 | 3300025261 | Ga0209233_1018269 | Ga0209233_10182692 | 292 |
| 751 | 3300025261 | Ga0209233_1027990 | Ga0209233_10279902 | 292 |
| 752 | 3300025297 | Ga0209758_1051180 | Ga0209758_10511802 | 292 |
| 753 | 3300025299 | Ga0209256_1027020 | Ga0209256_10270201 | 292 |
| 754 | 3300025304 | Ga0209257_1010441 | Ga0209257_10104414 | 292 |
| 755 | 3300025904 | Ga0207647_10006516 | Ga0207647_100065163 | 292 |
| 756 | 3300025909 | Ga0207705_10234754 | Ga0207705_102347542 | 292 |
| 757 | 3300025914 | Ga0207671_10006585 | Ga0207671_100065858 | 292 |
| 758 | 3300025923 | Ga0207681_10246603 | Ga0207681_102466032 | 292 |
| 759 | 3300025941 | Ga0207711_10070516 | Ga0207711_100705162 | 292 |
| 760 | 3300025986 | Ga0207658_10231279 | Ga0207658_102312792 | 292 |
| 761 | 3300026035 | Ga0207703_10100425 | Ga0207703_101004252 | 292 |
| 762 | 3300026041 | Ga0207639_10158993 | Ga0207639_101589932 | 292 |
| 763 | 3300026067 | Ga0207678_10177926 | Ga0207678_101779262 | 292 |
| 764 | 3300026078 | Ga0207702_10710223 | Ga0207702_107102231 | 292 |
| 765 | 3300026088 | Ga0207641_10297308 | Ga0207641_102973082 | 292 |
| 766 | 3300026095 | Ga0207676_10505132 | Ga0207676_105051322 | 292 |
| 767 | 3300028381 | Ga0268264_10000065 | Ga0268264_10000065184 | 292 |
| 768 | 3300031507 | Ga0307509_10105981 | Ga0307509_101059813 | 292 |
| 769 | 3300031730 | Ga0307516_10017791 | Ga0307516_100177914 | 292 |
| 770 | 3300033180 | Ga0307510_10063240 | Ga0307510_100632403 | 292 |
| 771 | 3300033180 | Ga0307510_10096666 | Ga0307510_100966662 | 292 |
| 772 | 3300035692 | Ga0373935_0121240 | Ga0373935_0121240_577_1479 | 292 |
| 773 | 3300037068 | Ga0373925_0032350 | Ga0373925_0032350_2188_3090 | 292 |
| 774 | 3300037418 | Ga0395900_0001586 | Ga0395900_0001586_4908_5807 | 292 |
| 775 | 3300037466 | Ga0395898_0045960 | Ga0395898_0045960_3175_4074 | 292 |
| 776 | 3300037471 | Ga0395905_0094419 | Ga0395905_0094419_492_1391 | 292 |
| 777 | 3300039447 | Ga0436361_0327683 | Ga0436361_0327683_664_1584 | 292 |
| 778 | 3300039453 | Ga0436362_0058908 | Ga0436362_0058908_512_1405 | 292 |
| 779 | 3300044658 | Ga0466972_0039062 | Ga0466972_0039062_1112_2011 | 292 |
| 780 | 3300044735 | Ga0466968_0021463 | Ga0466968_0021463_1165_2064 | 292 |
| 781 | 3300045976 | Ga0466967_0084499 | Ga0466967_0084499_643_1536 | 292 |
| 782 | 3300046455 | Ga0495603_0076851 | Ga0495603_0076851_959_1870 | 292 |
| 783 | 3300046512 | Ga0495610_0093164 | Ga0495610_0093164_274_1173 | 292 |
| 784 | 3300046513 | Ga0495616_0062781 | Ga0495616_0062781_310_1209 | 292 |
| 785 | 3300046522 | Ga0495643_0017469 | Ga0495643_0017469_2717_3616 | 292 |
| 786 | 3300046542 | Ga0495597_0038281 | Ga0495597_0038281_40_939 | 292 |
| 787 | 3300046616 | Ga0495668_0074265 | Ga0495668_0074265_518_1417 | 292 |
| 788 | 3300047323 | Ga0495683_0066552 | Ga0495683_0066552_225_1124 | 292 |
| 789 | 3300047443 | Ga0495687_034841 | Ga0495687_034841_1092_1991 | 292 |
| 790 | 3300048906 | Ga0496103_0020553 | Ga0496103_0020553_445_1344 | 292 |
| 791 | 3300048906 | Ga0496103_0150001 | Ga0496103_0150001_369_1271 | 292 |
| 792 | 3300048907 | Ga0496104_0184953 | Ga0496104_0184953_32_931 | 292 |
| 793 | 3300048908 | Ga0496105_0125062 | Ga0496105_0125062_847_1746 | 292 |
| 794 | 3300048909 | Ga0496106_0033959 | Ga0496106_0033959_1396_2298 | 292 |
| 795 | 3300048910 | Ga0496107_0168242 | Ga0496107_0168242_697_1599 | 292 |
| 796 | 3300048911 | Ga0496108_0228576 | Ga0496108_0228576_217_1116 | 292 |
| 797 | 3300048912 | Ga0496109_0245267 | Ga0496109_0245267_321_1220 | 292 |
| 798 | 3300048913 | Ga0496110_0058595 | Ga0496110_0058595_416_1315 | 292 |
| 799 | 3300048914 | Ga0496111_0374046 | Ga0496111_0374046_23_922 | 292 |
| 800 | 3300048915 | Ga0496112_0096051 | Ga0496112_0096051_1013_1912 | 292 |
| 801 | 3300048915 | Ga0496112_0584270 | Ga0496112_0584270_128_1027 | 292 |
| 802 | 3300048916 | Ga0496113_0073839 | Ga0496113_0073839_410_1309 | 292 |
| 803 | 3300048920 | Ga0496117_0064911 | Ga0496117_0064911_790_1692 | 292 |
| 804 | 3300048921 | Ga0496118_0006064 | Ga0496118_0006064_2071_2973 | 292 |
| 805 | 3300048922 | Ga0496119_0103052 | Ga0496119_0103052_94_993 | 292 |
| 806 | 3300048924 | Ga0496121_0001157 | Ga0496121_0001157_30769_31671 | 292 |
| 807 | 3300048924 | Ga0496121_0050969 | Ga0496121_0050969_1138_2037 | 292 |
| 808 | 3300048927 | Ga0496124_0021056 | Ga0496124_0021056_1457_2359 | 292 |
| 809 | 3300048927 | Ga0496124_0168541 | Ga0496124_0168541_783_1682 | 292 |
| 810 | 3300048928 | Ga0496125_0035390 | Ga0496125_0035390_397_1299 | 292 |
| 811 | 3300048928 | Ga0496125_0257020 | Ga0496125_0257020_144_1043 | 292 |
| 812 | 3300048929 | Ga0496126_0380569 | Ga0496126_0380569_42_941 | 292 |
| 813 | 3300050492 | nmdc:mga0yw44_34723_c1 | nmdc:mga0yw44_34723_c1_1986_2885 | 292 |
| 814 | 3300050516 | nmdc:mga0sz30_33134_c1 | nmdc:mga0sz30_33134_c1_955_1854 | 292 |
| 815 | 3300053080 | Ga0500635_0001309 | Ga0500635_0001309_725_1636 | 292 |
| 816 | 3300053119 | Ga0500595_055398 | Ga0500595_055398_121_1032 | 292 |
| 817 | 3300053120 | Ga0500597_120508 | Ga0500597_120508_147_1058 | 292 |
| 818 | 3300053130 | Ga0500642_0000306 | Ga0500642_0000306_1894_2793 | 292 |
| 819 | 3300053140 | Ga0500573_0065364 | Ga0500573_0065364_707_1609 | 292 |
| 820 | 3300053148 | Ga0500590_117171 | Ga0500590_117171_58_960 | 292 |
| 821 | 3300053150 | Ga0500603_002335 | Ga0500603_002335_2228_3139 | 292 |
| 822 | 3300053178 | Ga0500637_0007084 | Ga0500637_0007084_1063_1974 | 292 |
| 823 | 3300003203 | JGI25406J46586_10000019 | JGI25406J46586_1000001922 | 298 |
| 824 | 3300005985 | Ga0081539_10000003 | Ga0081539_10000003191 | 298 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2o34-assembly2.cif.gz_B | crystal structure of protein dvu1097 from desulfovibrio vulgaris hildenborough, pfam duf375 | 0.7356 | 9 | 279 |
| 2o34-assembly1.cif.gz_A | crystal structure of protein dvu1097 from desulfovibrio vulgaris hildenborough, pfam duf375 | 0.7279 | 5 | 279 |
| 2o34-assembly2.cif.gz_B | crystal structure of protein dvu1097 from desulfovibrio vulgaris hildenborough, pfam duf375 | 0.7131 | 9 | 279 |
| 2o34-assembly1.cif.gz_A | crystal structure of protein dvu1097 from desulfovibrio vulgaris hildenborough, pfam duf375 | 0.701 | 5 | 279 |
| 8b9n-assembly2.cif.gz_C | crystal structure of nei domain of mouse neil3 trapped in covalent complex with ssdna with abasic site | 0.6671 | 7 | 33 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58921_1_229_3.10.520.10 | Alpha Beta;Roll;T-fold;ApbE-like domains | 0.7681 | 15 | 280 | 3.10.520.10 |
| af_Q58921_1_229_3.10.520.10 | Alpha Beta;Roll;T-fold;ApbE-like domains | 0.7414 | 15 | 280 | 3.10.520.10 |
| af_Q9P7N3_14_258_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7384 | 5 | 33 | 2.130.10.10 |
| af_A0A1P8AW69_199_332_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7372 | 4 | 28 | 2.130.10.10 |
| 2wgqB01 | Alpha Beta;2-Layer Sandwich;Copper Amine Oxidase; Chain A, domain 1;Copper amine oxidase-like, N-terminal domain | 0.7333 | 5 | 33 | 3.30.457.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q3LJ29-F1-model_v4 | Thiamine biosynthesis protein ApbE | 0.9796 | 3 | 280 |
|
| AF-A0A661JQT5-F1-model_v4 | UPF0280 family protein | 0.9779 | 179 | 278 |
|
| AF-A0A1F3AHD4-F1-model_v4 | Thiamine biosynthesis protein ApbE | 0.9772 | 1 | 279 |
|
| AF-A0A1H5I2R2-F1-model_v4 | Thiamine biosynthesis protein ApbE | 0.9757 | 1 | 286 |
|
| AF-A0A6N6S952-F1-model_v4 | UPF0280 family protein | 0.9754 | 7 | 264 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar