F482393
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 824 | 394 | 798 | 142 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_0646826|Ga0436365_0646826_12188_12706 |
| Length | 172 |
| Sequence | MACRFNDDDRGAAPPGLARIGLPSGVRRSKALSMTLPPFHLAFPVHDIEAARAFYGGLLGCPEGRSAPEWVDFDFFGHQIVAHLDPTLRPPAHRNPVDGHDVPVPHFGAVLPMAQWQVLADRLTAAGTDFVIAPTVRFRGEPGEQATMFFLDPSGNALELKAMADPANLFAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 2 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 3 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 4 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 5 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 6 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 7 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 8 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 9 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 10 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 11 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 12 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 13 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 14 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 15 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 16 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 17 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 18 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 19 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 20 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 21 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 22 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 23 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 24 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 25 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 26 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 27 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 28 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 29 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 30 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 193 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 195 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 200 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 201 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 203 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 205 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 212 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 213 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 214 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 215 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 217 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 218 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 219 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 222 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 227 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 228 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 229 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 230 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 231 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 232 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 233 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 234 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 236 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 237 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 238 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 239 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 240 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 241 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 242 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 243 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 244 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 245 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 246 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 247 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 248 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 249 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 250 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 251 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 252 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 253 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 254 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 255 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 256 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 257 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 258 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 259 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 260 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 261 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 262 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 263 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 264 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 265 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 266 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 267 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 270 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 271 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 272 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 273 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 274 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 275 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 320 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 321 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 322 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 323 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 324 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 325 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 326 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 327 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 328 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 329 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 330 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 331 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 332 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 333 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 368 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 369 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 375 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 376 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 377 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 378 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 379 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 380 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 381 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 382 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 383 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 384 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 385 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 386 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 387 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 390 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 391 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 392 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 393 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 394 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.36 |
| Metatranscriptomes | 0.49 |
| Isolates | 3.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.13 |
| Nodule | 0.36 |
| Rhizoplane | 1.94 |
| Rhizosphere | 89.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10028803 | 3300001989 | Bacteria | 1935 |
| 2 | JGI24735J21928_10042589 | 3300002067 | Bacteria | 1322 |
| 3 | JGI25162J39368_1000482 | 3300002737 | Bacteria | 30484 |
| 4 | JGI25151J46595_10001007 | 3300003187 | Bacteria | 21295 |
| 5 | JGI25165J46597_1000328 | 3300003214 | Bacteria | 56610 |
| 6 | rootH2_10005494 | 3300003320 | Bacteria | 4776 |
| 7 | rootL2_10002812 | 3300003322 | Bacteria | 40354 |
| 8 | rootH1_10041044 | 3300003323 | Bacteria | 5772 |
| 9 | Ga0070658_10000040 | 3300005327 | Bacteria | 136073 |
| 10 | Ga0070658_10081965 | 3300005327 | Bacteria | 2650 |
| 11 | Ga0070676_11007084 | 3300005328 | Bacteria | 626 |
| 12 | Ga0070690_100053060 | 3300005330 | Bacteria | 2593 |
| 13 | Ga0068869_100076760 | 3300005334 | Bacteria | 2484 |
| 14 | Ga0068869_100163980 | 3300005334 | Bacteria | 1732 |
| 15 | Ga0070680_100010536 | 3300005336 | Bacteria | 7131 |
| 16 | Ga0070680_100015864 | 3300005336 | Bacteria | 5914 |
| 17 | Ga0070682_100267438 | 3300005337 | Bacteria | 1240 |
| 18 | Ga0070682_100598625 | 3300005337 | Bacteria | 870 |
| 19 | Ga0070682_100639942 | 3300005337 | Bacteria | 845 |
| 20 | Ga0068868_100000047 | 3300005338 | Bacteria | 67920 |
| 21 | Ga0068868_100011443 | 3300005338 | Bacteria | 6461 |
| 22 | Ga0070660_100000001 | 3300005339 | Bacteria | 190487 |
| 23 | Ga0070660_100000414 | 3300005339 | Bacteria | 28402 |
| 24 | Ga0070660_100002023 | 3300005339 | Bacteria | 13985 |
| 25 | Ga0070660_100014626 | 3300005339 | Bacteria | 5661 |
| 26 | Ga0070660_100015658 | 3300005339 | Bacteria | 5481 |
| 27 | Ga0070660_100065200 | 3300005339 | Bacteria | 2835 |
| 28 | Ga0070660_100097844 | 3300005339 | Bacteria | 2322 |
| 29 | Ga0070660_100147532 | 3300005339 | Bacteria | 1890 |
| 30 | Ga0070660_101186455 | 3300005339 | Bacteria | 647 |
| 31 | Ga0070689_100002871 | 3300005340 | Bacteria | 11332 |
| 32 | Ga0070689_100374048 | 3300005340 | Bacteria | 1199 |
| 33 | Ga0070691_10043175 | 3300005341 | Bacteria | 2135 |
| 34 | Ga0070691_10050970 | 3300005341 | Bacteria | 1975 |
| 35 | Ga0070661_100000324 | 3300005344 | Bacteria | 38428 |
| 36 | Ga0070661_100001393 | 3300005344 | Bacteria | 16882 |
| 37 | Ga0070661_100026806 | 3300005344 | Bacteria | 4147 |
| 38 | Ga0070661_100127933 | 3300005344 | Bacteria | 1906 |
| 39 | Ga0070661_100429640 | 3300005344 | Bacteria | 1048 |
| 40 | Ga0070692_10000687 | 3300005345 | Bacteria | 10867 |
| 41 | Ga0070692_10020047 | 3300005345 | Bacteria | 3236 |
| 42 | Ga0070692_10197341 | 3300005345 | Bacteria | 1176 |
| 43 | Ga0070692_10795489 | 3300005345 | Bacteria | 645 |
| 44 | Ga0070668_102032730 | 3300005347 | Bacteria | 530 |
| 45 | Ga0070669_100013267 | 3300005353 | Bacteria | 5857 |
| 46 | Ga0070669_100114428 | 3300005353 | Bacteria | 2051 |
| 47 | Ga0070669_101872207 | 3300005353 | Bacteria | 524 |
| 48 | Ga0070675_100032605 | 3300005354 | Bacteria | 4217 |
| 49 | Ga0070675_100116424 | 3300005354 | Bacteria | 2267 |
| 50 | Ga0070671_100028246 | 3300005355 | Bacteria | 4619 |
| 51 | Ga0070674_100151761 | 3300005356 | Bacteria | 1749 |
| 52 | Ga0070673_100164739 | 3300005364 | Bacteria | 1888 |
| 53 | Ga0070673_100815903 | 3300005364 | Bacteria | 862 |
| 54 | Ga0070659_100000022 | 3300005366 | Bacteria | 154091 |
| 55 | Ga0070659_100000326 | 3300005366 | Bacteria | 36612 |
| 56 | Ga0070659_100000526 | 3300005366 | Bacteria | 27993 |
| 57 | Ga0070659_100004108 | 3300005366 | Bacteria | 10376 |
| 58 | Ga0070659_100006002 | 3300005366 | Bacteria | 8759 |
| 59 | Ga0070659_100024020 | 3300005366 | Bacteria | 4670 |
| 60 | Ga0070659_100296747 | 3300005366 | Bacteria | 1347 |
| 61 | Ga0070659_100467732 | 3300005366 | Bacteria | 1071 |
| 62 | Ga0070659_100577394 | 3300005366 | Bacteria | 964 |
| 63 | Ga0070667_101382658 | 3300005367 | Bacteria | 660 |
| 64 | Ga0070710_10895294 | 3300005437 | Bacteria | 640 |
| 65 | Ga0070701_10005288 | 3300005438 | Bacteria | 5318 |
| 66 | Ga0070711_100250448 | 3300005439 | Bacteria | 1389 |
| 67 | Ga0070700_100051959 | 3300005441 | Bacteria | 2553 |
| 68 | Ga0070694_100577452 | 3300005444 | Bacteria | 903 |
| 69 | Ga0070708_101046461 | 3300005445 | Bacteria | 765 |
| 70 | Ga0070663_100003639 | 3300005455 | Bacteria | 8925 |
| 71 | Ga0070663_100310914 | 3300005455 | Bacteria | 1264 |
| 72 | Ga0070663_100434196 | 3300005455 | Bacteria | 1079 |
| 73 | Ga0070678_100042002 | 3300005456 | Bacteria | 3247 |
| 74 | Ga0070678_100257033 | 3300005456 | Bacteria | 1467 |
| 75 | Ga0070678_100379931 | 3300005456 | Bacteria | 1222 |
| 76 | Ga0070678_101033783 | 3300005456 | Bacteria | 756 |
| 77 | Ga0070662_100000260 | 3300005457 | Bacteria | 31271 |
| 78 | Ga0070662_100060905 | 3300005457 | Bacteria | 2754 |
| 79 | Ga0070662_100946168 | 3300005457 | Bacteria | 736 |
| 80 | Ga0070662_101505701 | 3300005457 | Bacteria | 580 |
| 81 | Ga0070681_10000619 | 3300005458 | Bacteria | 29107 |
| 82 | Ga0070681_10005369 | 3300005458 | Bacteria | 12372 |
| 83 | Ga0070681_10023617 | 3300005458 | Bacteria | 6185 |
| 84 | Ga0070681_10073821 | 3300005458 | Bacteria | 3373 |
| 85 | Ga0070681_10483961 | 3300005458 | Bacteria | 1150 |
| 86 | Ga0068867_101912983 | 3300005459 | Bacteria | 559 |
| 87 | Ga0070679_100000001 | 3300005530 | Bacteria | 764811 |
| 88 | Ga0070679_100001372 | 3300005530 | Bacteria | 21479 |
| 89 | Ga0070679_100008154 | 3300005530 | Bacteria | 9842 |
| 90 | Ga0070679_100059123 | 3300005530 | Bacteria | 3820 |
| 91 | Ga0070679_100247621 | 3300005530 | Unclassified | 1739 |
| 92 | Ga0070679_100707595 | 3300005530 | Bacteria | 950 |
| 93 | Ga0070679_101106443 | 3300005530 | Bacteria | 737 |
| 94 | Ga0070684_100294259 | 3300005535 | Bacteria | 1489 |
| 95 | Ga0068853_100001673 | 3300005539 | Bacteria | 16221 |
| 96 | Ga0068853_100344038 | 3300005539 | Bacteria | 1386 |
| 97 | Ga0070672_100087744 | 3300005543 | Bacteria | 2504 |
| 98 | Ga0070672_100400963 | 3300005543 | Bacteria | 1176 |
| 99 | Ga0070686_100104196 | 3300005544 | Bacteria | 1921 |
| 100 | Ga0070686_100613679 | 3300005544 | Bacteria | 858 |
| 101 | Ga0070696_100046350 | 3300005546 | Bacteria | 3014 |
| 102 | Ga0070696_100057270 | 3300005546 | Bacteria | 2720 |
| 103 | Ga0070696_100280670 | 3300005546 | Bacteria | 1270 |
| 104 | Ga0070693_100256165 | 3300005547 | Bacteria | 1162 |
| 105 | Ga0070665_100002152 | 3300005548 | Bacteria | 21984 |
| 106 | Ga0070665_100010218 | 3300005548 | Bacteria | 9494 |
| 107 | Ga0070665_100281520 | 3300005548 | Bacteria | 1665 |
| 108 | Ga0070665_101386176 | 3300005548 | Bacteria | 712 |
| 109 | Ga0068855_100000106 | 3300005563 | Bacteria | 103864 |
| 110 | Ga0068855_100000110 | 3300005563 | Bacteria | 102379 |
| 111 | Ga0068855_100000956 | 3300005563 | Bacteria | 35944 |
| 112 | Ga0068855_100027475 | 3300005563 | Bacteria | 6805 |
| 113 | Ga0068855_100066277 | 3300005563 | Bacteria | 4210 |
| 114 | Ga0068855_100143593 | 3300005563 | Bacteria | 2718 |
