F482393

General Info

Members Datasets Scaffolds Average Seq Length
824 394 798 142

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0646826|Ga0436365_0646826_12188_12706
Length 172
Sequence MACRFNDDDRGAAPPGLARIGLPSGVRRSKALSMTLPPFHLAFPVHDIEAARAFYGGLLGCPEGRSAPEWVDFDFFGHQIVAHLDPTLRPPAHRNPVDGHDVPVPHFGAVLPMAQWQVLADRLTAAGTDFVIAPTVRFRGEPGEQATMFFLDPSGNALELKAMADPANLFAR

Samples

Sample ID Description Type Environment
1 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
2 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
3 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
4 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
5 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
6 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
7 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
8 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
9 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
10 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
11 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
12 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
13 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
14 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
15 2842747753 Variovorax sp. R-72060 Isolate Unclassified
16 2885198086 Variovorax sp. 679 Isolate Unclassified
17 2885211737 Variovorax sp. 553 Isolate Unclassified
18 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
19 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
20 2928163908 Burkholderia sp. 567 Isolate Unclassified
21 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
22 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
23 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
26 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
27 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
192 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
193 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
194 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
195 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
200 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
201 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
202 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
217 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
230 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
231 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
232 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
233 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
234 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
235 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
236 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
237 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
238 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
239 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
240 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
241 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
242 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
243 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
244 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
245 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
246 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
247 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
248 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
249 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
250 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
251 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
252 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
253 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
254 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
255 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
256 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
257 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
258 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
259 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
260 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
261 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
262 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
263 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
264 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
265 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
266 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
267 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
270 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
271 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
272 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
273 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
274 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
275 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
276 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
277 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
278 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
279 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
280 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
283 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
284 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
285 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
286 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
287 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
288 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
289 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
290 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
291 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
292 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
293 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
294 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
295 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
296 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
297 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
298 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
299 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
300 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
301 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
302 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
303 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
306 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
307 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
308 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
309 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
310 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
311 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
312 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
313 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
314 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
315 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
316 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
317 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
318 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
319 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
320 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
321 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
322 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
323 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
324 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
328 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
329 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
330 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
331 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
332 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
333 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
334 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
350 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
351 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
352 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
353 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
354 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
355 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
356 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
357 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
358 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
359 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
360 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
361 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
362 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
367 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
368 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
369 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
370 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
371 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
372 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
373 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
374 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
375 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
376 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
377 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
378 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
379 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
380 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
381 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
382 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
383 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
384 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
385 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
386 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
387 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
388 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
389 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
390 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
391 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
392 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
393 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
394 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.36
Metatranscriptomes 0.49
Isolates 3.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.13
Nodule 0.36
Rhizoplane 1.94
Rhizosphere 89.32
Stem 0
Stem Tuber 0
Unclassified 4.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10028803 3300001989 Bacteria 1935
2 JGI24735J21928_10042589 3300002067 Bacteria 1322
3 JGI25162J39368_1000482 3300002737 Bacteria 30484
4 JGI25151J46595_10001007 3300003187 Bacteria 21295
5 JGI25165J46597_1000328 3300003214 Bacteria 56610
6 rootH2_10005494 3300003320 Bacteria 4776
7 rootL2_10002812 3300003322 Bacteria 40354
8 rootH1_10041044 3300003323 Bacteria 5772
9 Ga0070658_10000040 3300005327 Bacteria 136073
10 Ga0070658_10081965 3300005327 Bacteria 2650
11 Ga0070676_11007084 3300005328 Bacteria 626
12 Ga0070690_100053060 3300005330 Bacteria 2593
13 Ga0068869_100076760 3300005334 Bacteria 2484
14 Ga0068869_100163980 3300005334 Bacteria 1732
15 Ga0070680_100010536 3300005336 Bacteria 7131
16 Ga0070680_100015864 3300005336 Bacteria 5914
17 Ga0070682_100267438 3300005337 Bacteria 1240
18 Ga0070682_100598625 3300005337 Bacteria 870
19 Ga0070682_100639942 3300005337 Bacteria 845
20 Ga0068868_100000047 3300005338 Bacteria 67920
21 Ga0068868_100011443 3300005338 Bacteria 6461
22 Ga0070660_100000001 3300005339 Bacteria 190487
23 Ga0070660_100000414 3300005339 Bacteria 28402
24 Ga0070660_100002023 3300005339 Bacteria 13985
25 Ga0070660_100014626 3300005339 Bacteria 5661
26 Ga0070660_100015658 3300005339 Bacteria 5481
27 Ga0070660_100065200 3300005339 Bacteria 2835
28 Ga0070660_100097844 3300005339 Bacteria 2322
29 Ga0070660_100147532 3300005339 Bacteria 1890
30 Ga0070660_101186455 3300005339 Bacteria 647
31 Ga0070689_100002871 3300005340 Bacteria 11332
32 Ga0070689_100374048 3300005340 Bacteria 1199
33 Ga0070691_10043175 3300005341 Bacteria 2135
34 Ga0070691_10050970 3300005341 Bacteria 1975
35 Ga0070661_100000324 3300005344 Bacteria 38428
36 Ga0070661_100001393 3300005344 Bacteria 16882
37 Ga0070661_100026806 3300005344 Bacteria 4147
38 Ga0070661_100127933 3300005344 Bacteria 1906
39 Ga0070661_100429640 3300005344 Bacteria 1048
40 Ga0070692_10000687 3300005345 Bacteria 10867
41 Ga0070692_10020047 3300005345 Bacteria 3236
42 Ga0070692_10197341 3300005345 Bacteria 1176
43 Ga0070692_10795489 3300005345 Bacteria 645
44 Ga0070668_102032730 3300005347 Bacteria 530
45 Ga0070669_100013267 3300005353 Bacteria 5857
46 Ga0070669_100114428 3300005353 Bacteria 2051
47 Ga0070669_101872207 3300005353 Bacteria 524
48 Ga0070675_100032605 3300005354 Bacteria 4217
49 Ga0070675_100116424 3300005354 Bacteria 2267
50 Ga0070671_100028246 3300005355 Bacteria 4619
51 Ga0070674_100151761 3300005356 Bacteria 1749
52 Ga0070673_100164739 3300005364 Bacteria 1888
53 Ga0070673_100815903 3300005364 Bacteria 862
54 Ga0070659_100000022 3300005366 Bacteria 154091
55 Ga0070659_100000326 3300005366 Bacteria 36612
56 Ga0070659_100000526 3300005366 Bacteria 27993
57 Ga0070659_100004108 3300005366 Bacteria 10376
58 Ga0070659_100006002 3300005366 Bacteria 8759
59 Ga0070659_100024020 3300005366 Bacteria 4670
60 Ga0070659_100296747 3300005366 Bacteria 1347
61 Ga0070659_100467732 3300005366 Bacteria 1071
62 Ga0070659_100577394 3300005366 Bacteria 964
63 Ga0070667_101382658 3300005367 Bacteria 660
64 Ga0070710_10895294 3300005437 Bacteria 640
65 Ga0070701_10005288 3300005438 Bacteria 5318
66 Ga0070711_100250448 3300005439 Bacteria 1389
67 Ga0070700_100051959 3300005441 Bacteria 2553
68 Ga0070694_100577452 3300005444 Bacteria 903
69 Ga0070708_101046461 3300005445 Bacteria 765
70 Ga0070663_100003639 3300005455 Bacteria 8925
71 Ga0070663_100310914 3300005455 Bacteria 1264
72 Ga0070663_100434196 3300005455 Bacteria 1079
73 Ga0070678_100042002 3300005456 Bacteria 3247
74 Ga0070678_100257033 3300005456 Bacteria 1467
75 Ga0070678_100379931 3300005456 Bacteria 1222
76 Ga0070678_101033783 3300005456 Bacteria 756
77 Ga0070662_100000260 3300005457 Bacteria 31271
78 Ga0070662_100060905 3300005457 Bacteria 2754
79 Ga0070662_100946168 3300005457 Bacteria 736
80 Ga0070662_101505701 3300005457 Bacteria 580
81 Ga0070681_10000619 3300005458 Bacteria 29107
82 Ga0070681_10005369 3300005458 Bacteria 12372
83 Ga0070681_10023617 3300005458 Bacteria 6185
84 Ga0070681_10073821 3300005458 Bacteria 3373
85 Ga0070681_10483961 3300005458 Bacteria 1150
86 Ga0068867_101912983 3300005459 Bacteria 559
87 Ga0070679_100000001 3300005530 Bacteria 764811
88 Ga0070679_100001372 3300005530 Bacteria 21479
89 Ga0070679_100008154 3300005530 Bacteria 9842
90 Ga0070679_100059123 3300005530 Bacteria 3820
91 Ga0070679_100247621 3300005530 Unclassified 1739
92 Ga0070679_100707595 3300005530 Bacteria 950
93 Ga0070679_101106443 3300005530 Bacteria 737
94 Ga0070684_100294259 3300005535 Bacteria 1489
95 Ga0068853_100001673 3300005539 Bacteria 16221
96 Ga0068853_100344038 3300005539 Bacteria 1386
97 Ga0070672_100087744 3300005543 Bacteria 2504
98 Ga0070672_100400963 3300005543 Bacteria 1176
99 Ga0070686_100104196 3300005544 Bacteria 1921
100 Ga0070686_100613679 3300005544 Bacteria 858
101 Ga0070696_100046350 3300005546 Bacteria 3014
102 Ga0070696_100057270 3300005546 Bacteria 2720
103 Ga0070696_100280670 3300005546 Bacteria 1270
104 Ga0070693_100256165 3300005547 Bacteria 1162
105 Ga0070665_100002152 3300005548 Bacteria 21984
106 Ga0070665_100010218 3300005548 Bacteria 9494
107 Ga0070665_100281520 3300005548 Bacteria 1665
108 Ga0070665_101386176 3300005548 Bacteria 712
109 Ga0068855_100000106 3300005563 Bacteria 103864
110 Ga0068855_100000110 3300005563 Bacteria 102379
111 Ga0068855_100000956 3300005563 Bacteria 35944
112 Ga0068855_100027475 3300005563 Bacteria 6805
113 Ga0068855_100066277 3300005563 Bacteria 4210
114 Ga0068855_100143593 3300005563 Bacteria 2718
115 Ga0068855_100332242 3300005563 Bacteria 1678
116 Ga0068855_100589113 3300005563 Bacteria 1200
117 Ga0068855_101109377 3300005563 Bacteria 827
118 Ga0068855_101387804 3300005563 Bacteria 724
119 Ga0068855_101560316 3300005563 Bacteria 676
120 Ga0070664_100000378 3300005564 Bacteria 33105
121 Ga0070664_100218575 3300005564 Bacteria 1704
122 Ga0070664_100331588 3300005564 Bacteria 1380
123 Ga0070664_100441325 3300005564 Bacteria 1194
124 Ga0068857_101408747 3300005577 Bacteria 678
125 Ga0068854_100009590 3300005578 Bacteria 6249
126 Ga0068854_100309607 3300005578 Bacteria 1280
127 Ga0068856_100000111 3300005614 Bacteria 81104
128 Ga0068856_100089964 3300005614 Bacteria 3053
129 Ga0068856_100103897 3300005614 Bacteria 2834
130 Ga0068856_100391343 3300005614 Bacteria 1410
131 Ga0070702_100680859 3300005615 Bacteria 781
132 Ga0068852_100000530 3300005616 Bacteria 25064
133 Ga0068852_100002997 3300005616 Bacteria 11733
134 Ga0068852_100003598 3300005616 Bacteria 10848
135 Ga0068852_100032133 3300005616 Bacteria 4342
136 Ga0068852_100175210 3300005616 Bacteria 2013
137 Ga0068852_100476441 3300005616 Bacteria 1240
138 Ga0068852_101017783 3300005616 Bacteria 847
139 Ga0068859_100284700 3300005617 Bacteria 1746
140 Ga0068859_100810213 3300005617 Bacteria 1024
141 Ga0068859_100815896 3300005617 Bacteria 1020
142 Ga0068864_100062043 3300005618 Bacteria 3238
143 Ga0068864_100196746 3300005618 Bacteria 1850
144 Ga0068866_10027804 3300005718 Bacteria 2688
145 Ga0068861_100006025 3300005719 Bacteria 8243
146 Ga0068861_100884061 3300005719 Bacteria 845
147 Ga0068851_10007934 3300005834 Bacteria 4895
148 Ga0068863_102267347 3300005841 Bacteria 553
149 Ga0068858_100001633 3300005842 Bacteria 22876
150 Ga0068858_100249299 3300005842 Bacteria 1686
151 Ga0068858_101282267 3300005842 Bacteria 721
152 Ga0068860_100140375 3300005843 Bacteria 2322
153 Ga0068862_100349118 3300005844 Bacteria 1372
154 Ga0068862_100389155 3300005844 Bacteria 1302
155 Ga0068862_100800077 3300005844 Bacteria 920
156 Ga0081539_10101654 3300005985 Bacteria 1464
157 Ga0070712_100367870 3300006175 Bacteria 1181
158 Ga0075362_10125285 3300006177 Bacteria 1218
159 Ga0075367_10516901 3300006178 Bacteria 758
160 Ga0075366_10027545 3300006195 Bacteria 3334
161 Ga0097621_100021803 3300006237 Bacteria 4963
162 Ga0097621_100165351 3300006237 Bacteria 1904
163 Ga0075370_10004847 3300006353 Bacteria 6598
164 Ga0068871_100063796 3300006358 Bacteria 3014
165 Ga0068871_100270213 3300006358 Bacteria 1485
166 Ga0068871_100537798 3300006358 Bacteria 1057
167 Ga0075428_100027797 3300006844 Bacteria 6258
168 Ga0075430_100141423 3300006846 Bacteria 2004
169 Ga0075431_100572019 3300006847 Bacteria 1116
170 Ga0068865_100015542 3300006881 Bacteria 4856
171 Ga0068865_100729077 3300006881 Bacteria 849
172 Ga0075436_100266682 3300006914 Bacteria 1222
173 Ga0097620_100284700 3300006931 Bacteria 1746
174 Ga0097620_100810124 3300006931 Bacteria 1024
175 Ga0097620_100815662 3300006931 Bacteria 1020
176 Ga0105240_10000055 3300009093 Bacteria 225380
177 Ga0105240_10000921 3300009093 Bacteria 52415
178 Ga0105240_10009666 3300009093 Bacteria 13630
179 Ga0105240_10011013 3300009093 Bacteria 12658
180 Ga0105240_10037794 3300009093 Bacteria 6201
181 Ga0105240_10049795 3300009093 Bacteria 5285
182 Ga0105240_10115601 3300009093 Bacteria 3239
183 Ga0105240_10369042 3300009093 Bacteria 1623
184 Ga0111539_10029610 3300009094 Bacteria 6666
185 Ga0111539_13302298 3300009094 Bacteria 519
186 Ga0105245_10004106 3300009098 Bacteria 12927
187 Ga0105245_10268467 3300009098 Bacteria 1663
188 Ga0105245_10388007 3300009098 Bacteria 1392
189 Ga0105245_11270303 3300009098 Bacteria 785
190 Ga0105247_10005627 3300009101 Bacteria 7863
191 Ga0105247_10007480 3300009101 Bacteria 6697
192 Ga0105247_10283153 3300009101 Bacteria 1144
193 Ga0105243_10022806 3300009148 Bacteria 4759
194 Ga0105243_10164548 3300009148 Bacteria 1916
195 Ga0105243_12862885 3300009148 Bacteria 523
196 Ga0105241_10016353 3300009174 Bacteria 5440
197 Ga0105241_10171401 3300009174 Bacteria 1793
198 Ga0105241_11672125 3300009174 Bacteria 618
199 Ga0105242_10168870 3300009176 Bacteria 1921
200 Ga0105248_10000517 3300009177 Bacteria 43853
201 Ga0105248_10061914 3300009177 Bacteria 4202
202 Ga0105248_10651324 3300009177 Bacteria 1189
203 Ga0105237_10019700 3300009545 Bacteria 6965
204 Ga0105237_10103204 3300009545 Bacteria 2843
205 Ga0105237_10493869 3300009545 Bacteria 1230
206 Ga0105237_12314707 3300009545 Bacteria 547
207 Ga0105238_10000586 3300009551 Bacteria 38241
208 Ga0105238_10002000 3300009551 Bacteria 20551
209 Ga0105238_10026575 3300009551 Bacteria 5902
210 Ga0105238_10039822 3300009551 Bacteria 4764
211 Ga0105238_10164405 3300009551 Bacteria 2195
212 Ga0105238_10179560 3300009551 Bacteria 2094
213 Ga0105238_11292256 3300009551 Bacteria 755
214 Ga0105238_11729549 3300009551 Bacteria 657
215 Ga0105249_10744857 3300009553 Bacteria 1042
216 Ga0157347_1029477 3300012502 Bacteria 681
217 Ga0157373_10004775 3300013100 Bacteria 10199
218 Ga0157373_10209947 3300013100 Bacteria 1373
219 Ga0157373_11298797 3300013100 Bacteria 551
220 Ga0157371_10000248 3300013102 Bacteria 76451
221 Ga0157371_10050825 3300013102 Bacteria 2946
222 Ga0157371_10133910 3300013102 Bacteria 1764
223 Ga0157371_10253003 3300013102 Bacteria 1269
224 Ga0157371_10843690 3300013102 Bacteria 692
225 Ga0157370_10002265 3300013104 Bacteria 23367
226 Ga0157370_10062315 3300013104 Bacteria 3537
227 Ga0157370_10125803 3300013104 Bacteria 2392
228 Ga0157370_10131847 3300013104 Bacteria 2331
229 Ga0157370_10157325 3300013104 Bacteria 2114
230 Ga0157370_10419481 3300013104 Bacteria 1231
231 Ga0157370_11335202 3300013104 Bacteria 646
232 Ga0157369_10006105 3300013105 Bacteria 13984
233 Ga0157369_10010911 3300013105 Bacteria 10345
234 Ga0157369_10013484 3300013105 Bacteria 9235
235 Ga0157369_10023221 3300013105 Bacteria 6910
236 Ga0157369_10089945 3300013105 Bacteria 3278
237 Ga0157369_10111259 3300013105 Bacteria 2911
238 Ga0157369_10227994 3300013105 Bacteria 1948
239 Ga0157369_10782153 3300013105 Bacteria 981
240 Ga0157378_10258037 3300013297 Bacteria 1671
241 Ga0157378_10459768 3300013297 Bacteria 1264
242 Ga0163162_10194029 3300013306 Bacteria 2159
243 Ga0157372_10000402 3300013307 Bacteria 47788
244 Ga0157372_10004312 3300013307 Bacteria 15203
245 Ga0157372_10178613 3300013307 Bacteria 2457
246 Ga0157372_10230071 3300013307 Bacteria 2149
247 Ga0157372_10320359 3300013307 Bacteria 1805
248 Ga0157372_10377675 3300013307 Bacteria 1651
249 Ga0157372_11125113 3300013307 Bacteria 908
250 Ga0157375_11192945 3300013308 Bacteria 893
251 Ga0157380_10033868 3300014326 Bacteria 3935
252 Ga0182008_10051455 3300014497 Bacteria 2043
253 Ga0182008_10611242 3300014497 Bacteria 613
254 Ga0157379_10237614 3300014968 Bacteria 1652
255 Ga0206356_11270598 3300020070 Bacteria 698
256 Ga0206354_10201683 3300020081 Bacteria 628
257 Ga0206353_10090608 3300020082 Bacteria 618
258 Ga0213873_10000017 3300021358 Bacteria 123962
259 Ga0213876_10000071 3300021384 Bacteria 123962
260 Ga0213876_10000261 3300021384 Bacteria 48782
261 Ga0213876_10000274 3300021384 Bacteria 47640
262 Ga0213876_10000290 3300021384 Bacteria 45674
263 Ga0224712_10043427 3300022467 Unclassified 1708
264 Ga0209672_107191 3300025228 Bacteria 1734
265 Ga0209437_100057 3300025233 Bacteria 362922
266 Ga0209129_1002564 3300025258 Bacteria 8753
267 Ga0209233_1000130 3300025261 Bacteria 205687
268 Ga0209025_1000157 3300025294 Bacteria 168790
269 Ga0207656_10043977 3300025321 Bacteria 1906
270 Ga0207692_10126949 3300025898 Bacteria 1436
271 Ga0207692_10578583 3300025898 Bacteria 720
272 Ga0207642_10012770 3300025899 Bacteria 3043
273 Ga0207710_10002645 3300025900 Bacteria 8258
274 Ga0207710_10046203 3300025900 Bacteria 1944
275 Ga0207688_10433009 3300025901 Bacteria 818
276 Ga0207647_10024902 3300025904 Bacteria 3940
277 Ga0207705_10000002 3300025909 Bacteria 2046852
278 Ga0207705_10001024 3300025909 Bacteria 22688
279 Ga0207705_10075570 3300025909 Bacteria 2447
280 Ga0207705_10138543 3300025909 Bacteria 1815
281 Ga0207705_11107543 3300025909 Bacteria 610
282 Ga0207654_10019838 3300025911 Bacteria 3555
283 Ga0207654_10797396 3300025911 Bacteria 682
284 Ga0207707_10000038 3300025912 Bacteria 143359
285 Ga0207707_10004902 3300025912 Bacteria 11762
286 Ga0207707_10028844 3300025912 Bacteria 4850
287 Ga0207707_10046389 3300025912 Bacteria 3785
288 Ga0207695_10000012 3300025913 Bacteria 840961
289 Ga0207695_10000572 3300025913 Bacteria 75360
290 Ga0207695_10003158 3300025913 Bacteria 23497
291 Ga0207695_10007437 3300025913 Bacteria 13944
292 Ga0207695_10008910 3300025913 Bacteria 12491
293 Ga0207695_10043747 3300025913 Bacteria 4770
294 Ga0207695_10058882 3300025913 Bacteria 3986
295 Ga0207695_10194197 3300025913 Bacteria 1946
296 Ga0207695_10288658 3300025913 Bacteria 1533
297 Ga0207671_10148070 3300025914 Bacteria 1812
298 Ga0207663_10421711 3300025916 Bacteria 1024
299 Ga0207660_10001700 3300025917 Bacteria 14758
300 Ga0207660_10003203 3300025917 Bacteria 10704
301 Ga0207660_10003261 3300025917 Bacteria 10626
302 Ga0207660_10471806 3300025917 Bacteria 1016
303 Ga0207657_10000381 3300025919 Bacteria 46762
304 Ga0207657_10000590 3300025919 Bacteria 38432
305 Ga0207657_10000910 3300025919 Bacteria 31264
306 Ga0207657_10002098 3300025919 Bacteria 21566
307 Ga0207657_10005748 3300025919 Bacteria 12941
308 Ga0207657_10019686 3300025919 Bacteria 6401
309 Ga0207657_10089749 3300025919 Bacteria 2566
310 Ga0207657_10115822 3300025919 Bacteria 2209
311 Ga0207657_10131410 3300025919 Bacteria 2051
312 Ga0207657_10290360 3300025919 Bacteria 1297
313 Ga0207657_10768392 3300025919 Bacteria 746
314 Ga0207649_10000256 3300025920 Bacteria 42414
315 Ga0207649_10012952 3300025920 Bacteria 4647
316 Ga0207649_10017732 3300025920 Bacteria 4036
317 Ga0207649_10060105 3300025920 Bacteria 2387
318 Ga0207649_10247789 3300025920 Bacteria 1282
319 Ga0207652_10000003 3300025921 Bacteria 502441
320 Ga0207652_10000982 3300025921 Bacteria 26411
321 Ga0207652_10199177 3300025921 Bacteria 1802
322 Ga0207652_11119865 3300025921 Bacteria 688
323 Ga0207681_10117034 3300025923 Bacteria 1948
324 Ga0207681_11436749 3300025923 Bacteria 579
325 Ga0207694_10000006 3300025924 Bacteria 631109
326 Ga0207694_10005147 3300025924 Bacteria 10092
327 Ga0207694_10007598 3300025924 Bacteria 8219
328 Ga0207694_10077991 3300025924 Bacteria 2596
329 Ga0207694_10091217 3300025924 Bacteria 2405
330 Ga0207694_10146946 3300025924 Bacteria 1898
331 Ga0207694_10452873 3300025924 Bacteria 1071
332 Ga0207694_10707555 3300025924 Bacteria 850
333 Ga0207694_10708406 3300025924 Bacteria 849
334 Ga0207694_10873622 3300025924 Bacteria 760
335 Ga0207650_10277407 3300025925 Bacteria 1364
336 Ga0207687_10002318 3300025927 Bacteria 12956
337 Ga0207687_10073643 3300025927 Bacteria 2446
338 Ga0207687_10333770 3300025927 Bacteria 1231
339 Ga0207664_10339887 3300025929 Bacteria 1327
340 Ga0207664_11429295 3300025929 Bacteria 613
341 Ga0207644_10019042 3300025931 Bacteria 4653
342 Ga0207644_11540627 3300025931 Bacteria 558
343 Ga0207690_10000003 3300025932 Bacteria 783011
344 Ga0207690_10000010 3300025932 Bacteria 330298
345 Ga0207690_10000194 3300025932 Bacteria 47161
346 Ga0207690_10001039 3300025932 Bacteria 17769
347 Ga0207690_10002314 3300025932 Bacteria 11617
348 Ga0207690_10029512 3300025932 Bacteria 3488
349 Ga0207690_10164241 3300025932 Bacteria 1658
350 Ga0207690_10463299 3300025932 Bacteria 1020
351 Ga0207706_10000008 3300025933 Bacteria 201940
352 Ga0207706_10023372 3300025933 Bacteria 5552
353 Ga0207686_10012916 3300025934 Bacteria 4606
354 Ga0207709_10068495 3300025935 Bacteria 2243
355 Ga0207670_10004220 3300025936 Bacteria 7708
356 Ga0207670_10228596 3300025936 Bacteria 1427
357 Ga0207669_10170158 3300025937 Bacteria 1550
358 Ga0207704_10003198 3300025938 Bacteria 7414
359 Ga0207704_10128572 3300025938 Bacteria 1749
360 Ga0207691_10085498 3300025940 Bacteria 2831
361 Ga0207711_10001000 3300025941 Bacteria 27099
362 Ga0207711_10036878 3300025941 Bacteria 4150
363 Ga0207711_10903234 3300025941 Bacteria 821
364 Ga0207689_10007096 3300025942 Bacteria 9847
365 Ga0207661_10056398 3300025944 Bacteria 3154
366 Ga0207679_10000934 3300025945 Bacteria 18670
367 Ga0207679_11933411 3300025945 Bacteria 538
368 Ga0207667_10000026 3300025949 Bacteria 343713
369 Ga0207667_10001326 3300025949 Bacteria 31063
370 Ga0207667_10003312 3300025949 Bacteria 19879
371 Ga0207667_10004668 3300025949 Bacteria 16782
372 Ga0207667_10140552 3300025949 Bacteria 2486
373 Ga0207667_10176675 3300025949 Bacteria 2193
374 Ga0207667_10193016 3300025949 Bacteria 2089
375 Ga0207667_10244059 3300025949 Bacteria 1838
376 Ga0207667_10927825 3300025949 Bacteria 861
377 Ga0207667_11435319 3300025949 Bacteria 663
378 Ga0207651_10186694 3300025960 Bacteria 1650
379 Ga0207640_10004677 3300025981 Bacteria 7429
380 Ga0207640_10035158 3300025981 Bacteria 3133
381 Ga0207640_10804050 3300025981 Bacteria 815
382 Ga0207677_10000107 3300026023 Bacteria 67596
383 Ga0207677_10061851 3300026023 Bacteria 2595
384 Ga0207677_10082228 3300026023 Bacteria 2314
385 Ga0207677_11113237 3300026023 Bacteria 720
386 Ga0207703_10001323 3300026035 Bacteria 22741
387 Ga0207703_10108979 3300026035 Bacteria 2359
388 Ga0207703_11275298 3300026035 Bacteria 706
389 Ga0207639_10001218 3300026041 Bacteria 17476
390 Ga0207639_10002823 3300026041 Bacteria 11653
391 Ga0207639_10513925 3300026041 Bacteria 1096
392 Ga0207639_10992560 3300026041 Bacteria 786
393 Ga0207678_10000013 3300026067 Bacteria 141619
394 Ga0207678_10100896 3300026067 Bacteria 2465
395 Ga0207678_10817716 3300026067 Bacteria 823
396 Ga0207708_10000385 3300026075 Bacteria 34524
397 Ga0207702_10000510 3300026078 Bacteria 43837
398 Ga0207702_10102556 3300026078 Bacteria 2529
399 Ga0207702_10112615 3300026078 Bacteria 2422
400 Ga0207702_10228993 3300026078 Bacteria 1736
401 Ga0207702_11506382 3300026078 Bacteria 666
402 Ga0207641_10754322 3300026088 Bacteria 961
403 Ga0207641_11973808 3300026088 Bacteria 585
404 Ga0207648_10001978 3300026089 Bacteria 22373
405 Ga0207648_10570654 3300026089 Bacteria 1041
406 Ga0207676_10028277 3300026095 Bacteria 4186
407 Ga0207674_10217041 3300026116 Bacteria 1861
408 Ga0207674_10235219 3300026116 Bacteria 1780
409 Ga0207674_11071197 3300026116 Bacteria 775
410 Ga0207675_100002060 3300026118 Bacteria 20050
411 Ga0207675_101311513 3300026118 Bacteria 744
412 Ga0207683_10032154 3300026121 Bacteria 4557
413 Ga0207698_10001893 3300026142 Bacteria 12258
414 Ga0207698_10005482 3300026142 Bacteria 7850
415 Ga0207698_10022179 3300026142 Bacteria 4406
416 Ga0207698_10025195 3300026142 Bacteria 4185
417 Ga0207698_10116334 3300026142 Bacteria 2253
418 Ga0207698_11530545 3300026142 Bacteria 682
419 Ga0209999_1004974 3300027543 Bacteria 2393
420 Ga0209971_1025274 3300027682 Bacteria 1419
421 Ga0209974_10020533 3300027876 Bacteria 2189
422 Ga0209974_10079207 3300027876 Bacteria 1128
423 Ga0209974_10130861 3300027876 Bacteria 895
424 Ga0207428_10007500 3300027907 Bacteria 9940
425 Ga0268266_10002109 3300028379 Bacteria 21964
426 Ga0268266_10137854 3300028379 Bacteria 2187
427 Ga0268265_10111341 3300028380 Bacteria 2236
428 Ga0268265_10404698 3300028380 Bacteria 1262
429 Ga0268265_10504177 3300028380 Bacteria 1141
430 Ga0268265_10520551 3300028380 Bacteria 1124
431 Ga0268265_10627683 3300028380 Bacteria 1030
432 Ga0268264_10119750 3300028381 Bacteria 2318
433 Ga0265334_10149267 3300028573 Bacteria 825
434 Ga0307517_10001402 3300028786 Bacteria 40531
435 Ga0265338_10330923 3300028800 Bacteria 1100
436 Ga0307511_10003572 3300030521 Bacteria 15931
437 Ga0265329_10304338 3300031242 Bacteria 539
438 Ga0307513_10000020 3300031456 Bacteria 228745
439 Ga0307513_10008370 3300031456 Bacteria 13244
440 Ga0307509_10000056 3300031507 Bacteria 157836
441 Ga0307408_100068146 3300031548 Bacteria 2619
442 Ga0307408_100169980 3300031548 Bacteria 1740
443 Ga0307408_100301796 3300031548 Bacteria 1342
444 Ga0307408_100896427 3300031548 Bacteria 811
445 Ga0307408_100904355 3300031548 Bacteria 808
446 Ga0316575_10023402 3300031665 Bacteria 2388
447 Ga0316575_10410939 3300031665 Bacteria 581
448 Ga0316579_10020119 3300031691 Bacteria 2955
449 Ga0265342_10007158 3300031712 Bacteria 8211
450 Ga0307516_10047728 3300031730 Bacteria 4216
451 Ga0307405_10025432 3300031731 Bacteria 3399
452 Ga0307405_10363011 3300031731 Bacteria 1121
453 Ga0307405_10691972 3300031731 Bacteria 843
454 Ga0307405_10904265 3300031731 Bacteria 747
455 Ga0307413_10070066 3300031824 Bacteria 2203
456 Ga0307413_10291853 3300031824 Bacteria 1232
457 Ga0307413_10575506 3300031824 Bacteria 918
458 Ga0307413_10595082 3300031824 Bacteria 904
459 Ga0307413_10781636 3300031824 Bacteria 801
460 Ga0307413_11507632 3300031824 Bacteria 595
461 Ga0307410_10005780 3300031852 Bacteria 6595
462 Ga0307410_10151567 3300031852 Bacteria 1727
463 Ga0307410_10182545 3300031852 Bacteria 1589
464 Ga0307410_10521906 3300031852 Bacteria 980
465 Ga0307410_11261606 3300031852 Bacteria 645
466 Ga0307406_10020369 3300031901 Bacteria 3904
467 Ga0307406_10182563 3300031901 Bacteria 1529
468 Ga0307406_10812075 3300031901 Bacteria 790
469 Ga0307407_10067403 3300031903 Bacteria 2115
470 Ga0307412_10327413 3300031911 Bacteria 1221
471 Ga0307412_10328513 3300031911 Bacteria 1220
472 Ga0307412_10842833 3300031911 Bacteria 799
473 Ga0307409_100034586 3300031995 Bacteria 3692
474 Ga0307409_100486041 3300031995 Bacteria 1199
475 Ga0307416_100007443 3300032002 Bacteria 6964
476 Ga0307416_100449034 3300032002 Bacteria 1341
477 Ga0307416_101179386 3300032002 Bacteria 871
478 Ga0307416_101188248 3300032002 Bacteria 868
479 Ga0307414_10060944 3300032004 Bacteria 2671
480 Ga0307414_10150578 3300032004 Bacteria 1835
481 Ga0307414_10227696 3300032004 Bacteria 1535
482 Ga0307414_10443828 3300032004 Bacteria 1136
483 Ga0307414_11672758 3300032004 Bacteria 593
484 Ga0307411_10025273 3300032005 Bacteria 3556
485 Ga0307411_10042464 3300032005 Bacteria 2901
486 Ga0307411_10045331 3300032005 Bacteria 2828
487 Ga0307411_10245813 3300032005 Bacteria 1404
488 Ga0307415_100001602 3300032126 Bacteria 10932
489 Ga0307415_100176907 3300032126 Bacteria 1670
490 Ga0307415_100288849 3300032126 Bacteria 1353
491 Ga0307415_100585560 3300032126 Bacteria 990
492 Ga0307510_10002995 3300033180 Bacteria 19438
493 Ga0373936_0000887 3300035113 Bacteria 10695
494 Ga0373939_0091708 3300035114 Bacteria 1028
495 Ga0373962_0210662 3300035242 Bacteria 661
496 Ga0373927_0362630 3300035695 Bacteria 955
497 Ga0373933_0440330 3300035724 Bacteria 852
498 Ga0373937_0396323 3300036401 Bacteria 1310
499 Ga0316582_0002570 3300036647 Bacteria 8597
500 Ga0395899_0000065 3300037312 Bacteria 205510
501 Ga0395899_0104684 3300037312 Bacteria 2039
502 Ga0395899_0181544 3300037312 Bacteria 1477
503 Ga0395900_0000339 3300037418 Bacteria 69082
504 Ga0395900_0002169 3300037418 Bacteria 21931
505 Ga0395900_0111949 3300037418 Bacteria 2803
506 Ga0395900_0173674 3300037418 Bacteria 2193
507 Ga0395900_0185390 3300037418 Bacteria 2112
508 Ga0395900_0341354 3300037418 Bacteria 1473
509 Ga0395900_0364909 3300037418 Bacteria 1415
510 Ga0395900_0745310 3300037418 Bacteria 910
511 Ga0395900_1290620 3300037418 Bacteria 644
512 Ga0395900_1712055 3300037418 Bacteria 539
513 Ga0395898_0000565 3300037466 Bacteria 69082
514 Ga0395898_0034389 3300037466 Bacteria 5052
515 Ga0395898_0069666 3300037466 Bacteria 3402
516 Ga0395898_0155514 3300037466 Bacteria 2187
517 Ga0395905_0001727 3300037471 Bacteria 25583
518 Ga0395905_0027044 3300037471 Bacteria 5410
519 Ga0395905_0195730 3300037471 Bacteria 1895
520 Ga0395905_0448623 3300037471 Bacteria 1188
521 Ga0395905_0553544 3300037471 Bacteria 1051
522 Ga0395905_0671168 3300037471 Bacteria 939
523 Ga0436364_0186181 3300037853 Bacteria 1273
524 Ga0395901_0000994 3300038443 Bacteria 30620
525 Ga0395901_0143930 3300038443 Bacteria 2506
526 Ga0395901_0398951 3300038443 Bacteria 1413
527 Ga0395901_0576994 3300038443 Bacteria 1137
528 Ga0436365_0257402 3300039437 Bacteria 164674
529 Ga0436365_0646826 3300039437 Bacteria 110896
530 Ga0436365_0826287 3300039437 Bacteria 75557
531 Ga0436365_1685576 3300039437 Bacteria 49468
532 Ga0436362_1094363 3300039453 Bacteria 35955
533 Ga0439439_0058281 3300041406 Bacteria 1022
534 Ga0439453_0089630 3300041408 Bacteria 673
535 Ga0439461_0128858 3300041410 Bacteria 638
536 Ga0439466_0119927 3300041411 Bacteria 812
537 Ga0451793_0794819 3300041452 Bacteria 612
538 Ga0439431_0006863 3300041997 Bacteria 2529
539 Ga0439433_0024280 3300041999 Bacteria 1365
540 Ga0439433_0075409 3300041999 Bacteria 816
541 Ga0439441_068626 3300042001 Bacteria 757
542 Ga0439443_001002 3300042003 Bacteria 2908
543 Ga0439445_0139123 3300042004 Bacteria 703
544 Ga0439451_078934 3300042009 Bacteria 660
545 Ga0439462_0039882 3300042015 Bacteria 1252
546 Ga0450912_000880 3300042116 Bacteria 1677
547 Ga0450913_009306 3300042117 Bacteria 770
548 Ga0450914_019675 3300042118 Bacteria 743
549 Ga0450920_012034 3300042122 Bacteria 1618
550 Ga0450921_008756 3300042123 Bacteria 826
551 Ga0450922_003671 3300042124 Bacteria 1410
552 Ga0450923_001983 3300042125 Bacteria 2843
553 Ga0450890_034836 3300042127 Bacteria 728
554 Ga0450892_023010 3300042130 Bacteria 622
555 Ga0450894_002478 3300042131 Bacteria 2476
556 Ga0450896_005989 3300042133 Bacteria 1664
557 Ga0450896_020051 3300042133 Bacteria 976
558 Ga0450898_012904 3300042134 Bacteria 1386
559 Ga0450906_012176 3300042145 Bacteria 1597
560 Ga0450907_008148 3300042146 Bacteria 1744
561 Ga0450907_008643 3300042146 Bacteria 1688
562 Ga0439446_0008772 3300042156 Bacteria 2693
563 Ga0450908_000818 3300042184 Bacteria 5986
564 Ga0439434_0005621 3300042435 Bacteria 3662
565 Ga0439435_0000323 3300042436 Bacteria 7215
566 Ga0439444_0002954 3300042437 Bacteria 2368
567 Ga0439464_0222193 3300042439 Bacteria 606
568 Ga0439460_0027919 3300042461 Bacteria 1588
569 Ga0466969_0007130 3300044656 Bacteria 5950
570 Ga0466973_0047582 3300044659 Bacteria 3987
571 Ga0466965_0051002 3300044683 Bacteria 2052
572 Ga0466966_0204461 3300044684 Bacteria 1194
573 Ga0466961_0140905 3300044693 Bacteria 1509
574 Ga0466961_0264291 3300044693 Bacteria 1055
575 Ga0466963_0000420 3300044694 Bacteria 19496
576 Ga0466963_0037987 3300044694 Bacteria 3148
577 Ga0466971_0034581 3300044719 Bacteria 2264
578 Ga0466970_0011768 3300044765 Bacteria 4463
579 Ga0466970_0041943 3300044765 Bacteria 2433
580 Ga0466970_0267268 3300044765 Bacteria 960
581 Ga0466957_0002050 3300044842 Bacteria 10767
582 Ga0466957_0113287 3300044842 Bacteria 1722
583 Ga0466957_0214515 3300044842 Bacteria 1269
584 Ga0466957_0655971 3300044842 Bacteria 738
585 Ga0466959_0011577 3300045049 Bacteria 6339
586 Ga0466959_0013716 3300045049 Bacteria 5881
587 Ga0466958_0001742 3300045836 Bacteria 10525
588 Ga0466958_0561780 3300045836 Bacteria 742
589 Ga0466967_0028685 3300045976 Bacteria 4650
590 Ga0466967_0046076 3300045976 Bacteria 3794
591 Ga0466967_0180842 3300045976 Bacteria 1989
592 Ga0466967_0317091 3300045976 Bacteria 1503
593 Ga0466967_1920744 3300045976 Bacteria 589
594 Ga0495627_022360 3300046453 Bacteria 2081
595 Ga0495591_003976 3300046458 Bacteria 7409
596 Ga0495629_0090393 3300046459 Bacteria 2136
597 Ga0495651_0252364 3300046462 Bacteria 1204
598 Ga0495651_0508719 3300046462 Bacteria 770
599 Ga0495650_0002301 3300046471 Bacteria 15850
600 Ga0495605_0000013 3300046474 Bacteria 308178
601 Ga0495594_0009155 3300046499 Bacteria 5109
602 Ga0495594_0105903 3300046499 Bacteria 1584
603 Ga0495607_0102651 3300046501 Bacteria 1529
604 Ga0495583_0000042 3300046506 Bacteria 234630
605 Ga0495610_0010567 3300046512 Bacteria 5724
606 Ga0495616_0027713 3300046513 Bacteria 3004
607 Ga0495616_0206167 3300046513 Bacteria 862
608 Ga0495620_0000005 3300046515 Bacteria 284456
609 Ga0495628_0275488 3300046516 Bacteria 1251
610 Ga0495630_0617592 3300046517 Bacteria 831
611 Ga0495631_0005085 3300046518 Bacteria 6928
612 Ga0495637_0004482 3300046520 Bacteria 7226
613 Ga0495648_0003365 3300046524 Bacteria 14076
614 Ga0495648_0008447 3300046524 Bacteria 8102
615 Ga0495652_0012589 3300046529 Bacteria 7629
616 Ga0495652_0013775 3300046529 Bacteria 7276
617 Ga0495654_0008924 3300046530 Bacteria 5509
618 Ga0495609_0000266 3300046538 Bacteria 49129
619 Ga0495597_0001238 3300046542 Bacteria 18962
620 Ga0495645_0109625 3300046543 Bacteria 1954
621 Ga0495622_0243135 3300046557 Bacteria 793
622 Ga0495633_0000013 3300046558 Bacteria 262742
623 Ga0495668_0071522 3300046616 Bacteria 1906
624 Ga0495611_0000695 3300046648 Bacteria 19085
625 Ga0495611_0414848 3300046648 Bacteria 615
626 Ga0495661_0000008 3300046665 Bacteria 317971
627 Ga0495646_0001903 3300046680 Bacteria 12547
628 Ga0495647_0000679 3300046681 Bacteria 10146
629 Ga0495658_0005197 3300046683 Bacteria 6401
630 Ga0495669_0051406 3300046684 Bacteria 1849
631 Ga0495624_0208108 3300046690 Bacteria 1187
632 Ga0495670_0002708 3300046691 Bacteria 8750
633 Ga0495670_0168159 3300046691 Bacteria 1154
634 Ga0495671_0038740 3300046692 Bacteria 2408
635 Ga0495589_0000258 3300046794 Bacteria 43340
636 Ga0495660_0003027 3300046810 Bacteria 10485
637 Ga0495683_0000002 3300047323 Bacteria 638279
638 Ga0495687_075157 3300047443 Bacteria 1341
639 Ga0495677_0001724 3300047445 Bacteria 8775
640 Ga0495679_000315 3300047446 Bacteria 38700
641 Ga0495673_0009844 3300047469 Bacteria 5250
642 Ga0495602_0344983 3300048088 Bacteria 1076
643 Ga0496100_1031388 3300048903 Bacteria 647
644 Ga0496101_0675386 3300048904 Bacteria 816
645 Ga0496102_0001273 3300048905 Bacteria 22767
646 Ga0496102_0730626 3300048905 Bacteria 913
647 Ga0496103_0009351 3300048906 Bacteria 5806
648 Ga0496104_0232273 3300048907 Bacteria 1756
649 Ga0496105_0535895 3300048908 Bacteria 915
650 Ga0496106_0001067 3300048909 Bacteria 20209
651 Ga0496107_0009614 3300048910 Bacteria 6705
652 Ga0496110_0769774 3300048913 Bacteria 866
653 Ga0496114_0668223 3300048917 Bacteria 913
654 Ga0496115_0023967 3300048918 Bacteria 4739
655 Ga0496115_0346713 3300048918 Bacteria 1212
656 Ga0496115_0839344 3300048918 Bacteria 712
657 Ga0496116_0157723 3300048919 Bacteria 1250
658 Ga0496117_0169783 3300048920 Bacteria 1267
659 Ga0496118_0045566 3300048921 Bacteria 3421
660 Ga0496118_0485111 3300048921 Bacteria 618
661 Ga0496121_0262066 3300048924 Bacteria 1193
662 Ga0496126_0421180 3300048929 Bacteria 1079
663 Ga0495682_0001351 3300049460 Bacteria 13529
664 Ga0501031_0013941 3300049568 Bacteria 5235
665 Ga0501031_0032491 3300049568 Bacteria 3403
666 Ga0501032_0027352 3300049569 Bacteria 3919
667 Ga0501032_0069791 3300049569 Bacteria 2345
668 Ga0501032_0099543 3300049569 Bacteria 1926
669 Ga0501033_0002118 3300049570 Bacteria 17169
670 Ga0501033_0057451 3300049570 Bacteria 2876
671 Ga0501033_0068162 3300049570 Bacteria 2616
672 Ga0501033_0509900 3300049570 Bacteria 831
673 Ga0501033_0509901 3300049570 Bacteria 831
674 Ga0501033_1189907 3300049570 Bacteria 505
675 Ga0501034_0400607 3300049571 Bacteria 1295
676 Ga0501034_0467859 3300049571 Bacteria 1177
677 Ga0501034_0588509 3300049571 Bacteria 1019
678 Ga0501034_0624293 3300049571 Bacteria 981
679 Ga0501034_1376182 3300049571 Bacteria 581
680 Ga0501036_0029478 3300049572 Bacteria 4634
681 Ga0501036_0163876 3300049572 Bacteria 1874
682 Ga0501036_0300175 3300049572 Bacteria 1343
683 Ga0501037_0045879 3300049573 Bacteria 3207
684 Ga0501037_0108039 3300049573 Bacteria 2005
685 Ga0501037_0118952 3300049573 Bacteria 1900
686 Ga0501037_0183678 3300049573 Bacteria 1483
687 Ga0501038_0007899 3300049574 Bacteria 9807
688 Ga0501038_0338348 3300049574 Bacteria 1174
689 Ga0501038_0369830 3300049574 Bacteria 1114
690 Ga0501038_0619254 3300049574 Bacteria 817
691 Ga0501039_0017899 3300049575 Bacteria 5436
692 Ga0501039_0289805 3300049575 Bacteria 1287
693 Ga0501040_0035522 3300049576 Bacteria 3380
694 Ga0501041_0021329 3300049577 Bacteria 3882
695 Ga0501042_0012392 3300049578 Bacteria 5775
696 Ga0501043_0024618 3300049579 Bacteria 4723
697 Ga0501043_0106643 3300049579 Bacteria 2200
698 Ga0501043_0159297 3300049579 Bacteria 1764
699 Ga0501046_0081537 3300049580 Bacteria 2498
700 Ga0501046_0127161 3300049580 Bacteria 1935
701 Ga0501046_0826346 3300049580 Bacteria 648
702 Ga0501047_0005059 3300049581 Bacteria 12376
703 Ga0501047_0010064 3300049581 Bacteria 8941
704 Ga0501047_0032961 3300049581 Bacteria 5002
705 Ga0501047_0092941 3300049581 Bacteria 2895
706 Ga0501047_0201671 3300049581 Bacteria 1850
707 Ga0501047_0529611 3300049581 Bacteria 1003
708 Ga0501047_0708977 3300049581 Bacteria 823
709 Ga0501048_0039024 3300049582 Bacteria 3407
710 Ga0501048_0202684 3300049582 Bacteria 1406
711 Ga0501048_0584953 3300049582 Bacteria 801
712 Ga0501067_0320169 3300049583 Bacteria 864
713 Ga0501068_0395170 3300049584 Bacteria 891
714 Ga0501069_0035457 3300049585 Bacteria 2749
715 Ga0501069_0119160 3300049585 Bacteria 1507
716 Ga0501069_0146099 3300049585 Bacteria 1357
717 Ga0501070_0000053 3300049586 Bacteria 100509
718 Ga0501070_0066641 3300049586 Bacteria 2982
719 Ga0501070_0108241 3300049586 Bacteria 2296
720 Ga0501070_0155959 3300049586 Bacteria 1882
721 Ga0501070_0406947 3300049586 Bacteria 1100
722 Ga0501070_0423660 3300049586 Bacteria 1075
723 Ga0501071_0003737 3300049587 Bacteria 9561
724 Ga0501071_0082872 3300049587 Bacteria 2349
725 Ga0501073_0000577 3300049589 Bacteria 25884
726 Ga0501073_0028253 3300049589 Bacteria 4008
727 Ga0501073_0068978 3300049589 Bacteria 2464
728 Ga0501073_0409241 3300049589 Bacteria 937
729 Ga0501074_0002371 3300049590 Bacteria 13121
730 Ga0501074_0086083 3300049590 Bacteria 2251
731 Ga0501075_0059024 3300049591 Bacteria 2890
732 Ga0501076_0001771 3300049592 Bacteria 14617
733 Ga0501077_0274497 3300049593 Bacteria 1073
734 Ga0501077_0942644 3300049593 Bacteria 555
735 Ga0501079_0158877 3300049741 Bacteria 1762
736 Ga0501079_0304426 3300049741 Bacteria 1247
737 Ga0501079_1047731 3300049741 Bacteria 643
738 Ga0501079_1231777 3300049741 Bacteria 589
739 Ga0501080_0000938 3300049742 Bacteria 23852
740 Ga0501080_0008441 3300049742 Bacteria 9331
741 Ga0501080_0033586 3300049742 Bacteria 4788
742 Ga0501080_0357717 3300049742 Bacteria 1317
743 Ga0501081_0175732 3300049743 Bacteria 1547
744 Ga0501083_0127633 3300049744 Bacteria 1667
745 Ga0501083_0570553 3300049744 Bacteria 736
746 Ga0501083_0675116 3300049744 Bacteria 672
747 Ga0501035_0002523 3300049822 Bacteria 17906
748 Ga0501035_0013722 3300049822 Bacteria 7477
749 Ga0501035_0013871 3300049822 Bacteria 7436
750 Ga0501035_0034801 3300049822 Bacteria 4576
751 Ga0501035_0075995 3300049822 Bacteria 2970
752 Ga0501035_0165955 3300049822 Bacteria 1909
753 Ga0501035_0708039 3300049822 Bacteria 811
754 Ga0501035_0784644 3300049822 Bacteria 762
755 Ga0501035_0785788 3300049822 Bacteria 761
756 Ga0501044_0007608 3300049823 Bacteria 11911
757 Ga0501044_0009238 3300049823 Bacteria 10767
758 Ga0501044_0080394 3300049823 Bacteria 3302
759 Ga0501044_0264207 3300049823 Bacteria 1658
760 Ga0501044_0288942 3300049823 Bacteria 1571
761 Ga0501044_0397030 3300049823 Bacteria 1292
762 Ga0501044_0786581 3300049823 Bacteria 831
763 Ga0501044_1108284 3300049823 Bacteria 661
764 Ga0501044_1133217 3300049823 Bacteria 651
765 Ga0501045_0014534 3300049824 Bacteria 5580
766 nmdc:mga0yw44_311321_c1 3300050492 Bacteria 1056
767 nmdc:mga0yw44_9502_c1 3300050492 Bacteria 4923
768 nmdc:mga0k408_19569_c1 3300050493 Bacteria 3785
769 nmdc:mga0k408_300878_c1 3300050493 Bacteria 957
770 nmdc:mga06z11_11686_c1 3300050494 Bacteria 3793
771 nmdc:mga06z11_203119_c1 3300050494 Bacteria 1152
772 nmdc:mga07m45_355696_c1 3300050496 Bacteria 851
773 nmdc:mga07m45_77159_c1 3300050496 Bacteria 1900
774 nmdc:mga0qj67_130393_c1 3300050509 Bacteria 2036
775 nmdc:mga0qj67_1316339_c1 3300050509 Bacteria 559
776 nmdc:mga06r32_115354_c1 3300050510 Bacteria 2645
777 nmdc:mga08y16_2349_c1 3300050511 Bacteria 19391
778 nmdc:mga08x19_786066_c1 3300050514 Bacteria 676
779 nmdc:mga0sz30_2167_c1 3300050516 Bacteria 797
780 Ga0500583_0380171 3300053092 Bacteria 680
781 Ga0500566_0181718 3300053094 Bacteria 1078
782 Ga0500641_0053243 3300053096 Bacteria 1670
783 Ga0500560_000059 3300053107 Bacteria 10296
784 Ga0500591_004988 3300053115 Bacteria 5883
785 Ga0500595_015188 3300053119 Bacteria 2894
786 Ga0500595_075447 3300053119 Bacteria 994
787 Ga0500618_011279 3300053125 Bacteria 2374
788 Ga0500655_048237 3300053133 Bacteria 845
789 Ga0500568_0138862 3300053139 Bacteria 901
790 Ga0500573_0476260 3300053140 Bacteria 570
791 Ga0500624_002981 3300053157 Unclassified 2237
792 Ga0500634_0115463 3300053161 Bacteria 1316
793 Ga0501084_0000057 3300054114 Bacteria 87821
794 Ga0501084_0209931 3300054114 Bacteria 1643
795 Ga0501082_1055425 3300060353 Bacteria 710
796 Ga0466962_0033412 3300061719 Bacteria 2460
797 Ga0466962_0313998 3300061719 Bacteria 777
798 Ga0530510_0263186 3300061734 Bacteria 1286

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049593 Ga0501077_0274497 Ga0501077_0274497_67_498 134
2 3300060353 Ga0501082_1055425 Ga0501082_1055425_72_503 134
3 3300005617 Ga0068859_100810213 Ga0068859_1008102132 135
4 3300005617 Ga0068859_100815896 Ga0068859_1008158962 135
5 3300006844 Ga0075428_100027797 Ga0075428_1000277976 135
6 3300006846 Ga0075430_100141423 Ga0075430_1001414232 135
7 3300006847 Ga0075431_100572019 Ga0075431_1005720192 135
8 3300006931 Ga0097620_100810124 Ga0097620_1008101242 135
9 3300006931 Ga0097620_100815662 Ga0097620_1008156622 135
10 3300009177 Ga0105248_10651324 Ga0105248_106513242 135
11 3300026035 Ga0207703_11275298 Ga0207703_112752982 135
12 3300042439 Ga0439464_0222193 Ga0439464_0222193_50_469 135
13 3300050509 nmdc:mga0qj67_130393_c1 nmdc:mga0qj67_130393_c1_402_830 135
14 3300050510 nmdc:mga06r32_115354_c1 nmdc:mga06r32_115354_c1_1800_2228 135
15 3300037418 Ga0395900_0364909 Ga0395900_0364909_310_726 136
16 3300028573 Ga0265334_10149267 Ga0265334_101492671 137
17 3300037471 Ga0395905_0027044 Ga0395905_0027044_662_1081 137
18 3300046459 Ga0495629_0090393 Ga0495629_0090393_1466_1888 137
19 3300046499 Ga0495594_0105903 Ga0495594_0105903_295_717 137
20 3300046513 Ga0495616_0206167 Ga0495616_0206167_418_834 137
21 3300046681 Ga0495647_0000679 Ga0495647_0000679_439_861 137
22 3300046683 Ga0495658_0005197 Ga0495658_0005197_3403_3825 137
23 3300049586 Ga0501070_0423660 Ga0501070_0423660_73_492 137
24 3300005330 Ga0070690_100053060 Ga0070690_1000530603 138
25 3300005334 Ga0068869_100076760 Ga0068869_1000767602 138
26 3300005334 Ga0068869_100163980 Ga0068869_1001639802 138
27 3300005336 Ga0070680_100010536 Ga0070680_1000105365 138
28 3300005337 Ga0070682_100267438 Ga0070682_1002674382 138
29 3300005339 Ga0070660_100097844 Ga0070660_1000978442 138
30 3300005340 Ga0070689_100374048 Ga0070689_1003740483 138
31 3300005341 Ga0070691_10043175 Ga0070691_100431752 138
32 3300005344 Ga0070661_100429640 Ga0070661_1004296401 138
33 3300005345 Ga0070692_10795489 Ga0070692_107954891 138
34 3300005347 Ga0070668_102032730 Ga0070668_1020327301 138
35 3300005353 Ga0070669_100114428 Ga0070669_1001144282 138
36 3300005354 Ga0070675_100032605 Ga0070675_1000326052 138
37 3300005356 Ga0070674_100151761 Ga0070674_1001517612 138
38 3300005366 Ga0070659_100296747 Ga0070659_1002967472 138
39 3300005366 Ga0070659_100577394 Ga0070659_1005773941 138
40 3300005437 Ga0070710_10895294 Ga0070710_108952941 138
41 3300005438 Ga0070701_10005288 Ga0070701_100052882 138
42 3300005441 Ga0070700_100051959 Ga0070700_1000519593 138
43 3300005444 Ga0070694_100577452 Ga0070694_1005774521 138
44 3300005455 Ga0070663_100310914 Ga0070663_1003109142 138
45 3300005456 Ga0070678_100042002 Ga0070678_1000420021 138
46 3300005456 Ga0070678_101033783 Ga0070678_1010337831 138
47 3300005457 Ga0070662_100060905 Ga0070662_1000609051 138
48 3300005457 Ga0070662_100946168 Ga0070662_1009461682 138
49 3300005458 Ga0070681_10000619 Ga0070681_1000061910 138
50 3300005458 Ga0070681_10023617 Ga0070681_100236174 138
51 3300005459 Ga0068867_101912983 Ga0068867_1019129831 138
52 3300005530 Ga0070679_100001372 Ga0070679_1000013725 138
53 3300005530 Ga0070679_100247621 Ga0070679_1002476212 138
54 3300005530 Ga0070679_100707595 Ga0070679_1007075952 138
55 3300005530 Ga0070679_101106443 Ga0070679_1011064431 138
56 3300005539 Ga0068853_100344038 Ga0068853_1003440382 138
57 3300005543 Ga0070672_100087744 Ga0070672_1000877444 138
58 3300005544 Ga0070686_100104196 Ga0070686_1001041963 138
59 3300005544 Ga0070686_100613679 Ga0070686_1006136792 138
60 3300005546 Ga0070696_100057270 Ga0070696_1000572703 138
61 3300005547 Ga0070693_100256165 Ga0070693_1002561652 138
62 3300005548 Ga0070665_100010218 Ga0070665_1000102183 138
63 3300005548 Ga0070665_100281520 Ga0070665_1002815201 138
64 3300005563 Ga0068855_100000956 Ga0068855_10000095619 138
65 3300005563 Ga0068855_100027475 Ga0068855_1000274755 138
66 3300005564 Ga0070664_100441325 Ga0070664_1004413251 138
67 3300005615 Ga0070702_100680859 Ga0070702_1006808591 138
68 3300005616 Ga0068852_100476441 Ga0068852_1004764412 138
69 3300005616 Ga0068852_101017783 Ga0068852_1010177831 138
70 3300005617 Ga0068859_100284700 Ga0068859_1002847001 138
71 3300005618 Ga0068864_100196746 Ga0068864_1001967462 138
72 3300005718 Ga0068866_10027804 Ga0068866_100278044 138
73 3300005719 Ga0068861_100006025 Ga0068861_1000060258 138
74 3300005841 Ga0068863_102267347 Ga0068863_1022673471 138
75 3300005842 Ga0068858_100001633 Ga0068858_10000163324 138
76 3300005842 Ga0068858_100249299 Ga0068858_1002492992 138
77 3300005842 Ga0068858_101282267 Ga0068858_1012822671 138
78 3300005843 Ga0068860_100140375 Ga0068860_1001403753 138
79 3300005844 Ga0068862_100389155 Ga0068862_1003891552 138
80 3300006237 Ga0097621_100165351 Ga0097621_1001653511 138
81 3300006358 Ga0068871_100270213 Ga0068871_1002702132 138
82 3300006881 Ga0068865_100015542 Ga0068865_1000155423 138
83 3300006881 Ga0068865_100729077 Ga0068865_1007290771 138
84 3300006931 Ga0097620_100284700 Ga0097620_1002847001 138
85 3300009093 Ga0105240_10000921 Ga0105240_1000092134 138
86 3300009093 Ga0105240_10009666 Ga0105240_100096664 138
87 3300009093 Ga0105240_10011013 Ga0105240_100110134 138
88 3300009093 Ga0105240_10037794 Ga0105240_100377944 138
89 3300009094 Ga0111539_10029610 Ga0111539_100296102 138
90 3300009098 Ga0105245_10004106 Ga0105245_100041064 138
91 3300009098 Ga0105245_10388007 Ga0105245_103880072 138
92 3300009098 Ga0105245_11270303 Ga0105245_112703031 138
93 3300009101 Ga0105247_10283153 Ga0105247_102831532 138
94 3300009148 Ga0105243_10022806 Ga0105243_100228063 138
95 3300009148 Ga0105243_10164548 Ga0105243_101645482 138
96 3300009148 Ga0105243_12862885 Ga0105243_128628851 138
97 3300009174 Ga0105241_10171401 Ga0105241_101714012 138
98 3300009176 Ga0105242_10168870 Ga0105242_101688701 138
99 3300009545 Ga0105237_10103204 Ga0105237_101032042 138
100 3300009545 Ga0105237_10493869 Ga0105237_104938691 138
101 3300009551 Ga0105238_10002000 Ga0105238_100020005 138
102 3300009551 Ga0105238_10179560 Ga0105238_101795601 138
103 3300009551 Ga0105238_11292256 Ga0105238_112922562 138
104 3300009551 Ga0105238_11729549 Ga0105238_117295492 138
105 3300013102 Ga0157371_10253003 Ga0157371_102530032 138
106 3300013104 Ga0157370_10002265 Ga0157370_1000226521 138
107 3300013104 Ga0157370_10062315 Ga0157370_100623151 138
108 3300013104 Ga0157370_10125803 Ga0157370_101258033 138
109 3300013105 Ga0157369_10013484 Ga0157369_100134842 138
110 3300013105 Ga0157369_10089945 Ga0157369_100899453 138
111 3300013105 Ga0157369_10111259 Ga0157369_101112592 138
112 3300013297 Ga0157378_10459768 Ga0157378_104597682 138
113 3300013306 Ga0163162_10194029 Ga0163162_101940293 138
114 3300013307 Ga0157372_10320359 Ga0157372_103203591 138
115 3300014326 Ga0157380_10033868 Ga0157380_100338683 138
116 3300014968 Ga0157379_10237614 Ga0157379_102376142 138
117 3300020082 Ga0206353_10090608 Ga0206353_100906081 138
118 3300021358 Ga0213873_10000017 Ga0213873_10000017125 138
119 3300021384 Ga0213876_10000071 Ga0213876_1000007112 138
120 3300022467 Ga0224712_10043427 Ga0224712_100434272 138
121 3300025898 Ga0207692_10578583 Ga0207692_105785831 138
122 3300025899 Ga0207642_10012770 Ga0207642_100127703 138
123 3300025909 Ga0207705_11107543 Ga0207705_111075431 138
124 3300025911 Ga0207654_10797396 Ga0207654_107973962 138
125 3300025912 Ga0207707_10000038 Ga0207707_1000003850 138
126 3300025912 Ga0207707_10004902 Ga0207707_100049022 138
127 3300025913 Ga0207695_10003158 Ga0207695_100031584 138
128 3300025913 Ga0207695_10007437 Ga0207695_1000743711 138
129 3300025913 Ga0207695_10008910 Ga0207695_100089106 138
130 3300025914 Ga0207671_10148070 Ga0207671_101480702 138
131 3300025917 Ga0207660_10003261 Ga0207660_100032619 138
132 3300025919 Ga0207657_10290360 Ga0207657_102903602 138
133 3300025921 Ga0207652_10000982 Ga0207652_1000098224 138
134 3300025921 Ga0207652_11119865 Ga0207652_111198652 138
135 3300025924 Ga0207694_10007598 Ga0207694_100075984 138
136 3300025924 Ga0207694_10091217 Ga0207694_100912173 138
137 3300025924 Ga0207694_10708406 Ga0207694_107084062 138
138 3300025925 Ga0207650_10277407 Ga0207650_102774071 138
139 3300025927 Ga0207687_10333770 Ga0207687_103337701 138
140 3300025931 Ga0207644_11540627 Ga0207644_115406271 138
141 3300025933 Ga0207706_10023372 Ga0207706_100233725 138
142 3300025934 Ga0207686_10012916 Ga0207686_100129165 138
143 3300025935 Ga0207709_10068495 Ga0207709_100684952 138
144 3300025936 Ga0207670_10228596 Ga0207670_102285962 138
145 3300025937 Ga0207669_10170158 Ga0207669_101701582 138
146 3300025938 Ga0207704_10128572 Ga0207704_101285723 138
147 3300025942 Ga0207689_10007096 Ga0207689_100070968 138
148 3300025949 Ga0207667_10003312 Ga0207667_1000331213 138
149 3300025949 Ga0207667_10140552 Ga0207667_101405523 138
150 3300025949 Ga0207667_10244059 Ga0207667_102440592 138
151 3300026023 Ga0207677_10082228 Ga0207677_100822283 138
152 3300026035 Ga0207703_10001323 Ga0207703_100013234 138
153 3300026035 Ga0207703_10108979 Ga0207703_101089793 138
154 3300026041 Ga0207639_10992560 Ga0207639_109925602 138
155 3300026067 Ga0207678_10817716 Ga0207678_108177161 138
156 3300026075 Ga0207708_10000385 Ga0207708_1000038527 138
157 3300026088 Ga0207641_11973808 Ga0207641_119738081 138
158 3300026089 Ga0207648_10001978 Ga0207648_100019782 138
159 3300026118 Ga0207675_100002060 Ga0207675_1000020602 138
160 3300026121 Ga0207683_10032154 Ga0207683_100321542 138
161 3300026142 Ga0207698_11530545 Ga0207698_115305452 138
162 3300027907 Ga0207428_10007500 Ga0207428_100075004 138
163 3300028380 Ga0268265_10504177 Ga0268265_105041771 138
164 3300028380 Ga0268265_10520551 Ga0268265_105205512 138
165 3300028380 Ga0268265_10627683 Ga0268265_106276832 138
166 3300028381 Ga0268264_10119750 Ga0268264_101197501 138
167 3300030521 Ga0307511_10003572 Ga0307511_100035724 138
168 3300031242 Ga0265329_10304338 Ga0265329_103043381 138
169 3300031507 Ga0307509_10000056 Ga0307509_1000005672 138
170 3300031548 Ga0307408_100169980 Ga0307408_1001699802 138
171 3300031548 Ga0307408_100301796 Ga0307408_1003017962 138
172 3300031691 Ga0316579_10020119 Ga0316579_100201193 138
173 3300031712 Ga0265342_10007158 Ga0265342_1000715810 138
174 3300031731 Ga0307405_10691972 Ga0307405_106919721 138
175 3300031731 Ga0307405_10904265 Ga0307405_109042652 138
176 3300031824 Ga0307413_10575506 Ga0307413_105755062 138
177 3300031824 Ga0307413_10595082 Ga0307413_105950822 138
178 3300031852 Ga0307410_11261606 Ga0307410_112616062 138
179 3300031901 Ga0307406_10182563 Ga0307406_101825633 138
180 3300031901 Ga0307406_10812075 Ga0307406_108120751 138
181 3300031911 Ga0307412_10842833 Ga0307412_108428332 138
182 3300031995 Ga0307409_100486041 Ga0307409_1004860412 138
183 3300032002 Ga0307416_101188248 Ga0307416_1011882481 138
184 3300032004 Ga0307414_10150578 Ga0307414_101505784 138
185 3300032004 Ga0307414_10443828 Ga0307414_104438281 138
186 3300032004 Ga0307414_11672758 Ga0307414_116727581 138
187 3300032005 Ga0307411_10045331 Ga0307411_100453312 138
188 3300032126 Ga0307415_100176907 Ga0307415_1001769072 138
189 3300035113 Ga0373936_0000887 Ga0373936_0000887_4691_5125 138
190 3300036647 Ga0316582_0002570 Ga0316582_0002570_3431_3853 138
191 3300037312 Ga0395899_0181544 Ga0395899_0181544_770_1189 138
192 3300037418 Ga0395900_0341354 Ga0395900_0341354_266_688 138
193 3300037418 Ga0395900_0745310 Ga0395900_0745310_446_868 138
194 3300037471 Ga0395905_0448623 Ga0395905_0448623_16_438 138
195 3300037853 Ga0436364_0186181 Ga0436364_0186181_82_516 138
196 3300044694 Ga0466963_0037987 Ga0466963_0037987_2292_2711 138
197 3300044842 Ga0466957_0113287 Ga0466957_0113287_701_1120 138
198 3300044842 Ga0466957_0214515 Ga0466957_0214515_268_690 138
199 3300045976 Ga0466967_0028685 Ga0466967_0028685_1872_2291 138
200 3300045976 Ga0466967_0180842 Ga0466967_0180842_628_1050 138
201 3300045976 Ga0466967_0317091 Ga0466967_0317091_561_980 138
202 3300046684 Ga0495669_0051406 Ga0495669_0051406_441_863 138
203 3300046691 Ga0495670_0168159 Ga0495670_0168159_701_1120 138
204 3300047445 Ga0495677_0001724 Ga0495677_0001724_6968_7390 138
205 3300049744 Ga0501083_0127633 Ga0501083_0127633_738_1154 138
206 3300050511 nmdc:mga08y16_2349_c1 nmdc:mga08y16_2349_c1_3737_4156 138
207 3300053094 Ga0500566_0181718 Ga0500566_0181718_545_964 138
208 3300053096 Ga0500641_0053243 Ga0500641_0053243_813_1232 138
209 3300053115 Ga0500591_004988 Ga0500591_004988_2593_3027 138
210 3300053119 Ga0500595_015188 Ga0500595_015188_1056_1472 138
211 3300053139 Ga0500568_0138862 Ga0500568_0138862_292_711 138
212 3300061719 Ga0466962_0313998 Ga0466962_0313998_339_761 138
213 iso_pu_bacteria 2510917022 2511134251 138
214 iso_pu_bacteria 2582581307 2585271740 138
215 iso_pu_bacteria 2585427531 2585563020 138
216 iso_pu_bacteria 2585427608 2585902903 138
217 iso_pu_bacteria 2585427609 2585907235 138
218 iso_pu_bacteria 2585428125 2587982771 138
219 iso_pu_bacteria 2667528174 2671113426 138
220 iso_pu_bacteria 2838029111 2838030985 138
221 iso_pu_bacteria 2842475841 2842477717 138
222 iso_pu_bacteria 2842502639 2842504411 138
223 iso_pu_bacteria 2919408235 2919411117 138
224 iso_pu_bacteria 3005416602 3005421571 138
225 iso_pu_bacteria 8005314921 8005319726 138
226 3300005327 Ga0070658_10000040 Ga0070658_1000004049 139
227 3300005328 Ga0070676_11007084 Ga0070676_110070841 139
228 3300005336 Ga0070680_100015864 Ga0070680_1000158643 139
229 3300005338 Ga0068868_100000047 Ga0068868_10000004742 139
230 3300005339 Ga0070660_100002023 Ga0070660_1000020236 139
231 3300005339 Ga0070660_100014626 Ga0070660_1000146264 139
232 3300005339 Ga0070660_100015658 Ga0070660_1000156583 139
233 3300005339 Ga0070660_100065200 Ga0070660_1000652002 139
234 3300005339 Ga0070660_101186455 Ga0070660_1011864552 139
235 3300005340 Ga0070689_100002871 Ga0070689_1000028711 139
236 3300005344 Ga0070661_100000324 Ga0070661_10000032413 139
237 3300005345 Ga0070692_10000687 Ga0070692_100006878 139
238 3300005345 Ga0070692_10020047 Ga0070692_100200472 139
239 3300005353 Ga0070669_101872207 Ga0070669_1018722071 139
240 3300005354 Ga0070675_100116424 Ga0070675_1001164244 139
241 3300005366 Ga0070659_100000022 Ga0070659_100000022138 139
242 3300005366 Ga0070659_100004108 Ga0070659_1000041084 139
243 3300005366 Ga0070659_100006002 Ga0070659_1000060023 139
244 3300005366 Ga0070659_100024020 Ga0070659_1000240204 139
245 3300005445 Ga0070708_101046461 Ga0070708_1010464612 139
246 3300005458 Ga0070681_10005369 Ga0070681_1000536910 139
247 3300005530 Ga0070679_100000001 Ga0070679_100000001636 139
248 3300005530 Ga0070679_100008154 Ga0070679_1000081545 139
249 3300005546 Ga0070696_100280670 Ga0070696_1002806703 139
250 3300005548 Ga0070665_100002152 Ga0070665_10000215212 139
251 3300005548 Ga0070665_101386176 Ga0070665_1013861761 139
252 3300005563 Ga0068855_100066277 Ga0068855_1000662772 139
253 3300005563 Ga0068855_100143593 Ga0068855_1001435932 139
254 3300005563 Ga0068855_100332242 Ga0068855_1003322422 139
255 3300005563 Ga0068855_101387804 Ga0068855_1013878041 139
256 3300005577 Ga0068857_101408747 Ga0068857_1014087471 139
257 3300005614 Ga0068856_100103897 Ga0068856_1001038972 139
258 3300005618 Ga0068864_100062043 Ga0068864_1000620434 139
259 3300005719 Ga0068861_100884061 Ga0068861_1008840611 139
260 3300005985 Ga0081539_10101654 Ga0081539_101016543 139
261 3300006177 Ga0075362_10125285 Ga0075362_101252852 139
262 3300009093 Ga0105240_10049795 Ga0105240_100497952 139
263 3300009093 Ga0105240_10115601 Ga0105240_101156013 139
264 3300009094 Ga0111539_13302298 Ga0111539_133022981 139
265 3300009098 Ga0105245_10268467 Ga0105245_102684672 139
266 3300009174 Ga0105241_11672125 Ga0105241_116721251 139
267 3300009177 Ga0105248_10000517 Ga0105248_100005174 139
268 3300009551 Ga0105238_10000586 Ga0105238_100005866 139
269 3300009551 Ga0105238_10039822 Ga0105238_100398225 139
270 3300009551 Ga0105238_10164405 Ga0105238_101644051 139
271 3300013100 Ga0157373_11298797 Ga0157373_112987971 139
272 3300013104 Ga0157370_10157325 Ga0157370_101573252 139
273 3300013105 Ga0157369_10006105 Ga0157369_1000610512 139
274 3300013105 Ga0157369_10782153 Ga0157369_107821532 139
275 3300021384 Ga0213876_10000261 Ga0213876_1000026127 139
276 3300025901 Ga0207688_10433009 Ga0207688_104330092 139
277 3300025909 Ga0207705_10000002 Ga0207705_10000002187 139
278 3300025909 Ga0207705_10001024 Ga0207705_100010247 139
279 3300025912 Ga0207707_10028844 Ga0207707_100288445 139
280 3300025912 Ga0207707_10046389 Ga0207707_100463892 139
281 3300025913 Ga0207695_10000572 Ga0207695_1000057256 139
282 3300025913 Ga0207695_10058882 Ga0207695_100588825 139
283 3300025913 Ga0207695_10194197 Ga0207695_101941972 139
284 3300025917 Ga0207660_10001700 Ga0207660_100017004 139
285 3300025917 Ga0207660_10003203 Ga0207660_100032036 139
286 3300025919 Ga0207657_10000381 Ga0207657_1000038144 139
287 3300025919 Ga0207657_10002098 Ga0207657_100020988 139
288 3300025919 Ga0207657_10005748 Ga0207657_100057487 139
289 3300025919 Ga0207657_10019686 Ga0207657_100196863 139
290 3300025919 Ga0207657_10115822 Ga0207657_101158222 139
291 3300025919 Ga0207657_10768392 Ga0207657_107683922 139
292 3300025920 Ga0207649_10000256 Ga0207649_1000025629 139
293 3300025921 Ga0207652_10000003 Ga0207652_10000003232 139
294 3300025923 Ga0207681_11436749 Ga0207681_114367491 139
295 3300025924 Ga0207694_10005147 Ga0207694_100051476 139
296 3300025924 Ga0207694_10077991 Ga0207694_100779912 139
297 3300025924 Ga0207694_10146946 Ga0207694_101469462 139
298 3300025924 Ga0207694_10452873 Ga0207694_104528732 139
299 3300025924 Ga0207694_10707555 Ga0207694_107075551 139
300 3300025927 Ga0207687_10002318 Ga0207687_1000231813 139
301 3300025927 Ga0207687_10073643 Ga0207687_100736432 139
302 3300025929 Ga0207664_10339887 Ga0207664_103398872 139
303 3300025932 Ga0207690_10000003 Ga0207690_10000003783 139
304 3300025932 Ga0207690_10001039 Ga0207690_100010394 139
305 3300025932 Ga0207690_10002314 Ga0207690_100023144 139
306 3300025932 Ga0207690_10463299 Ga0207690_104632991 139
307 3300025936 Ga0207670_10004220 Ga0207670_100042205 139
308 3300025938 Ga0207704_10003198 Ga0207704_100031986 139
309 3300025941 Ga0207711_10001000 Ga0207711_100010004 139
310 3300025941 Ga0207711_10903234 Ga0207711_109032342 139
311 3300025949 Ga0207667_10004668 Ga0207667_100046686 139
312 3300025981 Ga0207640_10804050 Ga0207640_108040502 139
313 3300026023 Ga0207677_10000107 Ga0207677_1000010727 139
314 3300026023 Ga0207677_11113237 Ga0207677_111132372 139
315 3300026041 Ga0207639_10513925 Ga0207639_105139252 139
316 3300026078 Ga0207702_10102556 Ga0207702_101025562 139
317 3300026078 Ga0207702_10228993 Ga0207702_102289932 139
318 3300026088 Ga0207641_10754322 Ga0207641_107543222 139
319 3300026089 Ga0207648_10570654 Ga0207648_105706542 139
320 3300026095 Ga0207676_10028277 Ga0207676_100282774 139
321 3300026116 Ga0207674_10235219 Ga0207674_102352191 139
322 3300026118 Ga0207675_101311513 Ga0207675_1013115132 139
323 3300027543 Ga0209999_1004974 Ga0209999_10049742 139
324 3300028379 Ga0268266_10002109 Ga0268266_1000210912 139
325 3300028379 Ga0268266_10137854 Ga0268266_101378542 139
326 3300028786 Ga0307517_10001402 Ga0307517_100014025 139
327 3300031456 Ga0307513_10008370 Ga0307513_1000837014 139
328 3300031548 Ga0307408_100896427 Ga0307408_1008964272 139
329 3300031548 Ga0307408_100904355 Ga0307408_1009043552 139
330 3300031824 Ga0307413_10781636 Ga0307413_107816362 139
331 3300031824 Ga0307413_11507632 Ga0307413_115076321 139
332 3300031852 Ga0307410_10151567 Ga0307410_101515672 139
333 3300031911 Ga0307412_10328513 Ga0307412_103285132 139
334 3300032002 Ga0307416_101179386 Ga0307416_1011793861 139
335 3300032004 Ga0307414_10060944 Ga0307414_100609444 139
336 3300032005 Ga0307411_10245813 Ga0307411_102458132 139
337 3300032126 Ga0307415_100288849 Ga0307415_1002888492 139
338 3300033180 Ga0307510_10002995 Ga0307510_1000299516 139
339 3300036401 Ga0373937_0396323 Ga0373937_0396323_804_1223 139
340 3300037418 Ga0395900_0111949 Ga0395900_0111949_948_1367 139
341 3300037418 Ga0395900_0173674 Ga0395900_0173674_1548_1967 139
342 3300037418 Ga0395900_1712055 Ga0395900_1712055_24_443 139
343 3300037466 Ga0395898_0155514 Ga0395898_0155514_948_1367 139
344 3300037471 Ga0395905_0001727 Ga0395905_0001727_15990_16409 139
345 3300037471 Ga0395905_0195730 Ga0395905_0195730_158_577 139
346 3300037471 Ga0395905_0553544 Ga0395905_0553544_514_933 139
347 3300037471 Ga0395905_0671168 Ga0395905_0671168_323_742 139
348 3300038443 Ga0395901_0143930 Ga0395901_0143930_1419_1838 139
349 3300038443 Ga0395901_0576994 Ga0395901_0576994_492_911 139
350 3300039437 Ga0436365_0646826 Ga0436365_0646826_12188_12706 139
351 3300039437 Ga0436365_1685576 Ga0436365_1685576_28415_28846 139
352 3300039453 Ga0436362_1094363 Ga0436362_1094363_25016_25534 139
353 3300041999 Ga0439433_0075409 Ga0439433_0075409_14_436 139
354 3300042003 Ga0439443_001002 Ga0439443_001002_1282_1716 139
355 3300042004 Ga0439445_0139123 Ga0439445_0139123_196_618 139
356 3300044693 Ga0466961_0264291 Ga0466961_0264291_535_954 139
357 3300044765 Ga0466970_0267268 Ga0466970_0267268_105_524 139
358 3300044842 Ga0466957_0655971 Ga0466957_0655971_69_488 139
359 3300045836 Ga0466958_0561780 Ga0466958_0561780_54_473 139
360 3300046517 Ga0495630_0617592 Ga0495630_0617592_129_548 139
361 3300046616 Ga0495668_0071522 Ga0495668_0071522_1403_1822 139
362 3300046648 Ga0495611_0414848 Ga0495611_0414848_121_540 139
363 3300047443 Ga0495687_075157 Ga0495687_075157_290_757 139
364 3300048918 Ga0496115_0839344 Ga0496115_0839344_262_681 139
365 3300048929 Ga0496126_0421180 Ga0496126_0421180_328_756 139
366 3300049570 Ga0501033_0057451 Ga0501033_0057451_2381_2806 139
367 3300049571 Ga0501034_0588509 Ga0501034_0588509_317_739 139
368 3300049571 Ga0501034_1376182 Ga0501034_1376182_56_481 139
369 3300049581 Ga0501047_0005059 Ga0501047_0005059_10970_11389 139
370 3300049581 Ga0501047_0032961 Ga0501047_0032961_1006_1425 139
371 3300049583 Ga0501067_0320169 Ga0501067_0320169_37_456 139
372 3300049586 Ga0501070_0406947 Ga0501070_0406947_67_486 139
373 3300049589 Ga0501073_0000577 Ga0501073_0000577_237_656 139
374 3300049741 Ga0501079_1047731 Ga0501079_1047731_40_459 139
375 3300049742 Ga0501080_0357717 Ga0501080_0357717_801_1220 139
376 3300049744 Ga0501083_0570553 Ga0501083_0570553_170_589 139
377 3300049823 Ga0501044_0009238 Ga0501044_0009238_2066_2491 139
378 3300049823 Ga0501044_1133217 Ga0501044_1133217_51_470 139
379 3300050492 nmdc:mga0yw44_311321_c1 nmdc:mga0yw44_311321_c1_163_582 139
380 3300050496 nmdc:mga07m45_355696_c1 nmdc:mga07m45_355696_c1_83_502 139
381 3300050496 nmdc:mga07m45_77159_c1 nmdc:mga07m45_77159_c1_993_1418 139
382 3300053119 Ga0500595_075447 Ga0500595_075447_342_761 139
383 3300053140 Ga0500573_0476260 Ga0500573_0476260_129_551 139
384 iso_pu_bacteria 2885198086 2885198427 139
385 iso_pu_bacteria 2885211737 2885212193 139
386 3300005337 Ga0070682_100639942 Ga0070682_1006399422 140
387 3300005338 Ga0068868_100011443 Ga0068868_1000114431 140
388 3300005339 Ga0070660_100147532 Ga0070660_1001475323 140
389 3300005341 Ga0070691_10050970 Ga0070691_100509702 140
390 3300005344 Ga0070661_100026806 Ga0070661_1000268063 140
391 3300005344 Ga0070661_100127933 Ga0070661_1001279332 140
392 3300005345 Ga0070692_10197341 Ga0070692_101973412 140
393 3300005366 Ga0070659_100467732 Ga0070659_1004677322 140
394 3300005367 Ga0070667_101382658 Ga0070667_1013826582 140
395 3300005439 Ga0070711_100250448 Ga0070711_1002504482 140
396 3300005455 Ga0070663_100434196 Ga0070663_1004341962 140
397 3300005457 Ga0070662_101505701 Ga0070662_1015057011 140
398 3300005458 Ga0070681_10073821 Ga0070681_100738211 140
399 3300005458 Ga0070681_10483961 Ga0070681_104839612 140
400 3300005530 Ga0070679_100059123 Ga0070679_1000591232 140
401 3300005535 Ga0070684_100294259 Ga0070684_1002942591 140
402 3300005546 Ga0070696_100046350 Ga0070696_1000463503 140
403 3300005563 Ga0068855_100000106 Ga0068855_10000010681 140
404 3300005563 Ga0068855_101109377 Ga0068855_1011093772 140
405 3300005563 Ga0068855_101560316 Ga0068855_1015603162 140
406 3300005578 Ga0068854_100309607 Ga0068854_1003096072 140
407 3300005616 Ga0068852_100000530 Ga0068852_10000053021 140
408 3300005616 Ga0068852_100002997 Ga0068852_1000029977 140
409 3300005616 Ga0068852_100003598 Ga0068852_1000035986 140
410 3300005616 Ga0068852_100175210 Ga0068852_1001752102 140
411 3300005834 Ga0068851_10007934 Ga0068851_100079343 140
412 3300005844 Ga0068862_100800077 Ga0068862_1008000772 140
413 3300006175 Ga0070712_100367870 Ga0070712_1003678702 140
414 3300006237 Ga0097621_100021803 Ga0097621_1000218032 140
415 3300006358 Ga0068871_100063796 Ga0068871_1000637962 140
416 3300006914 Ga0075436_100266682 Ga0075436_1002666822 140
417 3300009093 Ga0105240_10000055 Ga0105240_1000005525 140
418 3300009093 Ga0105240_10369042 Ga0105240_103690423 140
419 3300009101 Ga0105247_10005627 Ga0105247_100056276 140
420 3300009101 Ga0105247_10007480 Ga0105247_100074804 140
421 3300009174 Ga0105241_10016353 Ga0105241_100163534 140
422 3300009545 Ga0105237_10019700 Ga0105237_100197002 140
423 3300009551 Ga0105238_10026575 Ga0105238_100265755 140
424 3300009553 Ga0105249_10744857 Ga0105249_107448572 140
425 3300013100 Ga0157373_10209947 Ga0157373_102099472 140
426 3300013102 Ga0157371_10050825 Ga0157371_100508252 140
427 3300013102 Ga0157371_10133910 Ga0157371_101339102 140
428 3300013102 Ga0157371_10843690 Ga0157371_108436901 140
429 3300013104 Ga0157370_10131847 Ga0157370_101318472 140
430 3300013104 Ga0157370_11335202 Ga0157370_113352022 140
431 3300013105 Ga0157369_10010911 Ga0157369_100109114 140
432 3300013105 Ga0157369_10023221 Ga0157369_100232216 140
433 3300013307 Ga0157372_10004312 Ga0157372_1000431210 140
434 3300013307 Ga0157372_10178613 Ga0157372_101786132 140
435 3300013307 Ga0157372_10230071 Ga0157372_102300712 140
436 3300013307 Ga0157372_10377675 Ga0157372_103776752 140
437 3300013307 Ga0157372_11125113 Ga0157372_111251132 140
438 3300014497 Ga0182008_10051455 Ga0182008_100514552 140
439 3300020070 Ga0206356_11270598 Ga0206356_112705981 140
440 3300020081 Ga0206354_10201683 Ga0206354_102016831 140
441 3300021384 Ga0213876_10000274 Ga0213876_1000027448 140
442 3300025321 Ga0207656_10043977 Ga0207656_100439773 140
443 3300025898 Ga0207692_10126949 Ga0207692_101269492 140
444 3300025900 Ga0207710_10002645 Ga0207710_100026453 140
445 3300025900 Ga0207710_10046203 Ga0207710_100462033 140
446 3300025909 Ga0207705_10075570 Ga0207705_100755702 140
447 3300025911 Ga0207654_10019838 Ga0207654_100198383 140
448 3300025913 Ga0207695_10000012 Ga0207695_10000012311 140
449 3300025913 Ga0207695_10043747 Ga0207695_100437474 140
450 3300025913 Ga0207695_10288658 Ga0207695_102886582 140
451 3300025916 Ga0207663_10421711 Ga0207663_104217112 140
452 3300025917 Ga0207660_10471806 Ga0207660_104718062 140
453 3300025919 Ga0207657_10089749 Ga0207657_100897492 140
454 3300025919 Ga0207657_10131410 Ga0207657_101314102 140
455 3300025920 Ga0207649_10017732 Ga0207649_100177324 140
456 3300025920 Ga0207649_10060105 Ga0207649_100601054 140
457 3300025920 Ga0207649_10247789 Ga0207649_102477892 140
458 3300025921 Ga0207652_10199177 Ga0207652_101991773 140
459 3300025924 Ga0207694_10000006 Ga0207694_10000006354 140
460 3300025929 Ga0207664_11429295 Ga0207664_114292951 140
461 3300025932 Ga0207690_10029512 Ga0207690_100295125 140
462 3300025932 Ga0207690_10164241 Ga0207690_101642413 140
463 3300025941 Ga0207711_10036878 Ga0207711_100368783 140
464 3300025944 Ga0207661_10056398 Ga0207661_100563984 140
465 3300025949 Ga0207667_10000026 Ga0207667_1000002654 140
466 3300025949 Ga0207667_10193016 Ga0207667_101930162 140
467 3300025949 Ga0207667_11435319 Ga0207667_114353192 140
468 3300025981 Ga0207640_10035158 Ga0207640_100351582 140
469 3300026023 Ga0207677_10061851 Ga0207677_100618512 140
470 3300026041 Ga0207639_10001218 Ga0207639_100012184 140
471 3300026067 Ga0207678_10100896 Ga0207678_101008962 140
472 3300026142 Ga0207698_10001893 Ga0207698_100018939 140
473 3300026142 Ga0207698_10005482 Ga0207698_100054827 140
474 3300026142 Ga0207698_10025195 Ga0207698_100251953 140
475 3300026142 Ga0207698_10116334 Ga0207698_101163341 140
476 3300027876 Ga0209974_10020533 Ga0209974_100205333 140
477 3300027876 Ga0209974_10079207 Ga0209974_100792072 140
478 3300028380 Ga0268265_10111341 Ga0268265_101113412 140
479 3300028800 Ga0265338_10330923 Ga0265338_103309232 140
480 3300031665 Ga0316575_10023402 Ga0316575_100234022 140
481 3300031665 Ga0316575_10410939 Ga0316575_104109391 140
482 3300031730 Ga0307516_10047728 Ga0307516_100477282 140
483 3300031731 Ga0307405_10025432 Ga0307405_100254323 140
484 3300031824 Ga0307413_10070066 Ga0307413_100700662 140
485 3300031852 Ga0307410_10182545 Ga0307410_101825452 140
486 3300031852 Ga0307410_10521906 Ga0307410_105219061 140
487 3300031901 Ga0307406_10020369 Ga0307406_100203693 140
488 3300031903 Ga0307407_10067403 Ga0307407_100674032 140
489 3300031911 Ga0307412_10327413 Ga0307412_103274132 140
490 3300031995 Ga0307409_100034586 Ga0307409_1000345863 140
491 3300032002 Ga0307416_100007443 Ga0307416_1000074436 140
492 3300032002 Ga0307416_100449034 Ga0307416_1004490342 140
493 3300032005 Ga0307411_10025273 Ga0307411_100252732 140
494 3300032126 Ga0307415_100001602 Ga0307415_1000016027 140
495 3300032126 Ga0307415_100585560 Ga0307415_1005855601 140
496 3300035242 Ga0373962_0210662 Ga0373962_0210662_11_433 140
497 3300035695 Ga0373927_0362630 Ga0373927_0362630_79_501 140
498 3300035724 Ga0373933_0440330 Ga0373933_0440330_61_483 140
499 3300037418 Ga0395900_0002169 Ga0395900_0002169_10179_10601 140
500 3300039437 Ga0436365_0257402 Ga0436365_0257402_117647_118069 140
501 3300041408 Ga0439453_0089630 Ga0439453_0089630_175_600 140
502 3300041410 Ga0439461_0128858 Ga0439461_0128858_85_510 140
503 3300041997 Ga0439431_0006863 Ga0439431_0006863_778_1203 140
504 3300041999 Ga0439433_0024280 Ga0439433_0024280_13_438 140
505 3300042001 Ga0439441_068626 Ga0439441_068626_118_543 140
506 3300042009 Ga0439451_078934 Ga0439451_078934_180_605 140
507 3300042116 Ga0450912_000880 Ga0450912_000880_946_1371 140
508 3300042122 Ga0450920_012034 Ga0450920_012034_112_537 140
509 3300042123 Ga0450921_008756 Ga0450921_008756_152_577 140
510 3300042124 Ga0450922_003671 Ga0450922_003671_328_753 140
511 3300042125 Ga0450923_001983 Ga0450923_001983_1329_1754 140
512 3300042130 Ga0450892_023010 Ga0450892_023010_113_538 140
513 3300042131 Ga0450894_002478 Ga0450894_002478_1334_1759 140
514 3300042133 Ga0450896_005989 Ga0450896_005989_745_1170 140
515 3300042133 Ga0450896_020051 Ga0450896_020051_328_753 140
516 3300042134 Ga0450898_012904 Ga0450898_012904_353_778 140
517 3300042145 Ga0450906_012176 Ga0450906_012176_21_446 140
518 3300042146 Ga0450907_008643 Ga0450907_008643_213_638 140
519 3300042156 Ga0439446_0008772 Ga0439446_0008772_2185_2610 140
520 3300042184 Ga0450908_000818 Ga0450908_000818_2387_2812 140
521 3300042435 Ga0439434_0005621 Ga0439434_0005621_1039_1464 140
522 3300042436 Ga0439435_0000323 Ga0439435_0000323_6337_6762 140
523 3300042437 Ga0439444_0002954 Ga0439444_0002954_535_960 140
524 3300042461 Ga0439460_0027919 Ga0439460_0027919_190_615 140
525 3300044765 Ga0466970_0011768 Ga0466970_0011768_1650_2072 140
526 3300045049 Ga0466959_0011577 Ga0466959_0011577_140_562 140
527 3300045976 Ga0466967_1920744 Ga0466967_1920744_94_516 140
528 3300046462 Ga0495651_0508719 Ga0495651_0508719_78_500 140
529 3300046516 Ga0495628_0275488 Ga0495628_0275488_556_978 140
530 3300046524 Ga0495648_0008447 Ga0495648_0008447_5606_6028 140
531 3300046529 Ga0495652_0012589 Ga0495652_0012589_4921_5343 140
532 3300046529 Ga0495652_0013775 Ga0495652_0013775_476_907 140
533 3300046543 Ga0495645_0109625 Ga0495645_0109625_414_836 140
534 3300046557 Ga0495622_0243135 Ga0495622_0243135_76_498 140
535 3300046680 Ga0495646_0001903 Ga0495646_0001903_458_880 140
536 3300046690 Ga0495624_0208108 Ga0495624_0208108_601_1023 140
537 3300048088 Ga0495602_0344983 Ga0495602_0344983_97_519 140
538 3300048904 Ga0496101_0675386 Ga0496101_0675386_266_688 140
539 3300048918 Ga0496115_0023967 Ga0496115_0023967_3073_3495 140
540 3300048924 Ga0496121_0262066 Ga0496121_0262066_116_538 140
541 3300049460 Ga0495682_0001351 Ga0495682_0001351_742_1164 140
542 3300049568 Ga0501031_0013941 Ga0501031_0013941_3472_3897 140
543 3300049568 Ga0501031_0032491 Ga0501031_0032491_1019_1441 140
544 3300049569 Ga0501032_0027352 Ga0501032_0027352_328_753 140
545 3300049569 Ga0501032_0069791 Ga0501032_0069791_386_808 140
546 3300049569 Ga0501032_0099543 Ga0501032_0099543_795_1217 140
547 3300049570 Ga0501033_0002118 Ga0501033_0002118_2780_3202 140
548 3300049570 Ga0501033_0068162 Ga0501033_0068162_154_576 140
549 3300049570 Ga0501033_0509900 Ga0501033_0509900_311_733 140
550 3300049570 Ga0501033_0509901 Ga0501033_0509901_99_521 140
551 3300049570 Ga0501033_1189907 Ga0501033_1189907_56_478 140
552 3300049571 Ga0501034_0400607 Ga0501034_0400607_348_773 140
553 3300049571 Ga0501034_0467859 Ga0501034_0467859_146_568 140
554 3300049571 Ga0501034_0624293 Ga0501034_0624293_535_957 140
555 3300049572 Ga0501036_0029478 Ga0501036_0029478_2055_2480 140
556 3300049572 Ga0501036_0163876 Ga0501036_0163876_392_814 140
557 3300049572 Ga0501036_0300175 Ga0501036_0300175_109_531 140
558 3300049573 Ga0501037_0045879 Ga0501037_0045879_482_904 140
559 3300049573 Ga0501037_0108039 Ga0501037_0108039_1532_1954 140
560 3300049573 Ga0501037_0118952 Ga0501037_0118952_271_693 140
561 3300049573 Ga0501037_0183678 Ga0501037_0183678_203_718 140
562 3300049574 Ga0501038_0007899 Ga0501038_0007899_1374_1799 140
563 3300049574 Ga0501038_0338348 Ga0501038_0338348_54_476 140
564 3300049574 Ga0501038_0369830 Ga0501038_0369830_230_652 140
565 3300049574 Ga0501038_0619254 Ga0501038_0619254_180_602 140
566 3300049575 Ga0501039_0017899 Ga0501039_0017899_4228_4653 140
567 3300049575 Ga0501039_0289805 Ga0501039_0289805_364_786 140
568 3300049576 Ga0501040_0035522 Ga0501040_0035522_2707_3132 140
569 3300049577 Ga0501041_0021329 Ga0501041_0021329_3130_3555 140
570 3300049578 Ga0501042_0012392 Ga0501042_0012392_3197_3622 140
571 3300049579 Ga0501043_0024618 Ga0501043_0024618_708_1130 140
572 3300049579 Ga0501043_0106643 Ga0501043_0106643_1324_1746 140
573 3300049579 Ga0501043_0159297 Ga0501043_0159297_924_1346 140
574 3300049580 Ga0501046_0081537 Ga0501046_0081537_1417_1839 140
575 3300049580 Ga0501046_0127161 Ga0501046_0127161_163_585 140
576 3300049580 Ga0501046_0826346 Ga0501046_0826346_180_602 140
577 3300049581 Ga0501047_0010064 Ga0501047_0010064_5106_5528 140
578 3300049581 Ga0501047_0092941 Ga0501047_0092941_555_1070 140
579 3300049581 Ga0501047_0201671 Ga0501047_0201671_905_1327 140
580 3300049581 Ga0501047_0529611 Ga0501047_0529611_271_693 140
581 3300049581 Ga0501047_0708977 Ga0501047_0708977_91_513 140
582 3300049582 Ga0501048_0039024 Ga0501048_0039024_2853_3278 140
583 3300049582 Ga0501048_0202684 Ga0501048_0202684_793_1215 140
584 3300049582 Ga0501048_0584953 Ga0501048_0584953_37_459 140
585 3300049584 Ga0501068_0395170 Ga0501068_0395170_430_852 140
586 3300049585 Ga0501069_0035457 Ga0501069_0035457_287_709 140
587 3300049585 Ga0501069_0146099 Ga0501069_0146099_67_582 140
588 3300049586 Ga0501070_0000053 Ga0501070_0000053_5681_6103 140
589 3300049586 Ga0501070_0066641 Ga0501070_0066641_62_484 140
590 3300049586 Ga0501070_0108241 Ga0501070_0108241_1331_1849 140
591 3300049586 Ga0501070_0155959 Ga0501070_0155959_425_940 140
592 3300049587 Ga0501071_0003737 Ga0501071_0003737_900_1325 140
593 3300049587 Ga0501071_0082872 Ga0501071_0082872_589_1104 140
594 3300049589 Ga0501073_0028253 Ga0501073_0028253_576_998 140
595 3300049589 Ga0501073_0068978 Ga0501073_0068978_592_1110 140
596 3300049589 Ga0501073_0409241 Ga0501073_0409241_283_708 140
597 3300049590 Ga0501074_0002371 Ga0501074_0002371_11964_12482 140
598 3300049590 Ga0501074_0086083 Ga0501074_0086083_152_667 140
599 3300049591 Ga0501075_0059024 Ga0501075_0059024_584_1009 140
600 3300049592 Ga0501076_0001771 Ga0501076_0001771_3638_4063 140
601 3300049593 Ga0501077_0942644 Ga0501077_0942644_75_500 140
602 3300049741 Ga0501079_0158877 Ga0501079_0158877_1044_1469 140
603 3300049741 Ga0501079_0304426 Ga0501079_0304426_341_859 140
604 3300049741 Ga0501079_1231777 Ga0501079_1231777_121_543 140
605 3300049742 Ga0501080_0000938 Ga0501080_0000938_850_1368 140
606 3300049742 Ga0501080_0008441 Ga0501080_0008441_7755_8270 140
607 3300049742 Ga0501080_0033586 Ga0501080_0033586_3583_4005 140
608 3300049743 Ga0501081_0175732 Ga0501081_0175732_291_716 140
609 3300049744 Ga0501083_0675116 Ga0501083_0675116_101_523 140
610 3300049822 Ga0501035_0002523 Ga0501035_0002523_14087_14509 140
611 3300049822 Ga0501035_0013722 Ga0501035_0013722_1118_1540 140
612 3300049822 Ga0501035_0013871 Ga0501035_0013871_465_890 140
613 3300049822 Ga0501035_0075995 Ga0501035_0075995_2057_2479 140
614 3300049822 Ga0501035_0165955 Ga0501035_0165955_1177_1599 140
615 3300049822 Ga0501035_0708039 Ga0501035_0708039_79_501 140
616 3300049822 Ga0501035_0784644 Ga0501035_0784644_67_582 140
617 3300049822 Ga0501035_0785788 Ga0501035_0785788_325_747 140
618 3300049823 Ga0501044_0007608 Ga0501044_0007608_1873_2295 140
619 3300049823 Ga0501044_0080394 Ga0501044_0080394_1695_2213 140
620 3300049823 Ga0501044_0264207 Ga0501044_0264207_1138_1560 140
621 3300049823 Ga0501044_0288942 Ga0501044_0288942_16_438 140
622 3300049823 Ga0501044_0786581 Ga0501044_0786581_99_521 140
623 3300049823 Ga0501044_1108284 Ga0501044_1108284_192_614 140
624 3300049824 Ga0501045_0014534 Ga0501045_0014534_1459_1884 140
625 3300050509 nmdc:mga0qj67_1316339_c1 nmdc:mga0qj67_1316339_c1_114_539 140
626 3300050514 nmdc:mga08x19_786066_c1 nmdc:mga08x19_786066_c1_33_455 140
627 3300053133 Ga0500655_048237 Ga0500655_048237_121_543 140
628 3300054114 Ga0501084_0000057 Ga0501084_0000057_2817_3239 140
629 3300054114 Ga0501084_0209931 Ga0501084_0209931_283_708 140
630 3300061734 Ga0530510_0263186 Ga0530510_0263186_17_442 140
631 iso_pu_bacteria 2808606384 2808969113 140
632 iso_pu_bacteria 2808606390 2809003944 140
633 iso_pu_bacteria 2808606391 2809011221 140
634 iso_pu_bacteria 641736154 642419037 140
635 3300003187 JGI25151J46595_10001007 JGI25151J46595_1000100720 141
636 3300005456 Ga0070678_100257033 Ga0070678_1002570331 141
637 3300005844 Ga0068862_100349118 Ga0068862_1003491182 141
638 3300006178 Ga0075367_10516901 Ga0075367_105169012 141
639 3300006195 Ga0075366_10027545 Ga0075366_100275455 141
640 3300006353 Ga0075370_10004847 Ga0075370_100048473 141
641 3300009545 Ga0105237_12314707 Ga0105237_123147071 141
642 3300012502 Ga0157347_1029477 Ga0157347_10294772 141
643 3300021384 Ga0213876_10000290 Ga0213876_1000029024 141
644 3300025258 Ga0209129_1002564 Ga0209129_10025641 141
645 3300025294 Ga0209025_1000157 Ga0209025_1000157120 141
646 3300028380 Ga0268265_10404698 Ga0268265_104046982 141
647 3300037312 Ga0395899_0000065 Ga0395899_0000065_16798_17223 141
648 3300037312 Ga0395899_0104684 Ga0395899_0104684_393_818 141
649 3300037418 Ga0395900_0000339 Ga0395900_0000339_16798_17223 141
650 3300037418 Ga0395900_0185390 Ga0395900_0185390_440_865 141
651 3300037466 Ga0395898_0000565 Ga0395898_0000565_51860_52285 141
652 3300037466 Ga0395898_0069666 Ga0395898_0069666_738_1163 141
653 3300038443 Ga0395901_0000994 Ga0395901_0000994_38_463 141
654 3300039437 Ga0436365_0826287 Ga0436365_0826287_20671_21096 141
655 3300044656 Ga0466969_0007130 Ga0466969_0007130_368_793 141
656 3300044659 Ga0466973_0047582 Ga0466973_0047582_328_753 141
657 3300044683 Ga0466965_0051002 Ga0466965_0051002_596_1021 141
658 3300044684 Ga0466966_0204461 Ga0466966_0204461_756_1181 141
659 3300044693 Ga0466961_0140905 Ga0466961_0140905_764_1189 141
660 3300044694 Ga0466963_0000420 Ga0466963_0000420_6273_6698 141
661 3300044719 Ga0466971_0034581 Ga0466971_0034581_1656_2081 141
662 3300044765 Ga0466970_0041943 Ga0466970_0041943_1803_2228 141
663 3300044842 Ga0466957_0002050 Ga0466957_0002050_4919_5344 141
664 3300045049 Ga0466959_0013716 Ga0466959_0013716_1655_2080 141
665 3300045836 Ga0466958_0001742 Ga0466958_0001742_3270_3695 141
666 3300046462 Ga0495651_0252364 Ga0495651_0252364_193_624 141
667 3300048917 Ga0496114_0668223 Ga0496114_0668223_278_712 141
668 3300048918 Ga0496115_0346713 Ga0496115_0346713_431_865 141
669 3300048919 Ga0496116_0157723 Ga0496116_0157723_627_1058 141
670 3300049585 Ga0501069_0119160 Ga0501069_0119160_912_1349 141
671 3300049822 Ga0501035_0034801 Ga0501035_0034801_3213_3686 141
672 3300049823 Ga0501044_0397030 Ga0501044_0397030_500_973 141
673 3300050493 nmdc:mga0k408_19569_c1 nmdc:mga0k408_19569_c1_2995_3426 141
674 3300050493 nmdc:mga0k408_300878_c1 nmdc:mga0k408_300878_c1_460_891 141
675 3300050494 nmdc:mga06z11_203119_c1 nmdc:mga06z11_203119_c1_101_532 141
676 3300061719 Ga0466962_0033412 Ga0466962_0033412_1902_2327 141
677 iso_pu_bacteria 2842747753 2842749987 141
678 iso_pu_bacteria 2928157003 2928161889 141
679 iso_pu_bacteria 2928163908 2928170005 141
680 iso_pu_bacteria 2981990288 2981992938 141
681 3300002737 JGI25162J39368_1000482 JGI25162J39368_100048215 142
682 3300003214 JGI25165J46597_1000328 JGI25165J46597_100032835 142
683 3300003320 rootH2_10005494 rootH2_100054944 142
684 3300003322 rootL2_10002812 rootL2_1000281228 142
685 3300003323 rootH1_10041044 rootH1_100410442 142
686 3300005337 Ga0070682_100598625 Ga0070682_1005986252 142
687 3300005339 Ga0070660_100000414 Ga0070660_10000041411 142
688 3300005344 Ga0070661_100001393 Ga0070661_10000139315 142
689 3300005353 Ga0070669_100013267 Ga0070669_1000132674 142
690 3300005355 Ga0070671_100028246 Ga0070671_1000282465 142
691 3300005364 Ga0070673_100164739 Ga0070673_1001647392 142
692 3300005364 Ga0070673_100815903 Ga0070673_1008159032 142
693 3300005366 Ga0070659_100000526 Ga0070659_1000005269 142
694 3300005455 Ga0070663_100003639 Ga0070663_1000036393 142
695 3300005456 Ga0070678_100379931 Ga0070678_1003799312 142
696 3300005457 Ga0070662_100000260 Ga0070662_10000026024 142
697 3300005539 Ga0068853_100001673 Ga0068853_1000016738 142
698 3300005543 Ga0070672_100400963 Ga0070672_1004009632 142
699 3300005563 Ga0068855_100000110 Ga0068855_10000011029 142
700 3300005564 Ga0070664_100000378 Ga0070664_10000037814 142
701 3300005564 Ga0070664_100218575 Ga0070664_1002185752 142
702 3300005578 Ga0068854_100009590 Ga0068854_1000095905 142
703 3300005614 Ga0068856_100000111 Ga0068856_10000011135 142
704 3300005614 Ga0068856_100089964 Ga0068856_1000899642 142
705 3300005616 Ga0068852_100032133 Ga0068852_1000321333 142
706 3300006358 Ga0068871_100537798 Ga0068871_1005377982 142
707 3300009177 Ga0105248_10061914 Ga0105248_100619143 142
708 3300013100 Ga0157373_10004775 Ga0157373_100047759 142
709 3300013102 Ga0157371_10000248 Ga0157371_1000024825 142
710 3300013105 Ga0157369_10227994 Ga0157369_102279943 142
711 3300013297 Ga0157378_10258037 Ga0157378_102580372 142
712 3300013307 Ga0157372_10000402 Ga0157372_100004022 142
713 3300013308 Ga0157375_11192945 Ga0157375_111929452 142
714 3300025228 Ga0209672_107191 Ga0209672_1071912 142
715 3300025233 Ga0209437_100057 Ga0209437_100057262 142
716 3300025261 Ga0209233_1000130 Ga0209233_100013064 142
717 3300025919 Ga0207657_10000910 Ga0207657_1000091023 142
718 3300025920 Ga0207649_10012952 Ga0207649_100129524 142
719 3300025923 Ga0207681_10117034 Ga0207681_101170342 142
720 3300025931 Ga0207644_10019042 Ga0207644_100190425 142
721 3300025932 Ga0207690_10000194 Ga0207690_1000019442 142
722 3300025933 Ga0207706_10000008 Ga0207706_1000000878 142
723 3300025940 Ga0207691_10085498 Ga0207691_100854984 142
724 3300025945 Ga0207679_10000934 Ga0207679_1000093413 142
725 3300025945 Ga0207679_11933411 Ga0207679_119334111 142
726 3300025949 Ga0207667_10001326 Ga0207667_1000132612 142
727 3300025960 Ga0207651_10186694 Ga0207651_101866942 142
728 3300025981 Ga0207640_10004677 Ga0207640_100046776 142
729 3300026041 Ga0207639_10002823 Ga0207639_100028236 142
730 3300026078 Ga0207702_10000510 Ga0207702_1000051014 142
731 3300026078 Ga0207702_10112615 Ga0207702_101126152 142
732 3300026116 Ga0207674_10217041 Ga0207674_102170412 142
733 3300026116 Ga0207674_11071197 Ga0207674_110711972 142
734 3300026142 Ga0207698_10022179 Ga0207698_100221794 142
735 3300027682 Ga0209971_1025274 Ga0209971_10252742 142
736 3300027876 Ga0209974_10130861 Ga0209974_101308612 142
737 3300031456 Ga0307513_10000020 Ga0307513_1000002046 142
738 3300031548 Ga0307408_100068146 Ga0307408_1000681464 142
739 3300031731 Ga0307405_10363011 Ga0307405_103630111 142
740 3300031824 Ga0307413_10291853 Ga0307413_102918532 142
741 3300031852 Ga0307410_10005780 Ga0307410_100057802 142
742 3300032004 Ga0307414_10227696 Ga0307414_102276962 142
743 3300032005 Ga0307411_10042464 Ga0307411_100424642 142
744 3300035114 Ga0373939_0091708 Ga0373939_0091708_145_585 142
745 3300037418 Ga0395900_1290620 Ga0395900_1290620_186_626 142
746 3300037466 Ga0395898_0034389 Ga0395898_0034389_4279_4719 142
747 3300038443 Ga0395901_0398951 Ga0395901_0398951_907_1347 142
748 3300041406 Ga0439439_0058281 Ga0439439_0058281_146_589 142
749 3300041411 Ga0439466_0119927 Ga0439466_0119927_44_487 142
750 3300041452 Ga0451793_0794819 Ga0451793_0794819_11_460 142
751 3300042015 Ga0439462_0039882 Ga0439462_0039882_706_1149 142
752 3300042117 Ga0450913_009306 Ga0450913_009306_23_496 142
753 3300042118 Ga0450914_019675 Ga0450914_019675_201_644 142
754 3300042127 Ga0450890_034836 Ga0450890_034836_24_464 142
755 3300042146 Ga0450907_008148 Ga0450907_008148_1207_1650 142
756 3300045976 Ga0466967_0046076 Ga0466967_0046076_19_447 142
757 3300046453 Ga0495627_022360 Ga0495627_022360_587_1018 142
758 3300046458 Ga0495591_003976 Ga0495591_003976_3194_3625 142
759 3300046471 Ga0495650_0002301 Ga0495650_0002301_4089_4520 142
760 3300046474 Ga0495605_0000013 Ga0495605_0000013_59074_59505 142
761 3300046499 Ga0495594_0009155 Ga0495594_0009155_2260_2691 142
762 3300046501 Ga0495607_0102651 Ga0495607_0102651_104_535 142
763 3300046506 Ga0495583_0000042 Ga0495583_0000042_39532_39963 142
764 3300046512 Ga0495610_0010567 Ga0495610_0010567_4004_4435 142
765 3300046513 Ga0495616_0027713 Ga0495616_0027713_1720_2151 142
766 3300046515 Ga0495620_0000005 Ga0495620_0000005_159872_160303 142
767 3300046518 Ga0495631_0005085 Ga0495631_0005085_347_778 142
768 3300046520 Ga0495637_0004482 Ga0495637_0004482_2560_2991 142
769 3300046524 Ga0495648_0003365 Ga0495648_0003365_4307_4738 142
770 3300046530 Ga0495654_0008924 Ga0495654_0008924_228_659 142
771 3300046538 Ga0495609_0000266 Ga0495609_0000266_7556_7987 142
772 3300046542 Ga0495597_0001238 Ga0495597_0001238_5695_6126 142
773 3300046558 Ga0495633_0000013 Ga0495633_0000013_107087_107518 142
774 3300046648 Ga0495611_0000695 Ga0495611_0000695_633_1064 142
775 3300046665 Ga0495661_0000008 Ga0495661_0000008_308466_308897 142
776 3300046691 Ga0495670_0002708 Ga0495670_0002708_5482_5913 142
777 3300046692 Ga0495671_0038740 Ga0495671_0038740_816_1247 142
778 3300046794 Ga0495589_0000258 Ga0495589_0000258_12807_13238 142
779 3300046810 Ga0495660_0003027 Ga0495660_0003027_4659_5090 142
780 3300047323 Ga0495683_0000002 Ga0495683_0000002_338938_339369 142
781 3300047446 Ga0495679_000315 Ga0495679_000315_23303_23734 142
782 3300047469 Ga0495673_0009844 Ga0495673_0009844_3658_4089 142
783 3300048905 Ga0496102_0001273 Ga0496102_0001273_21579_22019 142
784 3300048906 Ga0496103_0009351 Ga0496103_0009351_4841_5281 142
785 3300048909 Ga0496106_0001067 Ga0496106_0001067_14485_14925 142
786 3300048910 Ga0496107_0009614 Ga0496107_0009614_5258_5698 142
787 3300048913 Ga0496110_0769774 Ga0496110_0769774_206_646 142
788 3300053092 Ga0500583_0380171 Ga0500583_0380171_217_663 142
789 3300053107 Ga0500560_000059 Ga0500560_000059_3403_3831 142
790 3300053125 Ga0500618_011279 Ga0500618_011279_708_1139 142
791 3300053157 Ga0500624_002981 Ga0500624_002981_1152_1580 142
792 3300053161 Ga0500634_0115463 Ga0500634_0115463_25_453 142
793 iso_pu_bacteria 2643221644 2644248935 142
794 iso_pu_bacteria 641228493 641334176 142
795 iso_pu_bacteria 643348555 643391809 142
796 3300025949 Ga0207667_10927825 Ga0207667_109278251 144
797 3300048920 Ga0496117_0169783 Ga0496117_0169783_352_843 144
798 3300001989 JGI24739J22299_10028803 JGI24739J22299_100288031 145
799 3300002067 JGI24735J21928_10042589 JGI24735J21928_100425891 145
800 3300005327 Ga0070658_10081965 Ga0070658_100819652 145
801 3300005339 Ga0070660_100000001 Ga0070660_10000000137 145
802 3300005366 Ga0070659_100000326 Ga0070659_10000032637 145
803 3300005563 Ga0068855_100589113 Ga0068855_1005891132 145
804 3300005564 Ga0070664_100331588 Ga0070664_1003315882 145
805 3300005614 Ga0068856_100391343 Ga0068856_1003913432 145
806 3300013104 Ga0157370_10419481 Ga0157370_104194811 145
807 3300014497 Ga0182008_10611242 Ga0182008_106112422 145
808 3300025904 Ga0207647_10024902 Ga0207647_100249021 145
809 3300025909 Ga0207705_10138543 Ga0207705_101385432 145
810 3300025919 Ga0207657_10000590 Ga0207657_1000059020 145
811 3300025924 Ga0207694_10873622 Ga0207694_108736221 145
812 3300025932 Ga0207690_10000010 Ga0207690_10000010153 145
813 3300025949 Ga0207667_10176675 Ga0207667_101766752 145
814 3300026067 Ga0207678_10000013 Ga0207678_1000001327 145
815 3300026078 Ga0207702_11506382 Ga0207702_115063821 145
816 3300048903 Ga0496100_1031388 Ga0496100_1031388_154_591 145
817 3300048905 Ga0496102_0730626 Ga0496102_0730626_255_692 145
818 3300048907 Ga0496104_0232273 Ga0496104_0232273_1204_1641 145
819 3300048908 Ga0496105_0535895 Ga0496105_0535895_90_527 145
820 3300048921 Ga0496118_0045566 Ga0496118_0045566_1501_1938 145
821 3300048921 Ga0496118_0485111 Ga0496118_0485111_134_571 145
822 3300050492 nmdc:mga0yw44_9502_c1 nmdc:mga0yw44_9502_c1_2304_2816 145
823 3300050494 nmdc:mga06z11_11686_c1 nmdc:mga06z11_11686_c1_1034_1546 145
824 3300050516 nmdc:mga0sz30_2167_c1 nmdc:mga0sz30_2167_c1_189_701 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

38

160

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rri-assembly1.cif.gz_A crystal structure of glyoxalase/bleomycin resistance protein/dioxygenase from alicyclobacillus acidocaldarius 0.8638 10 143
3rri-assembly1.cif.gz_A crystal structure of glyoxalase/bleomycin resistance protein/dioxygenase from alicyclobacillus acidocaldarius 0.8278 10 143
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.8199 8 136
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8185 8 142
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.799 8 144
ID Description Score Start End Superfamily
3rriB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8682 10 138 3.10.180.10
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8207 8 136 3.10.180.10
3rriB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8191 10 138 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.796 78 135 3.30.720.110
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.773 8 136 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A357EZN1-F1-model_v4 Glyoxalase 0.9946 10 58
AF-A0A522RSE7-F1-model_v4 DUF1543 domain-containing protein 0.9919 9 145
AF-A0A2N2T9P4-F1-model_v4 Glyoxalase 0.9851 16 145
AF-A0A2W4PT80-F1-model_v4 Glyoxalase 0.9812 8 145
AF-A0A367V5B7-F1-model_v4 deleted 0.9787 8 145

Feature Viewer

pLDDT pTM Quality
94 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map