| 115 | Ga0068855_100332242 | 3300005563 | Bacteria | 1678 |
| 116 | Ga0068855_100589113 | 3300005563 | Bacteria | 1200 |
| 117 | Ga0068855_101109377 | 3300005563 | Bacteria | 827 |
| 118 | Ga0068855_101387804 | 3300005563 | Bacteria | 724 |
| 119 | Ga0068855_101560316 | 3300005563 | Bacteria | 676 |
| 120 | Ga0070664_100000378 | 3300005564 | Bacteria | 33105 |
| 121 | Ga0070664_100218575 | 3300005564 | Bacteria | 1704 |
| 122 | Ga0070664_100331588 | 3300005564 | Bacteria | 1380 |
| 123 | Ga0070664_100441325 | 3300005564 | Bacteria | 1194 |
| 124 | Ga0068857_101408747 | 3300005577 | Bacteria | 678 |
| 125 | Ga0068854_100009590 | 3300005578 | Bacteria | 6249 |
| 126 | Ga0068854_100309607 | 3300005578 | Bacteria | 1280 |
| 127 | Ga0068856_100000111 | 3300005614 | Bacteria | 81104 |
| 128 | Ga0068856_100089964 | 3300005614 | Bacteria | 3053 |
| 129 | Ga0068856_100103897 | 3300005614 | Bacteria | 2834 |
| 130 | Ga0068856_100391343 | 3300005614 | Bacteria | 1410 |
| 131 | Ga0070702_100680859 | 3300005615 | Bacteria | 781 |
| 132 | Ga0068852_100000530 | 3300005616 | Bacteria | 25064 |
| 133 | Ga0068852_100002997 | 3300005616 | Bacteria | 11733 |
| 134 | Ga0068852_100003598 | 3300005616 | Bacteria | 10848 |
| 135 | Ga0068852_100032133 | 3300005616 | Bacteria | 4342 |
| 136 | Ga0068852_100175210 | 3300005616 | Bacteria | 2013 |
| 137 | Ga0068852_100476441 | 3300005616 | Bacteria | 1240 |
| 138 | Ga0068852_101017783 | 3300005616 | Bacteria | 847 |
| 139 | Ga0068859_100284700 | 3300005617 | Bacteria | 1746 |
| 140 | Ga0068859_100810213 | 3300005617 | Bacteria | 1024 |
| 141 | Ga0068859_100815896 | 3300005617 | Bacteria | 1020 |
| 142 | Ga0068864_100062043 | 3300005618 | Bacteria | 3238 |
| 143 | Ga0068864_100196746 | 3300005618 | Bacteria | 1850 |
| 144 | Ga0068866_10027804 | 3300005718 | Bacteria | 2688 |
| 145 | Ga0068861_100006025 | 3300005719 | Bacteria | 8243 |
| 146 | Ga0068861_100884061 | 3300005719 | Bacteria | 845 |
| 147 | Ga0068851_10007934 | 3300005834 | Bacteria | 4895 |
| 148 | Ga0068863_102267347 | 3300005841 | Bacteria | 553 |
| 149 | Ga0068858_100001633 | 3300005842 | Bacteria | 22876 |
| 150 | Ga0068858_100249299 | 3300005842 | Bacteria | 1686 |
| 151 | Ga0068858_101282267 | 3300005842 | Bacteria | 721 |
| 152 | Ga0068860_100140375 | 3300005843 | Bacteria | 2322 |
| 153 | Ga0068862_100349118 | 3300005844 | Bacteria | 1372 |
| 154 | Ga0068862_100389155 | 3300005844 | Bacteria | 1302 |
| 155 | Ga0068862_100800077 | 3300005844 | Bacteria | 920 |
| 156 | Ga0081539_10101654 | 3300005985 | Bacteria | 1464 |
| 157 | Ga0070712_100367870 | 3300006175 | Bacteria | 1181 |
| 158 | Ga0075362_10125285 | 3300006177 | Bacteria | 1218 |
| 159 | Ga0075367_10516901 | 3300006178 | Bacteria | 758 |
| 160 | Ga0075366_10027545 | 3300006195 | Bacteria | 3334 |
| 161 | Ga0097621_100021803 | 3300006237 | Bacteria | 4963 |
| 162 | Ga0097621_100165351 | 3300006237 | Bacteria | 1904 |
| 163 | Ga0075370_10004847 | 3300006353 | Bacteria | 6598 |
| 164 | Ga0068871_100063796 | 3300006358 | Bacteria | 3014 |
| 165 | Ga0068871_100270213 | 3300006358 | Bacteria | 1485 |
| 166 | Ga0068871_100537798 | 3300006358 | Bacteria | 1057 |
| 167 | Ga0075428_100027797 | 3300006844 | Bacteria | 6258 |
| 168 | Ga0075430_100141423 | 3300006846 | Bacteria | 2004 |
| 169 | Ga0075431_100572019 | 3300006847 | Bacteria | 1116 |
| 170 | Ga0068865_100015542 | 3300006881 | Bacteria | 4856 |
| 171 | Ga0068865_100729077 | 3300006881 | Bacteria | 849 |
| 172 | Ga0075436_100266682 | 3300006914 | Bacteria | 1222 |
| 173 | Ga0097620_100284700 | 3300006931 | Bacteria | 1746 |
| 174 | Ga0097620_100810124 | 3300006931 | Bacteria | 1024 |
| 175 | Ga0097620_100815662 | 3300006931 | Bacteria | 1020 |
| 176 | Ga0105240_10000055 | 3300009093 | Bacteria | 225380 |
| 177 | Ga0105240_10000921 | 3300009093 | Bacteria | 52415 |
| 178 | Ga0105240_10009666 | 3300009093 | Bacteria | 13630 |
| 179 | Ga0105240_10011013 | 3300009093 | Bacteria | 12658 |
| 180 | Ga0105240_10037794 | 3300009093 | Bacteria | 6201 |
| 181 | Ga0105240_10049795 | 3300009093 | Bacteria | 5285 |
| 182 | Ga0105240_10115601 | 3300009093 | Bacteria | 3239 |
| 183 | Ga0105240_10369042 | 3300009093 | Bacteria | 1623 |
| 184 | Ga0111539_10029610 | 3300009094 | Bacteria | 6666 |
| 185 | Ga0111539_13302298 | 3300009094 | Bacteria | 519 |
| 186 | Ga0105245_10004106 | 3300009098 | Bacteria | 12927 |
| 187 | Ga0105245_10268467 | 3300009098 | Bacteria | 1663 |
| 188 | Ga0105245_10388007 | 3300009098 | Bacteria | 1392 |
| 189 | Ga0105245_11270303 | 3300009098 | Bacteria | 785 |
| 190 | Ga0105247_10005627 | 3300009101 | Bacteria | 7863 |
| 191 | Ga0105247_10007480 | 3300009101 | Bacteria | 6697 |
| 192 | Ga0105247_10283153 | 3300009101 | Bacteria | 1144 |
| 193 | Ga0105243_10022806 | 3300009148 | Bacteria | 4759 |
| 194 | Ga0105243_10164548 | 3300009148 | Bacteria | 1916 |
| 195 | Ga0105243_12862885 | 3300009148 | Bacteria | 523 |
| 196 | Ga0105241_10016353 | 3300009174 | Bacteria | 5440 |
| 197 | Ga0105241_10171401 | 3300009174 | Bacteria | 1793 |
| 198 | Ga0105241_11672125 | 3300009174 | Bacteria | 618 |
| 199 | Ga0105242_10168870 | 3300009176 | Bacteria | 1921 |
| 200 | Ga0105248_10000517 | 3300009177 | Bacteria | 43853 |
| 201 | Ga0105248_10061914 | 3300009177 | Bacteria | 4202 |
| 202 | Ga0105248_10651324 | 3300009177 | Bacteria | 1189 |
| 203 | Ga0105237_10019700 | 3300009545 | Bacteria | 6965 |
| 204 | Ga0105237_10103204 | 3300009545 | Bacteria | 2843 |
| 205 | Ga0105237_10493869 | 3300009545 | Bacteria | 1230 |
| 206 | Ga0105237_12314707 | 3300009545 | Bacteria | 547 |
| 207 | Ga0105238_10000586 | 3300009551 | Bacteria | 38241 |
| 208 | Ga0105238_10002000 | 3300009551 | Bacteria | 20551 |
| 209 | Ga0105238_10026575 | 3300009551 | Bacteria | 5902 |
| 210 | Ga0105238_10039822 | 3300009551 | Bacteria | 4764 |
| 211 | Ga0105238_10164405 | 3300009551 | Bacteria | 2195 |
| 212 | Ga0105238_10179560 | 3300009551 | Bacteria | 2094 |
| 213 | Ga0105238_11292256 | 3300009551 | Bacteria | 755 |
| 214 | Ga0105238_11729549 | 3300009551 | Bacteria | 657 |
| 215 | Ga0105249_10744857 | 3300009553 | Bacteria | 1042 |
| 216 | Ga0157347_1029477 | 3300012502 | Bacteria | 681 |
| 217 | Ga0157373_10004775 | 3300013100 | Bacteria | 10199 |
| 218 | Ga0157373_10209947 | 3300013100 | Bacteria | 1373 |
| 219 | Ga0157373_11298797 | 3300013100 | Bacteria | 551 |
| 220 | Ga0157371_10000248 | 3300013102 | Bacteria | 76451 |
| 221 | Ga0157371_10050825 | 3300013102 | Bacteria | 2946 |
| 222 | Ga0157371_10133910 | 3300013102 | Bacteria | 1764 |
| 223 | Ga0157371_10253003 | 3300013102 | Bacteria | 1269 |
| 224 | Ga0157371_10843690 | 3300013102 | Bacteria | 692 |
| 225 | Ga0157370_10002265 | 3300013104 | Bacteria | 23367 |
| 226 | Ga0157370_10062315 | 3300013104 | Bacteria | 3537 |
| 227 | Ga0157370_10125803 | 3300013104 | Bacteria | 2392 |
| 228 | Ga0157370_10131847 | 3300013104 | Bacteria | 2331 |
| 229 | Ga0157370_10157325 | 3300013104 | Bacteria | 2114 |
| 230 | Ga0157370_10419481 | 3300013104 | Bacteria | 1231 |
| 231 | Ga0157370_11335202 | 3300013104 | Bacteria | 646 |
| 232 | Ga0157369_10006105 | 3300013105 | Bacteria | 13984 |
| 233 | Ga0157369_10010911 | 3300013105 | Bacteria | 10345 |
| 234 | Ga0157369_10013484 | 3300013105 | Bacteria | 9235 |
| 235 | Ga0157369_10023221 | 3300013105 | Bacteria | 6910 |
| 236 | Ga0157369_10089945 | 3300013105 | Bacteria | 3278 |
| 237 | Ga0157369_10111259 | 3300013105 | Bacteria | 2911 |
| 238 | Ga0157369_10227994 | 3300013105 | Bacteria | 1948 |
| 239 | Ga0157369_10782153 | 3300013105 | Bacteria | 981 |
| 240 | Ga0157378_10258037 | 3300013297 | Bacteria | 1671 |
| 241 | Ga0157378_10459768 | 3300013297 | Bacteria | 1264 |
| 242 | Ga0163162_10194029 | 3300013306 | Bacteria | 2159 |
| 243 | Ga0157372_10000402 | 3300013307 | Bacteria | 47788 |
| 244 | Ga0157372_10004312 | 3300013307 | Bacteria | 15203 |
| 245 | Ga0157372_10178613 | 3300013307 | Bacteria | 2457 |
| 246 | Ga0157372_10230071 | 3300013307 | Bacteria | 2149 |
| 247 | Ga0157372_10320359 | 3300013307 | Bacteria | 1805 |
| 248 | Ga0157372_10377675 | 3300013307 | Bacteria | 1651 |
| 249 | Ga0157372_11125113 | 3300013307 | Bacteria | 908 |
| 250 | Ga0157375_11192945 | 3300013308 | Bacteria | 893 |
| 251 | Ga0157380_10033868 | 3300014326 | Bacteria | 3935 |
| 252 | Ga0182008_10051455 | 3300014497 | Bacteria | 2043 |
| 253 | Ga0182008_10611242 | 3300014497 | Bacteria | 613 |
| 254 | Ga0157379_10237614 | 3300014968 | Bacteria | 1652 |
| 255 | Ga0206356_11270598 | 3300020070 | Bacteria | 698 |
| 256 | Ga0206354_10201683 | 3300020081 | Bacteria | 628 |
| 257 | Ga0206353_10090608 | 3300020082 | Bacteria | 618 |
| 258 | Ga0213873_10000017 | 3300021358 | Bacteria | 123962 |
| 259 | Ga0213876_10000071 | 3300021384 | Bacteria | 123962 |
| 260 | Ga0213876_10000261 | 3300021384 | Bacteria | 48782 |
| 261 | Ga0213876_10000274 | 3300021384 | Bacteria | 47640 |
| 262 | Ga0213876_10000290 | 3300021384 | Bacteria | 45674 |
| 263 | Ga0224712_10043427 | 3300022467 | Unclassified | 1708 |
| 264 | Ga0209672_107191 | 3300025228 | Bacteria | 1734 |
| 265 | Ga0209437_100057 | 3300025233 | Bacteria | 362922 |
| 266 | Ga0209129_1002564 | 3300025258 | Bacteria | 8753 |
| 267 | Ga0209233_1000130 | 3300025261 | Bacteria | 205687 |
| 268 | Ga0209025_1000157 | 3300025294 | Bacteria | 168790 |
| 269 | Ga0207656_10043977 | 3300025321 | Bacteria | 1906 |
| 270 | Ga0207692_10126949 | 3300025898 | Bacteria | 1436 |
| 271 | Ga0207692_10578583 | 3300025898 | Bacteria | 720 |
| 272 | Ga0207642_10012770 | 3300025899 | Bacteria | 3043 |
| 273 | Ga0207710_10002645 | 3300025900 | Bacteria | 8258 |
| 274 | Ga0207710_10046203 | 3300025900 | Bacteria | 1944 |
| 275 | Ga0207688_10433009 | 3300025901 | Bacteria | 818 |
| 276 | Ga0207647_10024902 | 3300025904 | Bacteria | 3940 |
| 277 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 278 | Ga0207705_10001024 | 3300025909 | Bacteria | 22688 |
| 279 | Ga0207705_10075570 | 3300025909 | Bacteria | 2447 |
| 280 | Ga0207705_10138543 | 3300025909 | Bacteria | 1815 |
| 281 | Ga0207705_11107543 | 3300025909 | Bacteria | 610 |
| 282 | Ga0207654_10019838 | 3300025911 | Bacteria | 3555 |
| 283 | Ga0207654_10797396 | 3300025911 | Bacteria | 682 |
| 284 | Ga0207707_10000038 | 3300025912 | Bacteria | 143359 |
| 285 | Ga0207707_10004902 | 3300025912 | Bacteria | 11762 |
| 286 | Ga0207707_10028844 | 3300025912 | Bacteria | 4850 |
| 287 | Ga0207707_10046389 | 3300025912 | Bacteria | 3785 |
| 288 | Ga0207695_10000012 | 3300025913 | Bacteria | 840961 |
| 289 | Ga0207695_10000572 | 3300025913 | Bacteria | 75360 |
| 290 | Ga0207695_10003158 | 3300025913 | Bacteria | 23497 |
| 291 | Ga0207695_10007437 | 3300025913 | Bacteria | 13944 |
| 292 | Ga0207695_10008910 | 3300025913 | Bacteria | 12491 |
| 293 | Ga0207695_10043747 | 3300025913 | Bacteria | 4770 |
| 294 | Ga0207695_10058882 | 3300025913 | Bacteria | 3986 |
| 295 | Ga0207695_10194197 | 3300025913 | Bacteria | 1946 |
| 296 | Ga0207695_10288658 | 3300025913 | Bacteria | 1533 |
| 297 | Ga0207671_10148070 | 3300025914 | Bacteria | 1812 |
| 298 | Ga0207663_10421711 | 3300025916 | Bacteria | 1024 |
| 299 | Ga0207660_10001700 | 3300025917 | Bacteria | 14758 |
| 300 | Ga0207660_10003203 | 3300025917 | Bacteria | 10704 |
| 301 | Ga0207660_10003261 | 3300025917 | Bacteria | 10626 |
| 302 | Ga0207660_10471806 | 3300025917 | Bacteria | 1016 |
| 303 | Ga0207657_10000381 | 3300025919 | Bacteria | 46762 |
| 304 | Ga0207657_10000590 | 3300025919 | Bacteria | 38432 |
| 305 | Ga0207657_10000910 | 3300025919 | Bacteria | 31264 |
| 306 | Ga0207657_10002098 | 3300025919 | Bacteria | 21566 |
| 307 | Ga0207657_10005748 | 3300025919 | Bacteria | 12941 |
| 308 | Ga0207657_10019686 | 3300025919 | Bacteria | 6401 |
| 309 | Ga0207657_10089749 | 3300025919 | Bacteria | 2566 |
| 310 | Ga0207657_10115822 | 3300025919 | Bacteria | 2209 |
| 311 | Ga0207657_10131410 | 3300025919 | Bacteria | 2051 |
| 312 | Ga0207657_10290360 | 3300025919 | Bacteria | 1297 |
| 313 | Ga0207657_10768392 | 3300025919 | Bacteria | 746 |
| 314 | Ga0207649_10000256 | 3300025920 | Bacteria | 42414 |
| 315 | Ga0207649_10012952 | 3300025920 | Bacteria | 4647 |
| 316 | Ga0207649_10017732 | 3300025920 | Bacteria | 4036 |
| 317 | Ga0207649_10060105 | 3300025920 | Bacteria | 2387 |
| 318 | Ga0207649_10247789 | 3300025920 | Bacteria | 1282 |
| 319 | Ga0207652_10000003 | 3300025921 | Bacteria | 502441 |
| 320 | Ga0207652_10000982 | 3300025921 | Bacteria | 26411 |
| 321 | Ga0207652_10199177 | 3300025921 | Bacteria | 1802 |
| 322 | Ga0207652_11119865 | 3300025921 | Bacteria | 688 |
| 323 | Ga0207681_10117034 | 3300025923 | Bacteria | 1948 |
| 324 | Ga0207681_11436749 | 3300025923 | Bacteria | 579 |
| 325 | Ga0207694_10000006 | 3300025924 | Bacteria | 631109 |
| 326 | Ga0207694_10005147 | 3300025924 | Bacteria | 10092 |
| 327 | Ga0207694_10007598 | 3300025924 | Bacteria | 8219 |
| 328 | Ga0207694_10077991 | 3300025924 | Bacteria | 2596 |
| 329 | Ga0207694_10091217 | 3300025924 | Bacteria | 2405 |
| 330 | Ga0207694_10146946 | 3300025924 | Bacteria | 1898 |
| 331 | Ga0207694_10452873 | 3300025924 | Bacteria | 1071 |
| 332 | Ga0207694_10707555 | 3300025924 | Bacteria | 850 |
| 333 | Ga0207694_10708406 | 3300025924 | Bacteria | 849 |
| 334 | Ga0207694_10873622 | 3300025924 | Bacteria | 760 |
| 335 | Ga0207650_10277407 | 3300025925 | Bacteria | 1364 |
| 336 | Ga0207687_10002318 | 3300025927 | Bacteria | 12956 |
| 337 | Ga0207687_10073643 | 3300025927 | Bacteria | 2446 |
| 338 | Ga0207687_10333770 | 3300025927 | Bacteria | 1231 |
| 339 | Ga0207664_10339887 | 3300025929 | Bacteria | 1327 |
| 340 | Ga0207664_11429295 | 3300025929 | Bacteria | 613 |
| 341 | Ga0207644_10019042 | 3300025931 | Bacteria | 4653 |
| 342 | Ga0207644_11540627 | 3300025931 | Bacteria | 558 |
| 343 | Ga0207690_10000003 | 3300025932 | Bacteria | 783011 |
| 344 | Ga0207690_10000010 | 3300025932 | Bacteria | 330298 |
| 345 | Ga0207690_10000194 | 3300025932 | Bacteria | 47161 |
| 346 | Ga0207690_10001039 | 3300025932 | Bacteria | 17769 |
| 347 | Ga0207690_10002314 | 3300025932 | Bacteria | 11617 |
| 348 | Ga0207690_10029512 | 3300025932 | Bacteria | 3488 |
| 349 | Ga0207690_10164241 | 3300025932 | Bacteria | 1658 |
| 350 | Ga0207690_10463299 | 3300025932 | Bacteria | 1020 |
| 351 | Ga0207706_10000008 | 3300025933 | Bacteria | 201940 |
| 352 | Ga0207706_10023372 | 3300025933 | Bacteria | 5552 |
| 353 | Ga0207686_10012916 | 3300025934 | Bacteria | 4606 |
| 354 | Ga0207709_10068495 | 3300025935 | Bacteria | 2243 |
| 355 | Ga0207670_10004220 | 3300025936 | Bacteria | 7708 |
| 356 | Ga0207670_10228596 | 3300025936 | Bacteria | 1427 |
| 357 | Ga0207669_10170158 | 3300025937 | Bacteria | 1550 |
| 358 | Ga0207704_10003198 | 3300025938 | Bacteria | 7414 |
| 359 | Ga0207704_10128572 | 3300025938 | Bacteria | 1749 |
| 360 | Ga0207691_10085498 | 3300025940 | Bacteria | 2831 |
| 361 | Ga0207711_10001000 | 3300025941 | Bacteria | 27099 |
| 362 | Ga0207711_10036878 | 3300025941 | Bacteria | 4150 |
| 363 | Ga0207711_10903234 | 3300025941 | Bacteria | 821 |
| 364 | Ga0207689_10007096 | 3300025942 | Bacteria | 9847 |
| 365 | Ga0207661_10056398 | 3300025944 | Bacteria | 3154 |
| 366 | Ga0207679_10000934 | 3300025945 | Bacteria | 18670 |
| 367 | Ga0207679_11933411 | 3300025945 | Bacteria | 538 |
| 368 | Ga0207667_10000026 | 3300025949 | Bacteria | 343713 |
| 369 | Ga0207667_10001326 | 3300025949 | Bacteria | 31063 |
| 370 | Ga0207667_10003312 | 3300025949 | Bacteria | 19879 |
| 371 | Ga0207667_10004668 | 3300025949 | Bacteria | 16782 |
| 372 | Ga0207667_10140552 | 3300025949 | Bacteria | 2486 |
| 373 | Ga0207667_10176675 | 3300025949 | Bacteria | 2193 |
| 374 | Ga0207667_10193016 | 3300025949 | Bacteria | 2089 |
| 375 | Ga0207667_10244059 | 3300025949 | Bacteria | 1838 |
| 376 | Ga0207667_10927825 | 3300025949 | Bacteria | 861 |
| 377 | Ga0207667_11435319 | 3300025949 | Bacteria | 663 |
| 378 | Ga0207651_10186694 | 3300025960 | Bacteria | 1650 |
| 379 | Ga0207640_10004677 | 3300025981 | Bacteria | 7429 |
| 380 | Ga0207640_10035158 | 3300025981 | Bacteria | 3133 |
| 381 | Ga0207640_10804050 | 3300025981 | Bacteria | 815 |
| 382 | Ga0207677_10000107 | 3300026023 | Bacteria | 67596 |
| 383 | Ga0207677_10061851 | 3300026023 | Bacteria | 2595 |
| 384 | Ga0207677_10082228 | 3300026023 | Bacteria | 2314 |
| 385 | Ga0207677_11113237 | 3300026023 | Bacteria | 720 |
| 386 | Ga0207703_10001323 | 3300026035 | Bacteria | 22741 |
| 387 | Ga0207703_10108979 | 3300026035 | Bacteria | 2359 |
| 388 | Ga0207703_11275298 | 3300026035 | Bacteria | 706 |
| 389 | Ga0207639_10001218 | 3300026041 | Bacteria | 17476 |
| 390 | Ga0207639_10002823 | 3300026041 | Bacteria | 11653 |
| 391 | Ga0207639_10513925 | 3300026041 | Bacteria | 1096 |
| 392 | Ga0207639_10992560 | 3300026041 | Bacteria | 786 |
| 393 | Ga0207678_10000013 | 3300026067 | Bacteria | 141619 |
| 394 | Ga0207678_10100896 | 3300026067 | Bacteria | 2465 |
| 395 | Ga0207678_10817716 | 3300026067 | Bacteria | 823 |
| 396 | Ga0207708_10000385 | 3300026075 | Bacteria | 34524 |
| 397 | Ga0207702_10000510 | 3300026078 | Bacteria | 43837 |
| 398 | Ga0207702_10102556 | 3300026078 | Bacteria | 2529 |
| 399 | Ga0207702_10112615 | 3300026078 | Bacteria | 2422 |
| 400 | Ga0207702_10228993 | 3300026078 | Bacteria | 1736 |
| 401 | Ga0207702_11506382 | 3300026078 | Bacteria | 666 |
| 402 | Ga0207641_10754322 | 3300026088 | Bacteria | 961 |
| 403 | Ga0207641_11973808 | 3300026088 | Bacteria | 585 |
| 404 | Ga0207648_10001978 | 3300026089 | Bacteria | 22373 |
| 405 | Ga0207648_10570654 | 3300026089 | Bacteria | 1041 |
| 406 | Ga0207676_10028277 | 3300026095 | Bacteria | 4186 |
| 407 | Ga0207674_10217041 | 3300026116 | Bacteria | 1861 |
| 408 | Ga0207674_10235219 | 3300026116 | Bacteria | 1780 |
| 409 | Ga0207674_11071197 | 3300026116 | Bacteria | 775 |
| 410 | Ga0207675_100002060 | 3300026118 | Bacteria | 20050 |
| 411 | Ga0207675_101311513 | 3300026118 | Bacteria | 744 |
| 412 | Ga0207683_10032154 | 3300026121 | Bacteria | 4557 |
| 413 | Ga0207698_10001893 | 3300026142 | Bacteria | 12258 |
| 414 | Ga0207698_10005482 | 3300026142 | Bacteria | 7850 |
| 415 | Ga0207698_10022179 | 3300026142 | Bacteria | 4406 |
| 416 | Ga0207698_10025195 | 3300026142 | Bacteria | 4185 |
| 417 | Ga0207698_10116334 | 3300026142 | Bacteria | 2253 |
| 418 | Ga0207698_11530545 | 3300026142 | Bacteria | 682 |
| 419 | Ga0209999_1004974 | 3300027543 | Bacteria | 2393 |
| 420 | Ga0209971_1025274 | 3300027682 | Bacteria | 1419 |
| 421 | Ga0209974_10020533 | 3300027876 | Bacteria | 2189 |
| 422 | Ga0209974_10079207 | 3300027876 | Bacteria | 1128 |
| 423 | Ga0209974_10130861 | 3300027876 | Bacteria | 895 |
| 424 | Ga0207428_10007500 | 3300027907 | Bacteria | 9940 |
| 425 | Ga0268266_10002109 | 3300028379 | Bacteria | 21964 |
| 426 | Ga0268266_10137854 | 3300028379 | Bacteria | 2187 |
| 427 | Ga0268265_10111341 | 3300028380 | Bacteria | 2236 |
| 428 | Ga0268265_10404698 | 3300028380 | Bacteria | 1262 |
| 429 | Ga0268265_10504177 | 3300028380 | Bacteria | 1141 |
| 430 | Ga0268265_10520551 | 3300028380 | Bacteria | 1124 |
| 431 | Ga0268265_10627683 | 3300028380 | Bacteria | 1030 |
| 432 | Ga0268264_10119750 | 3300028381 | Bacteria | 2318 |
| 433 | Ga0265334_10149267 | 3300028573 | Bacteria | 825 |
| 434 | Ga0307517_10001402 | 3300028786 | Bacteria | 40531 |
| 435 | Ga0265338_10330923 | 3300028800 | Bacteria | 1100 |
| 436 | Ga0307511_10003572 | 3300030521 | Bacteria | 15931 |
| 437 | Ga0265329_10304338 | 3300031242 | Bacteria | 539 |
| 438 | Ga0307513_10000020 | 3300031456 | Bacteria | 228745 |
| 439 | Ga0307513_10008370 | 3300031456 | Bacteria | 13244 |
| 440 | Ga0307509_10000056 | 3300031507 | Bacteria | 157836 |
| 441 | Ga0307408_100068146 | 3300031548 | Bacteria | 2619 |
| 442 | Ga0307408_100169980 | 3300031548 | Bacteria | 1740 |
| 443 | Ga0307408_100301796 | 3300031548 | Bacteria | 1342 |
| 444 | Ga0307408_100896427 | 3300031548 | Bacteria | 811 |
| 445 | Ga0307408_100904355 | 3300031548 | Bacteria | 808 |
| 446 | Ga0316575_10023402 | 3300031665 | Bacteria | 2388 |
| 447 | Ga0316575_10410939 | 3300031665 | Bacteria | 581 |
| 448 | Ga0316579_10020119 | 3300031691 | Bacteria | 2955 |
| 449 | Ga0265342_10007158 | 3300031712 | Bacteria | 8211 |
| 450 | Ga0307516_10047728 | 3300031730 | Bacteria | 4216 |
| 451 | Ga0307405_10025432 | 3300031731 | Bacteria | 3399 |
| 452 | Ga0307405_10363011 | 3300031731 | Bacteria | 1121 |
| 453 | Ga0307405_10691972 | 3300031731 | Bacteria | 843 |
| 454 | Ga0307405_10904265 | 3300031731 | Bacteria | 747 |
| 455 | Ga0307413_10070066 | 3300031824 | Bacteria | 2203 |
| 456 | Ga0307413_10291853 | 3300031824 | Bacteria | 1232 |
| 457 | Ga0307413_10575506 | 3300031824 | Bacteria | 918 |
| 458 | Ga0307413_10595082 | 3300031824 | Bacteria | 904 |
| 459 | Ga0307413_10781636 | 3300031824 | Bacteria | 801 |
| 460 | Ga0307413_11507632 | 3300031824 | Bacteria | 595 |
| 461 | Ga0307410_10005780 | 3300031852 | Bacteria | 6595 |
| 462 | Ga0307410_10151567 | 3300031852 | Bacteria | 1727 |
| 463 | Ga0307410_10182545 | 3300031852 | Bacteria | 1589 |
| 464 | Ga0307410_10521906 | 3300031852 | Bacteria | 980 |
| 465 | Ga0307410_11261606 | 3300031852 | Bacteria | 645 |
| 466 | Ga0307406_10020369 | 3300031901 | Bacteria | 3904 |
| 467 | Ga0307406_10182563 | 3300031901 | Bacteria | 1529 |
| 468 | Ga0307406_10812075 | 3300031901 | Bacteria | 790 |
| 469 | Ga0307407_10067403 | 3300031903 | Bacteria | 2115 |
| 470 | Ga0307412_10327413 | 3300031911 | Bacteria | 1221 |
| 471 | Ga0307412_10328513 | 3300031911 | Bacteria | 1220 |
| 472 | Ga0307412_10842833 | 3300031911 | Bacteria | 799 |
| 473 | Ga0307409_100034586 | 3300031995 | Bacteria | 3692 |
| 474 | Ga0307409_100486041 | 3300031995 | Bacteria | 1199 |
| 475 | Ga0307416_100007443 | 3300032002 | Bacteria | 6964 |
| 476 | Ga0307416_100449034 | 3300032002 | Bacteria | 1341 |
| 477 | Ga0307416_101179386 | 3300032002 | Bacteria | 871 |
| 478 | Ga0307416_101188248 | 3300032002 | Bacteria | 868 |
| 479 | Ga0307414_10060944 | 3300032004 | Bacteria | 2671 |
| 480 | Ga0307414_10150578 | 3300032004 | Bacteria | 1835 |
| 481 | Ga0307414_10227696 | 3300032004 | Bacteria | 1535 |
| 482 | Ga0307414_10443828 | 3300032004 | Bacteria | 1136 |
| 483 | Ga0307414_11672758 | 3300032004 | Bacteria | 593 |
| 484 | Ga0307411_10025273 | 3300032005 | Bacteria | 3556 |
| 485 | Ga0307411_10042464 | 3300032005 | Bacteria | 2901 |
| 486 | Ga0307411_10045331 | 3300032005 | Bacteria | 2828 |
| 487 | Ga0307411_10245813 | 3300032005 | Bacteria | 1404 |
| 488 | Ga0307415_100001602 | 3300032126 | Bacteria | 10932 |
| 489 | Ga0307415_100176907 | 3300032126 | Bacteria | 1670 |
| 490 | Ga0307415_100288849 | 3300032126 | Bacteria | 1353 |
| 491 | Ga0307415_100585560 | 3300032126 | Bacteria | 990 |
| 492 | Ga0307510_10002995 | 3300033180 | Bacteria | 19438 |
| 493 | Ga0373936_0000887 | 3300035113 | Bacteria | 10695 |
| 494 | Ga0373939_0091708 | 3300035114 | Bacteria | 1028 |
| 495 | Ga0373962_0210662 | 3300035242 | Bacteria | 661 |
| 496 | Ga0373927_0362630 | 3300035695 | Bacteria | 955 |
| 497 | Ga0373933_0440330 | 3300035724 | Bacteria | 852 |
| 498 | Ga0373937_0396323 | 3300036401 | Bacteria | 1310 |
| 499 | Ga0316582_0002570 | 3300036647 | Bacteria | 8597 |
| 500 | Ga0395899_0000065 | 3300037312 | Bacteria | 205510 |
| 501 | Ga0395899_0104684 | 3300037312 | Bacteria | 2039 |
| 502 | Ga0395899_0181544 | 3300037312 | Bacteria | 1477 |
| 503 | Ga0395900_0000339 | 3300037418 | Bacteria | 69082 |
| 504 | Ga0395900_0002169 | 3300037418 | Bacteria | 21931 |
| 505 | Ga0395900_0111949 | 3300037418 | Bacteria | 2803 |
| 506 | Ga0395900_0173674 | 3300037418 | Bacteria | 2193 |
| 507 | Ga0395900_0185390 | 3300037418 | Bacteria | 2112 |
| 508 | Ga0395900_0341354 | 3300037418 | Bacteria | 1473 |
| 509 | Ga0395900_0364909 | 3300037418 | Bacteria | 1415 |
| 510 | Ga0395900_0745310 | 3300037418 | Bacteria | 910 |
| 511 | Ga0395900_1290620 | 3300037418 | Bacteria | 644 |
| 512 | Ga0395900_1712055 | 3300037418 | Bacteria | 539 |
| 513 | Ga0395898_0000565 | 3300037466 | Bacteria | 69082 |
| 514 | Ga0395898_0034389 | 3300037466 | Bacteria | 5052 |
| 515 | Ga0395898_0069666 | 3300037466 | Bacteria | 3402 |
| 516 | Ga0395898_0155514 | 3300037466 | Bacteria | 2187 |
| 517 | Ga0395905_0001727 | 3300037471 | Bacteria | 25583 |
| 518 | Ga0395905_0027044 | 3300037471 | Bacteria | 5410 |
| 519 | Ga0395905_0195730 | 3300037471 | Bacteria | 1895 |
| 520 | Ga0395905_0448623 | 3300037471 | Bacteria | 1188 |
| 521 | Ga0395905_0553544 | 3300037471 | Bacteria | 1051 |
| 522 | Ga0395905_0671168 | 3300037471 | Bacteria | 939 |
| 523 | Ga0436364_0186181 | 3300037853 | Bacteria | 1273 |
| 524 | Ga0395901_0000994 | 3300038443 | Bacteria | 30620 |
| 525 | Ga0395901_0143930 | 3300038443 | Bacteria | 2506 |
| 526 | Ga0395901_0398951 | 3300038443 | Bacteria | 1413 |
| 527 | Ga0395901_0576994 | 3300038443 | Bacteria | 1137 |
| 528 | Ga0436365_0257402 | 3300039437 | Bacteria | 164674 |
| 529 | Ga0436365_0646826 | 3300039437 | Bacteria | 110896 |
| 530 | Ga0436365_0826287 | 3300039437 | Bacteria | 75557 |
| 531 | Ga0436365_1685576 | 3300039437 | Bacteria | 49468 |
| 532 | Ga0436362_1094363 | 3300039453 | Bacteria | 35955 |
| 533 | Ga0439439_0058281 | 3300041406 | Bacteria | 1022 |
| 534 | Ga0439453_0089630 | 3300041408 | Bacteria | 673 |
| 535 | Ga0439461_0128858 | 3300041410 | Bacteria | 638 |
| 536 | Ga0439466_0119927 | 3300041411 | Bacteria | 812 |
| 537 | Ga0451793_0794819 | 3300041452 | Bacteria | 612 |
| 538 | Ga0439431_0006863 | 3300041997 | Bacteria | 2529 |
| 539 | Ga0439433_0024280 | 3300041999 | Bacteria | 1365 |
| 540 | Ga0439433_0075409 | 3300041999 | Bacteria | 816 |
| 541 | Ga0439441_068626 | 3300042001 | Bacteria | 757 |
| 542 | Ga0439443_001002 | 3300042003 | Bacteria | 2908 |
| 543 | Ga0439445_0139123 | 3300042004 | Bacteria | 703 |
| 544 | Ga0439451_078934 | 3300042009 | Bacteria | 660 |
| 545 | Ga0439462_0039882 | 3300042015 | Bacteria | 1252 |
| 546 | Ga0450912_000880 | 3300042116 | Bacteria | 1677 |
| 547 | Ga0450913_009306 | 3300042117 | Bacteria | 770 |
| 548 | Ga0450914_019675 | 3300042118 | Bacteria | 743 |
| 549 | Ga0450920_012034 | 3300042122 | Bacteria | 1618 |
| 550 | Ga0450921_008756 | 3300042123 | Bacteria | 826 |
| 551 | Ga0450922_003671 | 3300042124 | Bacteria | 1410 |
| 552 | Ga0450923_001983 | 3300042125 | Bacteria | 2843 |
| 553 | Ga0450890_034836 | 3300042127 | Bacteria | 728 |
| 554 | Ga0450892_023010 | 3300042130 | Bacteria | 622 |
| 555 | Ga0450894_002478 | 3300042131 | Bacteria | 2476 |
| 556 | Ga0450896_005989 | 3300042133 | Bacteria | 1664 |
| 557 | Ga0450896_020051 | 3300042133 | Bacteria | 976 |
| 558 | Ga0450898_012904 | 3300042134 | Bacteria | 1386 |
| 559 | Ga0450906_012176 | 3300042145 | Bacteria | 1597 |
| 560 | Ga0450907_008148 | 3300042146 | Bacteria | 1744 |
| 561 | Ga0450907_008643 | 3300042146 | Bacteria | 1688 |
| 562 | Ga0439446_0008772 | 3300042156 | Bacteria | 2693 |
| 563 | Ga0450908_000818 | 3300042184 | Bacteria | 5986 |
| 564 | Ga0439434_0005621 | 3300042435 | Bacteria | 3662 |
| 565 | Ga0439435_0000323 | 3300042436 | Bacteria | 7215 |
| 566 | Ga0439444_0002954 | 3300042437 | Bacteria | 2368 |
| 567 | Ga0439464_0222193 | 3300042439 | Bacteria | 606 |
| 568 | Ga0439460_0027919 | 3300042461 | Bacteria | 1588 |
| 569 | Ga0466969_0007130 | 3300044656 | Bacteria | 5950 |
| 570 | Ga0466973_0047582 | 3300044659 | Bacteria | 3987 |
| 571 | Ga0466965_0051002 | 3300044683 | Bacteria | 2052 |
| 572 | Ga0466966_0204461 | 3300044684 | Bacteria | 1194 |
| 573 | Ga0466961_0140905 | 3300044693 | Bacteria | 1509 |
| 574 | Ga0466961_0264291 | 3300044693 | Bacteria | 1055 |
| 575 | Ga0466963_0000420 | 3300044694 | Bacteria | 19496 |
| 576 | Ga0466963_0037987 | 3300044694 | Bacteria | 3148 |
| 577 | Ga0466971_0034581 | 3300044719 | Bacteria | 2264 |
| 578 | Ga0466970_0011768 | 3300044765 | Bacteria | 4463 |
| 579 | Ga0466970_0041943 | 3300044765 | Bacteria | 2433 |
| 580 | Ga0466970_0267268 | 3300044765 | Bacteria | 960 |
| 581 | Ga0466957_0002050 | 3300044842 | Bacteria | 10767 |
| 582 | Ga0466957_0113287 | 3300044842 | Bacteria | 1722 |
| 583 | Ga0466957_0214515 | 3300044842 | Bacteria | 1269 |
| 584 | Ga0466957_0655971 | 3300044842 | Bacteria | 738 |
| 585 | Ga0466959_0011577 | 3300045049 | Bacteria | 6339 |
| 586 | Ga0466959_0013716 | 3300045049 | Bacteria | 5881 |
| 587 | Ga0466958_0001742 | 3300045836 | Bacteria | 10525 |
| 588 | Ga0466958_0561780 | 3300045836 | Bacteria | 742 |
| 589 | Ga0466967_0028685 | 3300045976 | Bacteria | 4650 |
| 590 | Ga0466967_0046076 | 3300045976 | Bacteria | 3794 |
| 591 | Ga0466967_0180842 | 3300045976 | Bacteria | 1989 |
| 592 | Ga0466967_0317091 | 3300045976 | Bacteria | 1503 |
| 593 | Ga0466967_1920744 | 3300045976 | Bacteria | 589 |
| 594 | Ga0495627_022360 | 3300046453 | Bacteria | 2081 |
| 595 | Ga0495591_003976 | 3300046458 | Bacteria | 7409 |
| 596 | Ga0495629_0090393 | 3300046459 | Bacteria | 2136 |
| 597 | Ga0495651_0252364 | 3300046462 | Bacteria | 1204 |
| 598 | Ga0495651_0508719 | 3300046462 | Bacteria | 770 |
| 599 | Ga0495650_0002301 | 3300046471 | Bacteria | 15850 |
| 600 | Ga0495605_0000013 | 3300046474 | Bacteria | 308178 |
| 601 | Ga0495594_0009155 | 3300046499 | Bacteria | 5109 |
| 602 | Ga0495594_0105903 | 3300046499 | Bacteria | 1584 |
| 603 | Ga0495607_0102651 | 3300046501 | Bacteria | 1529 |
| 604 | Ga0495583_0000042 | 3300046506 | Bacteria | 234630 |
| 605 | Ga0495610_0010567 | 3300046512 | Bacteria | 5724 |
| 606 | Ga0495616_0027713 | 3300046513 | Bacteria | 3004 |
| 607 | Ga0495616_0206167 | 3300046513 | Bacteria | 862 |
| 608 | Ga0495620_0000005 | 3300046515 | Bacteria | 284456 |
| 609 | Ga0495628_0275488 | 3300046516 | Bacteria | 1251 |
| 610 | Ga0495630_0617592 | 3300046517 | Bacteria | 831 |
| 611 | Ga0495631_0005085 | 3300046518 | Bacteria | 6928 |
| 612 | Ga0495637_0004482 | 3300046520 | Bacteria | 7226 |
| 613 | Ga0495648_0003365 | 3300046524 | Bacteria | 14076 |
| 614 | Ga0495648_0008447 | 3300046524 | Bacteria | 8102 |
| 615 | Ga0495652_0012589 | 3300046529 | Bacteria | 7629 |
| 616 | Ga0495652_0013775 | 3300046529 | Bacteria | 7276 |
| 617 | Ga0495654_0008924 | 3300046530 | Bacteria | 5509 |
| 618 | Ga0495609_0000266 | 3300046538 | Bacteria | 49129 |
| 619 | Ga0495597_0001238 | 3300046542 | Bacteria | 18962 |
| 620 | Ga0495645_0109625 | 3300046543 | Bacteria | 1954 |
| 621 | Ga0495622_0243135 | 3300046557 | Bacteria | 793 |
| 622 | Ga0495633_0000013 | 3300046558 | Bacteria | 262742 |
| 623 | Ga0495668_0071522 | 3300046616 | Bacteria | 1906 |
| 624 | Ga0495611_0000695 | 3300046648 | Bacteria | 19085 |
| 625 | Ga0495611_0414848 | 3300046648 | Bacteria | 615 |
| 626 | Ga0495661_0000008 | 3300046665 | Bacteria | 317971 |
| 627 | Ga0495646_0001903 | 3300046680 | Bacteria | 12547 |
| 628 | Ga0495647_0000679 | 3300046681 | Bacteria | 10146 |
| 629 | Ga0495658_0005197 | 3300046683 | Bacteria | 6401 |
| 630 | Ga0495669_0051406 | 3300046684 | Bacteria | 1849 |
| 631 | Ga0495624_0208108 | 3300046690 | Bacteria | 1187 |
| 632 | Ga0495670_0002708 | 3300046691 | Bacteria | 8750 |
| 633 | Ga0495670_0168159 | 3300046691 | Bacteria | 1154 |
| 634 | Ga0495671_0038740 | 3300046692 | Bacteria | 2408 |
| 635 | Ga0495589_0000258 | 3300046794 | Bacteria | 43340 |
| 636 | Ga0495660_0003027 | 3300046810 | Bacteria | 10485 |
| 637 | Ga0495683_0000002 | 3300047323 | Bacteria | 638279 |
| 638 | Ga0495687_075157 | 3300047443 | Bacteria | 1341 |
| 639 | Ga0495677_0001724 | 3300047445 | Bacteria | 8775 |
| 640 | Ga0495679_000315 | 3300047446 | Bacteria | 38700 |
| 641 | Ga0495673_0009844 | 3300047469 | Bacteria | 5250 |
| 642 | Ga0495602_0344983 | 3300048088 | Bacteria | 1076 |
| 643 | Ga0496100_1031388 | 3300048903 | Bacteria | 647 |
| 644 | Ga0496101_0675386 | 3300048904 | Bacteria | 816 |
| 645 | Ga0496102_0001273 | 3300048905 | Bacteria | 22767 |
| 646 | Ga0496102_0730626 | 3300048905 | Bacteria | 913 |
| 647 | Ga0496103_0009351 | 3300048906 | Bacteria | 5806 |
| 648 | Ga0496104_0232273 | 3300048907 | Bacteria | 1756 |
| 649 | Ga0496105_0535895 | 3300048908 | Bacteria | 915 |
| 650 | Ga0496106_0001067 | 3300048909 | Bacteria | 20209 |
| 651 | Ga0496107_0009614 | 3300048910 | Bacteria | 6705 |
| 652 | Ga0496110_0769774 | 3300048913 | Bacteria | 866 |
| 653 | Ga0496114_0668223 | 3300048917 | Bacteria | 913 |
| 654 | Ga0496115_0023967 | 3300048918 | Bacteria | 4739 |
| 655 | Ga0496115_0346713 | 3300048918 | Bacteria | 1212 |
| 656 | Ga0496115_0839344 | 3300048918 | Bacteria | 712 |
| 657 | Ga0496116_0157723 | 3300048919 | Bacteria | 1250 |
| 658 | Ga0496117_0169783 | 3300048920 | Bacteria | 1267 |
| 659 | Ga0496118_0045566 | 3300048921 | Bacteria | 3421 |
| 660 | Ga0496118_0485111 | 3300048921 | Bacteria | 618 |
| 661 | Ga0496121_0262066 | 3300048924 | Bacteria | 1193 |
| 662 | Ga0496126_0421180 | 3300048929 | Bacteria | 1079 |
| 663 | Ga0495682_0001351 | 3300049460 | Bacteria | 13529 |
| 664 | Ga0501031_0013941 | 3300049568 | Bacteria | 5235 |
| 665 | Ga0501031_0032491 | 3300049568 | Bacteria | 3403 |
| 666 | Ga0501032_0027352 | 3300049569 | Bacteria | 3919 |
| 667 | Ga0501032_0069791 | 3300049569 | Bacteria | 2345 |
| 668 | Ga0501032_0099543 | 3300049569 | Bacteria | 1926 |
| 669 | Ga0501033_0002118 | 3300049570 | Bacteria | 17169 |
| 670 | Ga0501033_0057451 | 3300049570 | Bacteria | 2876 |
| 671 | Ga0501033_0068162 | 3300049570 | Bacteria | 2616 |
| 672 | Ga0501033_0509900 | 3300049570 | Bacteria | 831 |
| 673 | Ga0501033_0509901 | 3300049570 | Bacteria | 831 |
| 674 | Ga0501033_1189907 | 3300049570 | Bacteria | 505 |
| 675 | Ga0501034_0400607 | 3300049571 | Bacteria | 1295 |
| 676 | Ga0501034_0467859 | 3300049571 | Bacteria | 1177 |
| 677 | Ga0501034_0588509 | 3300049571 | Bacteria | 1019 |
| 678 | Ga0501034_0624293 | 3300049571 | Bacteria | 981 |
| 679 | Ga0501034_1376182 | 3300049571 | Bacteria | 581 |
| 680 | Ga0501036_0029478 | 3300049572 | Bacteria | 4634 |
| 681 | Ga0501036_0163876 | 3300049572 | Bacteria | 1874 |
| 682 | Ga0501036_0300175 | 3300049572 | Bacteria | 1343 |
| 683 | Ga0501037_0045879 | 3300049573 | Bacteria | 3207 |
| 684 | Ga0501037_0108039 | 3300049573 | Bacteria | 2005 |
| 685 | Ga0501037_0118952 | 3300049573 | Bacteria | 1900 |
| 686 | Ga0501037_0183678 | 3300049573 | Bacteria | 1483 |
| 687 | Ga0501038_0007899 | 3300049574 | Bacteria | 9807 |
| 688 | Ga0501038_0338348 | 3300049574 | Bacteria | 1174 |
| 689 | Ga0501038_0369830 | 3300049574 | Bacteria | 1114 |
| 690 | Ga0501038_0619254 | 3300049574 | Bacteria | 817 |
| 691 | Ga0501039_0017899 | 3300049575 | Bacteria | 5436 |
| 692 | Ga0501039_0289805 | 3300049575 | Bacteria | 1287 |
| 693 | Ga0501040_0035522 | 3300049576 | Bacteria | 3380 |
| 694 | Ga0501041_0021329 | 3300049577 | Bacteria | 3882 |
| 695 | Ga0501042_0012392 | 3300049578 | Bacteria | 5775 |
| 696 | Ga0501043_0024618 | 3300049579 | Bacteria | 4723 |
| 697 | Ga0501043_0106643 | 3300049579 | Bacteria | 2200 |
| 698 | Ga0501043_0159297 | 3300049579 | Bacteria | 1764 |
| 699 | Ga0501046_0081537 | 3300049580 | Bacteria | 2498 |
| 700 | Ga0501046_0127161 | 3300049580 | Bacteria | 1935 |
| 701 | Ga0501046_0826346 | 3300049580 | Bacteria | 648 |
| 702 | Ga0501047_0005059 | 3300049581 | Bacteria | 12376 |
| 703 | Ga0501047_0010064 | 3300049581 | Bacteria | 8941 |
| 704 | Ga0501047_0032961 | 3300049581 | Bacteria | 5002 |
| 705 | Ga0501047_0092941 | 3300049581 | Bacteria | 2895 |
| 706 | Ga0501047_0201671 | 3300049581 | Bacteria | 1850 |
| 707 | Ga0501047_0529611 | 3300049581 | Bacteria | 1003 |
| 708 | Ga0501047_0708977 | 3300049581 | Bacteria | 823 |
| 709 | Ga0501048_0039024 | 3300049582 | Bacteria | 3407 |
| 710 | Ga0501048_0202684 | 3300049582 | Bacteria | 1406 |
| 711 | Ga0501048_0584953 | 3300049582 | Bacteria | 801 |
| 712 | Ga0501067_0320169 | 3300049583 | Bacteria | 864 |
| 713 | Ga0501068_0395170 | 3300049584 | Bacteria | 891 |
| 714 | Ga0501069_0035457 | 3300049585 | Bacteria | 2749 |
| 715 | Ga0501069_0119160 | 3300049585 | Bacteria | 1507 |
| 716 | Ga0501069_0146099 | 3300049585 | Bacteria | 1357 |
| 717 | Ga0501070_0000053 | 3300049586 | Bacteria | 100509 |
| 718 | Ga0501070_0066641 | 3300049586 | Bacteria | 2982 |
| 719 | Ga0501070_0108241 | 3300049586 | Bacteria | 2296 |
| 720 | Ga0501070_0155959 | 3300049586 | Bacteria | 1882 |
| 721 | Ga0501070_0406947 | 3300049586 | Bacteria | 1100 |
| 722 | Ga0501070_0423660 | 3300049586 | Bacteria | 1075 |
| 723 | Ga0501071_0003737 | 3300049587 | Bacteria | 9561 |
| 724 | Ga0501071_0082872 | 3300049587 | Bacteria | 2349 |
| 725 | Ga0501073_0000577 | 3300049589 | Bacteria | 25884 |
| 726 | Ga0501073_0028253 | 3300049589 | Bacteria | 4008 |
| 727 | Ga0501073_0068978 | 3300049589 | Bacteria | 2464 |
| 728 | Ga0501073_0409241 | 3300049589 | Bacteria | 937 |
| 729 | Ga0501074_0002371 | 3300049590 | Bacteria | 13121 |
| 730 | Ga0501074_0086083 | 3300049590 | Bacteria | 2251 |
| 731 | Ga0501075_0059024 | 3300049591 | Bacteria | 2890 |
| 732 | Ga0501076_0001771 | 3300049592 | Bacteria | 14617 |
| 733 | Ga0501077_0274497 | 3300049593 | Bacteria | 1073 |
| 734 | Ga0501077_0942644 | 3300049593 | Bacteria | 555 |
| 735 | Ga0501079_0158877 | 3300049741 | Bacteria | 1762 |
| 736 | Ga0501079_0304426 | 3300049741 | Bacteria | 1247 |
| 737 | Ga0501079_1047731 | 3300049741 | Bacteria | 643 |
| 738 | Ga0501079_1231777 | 3300049741 | Bacteria | 589 |
| 739 | Ga0501080_0000938 | 3300049742 | Bacteria | 23852 |
| 740 | Ga0501080_0008441 | 3300049742 | Bacteria | 9331 |
| 741 | Ga0501080_0033586 | 3300049742 | Bacteria | 4788 |
| 742 | Ga0501080_0357717 | 3300049742 | Bacteria | 1317 |
| 743 | Ga0501081_0175732 | 3300049743 | Bacteria | 1547 |
| 744 | Ga0501083_0127633 | 3300049744 | Bacteria | 1667 |
| 745 | Ga0501083_0570553 | 3300049744 | Bacteria | 736 |
| 746 | Ga0501083_0675116 | 3300049744 | Bacteria | 672 |
| 747 | Ga0501035_0002523 | 3300049822 | Bacteria | 17906 |
| 748 | Ga0501035_0013722 | 3300049822 | Bacteria | 7477 |
| 749 | Ga0501035_0013871 | 3300049822 | Bacteria | 7436 |
| 750 | Ga0501035_0034801 | 3300049822 | Bacteria | 4576 |
| 751 | Ga0501035_0075995 | 3300049822 | Bacteria | 2970 |
| 752 | Ga0501035_0165955 | 3300049822 | Bacteria | 1909 |
| 753 | Ga0501035_0708039 | 3300049822 | Bacteria | 811 |
| 754 | Ga0501035_0784644 | 3300049822 | Bacteria | 762 |
| 755 | Ga0501035_0785788 | 3300049822 | Bacteria | 761 |
| 756 | Ga0501044_0007608 | 3300049823 | Bacteria | 11911 |
| 757 | Ga0501044_0009238 | 3300049823 | Bacteria | 10767 |
| 758 | Ga0501044_0080394 | 3300049823 | Bacteria | 3302 |
| 759 | Ga0501044_0264207 | 3300049823 | Bacteria | 1658 |
| 760 | Ga0501044_0288942 | 3300049823 | Bacteria | 1571 |
| 761 | Ga0501044_0397030 | 3300049823 | Bacteria | 1292 |
| 762 | Ga0501044_0786581 | 3300049823 | Bacteria | 831 |
| 763 | Ga0501044_1108284 | 3300049823 | Bacteria | 661 |
| 764 | Ga0501044_1133217 | 3300049823 | Bacteria | 651 |
| 765 | Ga0501045_0014534 | 3300049824 | Bacteria | 5580 |
| 766 | nmdc:mga0yw44_311321_c1 | 3300050492 | Bacteria | 1056 |
| 767 | nmdc:mga0yw44_9502_c1 | 3300050492 | Bacteria | 4923 |
| 768 | nmdc:mga0k408_19569_c1 | 3300050493 | Bacteria | 3785 |
| 769 | nmdc:mga0k408_300878_c1 | 3300050493 | Bacteria | 957 |
| 770 | nmdc:mga06z11_11686_c1 | 3300050494 | Bacteria | 3793 |
| 771 | nmdc:mga06z11_203119_c1 | 3300050494 | Bacteria | 1152 |
| 772 | nmdc:mga07m45_355696_c1 | 3300050496 | Bacteria | 851 |
| 773 | nmdc:mga07m45_77159_c1 | 3300050496 | Bacteria | 1900 |
| 774 | nmdc:mga0qj67_130393_c1 | 3300050509 | Bacteria | 2036 |
| 775 | nmdc:mga0qj67_1316339_c1 | 3300050509 | Bacteria | 559 |
| 776 | nmdc:mga06r32_115354_c1 | 3300050510 | Bacteria | 2645 |
| 777 | nmdc:mga08y16_2349_c1 | 3300050511 | Bacteria | 19391 |
| 778 | nmdc:mga08x19_786066_c1 | 3300050514 | Bacteria | 676 |
| 779 | nmdc:mga0sz30_2167_c1 | 3300050516 | Bacteria | 797 |
| 780 | Ga0500583_0380171 | 3300053092 | Bacteria | 680 |
| 781 | Ga0500566_0181718 | 3300053094 | Bacteria | 1078 |
| 782 | Ga0500641_0053243 | 3300053096 | Bacteria | 1670 |
| 783 | Ga0500560_000059 | 3300053107 | Bacteria | 10296 |
| 784 | Ga0500591_004988 | 3300053115 | Bacteria | 5883 |
| 785 | Ga0500595_015188 | 3300053119 | Bacteria | 2894 |
| 786 | Ga0500595_075447 | 3300053119 | Bacteria | 994 |
| 787 | Ga0500618_011279 | 3300053125 | Bacteria | 2374 |
| 788 | Ga0500655_048237 | 3300053133 | Bacteria | 845 |
| 789 | Ga0500568_0138862 | 3300053139 | Bacteria | 901 |
| 790 | Ga0500573_0476260 | 3300053140 | Bacteria | 570 |
| 791 | Ga0500624_002981 | 3300053157 | Unclassified | 2237 |
| 792 | Ga0500634_0115463 | 3300053161 | Bacteria | 1316 |
| 793 | Ga0501084_0000057 | 3300054114 | Bacteria | 87821 |
| 794 | Ga0501084_0209931 | 3300054114 | Bacteria | 1643 |
| 795 | Ga0501082_1055425 | 3300060353 | Bacteria | 710 |
| 796 | Ga0466962_0033412 | 3300061719 | Bacteria | 2460 |
| 797 | Ga0466962_0313998 | 3300061719 | Bacteria | 777 |
| 798 | Ga0530510_0263186 | 3300061734 | Bacteria | 1286 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049593 | Ga0501077_0274497 | Ga0501077_0274497_67_498 | 134 |
| 2 | 3300060353 | Ga0501082_1055425 | Ga0501082_1055425_72_503 | 134 |
| 3 | 3300005617 | Ga0068859_100810213 | Ga0068859_1008102132 | 135 |
| 4 | 3300005617 | Ga0068859_100815896 | Ga0068859_1008158962 | 135 |
| 5 | 3300006844 | Ga0075428_100027797 | Ga0075428_1000277976 | 135 |
| 6 | 3300006846 | Ga0075430_100141423 | Ga0075430_1001414232 | 135 |
| 7 | 3300006847 | Ga0075431_100572019 | Ga0075431_1005720192 | 135 |
| 8 | 3300006931 | Ga0097620_100810124 | Ga0097620_1008101242 | 135 |
| 9 | 3300006931 | Ga0097620_100815662 | Ga0097620_1008156622 | 135 |
| 10 | 3300009177 | Ga0105248_10651324 | Ga0105248_106513242 | 135 |
| 11 | 3300026035 | Ga0207703_11275298 | Ga0207703_112752982 | 135 |
| 12 | 3300042439 | Ga0439464_0222193 | Ga0439464_0222193_50_469 | 135 |
| 13 | 3300050509 | nmdc:mga0qj67_130393_c1 | nmdc:mga0qj67_130393_c1_402_830 | 135 |
| 14 | 3300050510 | nmdc:mga06r32_115354_c1 | nmdc:mga06r32_115354_c1_1800_2228 | 135 |
| 15 | 3300037418 | Ga0395900_0364909 | Ga0395900_0364909_310_726 | 136 |
| 16 | 3300028573 | Ga0265334_10149267 | Ga0265334_101492671 | 137 |
| 17 | 3300037471 | Ga0395905_0027044 | Ga0395905_0027044_662_1081 | 137 |
| 18 | 3300046459 | Ga0495629_0090393 | Ga0495629_0090393_1466_1888 | 137 |
| 19 | 3300046499 | Ga0495594_0105903 | Ga0495594_0105903_295_717 | 137 |
| 20 | 3300046513 | Ga0495616_0206167 | Ga0495616_0206167_418_834 | 137 |
| 21 | 3300046681 | Ga0495647_0000679 | Ga0495647_0000679_439_861 | 137 |
| 22 | 3300046683 | Ga0495658_0005197 | Ga0495658_0005197_3403_3825 | 137 |
| 23 | 3300049586 | Ga0501070_0423660 | Ga0501070_0423660_73_492 | 137 |
| 24 | 3300005330 | Ga0070690_100053060 | Ga0070690_1000530603 | 138 |
| 25 | 3300005334 | Ga0068869_100076760 | Ga0068869_1000767602 | 138 |
| 26 | 3300005334 | Ga0068869_100163980 | Ga0068869_1001639802 | 138 |
| 27 | 3300005336 | Ga0070680_100010536 | Ga0070680_1000105365 | 138 |
| 28 | 3300005337 | Ga0070682_100267438 | Ga0070682_1002674382 | 138 |
| 29 | 3300005339 | Ga0070660_100097844 | Ga0070660_1000978442 | 138 |
| 30 | 3300005340 | Ga0070689_100374048 | Ga0070689_1003740483 | 138 |
| 31 | 3300005341 | Ga0070691_10043175 | Ga0070691_100431752 | 138 |
| 32 | 3300005344 | Ga0070661_100429640 | Ga0070661_1004296401 | 138 |
| 33 | 3300005345 | Ga0070692_10795489 | Ga0070692_107954891 | 138 |
| 34 | 3300005347 | Ga0070668_102032730 | Ga0070668_1020327301 | 138 |
| 35 | 3300005353 | Ga0070669_100114428 | Ga0070669_1001144282 | 138 |
| 36 | 3300005354 | Ga0070675_100032605 | Ga0070675_1000326052 | 138 |
| 37 | 3300005356 | Ga0070674_100151761 | Ga0070674_1001517612 | 138 |
| 38 | 3300005366 | Ga0070659_100296747 | Ga0070659_1002967472 | 138 |
| 39 | 3300005366 | Ga0070659_100577394 | Ga0070659_1005773941 | 138 |
| 40 | 3300005437 | Ga0070710_10895294 | Ga0070710_108952941 | 138 |
| 41 | 3300005438 | Ga0070701_10005288 | Ga0070701_100052882 | 138 |
| 42 | 3300005441 | Ga0070700_100051959 | Ga0070700_1000519593 | 138 |
| 43 | 3300005444 | Ga0070694_100577452 | Ga0070694_1005774521 | 138 |
| 44 | 3300005455 | Ga0070663_100310914 | Ga0070663_1003109142 | 138 |
| 45 | 3300005456 | Ga0070678_100042002 | Ga0070678_1000420021 | 138 |
| 46 | 3300005456 | Ga0070678_101033783 | Ga0070678_1010337831 | 138 |
| 47 | 3300005457 | Ga0070662_100060905 | Ga0070662_1000609051 | 138 |
| 48 | 3300005457 | Ga0070662_100946168 | Ga0070662_1009461682 | 138 |
| 49 | 3300005458 | Ga0070681_10000619 | Ga0070681_1000061910 | 138 |
| 50 | 3300005458 | Ga0070681_10023617 | Ga0070681_100236174 | 138 |
| 51 | 3300005459 | Ga0068867_101912983 | Ga0068867_1019129831 | 138 |
| 52 | 3300005530 | Ga0070679_100001372 | Ga0070679_1000013725 | 138 |
| 53 | 3300005530 | Ga0070679_100247621 | Ga0070679_1002476212 | 138 |
| 54 | 3300005530 | Ga0070679_100707595 | Ga0070679_1007075952 | 138 |
| 55 | 3300005530 | Ga0070679_101106443 | Ga0070679_1011064431 | 138 |
| 56 | 3300005539 | Ga0068853_100344038 | Ga0068853_1003440382 | 138 |
| 57 | 3300005543 | Ga0070672_100087744 | Ga0070672_1000877444 | 138 |
| 58 | 3300005544 | Ga0070686_100104196 | Ga0070686_1001041963 | 138 |
| 59 | 3300005544 | Ga0070686_100613679 | Ga0070686_1006136792 | 138 |
| 60 | 3300005546 | Ga0070696_100057270 | Ga0070696_1000572703 | 138 |
| 61 | 3300005547 | Ga0070693_100256165 | Ga0070693_1002561652 | 138 |
| 62 | 3300005548 | Ga0070665_100010218 | Ga0070665_1000102183 | 138 |
| 63 | 3300005548 | Ga0070665_100281520 | Ga0070665_1002815201 | 138 |
| 64 | 3300005563 | Ga0068855_100000956 | Ga0068855_10000095619 | 138 |
| 65 | 3300005563 | Ga0068855_100027475 | Ga0068855_1000274755 | 138 |
| 66 | 3300005564 | Ga0070664_100441325 | Ga0070664_1004413251 | 138 |
| 67 | 3300005615 | Ga0070702_100680859 | Ga0070702_1006808591 | 138 |
| 68 | 3300005616 | Ga0068852_100476441 | Ga0068852_1004764412 | 138 |
| 69 | 3300005616 | Ga0068852_101017783 | Ga0068852_1010177831 | 138 |
| 70 | 3300005617 | Ga0068859_100284700 | Ga0068859_1002847001 | 138 |
| 71 | 3300005618 | Ga0068864_100196746 | Ga0068864_1001967462 | 138 |
| 72 | 3300005718 | Ga0068866_10027804 | Ga0068866_100278044 | 138 |
| 73 | 3300005719 | Ga0068861_100006025 | Ga0068861_1000060258 | 138 |
| 74 | 3300005841 | Ga0068863_102267347 | Ga0068863_1022673471 | 138 |
| 75 | 3300005842 | Ga0068858_100001633 | Ga0068858_10000163324 | 138 |
| 76 | 3300005842 | Ga0068858_100249299 | Ga0068858_1002492992 | 138 |
| 77 | 3300005842 | Ga0068858_101282267 | Ga0068858_1012822671 | 138 |
| 78 | 3300005843 | Ga0068860_100140375 | Ga0068860_1001403753 | 138 |
| 79 | 3300005844 | Ga0068862_100389155 | Ga0068862_1003891552 | 138 |
| 80 | 3300006237 | Ga0097621_100165351 | Ga0097621_1001653511 | 138 |
| 81 | 3300006358 | Ga0068871_100270213 | Ga0068871_1002702132 | 138 |
| 82 | 3300006881 | Ga0068865_100015542 | Ga0068865_1000155423 | 138 |
| 83 | 3300006881 | Ga0068865_100729077 | Ga0068865_1007290771 | 138 |
| 84 | 3300006931 | Ga0097620_100284700 | Ga0097620_1002847001 | 138 |
| 85 | 3300009093 | Ga0105240_10000921 | Ga0105240_1000092134 | 138 |
| 86 | 3300009093 | Ga0105240_10009666 | Ga0105240_100096664 | 138 |
| 87 | 3300009093 | Ga0105240_10011013 | Ga0105240_100110134 | 138 |
| 88 | 3300009093 | Ga0105240_10037794 | Ga0105240_100377944 | 138 |
| 89 | 3300009094 | Ga0111539_10029610 | Ga0111539_100296102 | 138 |
| 90 | 3300009098 | Ga0105245_10004106 | Ga0105245_100041064 | 138 |
| 91 | 3300009098 | Ga0105245_10388007 | Ga0105245_103880072 | 138 |
| 92 | 3300009098 | Ga0105245_11270303 | Ga0105245_112703031 | 138 |
| 93 | 3300009101 | Ga0105247_10283153 | Ga0105247_102831532 | 138 |
| 94 | 3300009148 | Ga0105243_10022806 | Ga0105243_100228063 | 138 |
| 95 | 3300009148 | Ga0105243_10164548 | Ga0105243_101645482 | 138 |
| 96 | 3300009148 | Ga0105243_12862885 | Ga0105243_128628851 | 138 |
| 97 | 3300009174 | Ga0105241_10171401 | Ga0105241_101714012 | 138 |
| 98 | 3300009176 | Ga0105242_10168870 | Ga0105242_101688701 | 138 |
| 99 | 3300009545 | Ga0105237_10103204 | Ga0105237_101032042 | 138 |
| 100 | 3300009545 | Ga0105237_10493869 | Ga0105237_104938691 | 138 |
| 101 | 3300009551 | Ga0105238_10002000 | Ga0105238_100020005 | 138 |
| 102 | 3300009551 | Ga0105238_10179560 | Ga0105238_101795601 | 138 |
| 103 | 3300009551 | Ga0105238_11292256 | Ga0105238_112922562 | 138 |
| 104 | 3300009551 | Ga0105238_11729549 | Ga0105238_117295492 | 138 |
| 105 | 3300013102 | Ga0157371_10253003 | Ga0157371_102530032 | 138 |
| 106 | 3300013104 | Ga0157370_10002265 | Ga0157370_1000226521 | 138 |
| 107 | 3300013104 | Ga0157370_10062315 | Ga0157370_100623151 | 138 |
| 108 | 3300013104 | Ga0157370_10125803 | Ga0157370_101258033 | 138 |
| 109 | 3300013105 | Ga0157369_10013484 | Ga0157369_100134842 | 138 |
| 110 | 3300013105 | Ga0157369_10089945 | Ga0157369_100899453 | 138 |
| 111 | 3300013105 | Ga0157369_10111259 | Ga0157369_101112592 | 138 |
| 112 | 3300013297 | Ga0157378_10459768 | Ga0157378_104597682 | 138 |
| 113 | 3300013306 | Ga0163162_10194029 | Ga0163162_101940293 | 138 |
| 114 | 3300013307 | Ga0157372_10320359 | Ga0157372_103203591 | 138 |
| 115 | 3300014326 | Ga0157380_10033868 | Ga0157380_100338683 | 138 |
| 116 | 3300014968 | Ga0157379_10237614 | Ga0157379_102376142 | 138 |
| 117 | 3300020082 | Ga0206353_10090608 | Ga0206353_100906081 | 138 |
| 118 | 3300021358 | Ga0213873_10000017 | Ga0213873_10000017125 | 138 |
| 119 | 3300021384 | Ga0213876_10000071 | Ga0213876_1000007112 | 138 |
| 120 | 3300022467 | Ga0224712_10043427 | Ga0224712_100434272 | 138 |
| 121 | 3300025898 | Ga0207692_10578583 | Ga0207692_105785831 | 138 |
| 122 | 3300025899 | Ga0207642_10012770 | Ga0207642_100127703 | 138 |
| 123 | 3300025909 | Ga0207705_11107543 | Ga0207705_111075431 | 138 |
| 124 | 3300025911 | Ga0207654_10797396 | Ga0207654_107973962 | 138 |
| 125 | 3300025912 | Ga0207707_10000038 | Ga0207707_1000003850 | 138 |
| 126 | 3300025912 | Ga0207707_10004902 | Ga0207707_100049022 | 138 |
| 127 | 3300025913 | Ga0207695_10003158 | Ga0207695_100031584 | 138 |
| 128 | 3300025913 | Ga0207695_10007437 | Ga0207695_1000743711 | 138 |
| 129 | 3300025913 | Ga0207695_10008910 | Ga0207695_100089106 | 138 |
| 130 | 3300025914 | Ga0207671_10148070 | Ga0207671_101480702 | 138 |
| 131 | 3300025917 | Ga0207660_10003261 | Ga0207660_100032619 | 138 |
| 132 | 3300025919 | Ga0207657_10290360 | Ga0207657_102903602 | 138 |
| 133 | 3300025921 | Ga0207652_10000982 | Ga0207652_1000098224 | 138 |
| 134 | 3300025921 | Ga0207652_11119865 | Ga0207652_111198652 | 138 |
| 135 | 3300025924 | Ga0207694_10007598 | Ga0207694_100075984 | 138 |
| 136 | 3300025924 | Ga0207694_10091217 | Ga0207694_100912173 | 138 |
| 137 | 3300025924 | Ga0207694_10708406 | Ga0207694_107084062 | 138 |
| 138 | 3300025925 | Ga0207650_10277407 | Ga0207650_102774071 | 138 |
| 139 | 3300025927 | Ga0207687_10333770 | Ga0207687_103337701 | 138 |
| 140 | 3300025931 | Ga0207644_11540627 | Ga0207644_115406271 | 138 |
| 141 | 3300025933 | Ga0207706_10023372 | Ga0207706_100233725 | 138 |
| 142 | 3300025934 | Ga0207686_10012916 | Ga0207686_100129165 | 138 |
| 143 | 3300025935 | Ga0207709_10068495 | Ga0207709_100684952 | 138 |
| 144 | 3300025936 | Ga0207670_10228596 | Ga0207670_102285962 | 138 |
| 145 | 3300025937 | Ga0207669_10170158 | Ga0207669_101701582 | 138 |
| 146 | 3300025938 | Ga0207704_10128572 | Ga0207704_101285723 | 138 |
| 147 | 3300025942 | Ga0207689_10007096 | Ga0207689_100070968 | 138 |
| 148 | 3300025949 | Ga0207667_10003312 | Ga0207667_1000331213 | 138 |
| 149 | 3300025949 | Ga0207667_10140552 | Ga0207667_101405523 | 138 |
| 150 | 3300025949 | Ga0207667_10244059 | Ga0207667_102440592 | 138 |
| 151 | 3300026023 | Ga0207677_10082228 | Ga0207677_100822283 | 138 |
| 152 | 3300026035 | Ga0207703_10001323 | Ga0207703_100013234 | 138 |
| 153 | 3300026035 | Ga0207703_10108979 | Ga0207703_101089793 | 138 |
| 154 | 3300026041 | Ga0207639_10992560 | Ga0207639_109925602 | 138 |
| 155 | 3300026067 | Ga0207678_10817716 | Ga0207678_108177161 | 138 |
| 156 | 3300026075 | Ga0207708_10000385 | Ga0207708_1000038527 | 138 |
| 157 | 3300026088 | Ga0207641_11973808 | Ga0207641_119738081 | 138 |
| 158 | 3300026089 | Ga0207648_10001978 | Ga0207648_100019782 | 138 |
| 159 | 3300026118 | Ga0207675_100002060 | Ga0207675_1000020602 | 138 |
| 160 | 3300026121 | Ga0207683_10032154 | Ga0207683_100321542 | 138 |
| 161 | 3300026142 | Ga0207698_11530545 | Ga0207698_115305452 | 138 |
| 162 | 3300027907 | Ga0207428_10007500 | Ga0207428_100075004 | 138 |
| 163 | 3300028380 | Ga0268265_10504177 | Ga0268265_105041771 | 138 |
| 164 | 3300028380 | Ga0268265_10520551 | Ga0268265_105205512 | 138 |
| 165 | 3300028380 | Ga0268265_10627683 | Ga0268265_106276832 | 138 |
| 166 | 3300028381 | Ga0268264_10119750 | Ga0268264_101197501 | 138 |
| 167 | 3300030521 | Ga0307511_10003572 | Ga0307511_100035724 | 138 |
| 168 | 3300031242 | Ga0265329_10304338 | Ga0265329_103043381 | 138 |
| 169 | 3300031507 | Ga0307509_10000056 | Ga0307509_1000005672 | 138 |
| 170 | 3300031548 | Ga0307408_100169980 | Ga0307408_1001699802 | 138 |
| 171 | 3300031548 | Ga0307408_100301796 | Ga0307408_1003017962 | 138 |
| 172 | 3300031691 | Ga0316579_10020119 | Ga0316579_100201193 | 138 |
| 173 | 3300031712 | Ga0265342_10007158 | Ga0265342_1000715810 | 138 |
| 174 | 3300031731 | Ga0307405_10691972 | Ga0307405_106919721 | 138 |
| 175 | 3300031731 | Ga0307405_10904265 | Ga0307405_109042652 | 138 |
| 176 | 3300031824 | Ga0307413_10575506 | Ga0307413_105755062 | 138 |
| 177 | 3300031824 | Ga0307413_10595082 | Ga0307413_105950822 | 138 |
| 178 | 3300031852 | Ga0307410_11261606 | Ga0307410_112616062 | 138 |
| 179 | 3300031901 | Ga0307406_10182563 | Ga0307406_101825633 | 138 |
| 180 | 3300031901 | Ga0307406_10812075 | Ga0307406_108120751 | 138 |
| 181 | 3300031911 | Ga0307412_10842833 | Ga0307412_108428332 | 138 |
| 182 | 3300031995 | Ga0307409_100486041 | Ga0307409_1004860412 | 138 |
| 183 | 3300032002 | Ga0307416_101188248 | Ga0307416_1011882481 | 138 |
| 184 | 3300032004 | Ga0307414_10150578 | Ga0307414_101505784 | 138 |
| 185 | 3300032004 | Ga0307414_10443828 | Ga0307414_104438281 | 138 |
| 186 | 3300032004 | Ga0307414_11672758 | Ga0307414_116727581 | 138 |
| 187 | 3300032005 | Ga0307411_10045331 | Ga0307411_100453312 | 138 |
| 188 | 3300032126 | Ga0307415_100176907 | Ga0307415_1001769072 | 138 |
| 189 | 3300035113 | Ga0373936_0000887 | Ga0373936_0000887_4691_5125 | 138 |
| 190 | 3300036647 | Ga0316582_0002570 | Ga0316582_0002570_3431_3853 | 138 |
| 191 | 3300037312 | Ga0395899_0181544 | Ga0395899_0181544_770_1189 | 138 |
| 192 | 3300037418 | Ga0395900_0341354 | Ga0395900_0341354_266_688 | 138 |
| 193 | 3300037418 | Ga0395900_0745310 | Ga0395900_0745310_446_868 | 138 |
| 194 | 3300037471 | Ga0395905_0448623 | Ga0395905_0448623_16_438 | 138 |
| 195 | 3300037853 | Ga0436364_0186181 | Ga0436364_0186181_82_516 | 138 |
| 196 | 3300044694 | Ga0466963_0037987 | Ga0466963_0037987_2292_2711 | 138 |
| 197 | 3300044842 | Ga0466957_0113287 | Ga0466957_0113287_701_1120 | 138 |
| 198 | 3300044842 | Ga0466957_0214515 | Ga0466957_0214515_268_690 | 138 |
| 199 | 3300045976 | Ga0466967_0028685 | Ga0466967_0028685_1872_2291 | 138 |
| 200 | 3300045976 | Ga0466967_0180842 | Ga0466967_0180842_628_1050 | 138 |
| 201 | 3300045976 | Ga0466967_0317091 | Ga0466967_0317091_561_980 | 138 |
| 202 | 3300046684 | Ga0495669_0051406 | Ga0495669_0051406_441_863 | 138 |
| 203 | 3300046691 | Ga0495670_0168159 | Ga0495670_0168159_701_1120 | 138 |
| 204 | 3300047445 | Ga0495677_0001724 | Ga0495677_0001724_6968_7390 | 138 |
| 205 | 3300049744 | Ga0501083_0127633 | Ga0501083_0127633_738_1154 | 138 |
| 206 | 3300050511 | nmdc:mga08y16_2349_c1 | nmdc:mga08y16_2349_c1_3737_4156 | 138 |
| 207 | 3300053094 | Ga0500566_0181718 | Ga0500566_0181718_545_964 | 138 |
| 208 | 3300053096 | Ga0500641_0053243 | Ga0500641_0053243_813_1232 | 138 |
| 209 | 3300053115 | Ga0500591_004988 | Ga0500591_004988_2593_3027 | 138 |
| 210 | 3300053119 | Ga0500595_015188 | Ga0500595_015188_1056_1472 | 138 |
| 211 | 3300053139 | Ga0500568_0138862 | Ga0500568_0138862_292_711 | 138 |
| 212 | 3300061719 | Ga0466962_0313998 | Ga0466962_0313998_339_761 | 138 |
| 213 | iso_pu_bacteria | 2510917022 | 2511134251 | 138 |
| 214 | iso_pu_bacteria | 2582581307 | 2585271740 | 138 |
| 215 | iso_pu_bacteria | 2585427531 | 2585563020 | 138 |
| 216 | iso_pu_bacteria | 2585427608 | 2585902903 | 138 |
| 217 | iso_pu_bacteria | 2585427609 | 2585907235 | 138 |
| 218 | iso_pu_bacteria | 2585428125 | 2587982771 | 138 |
| 219 | iso_pu_bacteria | 2667528174 | 2671113426 | 138 |
| 220 | iso_pu_bacteria | 2838029111 | 2838030985 | 138 |
| 221 | iso_pu_bacteria | 2842475841 | 2842477717 | 138 |
| 222 | iso_pu_bacteria | 2842502639 | 2842504411 | 138 |
| 223 | iso_pu_bacteria | 2919408235 | 2919411117 | 138 |
| 224 | iso_pu_bacteria | 3005416602 | 3005421571 | 138 |
| 225 | iso_pu_bacteria | 8005314921 | 8005319726 | 138 |
| 226 | 3300005327 | Ga0070658_10000040 | Ga0070658_1000004049 | 139 |
| 227 | 3300005328 | Ga0070676_11007084 | Ga0070676_110070841 | 139 |
| 228 | 3300005336 | Ga0070680_100015864 | Ga0070680_1000158643 | 139 |
| 229 | 3300005338 | Ga0068868_100000047 | Ga0068868_10000004742 | 139 |
| 230 | 3300005339 | Ga0070660_100002023 | Ga0070660_1000020236 | 139 |
| 231 | 3300005339 | Ga0070660_100014626 | Ga0070660_1000146264 | 139 |
| 232 | 3300005339 | Ga0070660_100015658 | Ga0070660_1000156583 | 139 |
| 233 | 3300005339 | Ga0070660_100065200 | Ga0070660_1000652002 | 139 |
| 234 | 3300005339 | Ga0070660_101186455 | Ga0070660_1011864552 | 139 |
| 235 | 3300005340 | Ga0070689_100002871 | Ga0070689_1000028711 | 139 |
| 236 | 3300005344 | Ga0070661_100000324 | Ga0070661_10000032413 | 139 |
| 237 | 3300005345 | Ga0070692_10000687 | Ga0070692_100006878 | 139 |
| 238 | 3300005345 | Ga0070692_10020047 | Ga0070692_100200472 | 139 |
| 239 | 3300005353 | Ga0070669_101872207 | Ga0070669_1018722071 | 139 |
| 240 | 3300005354 | Ga0070675_100116424 | Ga0070675_1001164244 | 139 |
| 241 | 3300005366 | Ga0070659_100000022 | Ga0070659_100000022138 | 139 |
| 242 | 3300005366 | Ga0070659_100004108 | Ga0070659_1000041084 | 139 |
| 243 | 3300005366 | Ga0070659_100006002 | Ga0070659_1000060023 | 139 |
| 244 | 3300005366 | Ga0070659_100024020 | Ga0070659_1000240204 | 139 |
| 245 | 3300005445 | Ga0070708_101046461 | Ga0070708_1010464612 | 139 |
| 246 | 3300005458 | Ga0070681_10005369 | Ga0070681_1000536910 | 139 |
| 247 | 3300005530 | Ga0070679_100000001 | Ga0070679_100000001636 | 139 |
| 248 | 3300005530 | Ga0070679_100008154 | Ga0070679_1000081545 | 139 |
| 249 | 3300005546 | Ga0070696_100280670 | Ga0070696_1002806703 | 139 |
| 250 | 3300005548 | Ga0070665_100002152 | Ga0070665_10000215212 | 139 |
| 251 | 3300005548 | Ga0070665_101386176 | Ga0070665_1013861761 | 139 |
| 252 | 3300005563 | Ga0068855_100066277 | Ga0068855_1000662772 | 139 |
| 253 | 3300005563 | Ga0068855_100143593 | Ga0068855_1001435932 | 139 |
| 254 | 3300005563 | Ga0068855_100332242 | Ga0068855_1003322422 | 139 |
| 255 | 3300005563 | Ga0068855_101387804 | Ga0068855_1013878041 | 139 |
| 256 | 3300005577 | Ga0068857_101408747 | Ga0068857_1014087471 | 139 |
| 257 | 3300005614 | Ga0068856_100103897 | Ga0068856_1001038972 | 139 |
| 258 | 3300005618 | Ga0068864_100062043 | Ga0068864_1000620434 | 139 |
| 259 | 3300005719 | Ga0068861_100884061 | Ga0068861_1008840611 | 139 |
| 260 | 3300005985 | Ga0081539_10101654 | Ga0081539_101016543 | 139 |
| 261 | 3300006177 | Ga0075362_10125285 | Ga0075362_101252852 | 139 |
| 262 | 3300009093 | Ga0105240_10049795 | Ga0105240_100497952 | 139 |
| 263 | 3300009093 | Ga0105240_10115601 | Ga0105240_101156013 | 139 |
| 264 | 3300009094 | Ga0111539_13302298 | Ga0111539_133022981 | 139 |
| 265 | 3300009098 | Ga0105245_10268467 | Ga0105245_102684672 | 139 |
| 266 | 3300009174 | Ga0105241_11672125 | Ga0105241_116721251 | 139 |
| 267 | 3300009177 | Ga0105248_10000517 | Ga0105248_100005174 | 139 |
| 268 | 3300009551 | Ga0105238_10000586 | Ga0105238_100005866 | 139 |
| 269 | 3300009551 | Ga0105238_10039822 | Ga0105238_100398225 | 139 |
| 270 | 3300009551 | Ga0105238_10164405 | Ga0105238_101644051 | 139 |
| 271 | 3300013100 | Ga0157373_11298797 | Ga0157373_112987971 | 139 |
| 272 | 3300013104 | Ga0157370_10157325 | Ga0157370_101573252 | 139 |
| 273 | 3300013105 | Ga0157369_10006105 | Ga0157369_1000610512 | 139 |
| 274 | 3300013105 | Ga0157369_10782153 | Ga0157369_107821532 | 139 |
| 275 | 3300021384 | Ga0213876_10000261 | Ga0213876_1000026127 | 139 |
| 276 | 3300025901 | Ga0207688_10433009 | Ga0207688_104330092 | 139 |
| 277 | 3300025909 | Ga0207705_10000002 | Ga0207705_10000002187 | 139 |
| 278 | 3300025909 | Ga0207705_10001024 | Ga0207705_100010247 | 139 |
| 279 | 3300025912 | Ga0207707_10028844 | Ga0207707_100288445 | 139 |
| 280 | 3300025912 | Ga0207707_10046389 | Ga0207707_100463892 | 139 |
| 281 | 3300025913 | Ga0207695_10000572 | Ga0207695_1000057256 | 139 |
| 282 | 3300025913 | Ga0207695_10058882 | Ga0207695_100588825 | 139 |
| 283 | 3300025913 | Ga0207695_10194197 | Ga0207695_101941972 | 139 |
| 284 | 3300025917 | Ga0207660_10001700 | Ga0207660_100017004 | 139 |
| 285 | 3300025917 | Ga0207660_10003203 | Ga0207660_100032036 | 139 |
| 286 | 3300025919 | Ga0207657_10000381 | Ga0207657_1000038144 | 139 |
| 287 | 3300025919 | Ga0207657_10002098 | Ga0207657_100020988 | 139 |
| 288 | 3300025919 | Ga0207657_10005748 | Ga0207657_100057487 | 139 |
| 289 | 3300025919 | Ga0207657_10019686 | Ga0207657_100196863 | 139 |
| 290 | 3300025919 | Ga0207657_10115822 | Ga0207657_101158222 | 139 |
| 291 | 3300025919 | Ga0207657_10768392 | Ga0207657_107683922 | 139 |
| 292 | 3300025920 | Ga0207649_10000256 | Ga0207649_1000025629 | 139 |
| 293 | 3300025921 | Ga0207652_10000003 | Ga0207652_10000003232 | 139 |
| 294 | 3300025923 | Ga0207681_11436749 | Ga0207681_114367491 | 139 |
| 295 | 3300025924 | Ga0207694_10005147 | Ga0207694_100051476 | 139 |
| 296 | 3300025924 | Ga0207694_10077991 | Ga0207694_100779912 | 139 |
| 297 | 3300025924 | Ga0207694_10146946 | Ga0207694_101469462 | 139 |
| 298 | 3300025924 | Ga0207694_10452873 | Ga0207694_104528732 | 139 |
| 299 | 3300025924 | Ga0207694_10707555 | Ga0207694_107075551 | 139 |
| 300 | 3300025927 | Ga0207687_10002318 | Ga0207687_1000231813 | 139 |
| 301 | 3300025927 | Ga0207687_10073643 | Ga0207687_100736432 | 139 |
| 302 | 3300025929 | Ga0207664_10339887 | Ga0207664_103398872 | 139 |
| 303 | 3300025932 | Ga0207690_10000003 | Ga0207690_10000003783 | 139 |
| 304 | 3300025932 | Ga0207690_10001039 | Ga0207690_100010394 | 139 |
| 305 | 3300025932 | Ga0207690_10002314 | Ga0207690_100023144 | 139 |
| 306 | 3300025932 | Ga0207690_10463299 | Ga0207690_104632991 | 139 |
| 307 | 3300025936 | Ga0207670_10004220 | Ga0207670_100042205 | 139 |
| 308 | 3300025938 | Ga0207704_10003198 | Ga0207704_100031986 | 139 |
| 309 | 3300025941 | Ga0207711_10001000 | Ga0207711_100010004 | 139 |
| 310 | 3300025941 | Ga0207711_10903234 | Ga0207711_109032342 | 139 |
| 311 | 3300025949 | Ga0207667_10004668 | Ga0207667_100046686 | 139 |
| 312 | 3300025981 | Ga0207640_10804050 | Ga0207640_108040502 | 139 |
| 313 | 3300026023 | Ga0207677_10000107 | Ga0207677_1000010727 | 139 |
| 314 | 3300026023 | Ga0207677_11113237 | Ga0207677_111132372 | 139 |
| 315 | 3300026041 | Ga0207639_10513925 | Ga0207639_105139252 | 139 |
| 316 | 3300026078 | Ga0207702_10102556 | Ga0207702_101025562 | 139 |
| 317 | 3300026078 | Ga0207702_10228993 | Ga0207702_102289932 | 139 |
| 318 | 3300026088 | Ga0207641_10754322 | Ga0207641_107543222 | 139 |
| 319 | 3300026089 | Ga0207648_10570654 | Ga0207648_105706542 | 139 |
| 320 | 3300026095 | Ga0207676_10028277 | Ga0207676_100282774 | 139 |
| 321 | 3300026116 | Ga0207674_10235219 | Ga0207674_102352191 | 139 |
| 322 | 3300026118 | Ga0207675_101311513 | Ga0207675_1013115132 | 139 |
| 323 | 3300027543 | Ga0209999_1004974 | Ga0209999_10049742 | 139 |
| 324 | 3300028379 | Ga0268266_10002109 | Ga0268266_1000210912 | 139 |
| 325 | 3300028379 | Ga0268266_10137854 | Ga0268266_101378542 | 139 |
| 326 | 3300028786 | Ga0307517_10001402 | Ga0307517_100014025 | 139 |
| 327 | 3300031456 | Ga0307513_10008370 | Ga0307513_1000837014 | 139 |
| 328 | 3300031548 | Ga0307408_100896427 | Ga0307408_1008964272 | 139 |
| 329 | 3300031548 | Ga0307408_100904355 | Ga0307408_1009043552 | 139 |
| 330 | 3300031824 | Ga0307413_10781636 | Ga0307413_107816362 | 139 |
| 331 | 3300031824 | Ga0307413_11507632 | Ga0307413_115076321 | 139 |
| 332 | 3300031852 | Ga0307410_10151567 | Ga0307410_101515672 | 139 |
| 333 | 3300031911 | Ga0307412_10328513 | Ga0307412_103285132 | 139 |
| 334 | 3300032002 | Ga0307416_101179386 | Ga0307416_1011793861 | 139 |
| 335 | 3300032004 | Ga0307414_10060944 | Ga0307414_100609444 | 139 |
| 336 | 3300032005 | Ga0307411_10245813 | Ga0307411_102458132 | 139 |
| 337 | 3300032126 | Ga0307415_100288849 | Ga0307415_1002888492 | 139 |
| 338 | 3300033180 | Ga0307510_10002995 | Ga0307510_1000299516 | 139 |
| 339 | 3300036401 | Ga0373937_0396323 | Ga0373937_0396323_804_1223 | 139 |
| 340 | 3300037418 | Ga0395900_0111949 | Ga0395900_0111949_948_1367 | 139 |
| 341 | 3300037418 | Ga0395900_0173674 | Ga0395900_0173674_1548_1967 | 139 |
| 342 | 3300037418 | Ga0395900_1712055 | Ga0395900_1712055_24_443 | 139 |
| 343 | 3300037466 | Ga0395898_0155514 | Ga0395898_0155514_948_1367 | 139 |
| 344 | 3300037471 | Ga0395905_0001727 | Ga0395905_0001727_15990_16409 | 139 |
| 345 | 3300037471 | Ga0395905_0195730 | Ga0395905_0195730_158_577 | 139 |
| 346 | 3300037471 | Ga0395905_0553544 | Ga0395905_0553544_514_933 | 139 |
| 347 | 3300037471 | Ga0395905_0671168 | Ga0395905_0671168_323_742 | 139 |
| 348 | 3300038443 | Ga0395901_0143930 | Ga0395901_0143930_1419_1838 | 139 |
| 349 | 3300038443 | Ga0395901_0576994 | Ga0395901_0576994_492_911 | 139 |
| 350 | 3300039437 | Ga0436365_0646826 | Ga0436365_0646826_12188_12706 | 139 |
| 351 | 3300039437 | Ga0436365_1685576 | Ga0436365_1685576_28415_28846 | 139 |
| 352 | 3300039453 | Ga0436362_1094363 | Ga0436362_1094363_25016_25534 | 139 |
| 353 | 3300041999 | Ga0439433_0075409 | Ga0439433_0075409_14_436 | 139 |
| 354 | 3300042003 | Ga0439443_001002 | Ga0439443_001002_1282_1716 | 139 |
| 355 | 3300042004 | Ga0439445_0139123 | Ga0439445_0139123_196_618 | 139 |
| 356 | 3300044693 | Ga0466961_0264291 | Ga0466961_0264291_535_954 | 139 |
| 357 | 3300044765 | Ga0466970_0267268 | Ga0466970_0267268_105_524 | 139 |
| 358 | 3300044842 | Ga0466957_0655971 | Ga0466957_0655971_69_488 | 139 |
| 359 | 3300045836 | Ga0466958_0561780 | Ga0466958_0561780_54_473 | 139 |
| 360 | 3300046517 | Ga0495630_0617592 | Ga0495630_0617592_129_548 | 139 |
| 361 | 3300046616 | Ga0495668_0071522 | Ga0495668_0071522_1403_1822 | 139 |
| 362 | 3300046648 | Ga0495611_0414848 | Ga0495611_0414848_121_540 | 139 |
| 363 | 3300047443 | Ga0495687_075157 | Ga0495687_075157_290_757 | 139 |
| 364 | 3300048918 | Ga0496115_0839344 | Ga0496115_0839344_262_681 | 139 |
| 365 | 3300048929 | Ga0496126_0421180 | Ga0496126_0421180_328_756 | 139 |
| 366 | 3300049570 | Ga0501033_0057451 | Ga0501033_0057451_2381_2806 | 139 |
| 367 | 3300049571 | Ga0501034_0588509 | Ga0501034_0588509_317_739 | 139 |
| 368 | 3300049571 | Ga0501034_1376182 | Ga0501034_1376182_56_481 | 139 |
| 369 | 3300049581 | Ga0501047_0005059 | Ga0501047_0005059_10970_11389 | 139 |
| 370 | 3300049581 | Ga0501047_0032961 | Ga0501047_0032961_1006_1425 | 139 |
| 371 | 3300049583 | Ga0501067_0320169 | Ga0501067_0320169_37_456 | 139 |
| 372 | 3300049586 | Ga0501070_0406947 | Ga0501070_0406947_67_486 | 139 |
| 373 | 3300049589 | Ga0501073_0000577 | Ga0501073_0000577_237_656 | 139 |
| 374 | 3300049741 | Ga0501079_1047731 | Ga0501079_1047731_40_459 | 139 |
| 375 | 3300049742 | Ga0501080_0357717 | Ga0501080_0357717_801_1220 | 139 |
| 376 | 3300049744 | Ga0501083_0570553 | Ga0501083_0570553_170_589 | 139 |
| 377 | 3300049823 | Ga0501044_0009238 | Ga0501044_0009238_2066_2491 | 139 |
| 378 | 3300049823 | Ga0501044_1133217 | Ga0501044_1133217_51_470 | 139 |
| 379 | 3300050492 | nmdc:mga0yw44_311321_c1 | nmdc:mga0yw44_311321_c1_163_582 | 139 |
| 380 | 3300050496 | nmdc:mga07m45_355696_c1 | nmdc:mga07m45_355696_c1_83_502 | 139 |
| 381 | 3300050496 | nmdc:mga07m45_77159_c1 | nmdc:mga07m45_77159_c1_993_1418 | 139 |
| 382 | 3300053119 | Ga0500595_075447 | Ga0500595_075447_342_761 | 139 |
| 383 | 3300053140 | Ga0500573_0476260 | Ga0500573_0476260_129_551 | 139 |
| 384 | iso_pu_bacteria | 2885198086 | 2885198427 | 139 |
| 385 | iso_pu_bacteria | 2885211737 | 2885212193 | 139 |
| 386 | 3300005337 | Ga0070682_100639942 | Ga0070682_1006399422 | 140 |
| 387 | 3300005338 | Ga0068868_100011443 | Ga0068868_1000114431 | 140 |
| 388 | 3300005339 | Ga0070660_100147532 | Ga0070660_1001475323 | 140 |
| 389 | 3300005341 | Ga0070691_10050970 | Ga0070691_100509702 | 140 |
| 390 | 3300005344 | Ga0070661_100026806 | Ga0070661_1000268063 | 140 |
| 391 | 3300005344 | Ga0070661_100127933 | Ga0070661_1001279332 | 140 |
| 392 | 3300005345 | Ga0070692_10197341 | Ga0070692_101973412 | 140 |
| 393 | 3300005366 | Ga0070659_100467732 | Ga0070659_1004677322 | 140 |
| 394 | 3300005367 | Ga0070667_101382658 | Ga0070667_1013826582 | 140 |
| 395 | 3300005439 | Ga0070711_100250448 | Ga0070711_1002504482 | 140 |
| 396 | 3300005455 | Ga0070663_100434196 | Ga0070663_1004341962 | 140 |
| 397 | 3300005457 | Ga0070662_101505701 | Ga0070662_1015057011 | 140 |
| 398 | 3300005458 | Ga0070681_10073821 | Ga0070681_100738211 | 140 |
| 399 | 3300005458 | Ga0070681_10483961 | Ga0070681_104839612 | 140 |
| 400 | 3300005530 | Ga0070679_100059123 | Ga0070679_1000591232 | 140 |
| 401 | 3300005535 | Ga0070684_100294259 | Ga0070684_1002942591 | 140 |
| 402 | 3300005546 | Ga0070696_100046350 | Ga0070696_1000463503 | 140 |
| 403 | 3300005563 | Ga0068855_100000106 | Ga0068855_10000010681 | 140 |
| 404 | 3300005563 | Ga0068855_101109377 | Ga0068855_1011093772 | 140 |
| 405 | 3300005563 | Ga0068855_101560316 | Ga0068855_1015603162 | 140 |
| 406 | 3300005578 | Ga0068854_100309607 | Ga0068854_1003096072 | 140 |
| 407 | 3300005616 | Ga0068852_100000530 | Ga0068852_10000053021 | 140 |
| 408 | 3300005616 | Ga0068852_100002997 | Ga0068852_1000029977 | 140 |
| 409 | 3300005616 | Ga0068852_100003598 | Ga0068852_1000035986 | 140 |
| 410 | 3300005616 | Ga0068852_100175210 | Ga0068852_1001752102 | 140 |
| 411 | 3300005834 | Ga0068851_10007934 | Ga0068851_100079343 | 140 |
| 412 | 3300005844 | Ga0068862_100800077 | Ga0068862_1008000772 | 140 |
| 413 | 3300006175 | Ga0070712_100367870 | Ga0070712_1003678702 | 140 |
| 414 | 3300006237 | Ga0097621_100021803 | Ga0097621_1000218032 | 140 |
| 415 | 3300006358 | Ga0068871_100063796 | Ga0068871_1000637962 | 140 |
| 416 | 3300006914 | Ga0075436_100266682 | Ga0075436_1002666822 | 140 |
| 417 | 3300009093 | Ga0105240_10000055 | Ga0105240_1000005525 | 140 |
| 418 | 3300009093 | Ga0105240_10369042 | Ga0105240_103690423 | 140 |
| 419 | 3300009101 | Ga0105247_10005627 | Ga0105247_100056276 | 140 |
| 420 | 3300009101 | Ga0105247_10007480 | Ga0105247_100074804 | 140 |
| 421 | 3300009174 | Ga0105241_10016353 | Ga0105241_100163534 | 140 |
| 422 | 3300009545 | Ga0105237_10019700 | Ga0105237_100197002 | 140 |
| 423 | 3300009551 | Ga0105238_10026575 | Ga0105238_100265755 | 140 |
| 424 | 3300009553 | Ga0105249_10744857 | Ga0105249_107448572 | 140 |
| 425 | 3300013100 | Ga0157373_10209947 | Ga0157373_102099472 | 140 |
| 426 | 3300013102 | Ga0157371_10050825 | Ga0157371_100508252 | 140 |
| 427 | 3300013102 | Ga0157371_10133910 | Ga0157371_101339102 | 140 |
| 428 | 3300013102 | Ga0157371_10843690 | Ga0157371_108436901 | 140 |
| 429 | 3300013104 | Ga0157370_10131847 | Ga0157370_101318472 | 140 |
| 430 | 3300013104 | Ga0157370_11335202 | Ga0157370_113352022 | 140 |
| 431 | 3300013105 | Ga0157369_10010911 | Ga0157369_100109114 | 140 |
| 432 | 3300013105 | Ga0157369_10023221 | Ga0157369_100232216 | 140 |
| 433 | 3300013307 | Ga0157372_10004312 | Ga0157372_1000431210 | 140 |
| 434 | 3300013307 | Ga0157372_10178613 | Ga0157372_101786132 | 140 |
| 435 | 3300013307 | Ga0157372_10230071 | Ga0157372_102300712 | 140 |
| 436 | 3300013307 | Ga0157372_10377675 | Ga0157372_103776752 | 140 |
| 437 | 3300013307 | Ga0157372_11125113 | Ga0157372_111251132 | 140 |
| 438 | 3300014497 | Ga0182008_10051455 | Ga0182008_100514552 | 140 |
| 439 | 3300020070 | Ga0206356_11270598 | Ga0206356_112705981 | 140 |
| 440 | 3300020081 | Ga0206354_10201683 | Ga0206354_102016831 | 140 |
| 441 | 3300021384 | Ga0213876_10000274 | Ga0213876_1000027448 | 140 |
| 442 | 3300025321 | Ga0207656_10043977 | Ga0207656_100439773 | 140 |
| 443 | 3300025898 | Ga0207692_10126949 | Ga0207692_101269492 | 140 |
| 444 | 3300025900 | Ga0207710_10002645 | Ga0207710_100026453 | 140 |
| 445 | 3300025900 | Ga0207710_10046203 | Ga0207710_100462033 | 140 |
| 446 | 3300025909 | Ga0207705_10075570 | Ga0207705_100755702 | 140 |
| 447 | 3300025911 | Ga0207654_10019838 | Ga0207654_100198383 | 140 |
| 448 | 3300025913 | Ga0207695_10000012 | Ga0207695_10000012311 | 140 |
| 449 | 3300025913 | Ga0207695_10043747 | Ga0207695_100437474 | 140 |
| 450 | 3300025913 | Ga0207695_10288658 | Ga0207695_102886582 | 140 |
| 451 | 3300025916 | Ga0207663_10421711 | Ga0207663_104217112 | 140 |
| 452 | 3300025917 | Ga0207660_10471806 | Ga0207660_104718062 | 140 |
| 453 | 3300025919 | Ga0207657_10089749 | Ga0207657_100897492 | 140 |
| 454 | 3300025919 | Ga0207657_10131410 | Ga0207657_101314102 | 140 |
| 455 | 3300025920 | Ga0207649_10017732 | Ga0207649_100177324 | 140 |
| 456 | 3300025920 | Ga0207649_10060105 | Ga0207649_100601054 | 140 |
| 457 | 3300025920 | Ga0207649_10247789 | Ga0207649_102477892 | 140 |
| 458 | 3300025921 | Ga0207652_10199177 | Ga0207652_101991773 | 140 |
| 459 | 3300025924 | Ga0207694_10000006 | Ga0207694_10000006354 | 140 |
| 460 | 3300025929 | Ga0207664_11429295 | Ga0207664_114292951 | 140 |
| 461 | 3300025932 | Ga0207690_10029512 | Ga0207690_100295125 | 140 |
| 462 | 3300025932 | Ga0207690_10164241 | Ga0207690_101642413 | 140 |
| 463 | 3300025941 | Ga0207711_10036878 | Ga0207711_100368783 | 140 |
| 464 | 3300025944 | Ga0207661_10056398 | Ga0207661_100563984 | 140 |
| 465 | 3300025949 | Ga0207667_10000026 | Ga0207667_1000002654 | 140 |
| 466 | 3300025949 | Ga0207667_10193016 | Ga0207667_101930162 | 140 |
| 467 | 3300025949 | Ga0207667_11435319 | Ga0207667_114353192 | 140 |
| 468 | 3300025981 | Ga0207640_10035158 | Ga0207640_100351582 | 140 |
| 469 | 3300026023 | Ga0207677_10061851 | Ga0207677_100618512 | 140 |
| 470 | 3300026041 | Ga0207639_10001218 | Ga0207639_100012184 | 140 |
| 471 | 3300026067 | Ga0207678_10100896 | Ga0207678_101008962 | 140 |
| 472 | 3300026142 | Ga0207698_10001893 | Ga0207698_100018939 | 140 |
| 473 | 3300026142 | Ga0207698_10005482 | Ga0207698_100054827 | 140 |
| 474 | 3300026142 | Ga0207698_10025195 | Ga0207698_100251953 | 140 |
| 475 | 3300026142 | Ga0207698_10116334 | Ga0207698_101163341 | 140 |
| 476 | 3300027876 | Ga0209974_10020533 | Ga0209974_100205333 | 140 |
| 477 | 3300027876 | Ga0209974_10079207 | Ga0209974_100792072 | 140 |
| 478 | 3300028380 | Ga0268265_10111341 | Ga0268265_101113412 | 140 |
| 479 | 3300028800 | Ga0265338_10330923 | Ga0265338_103309232 | 140 |
| 480 | 3300031665 | Ga0316575_10023402 | Ga0316575_100234022 | 140 |
| 481 | 3300031665 | Ga0316575_10410939 | Ga0316575_104109391 | 140 |
| 482 | 3300031730 | Ga0307516_10047728 | Ga0307516_100477282 | 140 |
| 483 | 3300031731 | Ga0307405_10025432 | Ga0307405_100254323 | 140 |
| 484 | 3300031824 | Ga0307413_10070066 | Ga0307413_100700662 | 140 |
| 485 | 3300031852 | Ga0307410_10182545 | Ga0307410_101825452 | 140 |
| 486 | 3300031852 | Ga0307410_10521906 | Ga0307410_105219061 | 140 |
| 487 | 3300031901 | Ga0307406_10020369 | Ga0307406_100203693 | 140 |
| 488 | 3300031903 | Ga0307407_10067403 | Ga0307407_100674032 | 140 |
| 489 | 3300031911 | Ga0307412_10327413 | Ga0307412_103274132 | 140 |
| 490 | 3300031995 | Ga0307409_100034586 | Ga0307409_1000345863 | 140 |
| 491 | 3300032002 | Ga0307416_100007443 | Ga0307416_1000074436 | 140 |
| 492 | 3300032002 | Ga0307416_100449034 | Ga0307416_1004490342 | 140 |
| 493 | 3300032005 | Ga0307411_10025273 | Ga0307411_100252732 | 140 |
| 494 | 3300032126 | Ga0307415_100001602 | Ga0307415_1000016027 | 140 |
| 495 | 3300032126 | Ga0307415_100585560 | Ga0307415_1005855601 | 140 |
| 496 | 3300035242 | Ga0373962_0210662 | Ga0373962_0210662_11_433 | 140 |
| 497 | 3300035695 | Ga0373927_0362630 | Ga0373927_0362630_79_501 | 140 |
| 498 | 3300035724 | Ga0373933_0440330 | Ga0373933_0440330_61_483 | 140 |
| 499 | 3300037418 | Ga0395900_0002169 | Ga0395900_0002169_10179_10601 | 140 |
| 500 | 3300039437 | Ga0436365_0257402 | Ga0436365_0257402_117647_118069 | 140 |
| 501 | 3300041408 | Ga0439453_0089630 | Ga0439453_0089630_175_600 | 140 |
| 502 | 3300041410 | Ga0439461_0128858 | Ga0439461_0128858_85_510 | 140 |
| 503 | 3300041997 | Ga0439431_0006863 | Ga0439431_0006863_778_1203 | 140 |
| 504 | 3300041999 | Ga0439433_0024280 | Ga0439433_0024280_13_438 | 140 |
| 505 | 3300042001 | Ga0439441_068626 | Ga0439441_068626_118_543 | 140 |
| 506 | 3300042009 | Ga0439451_078934 | Ga0439451_078934_180_605 | 140 |
| 507 | 3300042116 | Ga0450912_000880 | Ga0450912_000880_946_1371 | 140 |
| 508 | 3300042122 | Ga0450920_012034 | Ga0450920_012034_112_537 | 140 |
| 509 | 3300042123 | Ga0450921_008756 | Ga0450921_008756_152_577 | 140 |
| 510 | 3300042124 | Ga0450922_003671 | Ga0450922_003671_328_753 | 140 |
| 511 | 3300042125 | Ga0450923_001983 | Ga0450923_001983_1329_1754 | 140 |
| 512 | 3300042130 | Ga0450892_023010 | Ga0450892_023010_113_538 | 140 |
| 513 | 3300042131 | Ga0450894_002478 | Ga0450894_002478_1334_1759 | 140 |
| 514 | 3300042133 | Ga0450896_005989 | Ga0450896_005989_745_1170 | 140 |
| 515 | 3300042133 | Ga0450896_020051 | Ga0450896_020051_328_753 | 140 |
| 516 | 3300042134 | Ga0450898_012904 | Ga0450898_012904_353_778 | 140 |
| 517 | 3300042145 | Ga0450906_012176 | Ga0450906_012176_21_446 | 140 |
| 518 | 3300042146 | Ga0450907_008643 | Ga0450907_008643_213_638 | 140 |
| 519 | 3300042156 | Ga0439446_0008772 | Ga0439446_0008772_2185_2610 | 140 |
| 520 | 3300042184 | Ga0450908_000818 | Ga0450908_000818_2387_2812 | 140 |
| 521 | 3300042435 | Ga0439434_0005621 | Ga0439434_0005621_1039_1464 | 140 |
| 522 | 3300042436 | Ga0439435_0000323 | Ga0439435_0000323_6337_6762 | 140 |
| 523 | 3300042437 | Ga0439444_0002954 | Ga0439444_0002954_535_960 | 140 |
| 524 | 3300042461 | Ga0439460_0027919 | Ga0439460_0027919_190_615 | 140 |
| 525 | 3300044765 | Ga0466970_0011768 | Ga0466970_0011768_1650_2072 | 140 |
| 526 | 3300045049 | Ga0466959_0011577 | Ga0466959_0011577_140_562 | 140 |
| 527 | 3300045976 | Ga0466967_1920744 | Ga0466967_1920744_94_516 | 140 |
| 528 | 3300046462 | Ga0495651_0508719 | Ga0495651_0508719_78_500 | 140 |
| 529 | 3300046516 | Ga0495628_0275488 | Ga0495628_0275488_556_978 | 140 |
| 530 | 3300046524 | Ga0495648_0008447 | Ga0495648_0008447_5606_6028 | 140 |
| 531 | 3300046529 | Ga0495652_0012589 | Ga0495652_0012589_4921_5343 | 140 |
| 532 | 3300046529 | Ga0495652_0013775 | Ga0495652_0013775_476_907 | 140 |
| 533 | 3300046543 | Ga0495645_0109625 | Ga0495645_0109625_414_836 | 140 |
| 534 | 3300046557 | Ga0495622_0243135 | Ga0495622_0243135_76_498 | 140 |
| 535 | 3300046680 | Ga0495646_0001903 | Ga0495646_0001903_458_880 | 140 |
| 536 | 3300046690 | Ga0495624_0208108 | Ga0495624_0208108_601_1023 | 140 |
| 537 | 3300048088 | Ga0495602_0344983 | Ga0495602_0344983_97_519 | 140 |
| 538 | 3300048904 | Ga0496101_0675386 | Ga0496101_0675386_266_688 | 140 |
| 539 | 3300048918 | Ga0496115_0023967 | Ga0496115_0023967_3073_3495 | 140 |
| 540 | 3300048924 | Ga0496121_0262066 | Ga0496121_0262066_116_538 | 140 |
| 541 | 3300049460 | Ga0495682_0001351 | Ga0495682_0001351_742_1164 | 140 |
| 542 | 3300049568 | Ga0501031_0013941 | Ga0501031_0013941_3472_3897 | 140 |
| 543 | 3300049568 | Ga0501031_0032491 | Ga0501031_0032491_1019_1441 | 140 |
| 544 | 3300049569 | Ga0501032_0027352 | Ga0501032_0027352_328_753 | 140 |
| 545 | 3300049569 | Ga0501032_0069791 | Ga0501032_0069791_386_808 | 140 |
| 546 | 3300049569 | Ga0501032_0099543 | Ga0501032_0099543_795_1217 | 140 |
| 547 | 3300049570 | Ga0501033_0002118 | Ga0501033_0002118_2780_3202 | 140 |
| 548 | 3300049570 | Ga0501033_0068162 | Ga0501033_0068162_154_576 | 140 |
| 549 | 3300049570 | Ga0501033_0509900 | Ga0501033_0509900_311_733 | 140 |
| 550 | 3300049570 | Ga0501033_0509901 | Ga0501033_0509901_99_521 | 140 |
| 551 | 3300049570 | Ga0501033_1189907 | Ga0501033_1189907_56_478 | 140 |
| 552 | 3300049571 | Ga0501034_0400607 | Ga0501034_0400607_348_773 | 140 |
| 553 | 3300049571 | Ga0501034_0467859 | Ga0501034_0467859_146_568 | 140 |
| 554 | 3300049571 | Ga0501034_0624293 | Ga0501034_0624293_535_957 | 140 |
| 555 | 3300049572 | Ga0501036_0029478 | Ga0501036_0029478_2055_2480 | 140 |
| 556 | 3300049572 | Ga0501036_0163876 | Ga0501036_0163876_392_814 | 140 |
| 557 | 3300049572 | Ga0501036_0300175 | Ga0501036_0300175_109_531 | 140 |
| 558 | 3300049573 | Ga0501037_0045879 | Ga0501037_0045879_482_904 | 140 |
| 559 | 3300049573 | Ga0501037_0108039 | Ga0501037_0108039_1532_1954 | 140 |
| 560 | 3300049573 | Ga0501037_0118952 | Ga0501037_0118952_271_693 | 140 |
| 561 | 3300049573 | Ga0501037_0183678 | Ga0501037_0183678_203_718 | 140 |
| 562 | 3300049574 | Ga0501038_0007899 | Ga0501038_0007899_1374_1799 | 140 |
| 563 | 3300049574 | Ga0501038_0338348 | Ga0501038_0338348_54_476 | 140 |
| 564 | 3300049574 | Ga0501038_0369830 | Ga0501038_0369830_230_652 | 140 |
| 565 | 3300049574 | Ga0501038_0619254 | Ga0501038_0619254_180_602 | 140 |
| 566 | 3300049575 | Ga0501039_0017899 | Ga0501039_0017899_4228_4653 | 140 |
| 567 | 3300049575 | Ga0501039_0289805 | Ga0501039_0289805_364_786 | 140 |
| 568 | 3300049576 | Ga0501040_0035522 | Ga0501040_0035522_2707_3132 | 140 |
| 569 | 3300049577 | Ga0501041_0021329 | Ga0501041_0021329_3130_3555 | 140 |
| 570 | 3300049578 | Ga0501042_0012392 | Ga0501042_0012392_3197_3622 | 140 |
| 571 | 3300049579 | Ga0501043_0024618 | Ga0501043_0024618_708_1130 | 140 |
| 572 | 3300049579 | Ga0501043_0106643 | Ga0501043_0106643_1324_1746 | 140 |
| 573 | 3300049579 | Ga0501043_0159297 | Ga0501043_0159297_924_1346 | 140 |
| 574 | 3300049580 | Ga0501046_0081537 | Ga0501046_0081537_1417_1839 | 140 |
| 575 | 3300049580 | Ga0501046_0127161 | Ga0501046_0127161_163_585 | 140 |
| 576 | 3300049580 | Ga0501046_0826346 | Ga0501046_0826346_180_602 | 140 |
| 577 | 3300049581 | Ga0501047_0010064 | Ga0501047_0010064_5106_5528 | 140 |
| 578 | 3300049581 | Ga0501047_0092941 | Ga0501047_0092941_555_1070 | 140 |
| 579 | 3300049581 | Ga0501047_0201671 | Ga0501047_0201671_905_1327 | 140 |
| 580 | 3300049581 | Ga0501047_0529611 | Ga0501047_0529611_271_693 | 140 |
| 581 | 3300049581 | Ga0501047_0708977 | Ga0501047_0708977_91_513 | 140 |
| 582 | 3300049582 | Ga0501048_0039024 | Ga0501048_0039024_2853_3278 | 140 |
| 583 | 3300049582 | Ga0501048_0202684 | Ga0501048_0202684_793_1215 | 140 |
| 584 | 3300049582 | Ga0501048_0584953 | Ga0501048_0584953_37_459 | 140 |
| 585 | 3300049584 | Ga0501068_0395170 | Ga0501068_0395170_430_852 | 140 |
| 586 | 3300049585 | Ga0501069_0035457 | Ga0501069_0035457_287_709 | 140 |
| 587 | 3300049585 | Ga0501069_0146099 | Ga0501069_0146099_67_582 | 140 |
| 588 | 3300049586 | Ga0501070_0000053 | Ga0501070_0000053_5681_6103 | 140 |
| 589 | 3300049586 | Ga0501070_0066641 | Ga0501070_0066641_62_484 | 140 |
| 590 | 3300049586 | Ga0501070_0108241 | Ga0501070_0108241_1331_1849 | 140 |
| 591 | 3300049586 | Ga0501070_0155959 | Ga0501070_0155959_425_940 | 140 |
| 592 | 3300049587 | Ga0501071_0003737 | Ga0501071_0003737_900_1325 | 140 |
| 593 | 3300049587 | Ga0501071_0082872 | Ga0501071_0082872_589_1104 | 140 |
| 594 | 3300049589 | Ga0501073_0028253 | Ga0501073_0028253_576_998 | 140 |
| 595 | 3300049589 | Ga0501073_0068978 | Ga0501073_0068978_592_1110 | 140 |
| 596 | 3300049589 | Ga0501073_0409241 | Ga0501073_0409241_283_708 | 140 |
| 597 | 3300049590 | Ga0501074_0002371 | Ga0501074_0002371_11964_12482 | 140 |
| 598 | 3300049590 | Ga0501074_0086083 | Ga0501074_0086083_152_667 | 140 |
| 599 | 3300049591 | Ga0501075_0059024 | Ga0501075_0059024_584_1009 | 140 |
| 600 | 3300049592 | Ga0501076_0001771 | Ga0501076_0001771_3638_4063 | 140 |
| 601 | 3300049593 | Ga0501077_0942644 | Ga0501077_0942644_75_500 | 140 |
| 602 | 3300049741 | Ga0501079_0158877 | Ga0501079_0158877_1044_1469 | 140 |
| 603 | 3300049741 | Ga0501079_0304426 | Ga0501079_0304426_341_859 | 140 |
| 604 | 3300049741 | Ga0501079_1231777 | Ga0501079_1231777_121_543 | 140 |
| 605 | 3300049742 | Ga0501080_0000938 | Ga0501080_0000938_850_1368 | 140 |
| 606 | 3300049742 | Ga0501080_0008441 | Ga0501080_0008441_7755_8270 | 140 |
| 607 | 3300049742 | Ga0501080_0033586 | Ga0501080_0033586_3583_4005 | 140 |
| 608 | 3300049743 | Ga0501081_0175732 | Ga0501081_0175732_291_716 | 140 |
| 609 | 3300049744 | Ga0501083_0675116 | Ga0501083_0675116_101_523 | 140 |
| 610 | 3300049822 | Ga0501035_0002523 | Ga0501035_0002523_14087_14509 | 140 |
| 611 | 3300049822 | Ga0501035_0013722 | Ga0501035_0013722_1118_1540 | 140 |
| 612 | 3300049822 | Ga0501035_0013871 | Ga0501035_0013871_465_890 | 140 |
| 613 | 3300049822 | Ga0501035_0075995 | Ga0501035_0075995_2057_2479 | 140 |
| 614 | 3300049822 | Ga0501035_0165955 | Ga0501035_0165955_1177_1599 | 140 |
| 615 | 3300049822 | Ga0501035_0708039 | Ga0501035_0708039_79_501 | 140 |
| 616 | 3300049822 | Ga0501035_0784644 | Ga0501035_0784644_67_582 | 140 |
| 617 | 3300049822 | Ga0501035_0785788 | Ga0501035_0785788_325_747 | 140 |
| 618 | 3300049823 | Ga0501044_0007608 | Ga0501044_0007608_1873_2295 | 140 |
| 619 | 3300049823 | Ga0501044_0080394 | Ga0501044_0080394_1695_2213 | 140 |
| 620 | 3300049823 | Ga0501044_0264207 | Ga0501044_0264207_1138_1560 | 140 |
| 621 | 3300049823 | Ga0501044_0288942 | Ga0501044_0288942_16_438 | 140 |
| 622 | 3300049823 | Ga0501044_0786581 | Ga0501044_0786581_99_521 | 140 |
| 623 | 3300049823 | Ga0501044_1108284 | Ga0501044_1108284_192_614 | 140 |
| 624 | 3300049824 | Ga0501045_0014534 | Ga0501045_0014534_1459_1884 | 140 |
| 625 | 3300050509 | nmdc:mga0qj67_1316339_c1 | nmdc:mga0qj67_1316339_c1_114_539 | 140 |
| 626 | 3300050514 | nmdc:mga08x19_786066_c1 | nmdc:mga08x19_786066_c1_33_455 | 140 |
| 627 | 3300053133 | Ga0500655_048237 | Ga0500655_048237_121_543 | 140 |
| 628 | 3300054114 | Ga0501084_0000057 | Ga0501084_0000057_2817_3239 | 140 |
| 629 | 3300054114 | Ga0501084_0209931 | Ga0501084_0209931_283_708 | 140 |
| 630 | 3300061734 | Ga0530510_0263186 | Ga0530510_0263186_17_442 | 140 |
| 631 | iso_pu_bacteria | 2808606384 | 2808969113 | 140 |
| 632 | iso_pu_bacteria | 2808606390 | 2809003944 | 140 |
| 633 | iso_pu_bacteria | 2808606391 | 2809011221 | 140 |
| 634 | iso_pu_bacteria | 641736154 | 642419037 | 140 |
| 635 | 3300003187 | JGI25151J46595_10001007 | JGI25151J46595_1000100720 | 141 |
| 636 | 3300005456 | Ga0070678_100257033 | Ga0070678_1002570331 | 141 |
| 637 | 3300005844 | Ga0068862_100349118 | Ga0068862_1003491182 | 141 |
| 638 | 3300006178 | Ga0075367_10516901 | Ga0075367_105169012 | 141 |
| 639 | 3300006195 | Ga0075366_10027545 | Ga0075366_100275455 | 141 |
| 640 | 3300006353 | Ga0075370_10004847 | Ga0075370_100048473 | 141 |
| 641 | 3300009545 | Ga0105237_12314707 | Ga0105237_123147071 | 141 |
| 642 | 3300012502 | Ga0157347_1029477 | Ga0157347_10294772 | 141 |
| 643 | 3300021384 | Ga0213876_10000290 | Ga0213876_1000029024 | 141 |
| 644 | 3300025258 | Ga0209129_1002564 | Ga0209129_10025641 | 141 |
| 645 | 3300025294 | Ga0209025_1000157 | Ga0209025_1000157120 | 141 |
| 646 | 3300028380 | Ga0268265_10404698 | Ga0268265_104046982 | 141 |
| 647 | 3300037312 | Ga0395899_0000065 | Ga0395899_0000065_16798_17223 | 141 |
| 648 | 3300037312 | Ga0395899_0104684 | Ga0395899_0104684_393_818 | 141 |
| 649 | 3300037418 | Ga0395900_0000339 | Ga0395900_0000339_16798_17223 | 141 |
| 650 | 3300037418 | Ga0395900_0185390 | Ga0395900_0185390_440_865 | 141 |
| 651 | 3300037466 | Ga0395898_0000565 | Ga0395898_0000565_51860_52285 | 141 |
| 652 | 3300037466 | Ga0395898_0069666 | Ga0395898_0069666_738_1163 | 141 |
| 653 | 3300038443 | Ga0395901_0000994 | Ga0395901_0000994_38_463 | 141 |
| 654 | 3300039437 | Ga0436365_0826287 | Ga0436365_0826287_20671_21096 | 141 |
| 655 | 3300044656 | Ga0466969_0007130 | Ga0466969_0007130_368_793 | 141 |
| 656 | 3300044659 | Ga0466973_0047582 | Ga0466973_0047582_328_753 | 141 |
| 657 | 3300044683 | Ga0466965_0051002 | Ga0466965_0051002_596_1021 | 141 |
| 658 | 3300044684 | Ga0466966_0204461 | Ga0466966_0204461_756_1181 | 141 |
| 659 | 3300044693 | Ga0466961_0140905 | Ga0466961_0140905_764_1189 | 141 |
| 660 | 3300044694 | Ga0466963_0000420 | Ga0466963_0000420_6273_6698 | 141 |
| 661 | 3300044719 | Ga0466971_0034581 | Ga0466971_0034581_1656_2081 | 141 |
| 662 | 3300044765 | Ga0466970_0041943 | Ga0466970_0041943_1803_2228 | 141 |
| 663 | 3300044842 | Ga0466957_0002050 | Ga0466957_0002050_4919_5344 | 141 |
| 664 | 3300045049 | Ga0466959_0013716 | Ga0466959_0013716_1655_2080 | 141 |
| 665 | 3300045836 | Ga0466958_0001742 | Ga0466958_0001742_3270_3695 | 141 |
| 666 | 3300046462 | Ga0495651_0252364 | Ga0495651_0252364_193_624 | 141 |
| 667 | 3300048917 | Ga0496114_0668223 | Ga0496114_0668223_278_712 | 141 |
| 668 | 3300048918 | Ga0496115_0346713 | Ga0496115_0346713_431_865 | 141 |
| 669 | 3300048919 | Ga0496116_0157723 | Ga0496116_0157723_627_1058 | 141 |
| 670 | 3300049585 | Ga0501069_0119160 | Ga0501069_0119160_912_1349 | 141 |
| 671 | 3300049822 | Ga0501035_0034801 | Ga0501035_0034801_3213_3686 | 141 |
| 672 | 3300049823 | Ga0501044_0397030 | Ga0501044_0397030_500_973 | 141 |
| 673 | 3300050493 | nmdc:mga0k408_19569_c1 | nmdc:mga0k408_19569_c1_2995_3426 | 141 |
| 674 | 3300050493 | nmdc:mga0k408_300878_c1 | nmdc:mga0k408_300878_c1_460_891 | 141 |
| 675 | 3300050494 | nmdc:mga06z11_203119_c1 | nmdc:mga06z11_203119_c1_101_532 | 141 |
| 676 | 3300061719 | Ga0466962_0033412 | Ga0466962_0033412_1902_2327 | 141 |
| 677 | iso_pu_bacteria | 2842747753 | 2842749987 | 141 |
| 678 | iso_pu_bacteria | 2928157003 | 2928161889 | 141 |
| 679 | iso_pu_bacteria | 2928163908 | 2928170005 | 141 |
| 680 | iso_pu_bacteria | 2981990288 | 2981992938 | 141 |
| 681 | 3300002737 | JGI25162J39368_1000482 | JGI25162J39368_100048215 | 142 |
| 682 | 3300003214 | JGI25165J46597_1000328 | JGI25165J46597_100032835 | 142 |
| 683 | 3300003320 | rootH2_10005494 | rootH2_100054944 | 142 |
| 684 | 3300003322 | rootL2_10002812 | rootL2_1000281228 | 142 |
| 685 | 3300003323 | rootH1_10041044 | rootH1_100410442 | 142 |
| 686 | 3300005337 | Ga0070682_100598625 | Ga0070682_1005986252 | 142 |
| 687 | 3300005339 | Ga0070660_100000414 | Ga0070660_10000041411 | 142 |
| 688 | 3300005344 | Ga0070661_100001393 | Ga0070661_10000139315 | 142 |
| 689 | 3300005353 | Ga0070669_100013267 | Ga0070669_1000132674 | 142 |
| 690 | 3300005355 | Ga0070671_100028246 | Ga0070671_1000282465 | 142 |
| 691 | 3300005364 | Ga0070673_100164739 | Ga0070673_1001647392 | 142 |
| 692 | 3300005364 | Ga0070673_100815903 | Ga0070673_1008159032 | 142 |
| 693 | 3300005366 | Ga0070659_100000526 | Ga0070659_1000005269 | 142 |
| 694 | 3300005455 | Ga0070663_100003639 | Ga0070663_1000036393 | 142 |
| 695 | 3300005456 | Ga0070678_100379931 | Ga0070678_1003799312 | 142 |
| 696 | 3300005457 | Ga0070662_100000260 | Ga0070662_10000026024 | 142 |
| 697 | 3300005539 | Ga0068853_100001673 | Ga0068853_1000016738 | 142 |
| 698 | 3300005543 | Ga0070672_100400963 | Ga0070672_1004009632 | 142 |
| 699 | 3300005563 | Ga0068855_100000110 | Ga0068855_10000011029 | 142 |
| 700 | 3300005564 | Ga0070664_100000378 | Ga0070664_10000037814 | 142 |
| 701 | 3300005564 | Ga0070664_100218575 | Ga0070664_1002185752 | 142 |
| 702 | 3300005578 | Ga0068854_100009590 | Ga0068854_1000095905 | 142 |
| 703 | 3300005614 | Ga0068856_100000111 | Ga0068856_10000011135 | 142 |
| 704 | 3300005614 | Ga0068856_100089964 | Ga0068856_1000899642 | 142 |
| 705 | 3300005616 | Ga0068852_100032133 | Ga0068852_1000321333 | 142 |
| 706 | 3300006358 | Ga0068871_100537798 | Ga0068871_1005377982 | 142 |
| 707 | 3300009177 | Ga0105248_10061914 | Ga0105248_100619143 | 142 |
| 708 | 3300013100 | Ga0157373_10004775 | Ga0157373_100047759 | 142 |
| 709 | 3300013102 | Ga0157371_10000248 | Ga0157371_1000024825 | 142 |
| 710 | 3300013105 | Ga0157369_10227994 | Ga0157369_102279943 | 142 |
| 711 | 3300013297 | Ga0157378_10258037 | Ga0157378_102580372 | 142 |
| 712 | 3300013307 | Ga0157372_10000402 | Ga0157372_100004022 | 142 |
| 713 | 3300013308 | Ga0157375_11192945 | Ga0157375_111929452 | 142 |
| 714 | 3300025228 | Ga0209672_107191 | Ga0209672_1071912 | 142 |
| 715 | 3300025233 | Ga0209437_100057 | Ga0209437_100057262 | 142 |
| 716 | 3300025261 | Ga0209233_1000130 | Ga0209233_100013064 | 142 |
| 717 | 3300025919 | Ga0207657_10000910 | Ga0207657_1000091023 | 142 |
| 718 | 3300025920 | Ga0207649_10012952 | Ga0207649_100129524 | 142 |
| 719 | 3300025923 | Ga0207681_10117034 | Ga0207681_101170342 | 142 |
| 720 | 3300025931 | Ga0207644_10019042 | Ga0207644_100190425 | 142 |
| 721 | 3300025932 | Ga0207690_10000194 | Ga0207690_1000019442 | 142 |
| 722 | 3300025933 | Ga0207706_10000008 | Ga0207706_1000000878 | 142 |
| 723 | 3300025940 | Ga0207691_10085498 | Ga0207691_100854984 | 142 |
| 724 | 3300025945 | Ga0207679_10000934 | Ga0207679_1000093413 | 142 |
| 725 | 3300025945 | Ga0207679_11933411 | Ga0207679_119334111 | 142 |
| 726 | 3300025949 | Ga0207667_10001326 | Ga0207667_1000132612 | 142 |
| 727 | 3300025960 | Ga0207651_10186694 | Ga0207651_101866942 | 142 |
| 728 | 3300025981 | Ga0207640_10004677 | Ga0207640_100046776 | 142 |
| 729 | 3300026041 | Ga0207639_10002823 | Ga0207639_100028236 | 142 |
| 730 | 3300026078 | Ga0207702_10000510 | Ga0207702_1000051014 | 142 |
| 731 | 3300026078 | Ga0207702_10112615 | Ga0207702_101126152 | 142 |
| 732 | 3300026116 | Ga0207674_10217041 | Ga0207674_102170412 | 142 |
| 733 | 3300026116 | Ga0207674_11071197 | Ga0207674_110711972 | 142 |
| 734 | 3300026142 | Ga0207698_10022179 | Ga0207698_100221794 | 142 |
| 735 | 3300027682 | Ga0209971_1025274 | Ga0209971_10252742 | 142 |
| 736 | 3300027876 | Ga0209974_10130861 | Ga0209974_101308612 | 142 |
| 737 | 3300031456 | Ga0307513_10000020 | Ga0307513_1000002046 | 142 |
| 738 | 3300031548 | Ga0307408_100068146 | Ga0307408_1000681464 | 142 |
| 739 | 3300031731 | Ga0307405_10363011 | Ga0307405_103630111 | 142 |
| 740 | 3300031824 | Ga0307413_10291853 | Ga0307413_102918532 | 142 |
| 741 | 3300031852 | Ga0307410_10005780 | Ga0307410_100057802 | 142 |
| 742 | 3300032004 | Ga0307414_10227696 | Ga0307414_102276962 | 142 |
| 743 | 3300032005 | Ga0307411_10042464 | Ga0307411_100424642 | 142 |
| 744 | 3300035114 | Ga0373939_0091708 | Ga0373939_0091708_145_585 | 142 |
| 745 | 3300037418 | Ga0395900_1290620 | Ga0395900_1290620_186_626 | 142 |
| 746 | 3300037466 | Ga0395898_0034389 | Ga0395898_0034389_4279_4719 | 142 |
| 747 | 3300038443 | Ga0395901_0398951 | Ga0395901_0398951_907_1347 | 142 |
| 748 | 3300041406 | Ga0439439_0058281 | Ga0439439_0058281_146_589 | 142 |
| 749 | 3300041411 | Ga0439466_0119927 | Ga0439466_0119927_44_487 | 142 |
| 750 | 3300041452 | Ga0451793_0794819 | Ga0451793_0794819_11_460 | 142 |
| 751 | 3300042015 | Ga0439462_0039882 | Ga0439462_0039882_706_1149 | 142 |
| 752 | 3300042117 | Ga0450913_009306 | Ga0450913_009306_23_496 | 142 |
| 753 | 3300042118 | Ga0450914_019675 | Ga0450914_019675_201_644 | 142 |
| 754 | 3300042127 | Ga0450890_034836 | Ga0450890_034836_24_464 | 142 |
| 755 | 3300042146 | Ga0450907_008148 | Ga0450907_008148_1207_1650 | 142 |
| 756 | 3300045976 | Ga0466967_0046076 | Ga0466967_0046076_19_447 | 142 |
| 757 | 3300046453 | Ga0495627_022360 | Ga0495627_022360_587_1018 | 142 |
| 758 | 3300046458 | Ga0495591_003976 | Ga0495591_003976_3194_3625 | 142 |
| 759 | 3300046471 | Ga0495650_0002301 | Ga0495650_0002301_4089_4520 | 142 |
| 760 | 3300046474 | Ga0495605_0000013 | Ga0495605_0000013_59074_59505 | 142 |
| 761 | 3300046499 | Ga0495594_0009155 | Ga0495594_0009155_2260_2691 | 142 |
| 762 | 3300046501 | Ga0495607_0102651 | Ga0495607_0102651_104_535 | 142 |
| 763 | 3300046506 | Ga0495583_0000042 | Ga0495583_0000042_39532_39963 | 142 |
| 764 | 3300046512 | Ga0495610_0010567 | Ga0495610_0010567_4004_4435 | 142 |
| 765 | 3300046513 | Ga0495616_0027713 | Ga0495616_0027713_1720_2151 | 142 |
| 766 | 3300046515 | Ga0495620_0000005 | Ga0495620_0000005_159872_160303 | 142 |
| 767 | 3300046518 | Ga0495631_0005085 | Ga0495631_0005085_347_778 | 142 |
| 768 | 3300046520 | Ga0495637_0004482 | Ga0495637_0004482_2560_2991 | 142 |
| 769 | 3300046524 | Ga0495648_0003365 | Ga0495648_0003365_4307_4738 | 142 |
| 770 | 3300046530 | Ga0495654_0008924 | Ga0495654_0008924_228_659 | 142 |
| 771 | 3300046538 | Ga0495609_0000266 | Ga0495609_0000266_7556_7987 | 142 |
| 772 | 3300046542 | Ga0495597_0001238 | Ga0495597_0001238_5695_6126 | 142 |
| 773 | 3300046558 | Ga0495633_0000013 | Ga0495633_0000013_107087_107518 | 142 |
| 774 | 3300046648 | Ga0495611_0000695 | Ga0495611_0000695_633_1064 | 142 |
| 775 | 3300046665 | Ga0495661_0000008 | Ga0495661_0000008_308466_308897 | 142 |
| 776 | 3300046691 | Ga0495670_0002708 | Ga0495670_0002708_5482_5913 | 142 |
| 777 | 3300046692 | Ga0495671_0038740 | Ga0495671_0038740_816_1247 | 142 |
| 778 | 3300046794 | Ga0495589_0000258 | Ga0495589_0000258_12807_13238 | 142 |
| 779 | 3300046810 | Ga0495660_0003027 | Ga0495660_0003027_4659_5090 | 142 |
| 780 | 3300047323 | Ga0495683_0000002 | Ga0495683_0000002_338938_339369 | 142 |
| 781 | 3300047446 | Ga0495679_000315 | Ga0495679_000315_23303_23734 | 142 |
| 782 | 3300047469 | Ga0495673_0009844 | Ga0495673_0009844_3658_4089 | 142 |
| 783 | 3300048905 | Ga0496102_0001273 | Ga0496102_0001273_21579_22019 | 142 |
| 784 | 3300048906 | Ga0496103_0009351 | Ga0496103_0009351_4841_5281 | 142 |
| 785 | 3300048909 | Ga0496106_0001067 | Ga0496106_0001067_14485_14925 | 142 |
| 786 | 3300048910 | Ga0496107_0009614 | Ga0496107_0009614_5258_5698 | 142 |
| 787 | 3300048913 | Ga0496110_0769774 | Ga0496110_0769774_206_646 | 142 |
| 788 | 3300053092 | Ga0500583_0380171 | Ga0500583_0380171_217_663 | 142 |
| 789 | 3300053107 | Ga0500560_000059 | Ga0500560_000059_3403_3831 | 142 |
| 790 | 3300053125 | Ga0500618_011279 | Ga0500618_011279_708_1139 | 142 |
| 791 | 3300053157 | Ga0500624_002981 | Ga0500624_002981_1152_1580 | 142 |
| 792 | 3300053161 | Ga0500634_0115463 | Ga0500634_0115463_25_453 | 142 |
| 793 | iso_pu_bacteria | 2643221644 | 2644248935 | 142 |
| 794 | iso_pu_bacteria | 641228493 | 641334176 | 142 |
| 795 | iso_pu_bacteria | 643348555 | 643391809 | 142 |
| 796 | 3300025949 | Ga0207667_10927825 | Ga0207667_109278251 | 144 |
| 797 | 3300048920 | Ga0496117_0169783 | Ga0496117_0169783_352_843 | 144 |
| 798 | 3300001989 | JGI24739J22299_10028803 | JGI24739J22299_100288031 | 145 |
| 799 | 3300002067 | JGI24735J21928_10042589 | JGI24735J21928_100425891 | 145 |
| 800 | 3300005327 | Ga0070658_10081965 | Ga0070658_100819652 | 145 |
| 801 | 3300005339 | Ga0070660_100000001 | Ga0070660_10000000137 | 145 |
| 802 | 3300005366 | Ga0070659_100000326 | Ga0070659_10000032637 | 145 |
| 803 | 3300005563 | Ga0068855_100589113 | Ga0068855_1005891132 | 145 |
| 804 | 3300005564 | Ga0070664_100331588 | Ga0070664_1003315882 | 145 |
| 805 | 3300005614 | Ga0068856_100391343 | Ga0068856_1003913432 | 145 |
| 806 | 3300013104 | Ga0157370_10419481 | Ga0157370_104194811 | 145 |
| 807 | 3300014497 | Ga0182008_10611242 | Ga0182008_106112422 | 145 |
| 808 | 3300025904 | Ga0207647_10024902 | Ga0207647_100249021 | 145 |
| 809 | 3300025909 | Ga0207705_10138543 | Ga0207705_101385432 | 145 |
| 810 | 3300025919 | Ga0207657_10000590 | Ga0207657_1000059020 | 145 |
| 811 | 3300025924 | Ga0207694_10873622 | Ga0207694_108736221 | 145 |
| 812 | 3300025932 | Ga0207690_10000010 | Ga0207690_10000010153 | 145 |
| 813 | 3300025949 | Ga0207667_10176675 | Ga0207667_101766752 | 145 |
| 814 | 3300026067 | Ga0207678_10000013 | Ga0207678_1000001327 | 145 |
| 815 | 3300026078 | Ga0207702_11506382 | Ga0207702_115063821 | 145 |
| 816 | 3300048903 | Ga0496100_1031388 | Ga0496100_1031388_154_591 | 145 |
| 817 | 3300048905 | Ga0496102_0730626 | Ga0496102_0730626_255_692 | 145 |
| 818 | 3300048907 | Ga0496104_0232273 | Ga0496104_0232273_1204_1641 | 145 |
| 819 | 3300048908 | Ga0496105_0535895 | Ga0496105_0535895_90_527 | 145 |
| 820 | 3300048921 | Ga0496118_0045566 | Ga0496118_0045566_1501_1938 | 145 |
| 821 | 3300048921 | Ga0496118_0485111 | Ga0496118_0485111_134_571 | 145 |
| 822 | 3300050492 | nmdc:mga0yw44_9502_c1 | nmdc:mga0yw44_9502_c1_2304_2816 | 145 |
| 823 | 3300050494 | nmdc:mga06z11_11686_c1 | nmdc:mga06z11_11686_c1_1034_1546 | 145 |
| 824 | 3300050516 | nmdc:mga0sz30_2167_c1 | nmdc:mga0sz30_2167_c1_189_701 | 145 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rri-assembly1.cif.gz_A | crystal structure of glyoxalase/bleomycin resistance protein/dioxygenase from alicyclobacillus acidocaldarius | 0.8638 | 10 | 143 |
| 3rri-assembly1.cif.gz_A | crystal structure of glyoxalase/bleomycin resistance protein/dioxygenase from alicyclobacillus acidocaldarius | 0.8278 | 10 | 143 |
| 2p7k-assembly1.cif.gz_B | crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) | 0.8199 | 8 | 136 |
| 4nb0-assembly1.cif.gz_A | crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution | 0.8185 | 8 | 142 |
| 4nb2-assembly1.cif.gz_A | crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure | 0.799 | 8 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3rriB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8682 | 10 | 138 | 3.10.180.10 |
| 2p7kA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8207 | 8 | 136 | 3.10.180.10 |
| 3rriB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8191 | 10 | 138 | 3.10.180.10 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.796 | 78 | 135 | 3.30.720.110 |
| 2p7kA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.773 | 8 | 136 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A357EZN1-F1-model_v4 | Glyoxalase | 0.9946 | 10 | 58 |
|
| AF-A0A522RSE7-F1-model_v4 | DUF1543 domain-containing protein | 0.9919 | 9 | 145 |
|
| AF-A0A2N2T9P4-F1-model_v4 | Glyoxalase | 0.9851 | 16 | 145 |
|
| AF-A0A2W4PT80-F1-model_v4 | Glyoxalase | 0.9812 | 8 | 145 |
|
| AF-A0A367V5B7-F1-model_v4 | deleted | 0.9787 | 8 | 145 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar