F482332

General Info

Members Datasets Scaffolds Average Seq Length
823 260 1646 136

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100401199|Ga0097621_1004011992
Length 144
Sequence MKLKLMIVIGCVALLGAVSSVMAHHAFAAEFDVNKPITLKGTMEKWDMVNPHSWFHLNVKDPKTGKVTEWMIEGGSPNTLIRLGVTKYTITPGTELTVEGYQAKEGTNKAVGRNFILKDGSRLFLSLSSAVPGGAPEGTSDGKK

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
178 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
192 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
193 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
194 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
195 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
196 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
197 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
198 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
199 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
213 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
214 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
218 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
238 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.35
Metatranscriptomes 3.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.61
Rhizosphere 97.57
Stem 0
Stem Tuber 0
Unclassified 36.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100401199 3300006237 Bacteria 1228
2 ARcpr5yngRDRAFT_c015761 3300000043 Unclassified 634
3 JGI24746J21847_1017555 3300001977 Unclassified 1016
4 JGI25406J46586_10000191 3300003203 Bacteria 27363
5 JGI25406J46586_10011690 3300003203 Bacteria 3839
6 JGI25406J46586_10194635 3300003203 Unclassified 592
7 Ga0007410J51695_1058436 3300003574 Unclassified 520
8 Ga0007409J51694_1099884 3300003575 Unclassified 560
9 Ga0007416J51690_1070261 3300003577 Unclassified 1256
10 Ga0032354_1113736 3300003693 Unclassified 1128
11 Ga0058858_1192668 3300004785 Unclassified 561
12 Ga0058858_1396011 3300004785 Unclassified 870
13 Ga0058859_10071507 3300004798 Unclassified 1041
14 Ga0058859_11564696 3300004798 Bacteria 948
15 Ga0058859_11572019 3300004798 Unclassified 860
16 Ga0058859_11648162 3300004798 Bacteria 800
17 Ga0058859_11651765 3300004798 Unclassified 891
18 Ga0058859_11721032 3300004798 Unclassified 795
19 Ga0058859_11796824 3300004798 Bacteria 692
20 Ga0058859_11799877 3300004798 Bacteria 669
21 Ga0058863_10051321 3300004799 Unclassified 805
22 Ga0058863_10133683 3300004799 Unclassified 1515
23 Ga0058860_10059000 3300004801 Unclassified 719
24 Ga0058860_10099214 3300004801 Unclassified 1730
25 Ga0058860_11472822 3300004801 Bacteria 620
26 Ga0058860_11524806 3300004801 Unclassified 555
27 Ga0058860_12052082 3300004801 Unclassified 863
28 Ga0058862_10272084 3300004803 Bacteria 690
29 Ga0065714_10047208 3300005288 Unclassified 762
30 Ga0065714_10100875 3300005288 Bacteria 1655
31 Ga0065712_10208227 3300005290 Unclassified 1082
32 Ga0065712_10394087 3300005290 Unclassified 738
33 Ga0065715_10015782 3300005293 Bacteria 2110
34 Ga0065715_10129483 3300005293 Bacteria 2044
35 Ga0065715_10321296 3300005293 Bacteria 1001
36 Ga0065715_10569228 3300005293 Bacteria 728
37 Ga0065715_10646683 3300005293 Unclassified 681
38 Ga0065707_10042440 3300005295 Bacteria 963
39 Ga0065707_10120598 3300005295 Bacteria 2130
40 Ga0065707_10320942 3300005295 Unclassified 963
41 Ga0070676_10007251 3300005328 Bacteria 5945
42 Ga0070676_10073938 3300005328 Bacteria 2051
43 Ga0070676_10480545 3300005328 Unclassified 879
44 Ga0070676_10548552 3300005328 Unclassified 827
45 Ga0070676_11054214 3300005328 Unclassified 612
46 Ga0070683_100570547 3300005329 Bacteria 1082
47 Ga0070690_100002003 3300005330 Bacteria 10847
48 Ga0070690_100268258 3300005330 Bacteria 1213
49 Ga0070690_100403544 3300005330 Unclassified 1004
50 Ga0070690_100950260 3300005330 Unclassified 675
51 Ga0070690_101198142 3300005330 Unclassified 605
52 Ga0070670_100001562 3300005331 Bacteria 18459
53 Ga0070670_100015895 3300005331 Bacteria 6459
54 Ga0070670_100022899 3300005331 Bacteria 5375
55 Ga0070670_100798551 3300005331 Unclassified 852
56 Ga0070670_100821320 3300005331 Bacteria 840
57 Ga0070677_10011811 3300005333 Bacteria 3020
58 Ga0070677_10047400 3300005333 Unclassified 1723
59 Ga0070677_10222570 3300005333 Bacteria 923
60 Ga0068869_100013297 3300005334 Bacteria 5471
61 Ga0068869_100222037 3300005334 Unclassified 1498
62 Ga0068869_100395709 3300005334 Bacteria 1135
63 Ga0068869_100540617 3300005334 Unclassified 977
64 Ga0070666_10051919 3300005335 Bacteria 2762
65 Ga0070666_10156515 3300005335 Unclassified 1591
66 Ga0070666_10205308 3300005335 Bacteria 1387
67 Ga0070666_10207554 3300005335 Unclassified 1379
68 Ga0070666_10583671 3300005335 Bacteria 815
69 Ga0070666_10700690 3300005335 Bacteria 743
70 Ga0070666_10840683 3300005335 Bacteria 677
71 Ga0070680_100490234 3300005336 Unclassified 1051
72 Ga0068868_101315850 3300005338 Unclassified 672
73 Ga0070689_100025501 3300005340 Unclassified 4442
74 Ga0070689_100041645 3300005340 Bacteria 3526
75 Ga0070689_100074781 3300005340 Bacteria 2651
76 Ga0070689_100131936 3300005340 Bacteria 2004
77 Ga0070689_100154751 3300005340 Unclassified 1851
78 Ga0070689_100422724 3300005340 Unclassified 1130
79 Ga0070691_10716230 3300005341 Unclassified 602
80 Ga0070687_100044394 3300005343 Bacteria 2264
81 Ga0070687_100120027 3300005343 Unclassified 1502
82 Ga0070687_100123109 3300005343 Unclassified 1486
83 Ga0070661_100097223 3300005344 Bacteria 2186
84 Ga0070661_100200614 3300005344 Bacteria 1524
85 Ga0070692_10148666 3300005345 Bacteria 1332
86 Ga0070692_10204022 3300005345 Unclassified 1160
87 Ga0070692_10532565 3300005345 Unclassified 766
88 Ga0070668_100024393 3300005347 Bacteria 4582
89 Ga0070668_100206312 3300005347 Bacteria 1615
90 Ga0070668_100292043 3300005347 Bacteria 1365
91 Ga0070668_101108177 3300005347 Unclassified 715
92 Ga0070668_101160737 3300005347 Unclassified 699
93 Ga0070669_100000757 3300005353 Bacteria 23488
94 Ga0070669_100028157 3300005353 Bacteria 4046
95 Ga0070669_100037540 3300005353 Bacteria 3514
96 Ga0070669_100116240 3300005353 Unclassified 2035
97 Ga0070669_100304709 3300005353 Unclassified 1282
98 Ga0070669_100382364 3300005353 Bacteria 1148
99 Ga0070669_100479147 3300005353 Unclassified 1029
100 Ga0070675_100000121 3300005354 Bacteria 46078
101 Ga0070675_100017747 3300005354 Bacteria 5660
102 Ga0070675_100023004 3300005354 Unclassified 4980
103 Ga0070675_100083671 3300005354 Bacteria 2664
104 Ga0070675_100096023 3300005354 Unclassified 2490
105 Ga0070675_100138116 3300005354 Bacteria 2081
106 Ga0070675_100231069 3300005354 Bacteria 1613
107 Ga0070675_100325907 3300005354 Bacteria 1357
108 Ga0070675_100835199 3300005354 Bacteria 843
109 Ga0070671_100027306 3300005355 Bacteria 4697
110 Ga0070671_100047495 3300005355 Bacteria 3570
111 Ga0070671_100451708 3300005355 Bacteria 1103
112 Ga0070674_100003046 3300005356 Bacteria 9321
113 Ga0070674_100592472 3300005356 Unclassified 936
114 Ga0070674_100619667 3300005356 Bacteria 917
115 Ga0070674_101259067 3300005356 Unclassified 658
116 Ga0070673_100038736 3300005364 Bacteria 3642
117 Ga0070673_100044145 3300005364 Bacteria 3450
118 Ga0070673_100236046 3300005364 Bacteria 1588
119 Ga0070673_100416706 3300005364 Bacteria 1203
120 Ga0070688_100006887 3300005365 Bacteria 6103
121 Ga0070688_100051748 3300005365 Bacteria 2563
122 Ga0070688_100083752 3300005365 Bacteria 2070
123 Ga0070688_100106696 3300005365 Unclassified 1856
124 Ga0070688_100180142 3300005365 Bacteria 1465
125 Ga0070688_100467404 3300005365 Bacteria 946
126 Ga0070667_100044380 3300005367 Bacteria 3733
127 Ga0070667_100280794 3300005367 Unclassified 1495
128 Ga0070667_100596811 3300005367 Bacteria 1017
129 Ga0070703_10216170 3300005406 Unclassified 760
130 Ga0070703_10336424 3300005406 Unclassified 640
131 Ga0070709_11113255 3300005434 Bacteria 632
132 Ga0070713_100967910 3300005436 Bacteria 820
133 Ga0070701_10016711 3300005438 Bacteria 3417
134 Ga0070701_10093035 3300005438 Bacteria 1656
135 Ga0070701_10360642 3300005438 Unclassified 910
136 Ga0070705_100236176 3300005440 Bacteria 1275
137 Ga0070705_100465276 3300005440 Bacteria 952
138 Ga0070705_100518155 3300005440 Unclassified 908
139 Ga0070700_100275571 3300005441 Bacteria 1217
140 Ga0070700_100692072 3300005441 Unclassified 809
141 Ga0070700_100879150 3300005441 Unclassified 728
142 Ga0070694_100005209 3300005444 Bacteria 7852
143 Ga0070694_100010647 3300005444 Bacteria 5681
144 Ga0070694_100032663 3300005444 Bacteria 3419
145 Ga0070694_100242238 3300005444 Bacteria 1361
146 Ga0070694_100574857 3300005444 Bacteria 905
147 Ga0070694_101332320 3300005444 Unclassified 604
148 Ga0070708_100758366 3300005445 Unclassified 912
149 Ga0070708_101047007 3300005445 Unclassified 765
150 Ga0070678_100488567 3300005456 Unclassified 1085
151 Ga0070678_100542422 3300005456 Unclassified 1031
152 Ga0070662_100061685 3300005457 Bacteria 2738
153 Ga0070662_100295618 3300005457 Bacteria 1314
154 Ga0070662_100350598 3300005457 Bacteria 1209
155 Ga0070662_100402793 3300005457 Unclassified 1129
156 Ga0070662_100907671 3300005457 Unclassified 752
157 Ga0070662_101364543 3300005457 Unclassified 610
158 Ga0070681_10426533 3300005458 Unclassified 1238
159 Ga0068867_100067964 3300005459 Bacteria 2658
160 Ga0068867_100149607 3300005459 Bacteria 1833
161 Ga0068867_100181301 3300005459 Bacteria 1675
162 Ga0068867_100948915 3300005459 Unclassified 777
163 Ga0070685_10023516 3300005466 Bacteria 3374
164 Ga0070685_10033064 3300005466 Unclassified 2901
165 Ga0070685_10044817 3300005466 Bacteria 2534
166 Ga0070685_10073767 3300005466 Unclassified 2029
167 Ga0070685_10131169 3300005466 Bacteria 1567
168 Ga0070685_10380088 3300005466 Viruses 973
169 Ga0070706_100190249 3300005467 Bacteria 1918
170 Ga0070706_100444759 3300005467 Bacteria 1206
171 Ga0070706_100697006 3300005467 Unclassified 942
172 Ga0070706_100828984 3300005467 Bacteria 856
173 Ga0070706_100840982 3300005467 Bacteria 849
174 Ga0070707_100030488 3300005468 Bacteria 5135
175 Ga0070707_100033449 3300005468 Bacteria 4903
176 Ga0070707_100238874 3300005468 Bacteria 1769
177 Ga0070707_100488396 3300005468 Bacteria 1193
178 Ga0070707_101330764 3300005468 Bacteria 685
179 Ga0070698_100027538 3300005471 Bacteria 5908
180 Ga0070698_100090648 3300005471 Bacteria 3040
181 Ga0070698_100126839 3300005471 Bacteria 2509
182 Ga0070698_101278128 3300005471 Unclassified 684
183 Ga0070698_101672266 3300005471 Bacteria 589
184 Ga0070699_100000553 3300005518 Bacteria 35310
185 Ga0070699_100030973 3300005518 Bacteria 4619
186 Ga0070699_100082154 3300005518 Bacteria 2808
187 Ga0070699_100263853 3300005518 Unclassified 1540
188 Ga0070699_101828742 3300005518 Bacteria 556
189 Ga0070684_100729920 3300005535 Bacteria 924
190 Ga0070697_100101516 3300005536 Bacteria 2390
191 Ga0070697_100131502 3300005536 Bacteria 2099
192 Ga0070697_100487599 3300005536 Bacteria 1077
193 Ga0070672_100007408 3300005543 Bacteria 7441
194 Ga0070672_100021138 3300005543 Bacteria 4757
195 Ga0070672_100110702 3300005543 Bacteria 2238
196 Ga0070672_100327209 3300005543 Unclassified 1303
197 Ga0070672_100357753 3300005543 Bacteria 1245
198 Ga0070672_100507324 3300005543 Unclassified 1044
199 Ga0070672_100802544 3300005543 Bacteria 828
200 Ga0070686_100042435 3300005544 Bacteria 2849
201 Ga0070686_100080478 3300005544 Archaea 2155
202 Ga0070686_100173527 3300005544 Bacteria 1527
203 Ga0070686_100784679 3300005544 Unclassified 767
204 Ga0070686_101050977 3300005544 Unclassified 670
205 Ga0070695_100190944 3300005545 Bacteria 1458
206 Ga0070695_100413680 3300005545 Unclassified 1025
207 Ga0070695_101364933 3300005545 Unclassified 587
208 Ga0070695_101547173 3300005545 Bacteria 553
209 Ga0070696_100028060 3300005546 Unclassified 3839
210 Ga0070696_100047809 3300005546 Bacteria 2969
211 Ga0070696_100081877 3300005546 Bacteria 2288
212 Ga0070696_100955426 3300005546 Archaea 714
213 Ga0070665_100180872 3300005548 Bacteria 2109
214 Ga0070665_101274835 3300005548 Unclassified 745
215 Ga0070665_102161612 3300005548 Unclassified 561
216 Ga0070704_100005992 3300005549 Bacteria 7128
217 Ga0070704_100030187 3300005549 Unclassified 3630
218 Ga0070704_100036994 3300005549 Bacteria 3330
219 Ga0070704_100086029 3300005549 Bacteria 2328
220 Ga0070704_100122218 3300005549 Bacteria 2002
221 Ga0070704_100381568 3300005549 Unclassified 1198
222 Ga0070664_100025349 3300005564 Unclassified 4914
223 Ga0070664_100026394 3300005564 Bacteria 4818
224 Ga0070664_100241580 3300005564 Unclassified 1621
225 Ga0070664_100320071 3300005564 Bacteria 1405
226 Ga0070664_101348391 3300005564 Unclassified 674
227 Ga0068857_100069047 3300005577 Bacteria 3146
228 Ga0068857_100095717 3300005577 Unclassified 2661
229 Ga0068857_100359218 3300005577 Unclassified 1350
230 Ga0068857_100405638 3300005577 Bacteria 1269
231 Ga0068857_100812388 3300005577 Bacteria 893
232 Ga0068857_101284066 3300005577 Unclassified 710
233 Ga0070702_100182833 3300005615 Bacteria 1373
234 Ga0070702_100213615 3300005615 Unclassified 1286
235 Ga0070702_100892913 3300005615 Unclassified 695
236 Ga0068852_101579679 3300005616 Unclassified 678
237 Ga0068859_100000730 3300005617 Bacteria 33081
238 Ga0068859_100001253 3300005617 Bacteria 25918
239 Ga0068859_100004340 3300005617 Bacteria 14461
240 Ga0068859_100091551 3300005617 Bacteria 3092
241 Ga0068859_100286335 3300005617 Bacteria 1741
242 Ga0068859_100526866 3300005617 Unclassified 1276
243 Ga0068859_100918525 3300005617 Unclassified 959
244 Ga0068859_101004660 3300005617 Bacteria 916
245 Ga0068859_101129931 3300005617 Bacteria 862
246 Ga0068859_101515254 3300005617 Bacteria 740
247 Ga0068859_101691998 3300005617 Unclassified 699
248 Ga0068859_102893461 3300005617 Bacteria 526
249 Ga0068864_100009147 3300005618 Bacteria 8167
250 Ga0068864_100034304 3300005618 Bacteria 4316
251 Ga0068864_100366142 3300005618 Bacteria 1363
252 Ga0068864_101447682 3300005618 Unclassified 689
253 Ga0068864_102368581 3300005618 Unclassified 537
254 Ga0068866_10785066 3300005718 Unclassified 661
255 Ga0068861_100077310 3300005719 Bacteria 2596
256 Ga0068861_100899433 3300005719 Bacteria 838
257 Ga0068861_101127151 3300005719 Unclassified 755
258 Ga0068861_101187799 3300005719 Unclassified 737
259 Ga0068870_10122017 3300005840 Unclassified 1502
260 Ga0068870_10235360 3300005840 Unclassified 1128
261 Ga0068870_10916522 3300005840 Unclassified 620
262 Ga0068863_100001411 3300005841 Bacteria 23786
263 Ga0068863_100026428 3300005841 Bacteria 5537
264 Ga0068858_100016190 3300005842 Bacteria 7004
265 Ga0068858_100028953 3300005842 Bacteria 5143
266 Ga0068858_100040340 3300005842 Bacteria 4329
267 Ga0068858_100168893 3300005842 Bacteria 2062
268 Ga0068858_101350863 3300005842 Unclassified 702
269 Ga0068860_100005789 3300005843 Bacteria 12452
270 Ga0068860_100201695 3300005843 Bacteria 1928
271 Ga0068860_100401146 3300005843 Bacteria 1357
272 Ga0068860_102591144 3300005843 Unclassified 526
273 Ga0068862_100008247 3300005844 Bacteria 8620
274 Ga0068862_100160485 3300005844 Bacteria 2006
275 Ga0068862_100324872 3300005844 Bacteria 1421
276 Ga0068862_100348154 3300005844 Unclassified 1374
277 Ga0068862_100774741 3300005844 Unclassified 935
278 Ga0068862_100830880 3300005844 Bacteria 904
279 Ga0068862_101658211 3300005844 Unclassified 647
280 Ga0081455_10800867 3300005937 Bacteria 592
281 Ga0081539_10000047 3300005985 Bacteria 275235
282 Ga0081539_10000175 3300005985 Bacteria 150479
283 Ga0081539_10002917 3300005985 Bacteria 22574
284 Ga0070716_100209180 3300006173 Unclassified 1302
285 Ga0097621_100019510 3300006237 Bacteria 5205
286 Ga0068871_100479028 3300006358 Bacteria 1119
287 Ga0075428_100007083 3300006844 Bacteria 12423
288 Ga0075428_100048555 3300006844 Unclassified 4658
289 Ga0075428_100064041 3300006844 Bacteria 4026
290 Ga0075428_100075038 3300006844 Unclassified 3694
291 Ga0075428_100093723 3300006844 Bacteria 3274
292 Ga0075428_100095081 3300006844 Unclassified 3248
293 Ga0075428_100160794 3300006844 Bacteria 2438
294 Ga0075428_100872996 3300006844 Unclassified 955
295 Ga0075430_100002832 3300006846 Bacteria 14516
296 Ga0075430_100271426 3300006846 Bacteria 1404
297 Ga0075430_100301560 3300006846 Unclassified 1325
298 Ga0075430_100482439 3300006846 Bacteria 1023
299 Ga0075431_100001359 3300006847 Bacteria 22427
300 Ga0075431_100079364 3300006847 Bacteria 3388
301 Ga0075431_100135108 3300006847 Unclassified 2543
302 Ga0075431_100619743 3300006847 Bacteria 1064
303 Ga0075433_10053439 3300006852 Bacteria 3522
304 Ga0075433_10124988 3300006852 Unclassified 2285
305 Ga0075433_10274642 3300006852 Bacteria 1494
306 Ga0075433_10287243 3300006852 Unclassified 1457
307 Ga0075433_10547664 3300006852 Bacteria 1017
308 Ga0075434_100022942 3300006871 Bacteria 6075
309 Ga0075434_100031687 3300006871 Bacteria 5212
310 Ga0075434_100075345 3300006871 Unclassified 3367
311 Ga0075434_100118207 3300006871 Unclassified 2665
312 Ga0075434_100252178 3300006871 Bacteria 1784
313 Ga0075434_101048653 3300006871 Unclassified 829
314 Ga0075434_101068144 3300006871 Unclassified 821
315 Ga0075434_101645864 3300006871 Unclassified 650
316 Ga0075429_100009790 3300006880 Bacteria 8311
317 Ga0075429_100230364 3300006880 Unclassified 1623
318 Ga0075429_100383275 3300006880 Bacteria 1231
319 Ga0075429_100405831 3300006880 Unclassified 1193
320 Ga0075429_101219230 3300006880 Unclassified 657
321 Ga0068865_100067873 3300006881 Bacteria 2520
322 Ga0068865_100114245 3300006881 Bacteria 1997
323 Ga0068865_100212050 3300006881 Unclassified 1510
324 Ga0068865_101046448 3300006881 Bacteria 717
325 Ga0068865_101162144 3300006881 Unclassified 682
326 Ga0075436_100000806 3300006914 Bacteria 20816
327 Ga0075436_100205728 3300006914 Bacteria 1395
328 Ga0097620_100000730 3300006931 Bacteria 33081
329 Ga0097620_100001253 3300006931 Bacteria 25918
330 Ga0097620_100004340 3300006931 Bacteria 14461
331 Ga0097620_100091549 3300006931 Bacteria 3092
332 Ga0097620_100286319 3300006931 Bacteria 1741
333 Ga0097620_100526876 3300006931 Unclassified 1276
334 Ga0097620_100918534 3300006931 Unclassified 959
335 Ga0097620_101004761 3300006931 Bacteria 916
336 Ga0097620_101130087 3300006931 Bacteria 862
337 Ga0097620_101515209 3300006931 Bacteria 740
338 Ga0097620_101691529 3300006931 Unclassified 699
339 Ga0097620_102894074 3300006931 Bacteria 526
340 Ga0075435_100000267 3300007076 Bacteria 32480
341 Ga0075435_100013520 3300007076 Bacteria 6074
342 Ga0075435_100065622 3300007076 Bacteria 2951
343 Ga0075435_100275568 3300007076 Unclassified 1435
344 Ga0075435_100520884 3300007076 Bacteria 1028
345 Ga0111539_10000810 3300009094 Bacteria 40595
346 Ga0111539_10003655 3300009094 Bacteria 20264
347 Ga0111539_10009096 3300009094 Bacteria 12573
348 Ga0111539_10009153 3300009094 Bacteria 12523
349 Ga0111539_10010337 3300009094 Bacteria 11749
350 Ga0111539_10047424 3300009094 Bacteria 5134
351 Ga0111539_10063870 3300009094 Bacteria 4356
352 Ga0111539_10206121 3300009094 Unclassified 2292
353 Ga0111539_10283744 3300009094 Bacteria 1927
354 Ga0111539_10296524 3300009094 Unclassified 1881
355 Ga0111539_10449902 3300009094 Bacteria 1500
356 Ga0111539_10507308 3300009094 Bacteria 1405
357 Ga0111539_11032975 3300009094 Bacteria 955
358 Ga0111539_11455053 3300009094 Bacteria 795
359 Ga0105245_10656290 3300009098 Bacteria 1079
360 Ga0105247_10013444 3300009101 Bacteria 4909
361 Ga0105247_10595404 3300009101 Unclassified 819
362 Ga0114129_10021195 3300009147 Bacteria 9230
363 Ga0114129_10030036 3300009147 Bacteria 7695
364 Ga0114129_10048846 3300009147 Bacteria 5947
365 Ga0114129_10084437 3300009147 Unclassified 4409
366 Ga0114129_10269786 3300009147 Bacteria 2277
367 Ga0114129_10305666 3300009147 Bacteria 2118
368 Ga0114129_10334801 3300009147 Bacteria 2009
369 Ga0114129_10354645 3300009147 Bacteria 1942
370 Ga0114129_10375571 3300009147 Bacteria 1878
371 Ga0114129_10914392 3300009147 Bacteria 1111
372 Ga0114129_11213102 3300009147 Unclassified 939
373 Ga0114129_12650429 3300009147 Unclassified 598
374 Ga0105243_10593974 3300009148 Unclassified 1065
375 Ga0105243_10877492 3300009148 Bacteria 891
376 Ga0105243_11216664 3300009148 Unclassified 767
377 Ga0105243_11714072 3300009148 Unclassified 658
378 Ga0105243_12148053 3300009148 Bacteria 594
379 Ga0105243_12251236 3300009148 Bacteria 582
380 Ga0105242_10227694 3300009176 Bacteria 1669
381 Ga0105242_10229138 3300009176 Bacteria 1664
382 Ga0105242_10565389 3300009176 Bacteria 1093
383 Ga0105242_11296581 3300009176 Bacteria 752
384 Ga0105242_11636858 3300009176 Unclassified 678
385 Ga0105242_13035302 3300009176 Unclassified 520
386 Ga0105248_10000871 3300009177 Bacteria 33809
387 Ga0105248_10006333 3300009177 Bacteria 12985
388 Ga0105248_10095215 3300009177 Bacteria 3352
389 Ga0105248_10237950 3300009177 Unclassified 2050
390 Ga0105248_10352025 3300009177 Bacteria 1658
391 Ga0105248_10764786 3300009177 Bacteria 1090
392 Ga0105248_12268962 3300009177 Unclassified 618
393 Ga0105237_12619633 3300009545 Unclassified 515
394 Ga0105249_10043818 3300009553 Bacteria 4070
395 Ga0105249_10730676 3300009553 Unclassified 1051
396 Ga0105249_10869173 3300009553 Bacteria 968
397 Ga0105249_11411979 3300009553 Unclassified 768
398 Ga0105246_10032370 3300011119 Bacteria 3467
399 Ga0105246_10537905 3300011119 Bacteria 999
400 Ga0157319_1010625 3300012497 Unclassified 746
401 Ga0157374_10813759 3300013296 Unclassified 950
402 Ga0157378_10113894 3300013297 Bacteria 2484
403 Ga0157378_10175452 3300013297 Bacteria 2013
404 Ga0157378_12974815 3300013297 Unclassified 526
405 Ga0163162_10037092 3300013306 Unclassified 4862
406 Ga0163162_10044148 3300013306 Bacteria 4463
407 Ga0163162_10506803 3300013306 Bacteria 1337
408 Ga0163162_10802775 3300013306 Unclassified 1058
409 Ga0157375_10000800 3300013308 Bacteria 27590
410 Ga0157375_10009094 3300013308 Bacteria 8701
411 Ga0157375_10188172 3300013308 Bacteria 2218
412 Ga0157375_11601246 3300013308 Unclassified 770
413 Ga0157375_11957549 3300013308 Unclassified 696
414 Ga0157375_12182625 3300013308 Unclassified 659
415 Ga0163163_10003949 3300014325 Bacteria 12655
416 Ga0163163_10009812 3300014325 Bacteria 8577
417 Ga0157380_10014879 3300014326 Bacteria 5702
418 Ga0157380_10080366 3300014326 Bacteria 2664
419 Ga0157380_10093700 3300014326 Bacteria 2484
420 Ga0157380_10264958 3300014326 Bacteria 1563
421 Ga0157380_10377662 3300014326 Unclassified 1336
422 Ga0157380_12246530 3300014326 Unclassified 610
423 Ga0157377_10167510 3300014745 Bacteria 1371
424 Ga0157377_10474982 3300014745 Unclassified 868
425 Ga0157379_10000641 3300014968 Bacteria 28223
426 Ga0157379_10176467 3300014968 Unclassified 1929
427 Ga0157379_10259651 3300014968 Unclassified 1578
428 Ga0157379_10916558 3300014968 Unclassified 832
429 Ga0157376_10296663 3300014969 Unclassified 1528
430 Ga0157376_10366346 3300014969 Unclassified 1384
431 Ga0163161_10022156 3300017792 Unclassified 4471
432 Ga0163161_10075551 3300017792 Bacteria 2473
433 Ga0163161_10355442 3300017792 Bacteria 1166
434 Ga0207673_1011185 3300025290 Bacteria 1160
435 Ga0207697_10000863 3300025315 Bacteria 17170
436 Ga0207697_10131966 3300025315 Bacteria 1080
437 Ga0207697_10395785 3300025315 Unclassified 614
438 Ga0207682_10008116 3300025893 Bacteria 4163
439 Ga0207682_10012819 3300025893 Unclassified 3270
440 Ga0207682_10015675 3300025893 Bacteria 2952
441 Ga0207642_10639446 3300025899 Unclassified 666
442 Ga0207710_10019360 3300025900 Bacteria 2904
443 Ga0207710_10395092 3300025900 Unclassified 709
444 Ga0207688_10026729 3300025901 Bacteria 3175
445 Ga0207688_10982932 3300025901 Unclassified 534
446 Ga0207680_10011450 3300025903 Unclassified 4484
447 Ga0207680_10056231 3300025903 Bacteria 2375
448 Ga0207680_10126299 3300025903 Unclassified 1680
449 Ga0207680_10133338 3300025903 Unclassified 1639
450 Ga0207680_10583214 3300025903 Bacteria 799
451 Ga0207647_10235920 3300025904 Unclassified 1051
452 Ga0207699_10426555 3300025906 Bacteria 948
453 Ga0207645_10028865 3300025907 Bacteria 3578
454 Ga0207645_10050501 3300025907 Bacteria 2656
455 Ga0207645_10240031 3300025907 Bacteria 1197
456 Ga0207645_10286843 3300025907 Unclassified 1094
457 Ga0207645_10452862 3300025907 Bacteria 866
458 Ga0207643_10002040 3300025908 Bacteria 11136
459 Ga0207643_10088845 3300025908 Bacteria 1799
460 Ga0207684_10458333 3300025910 Bacteria 1094
461 Ga0207684_10657026 3300025910 Unclassified 893
462 Ga0207684_11631220 3300025910 Unclassified 521
463 Ga0207707_10819225 3300025912 Bacteria 774
464 Ga0207707_11209978 3300025912 Unclassified 611
465 Ga0207660_10339978 3300025917 Bacteria 1201
466 Ga0207662_10074842 3300025918 Bacteria 2056
467 Ga0207662_10140438 3300025918 Unclassified 1530
468 Ga0207662_11298251 3300025918 Unclassified 517
469 Ga0207649_10151629 3300025920 Bacteria 1597
470 Ga0207646_10044281 3300025922 Bacteria 3995
471 Ga0207646_10053237 3300025922 Bacteria 3620
472 Ga0207646_10057766 3300025922 Bacteria 3467
473 Ga0207646_10080161 3300025922 Bacteria 2919
474 Ga0207646_10134015 3300025922 Bacteria 2231
475 Ga0207646_10184443 3300025922 Bacteria 1885
476 Ga0207681_10000773 3300025923 Bacteria 21058
477 Ga0207681_10030418 3300025923 Bacteria 3520
478 Ga0207681_10072302 3300025923 Unclassified 2408
479 Ga0207681_10173791 3300025923 Bacteria 1635
480 Ga0207681_10224980 3300025923 Unclassified 1453
481 Ga0207681_10372947 3300025923 Unclassified 1147
482 Ga0207650_10001285 3300025925 Bacteria 18202
483 Ga0207650_10013683 3300025925 Bacteria 5625
484 Ga0207650_10169582 3300025925 Bacteria 1734
485 Ga0207650_10210317 3300025925 Bacteria 1562
486 Ga0207650_10726524 3300025925 Bacteria 840
487 Ga0207659_10000354 3300025926 Bacteria 27376
488 Ga0207659_10004329 3300025926 Bacteria 8578
489 Ga0207659_10014022 3300025926 Bacteria 5157
490 Ga0207659_10014457 3300025926 Bacteria 5091
491 Ga0207659_10033325 3300025926 Unclassified 3544
492 Ga0207659_10195113 3300025926 Bacteria 1613
493 Ga0207659_10739323 3300025926 Unclassified 843
494 Ga0207687_10487588 3300025927 Bacteria 1027
495 Ga0207644_10039486 3300025931 Bacteria 3332
496 Ga0207644_10413981 3300025931 Bacteria 1103
497 Ga0207644_10988863 3300025931 Unclassified 706
498 Ga0207706_10005798 3300025933 Bacteria 11486
499 Ga0207706_10012423 3300025933 Bacteria 7760
500 Ga0207706_10021330 3300025933 Bacteria 5820
501 Ga0207706_10053091 3300025933 Unclassified 3578
502 Ga0207706_10250689 3300025933 Bacteria 1546
503 Ga0207706_10496387 3300025933 Unclassified 1054
504 Ga0207686_10036528 3300025934 Unclassified 2959
505 Ga0207686_10172441 3300025934 Unclassified 1527
506 Ga0207686_10252252 3300025934 Bacteria 1290
507 Ga0207686_10668268 3300025934 Bacteria 823
508 Ga0207709_10726120 3300025935 Bacteria 797
509 Ga0207670_10057419 3300025936 Bacteria 2640
510 Ga0207670_10081928 3300025936 Bacteria 2260
511 Ga0207670_10085144 3300025936 Bacteria 2221
512 Ga0207670_10414498 3300025936 Bacteria 1080
513 Ga0207670_10538657 3300025936 Unclassified 952
514 Ga0207704_10089601 3300025938 Bacteria 2016
515 Ga0207704_10567368 3300025938 Unclassified 925
516 Ga0207704_11009565 3300025938 Unclassified 704
517 Ga0207665_10936022 3300025939 Unclassified 688
518 Ga0207691_10019254 3300025940 Bacteria 6461
519 Ga0207691_10027605 3300025940 Bacteria 5321
520 Ga0207691_10085258 3300025940 Unclassified 2835
521 Ga0207691_10351655 3300025940 Bacteria 1261
522 Ga0207691_10602869 3300025940 Unclassified 930
523 Ga0207691_10793812 3300025940 Viruses 796
524 Ga0207691_10820687 3300025940 Unclassified 781
525 Ga0207711_10014128 3300025941 Bacteria 6634
526 Ga0207711_10025914 3300025941 Bacteria 4918
527 Ga0207711_10222303 3300025941 Unclassified 1727
528 Ga0207711_10525063 3300025941 Bacteria 1104
529 Ga0207689_10010464 3300025942 Bacteria 7988
530 Ga0207689_10054561 3300025942 Bacteria 3291
531 Ga0207689_10130207 3300025942 Bacteria 2071
532 Ga0207689_10146160 3300025942 Bacteria 1948
533 Ga0207689_10324337 3300025942 Unclassified 1278
534 Ga0207689_11248514 3300025942 Unclassified 625
535 Ga0207689_11410840 3300025942 Unclassified 583
536 Ga0207679_10004995 3300025945 Bacteria 8281
537 Ga0207679_10022183 3300025945 Bacteria 4319
538 Ga0207679_11263849 3300025945 Unclassified 677
539 Ga0207679_11501112 3300025945 Unclassified 618
540 Ga0207651_10008095 3300025960 Bacteria 5649
541 Ga0207651_10008325 3300025960 Bacteria 5594
542 Ga0207651_10040961 3300025960 Bacteria 3070
543 Ga0207651_10121324 3300025960 Bacteria 1983
544 Ga0207712_10048908 3300025961 Unclassified 2944
545 Ga0207712_10108062 3300025961 Bacteria 2081
546 Ga0207712_11114362 3300025961 Unclassified 703
547 Ga0207668_10010185 3300025972 Bacteria 5672
548 Ga0207668_10186302 3300025972 Bacteria 1641
549 Ga0207668_10195732 3300025972 Unclassified 1606
550 Ga0207668_10388208 3300025972 Unclassified 1177
551 Ga0207668_10781398 3300025972 Viruses 844
552 Ga0207658_10007254 3300025986 Bacteria 7558
553 Ga0207658_10981901 3300025986 Unclassified 770
554 Ga0207677_10351250 3300026023 Bacteria 1236
555 Ga0207703_10007495 3300026035 Bacteria 8663
556 Ga0207703_10007513 3300026035 Bacteria 8650
557 Ga0207703_10018737 3300026035 Bacteria 5407
558 Ga0207703_10122198 3300026035 Bacteria 2237
559 Ga0207703_10153419 3300026035 Bacteria 2011
560 Ga0207639_10408227 3300026041 Unclassified 1225
561 Ga0207708_10016206 3300026075 Bacteria 5600
562 Ga0207708_10105835 3300026075 Unclassified 2181
563 Ga0207708_10127681 3300026075 Unclassified 1986
564 Ga0207708_10160474 3300026075 Bacteria 1775
565 Ga0207708_10194212 3300026075 Unclassified 1617
566 Ga0207641_10002926 3300026088 Bacteria 15453
567 Ga0207641_10114065 3300026088 Bacteria 2400
568 Ga0207641_12226509 3300026088 Archaea 548
569 Ga0207648_10038158 3300026089 Bacteria 4228
570 Ga0207648_10245917 3300026089 Bacteria 1594
571 Ga0207648_10940887 3300026089 Bacteria 808
572 Ga0207676_10018818 3300026095 Bacteria 5028
573 Ga0207676_10027564 3300026095 Bacteria 4232
574 Ga0207676_10043772 3300026095 Bacteria 3449
575 Ga0207676_10254868 3300026095 Unclassified 1581
576 Ga0207676_10390320 3300026095 Bacteria 1298
577 Ga0207674_10030726 3300026116 Bacteria 5646
578 Ga0207674_10322017 3300026116 Unclassified 1495
579 Ga0207674_10400688 3300026116 Bacteria 1326
580 Ga0207674_10451388 3300026116 Unclassified 1243
581 Ga0207674_10596723 3300026116 Bacteria 1067
582 Ga0207674_11022389 3300026116 Unclassified 796
583 Ga0207674_11672518 3300026116 Unclassified 605
584 Ga0207675_100002363 3300026118 Bacteria 18683
585 Ga0207675_100023053 3300026118 Bacteria 5789
586 Ga0207675_100108695 3300026118 Bacteria 2616
587 Ga0207675_100201121 3300026118 Bacteria 1914
588 Ga0207675_100792564 3300026118 Bacteria 960
589 Ga0207675_101481540 3300026118 Bacteria 699
590 Ga0207675_101822964 3300026118 Bacteria 627
591 Ga0207683_10105306 3300026121 Bacteria 2521
592 Ga0207683_10425531 3300026121 Unclassified 1223
593 Ga0207683_10706537 3300026121 Bacteria 935
594 Ga0209983_1107278 3300027665 Unclassified 634
595 Ga0207428_10000257 3300027907 Bacteria 72841
596 Ga0207428_10007238 3300027907 Bacteria 10146
597 Ga0207428_10038155 3300027907 Bacteria 3906
598 Ga0207428_10053533 3300027907 Unclassified 3218
599 Ga0207428_10096069 3300027907 Unclassified 2295
600 Ga0207428_10108257 3300027907 Unclassified 2141
601 Ga0207428_10127979 3300027907 Unclassified 1944
602 Ga0207428_10141657 3300027907 Bacteria 1835
603 Ga0207428_10183016 3300027907 Bacteria 1582
604 Ga0207428_10458793 3300027907 Bacteria 928
605 Ga0207428_10548068 3300027907 Bacteria 837
606 Ga0207428_10876415 3300027907 Bacteria 635
607 Ga0268266_10038083 3300028379 Unclassified 4095
608 Ga0268266_10815742 3300028379 Unclassified 901
609 Ga0268265_10000914 3300028380 Bacteria 27341
610 Ga0268265_10105620 3300028380 Bacteria 2286
611 Ga0268265_10234240 3300028380 Unclassified 1616
612 Ga0268265_10637809 3300028380 Unclassified 1022
613 Ga0268265_10649068 3300028380 Unclassified 1014
614 Ga0268265_10853686 3300028380 Unclassified 891
615 Ga0268265_11036573 3300028380 Bacteria 812
616 Ga0268265_11553642 3300028380 Bacteria 666
617 Ga0268264_10008603 3300028381 Bacteria 8480
618 Ga0268264_10178693 3300028381 Bacteria 1926
619 Ga0268264_10391675 3300028381 Bacteria 1333
620 Ga0268264_10879554 3300028381 Bacteria 898
621 Ga0265776_112851 3300030880 Unclassified 515
622 Ga0307408_100079448 3300031548 Bacteria 2448
623 Ga0307408_100084950 3300031548 Bacteria 2375
624 Ga0307408_100111872 3300031548 Unclassified 2099
625 Ga0307408_100506243 3300031548 Bacteria 1058
626 Ga0307405_10029123 3300031731 Bacteria 3224
627 Ga0307405_10345932 3300031731 Bacteria 1145
628 Ga0307405_11032348 3300031731 Bacteria 703
629 Ga0307413_11160325 3300031824 Unclassified 670
630 Ga0307410_10088518 3300031852 Bacteria 2192
631 Ga0307410_10974188 3300031852 Unclassified 730
632 Ga0307406_10008106 3300031901 Bacteria 5854
633 Ga0307407_10263276 3300031903 Bacteria 1187
634 Ga0307412_10003150 3300031911 Bacteria 9158
635 Ga0307409_100837825 3300031995 Bacteria 930
636 Ga0307416_100762269 3300032002 Unclassified 1061
637 Ga0307414_10089624 3300032004 Bacteria 2280
638 Ga0307414_10800070 3300032004 Bacteria 860
639 Ga0307411_10031212 3300032005 Bacteria 3275
640 Ga0307411_10095793 3300032005 Bacteria 2085
641 Ga0307411_10457597 3300032005 Bacteria 1069
642 Ga0307415_100007727 3300032126 Bacteria 5906
643 Ga0307415_100033468 3300032126 Bacteria 3337
644 Ga0373958_0028530 3300034819 Bacteria 1081
645 Ga0373940_0040753 3300035088 Bacteria 1276
646 Ga0373952_0206636 3300035092 Unclassified 578
647 Ga0373939_0323111 3300035114 Unclassified 621
648 Ga0373939_0340778 3300035114 Unclassified 608
649 Ga0373941_0337407 3300035115 Unclassified 610
650 Ga0373953_0064582 3300035117 Unclassified 1502
651 Ga0373957_0011830 3300035120 Bacteria 2923
652 Ga0373955_0086046 3300035172 Bacteria 1785
653 Ga0373931_0540165 3300035691 Unclassified 756
654 Ga0373933_0294321 3300035724 Bacteria 1050
655 Ga0373933_0694711 3300035724 Unclassified 669
656 Ga0373937_0001625 3300036401 Bacteria 18877
657 Ga0373937_0013638 3300036401 Bacteria 7162
658 Ga0373937_0314219 3300036401 Unclassified 1482
659 Ga0373937_0583037 3300036401 Bacteria 1062
660 Ga0373937_1017568 3300036401 Bacteria 777
661 Ga0373937_1764152 3300036401 Bacteria 566
662 Ga0373925_0556929 3300037068 Unclassified 943
663 Ga0395898_1765914 3300037466 Bacteria 540
664 Ga0395905_1868840 3300037471 Bacteria 507
665 Ga0242420_059273 3300038996 Unclassified 761
666 Ga0436362_0662616 3300039453 Bacteria 901
667 Ga0436362_1033597 3300039453 Unclassified 667
668 Ga0439439_0108253 3300041406 Bacteria 769
669 Ga0439433_0081418 3300041999 Unclassified 788
670 Ga0439455_0268680 3300042012 Unclassified 501
671 Ga0439446_0042445 3300042156 Unclassified 1342
672 Ga0439446_0157965 3300042156 Bacteria 749
673 Ga0439464_0203032 3300042439 Unclassified 633
674 Ga0439460_0055124 3300042461 Bacteria 1201
675 Ga0439440_0050493 3300042993 Unclassified 1038
676 Ga0453684_1966810 3300044712 Unclassified 590
677 Ga0451576_0066916 3300045051 Bacteria 3739
678 Ga0451576_0868840 3300045051 Bacteria 947
679 Ga0495591_109541 3300046458 Bacteria 679
680 Ga0495608_0194702 3300046511 Bacteria 1279
681 Ga0495628_0180706 3300046516 Unclassified 1596
682 Ga0495630_0265816 3300046517 Bacteria 1310
683 Ga0495630_0439150 3300046517 Bacteria 1000
684 Ga0495643_0166905 3300046522 Unclassified 1079
685 Ga0495644_0169634 3300046523 Unclassified 838
686 Ga0495644_0428582 3300046523 Bacteria 525
687 Ga0495642_0057611 3300046528 Bacteria 1607
688 Ga0495652_0211501 3300046529 Bacteria 1464
689 Ga0495652_1024184 3300046529 Bacteria 539
690 Ga0495640_0597294 3300046533 Unclassified 667
691 Ga0495586_0062089 3300046535 Bacteria 2034
692 Ga0495586_0063796 3300046535 Bacteria 2007
693 Ga0495586_0220496 3300046535 Bacteria 1078
694 Ga0495586_0333672 3300046535 Unclassified 870
695 Ga0495598_0002149 3300046537 Unclassified 4027
696 Ga0495598_0003065 3300046537 Bacteria 3512
697 Ga0495598_0161585 3300046537 Bacteria 788
698 Ga0495609_0165631 3300046538 Bacteria 935
699 Ga0495621_0001066 3300046539 Bacteria 7020
700 Ga0495621_0022380 3300046539 Unclassified 2094
701 Ga0495621_0075672 3300046539 Unclassified 1248
702 Ga0495621_0094353 3300046539 Unclassified 1132
703 Ga0495633_0032830 3300046558 Unclassified 2506
704 Ga0495633_0139325 3300046558 Bacteria 1122
705 Ga0495633_0475692 3300046558 Unclassified 564
706 Ga0495667_0000216 3300046559 Bacteria 38531
707 Ga0495656_0272240 3300046615 Bacteria 861
708 Ga0495634_0097959 3300046642 Bacteria 1897
709 Ga0495635_0136059 3300046663 Bacteria 1675
710 Ga0495659_0064883 3300046664 Bacteria 1357
711 Ga0495659_0081227 3300046664 Bacteria 1230
712 Ga0495657_0046672 3300046675 Bacteria 2931
713 Ga0495658_0302808 3300046683 Bacteria 1011
714 Ga0495669_0169440 3300046684 Bacteria 1038
715 Ga0495613_0049271 3300046689 Bacteria 3109
716 Ga0495613_0142312 3300046689 Bacteria 1713
717 Ga0495670_0159362 3300046691 Bacteria 1185
718 Ga0495670_0203359 3300046691 Bacteria 1049
719 Ga0495600_0636938 3300046809 Bacteria 645
720 Ga0495636_0129585 3300047318 Unclassified 1121
721 Ga0495636_0189868 3300047318 Bacteria 935
722 Ga0495674_0111629 3300047319 Unclassified 2317
723 Ga0495676_0989718 3300047321 Unclassified 537
724 Ga0495677_0095075 3300047445 Bacteria 1125
725 Ga0495677_0154507 3300047445 Archaea 884
726 Ga0495684_0064858 3300047471 Bacteria 2776
727 Ga0495602_1062127 3300048088 Bacteria 532
728 Ga0496104_0592410 3300048907 Unclassified 1019
729 Ga0496109_1249466 3300048912 Unclassified 679
730 Ga0496110_1899285 3300048913 Unclassified 505
731 Ga0496114_0311303 3300048917 Bacteria 1391
732 Ga0496114_1088783 3300048917 Unclassified 684
733 Ga0501295_147527 3300049518 Unclassified 579
734 Ga0501298_009016 3300049521 Unclassified 1688
735 Ga0501076_1251406 3300049592 Unclassified 611
736 Ga0501259_131099 3300049688 Unclassified 605
737 Ga0501079_0470985 3300049741 Bacteria 987
738 Ga0501045_0078678 3300049824 Bacteria 2431
739 nmdc:mga05p37_1010553_c1 3300050507 Bacteria 882
740 nmdc:mga05p37_10747_c1 3300050507 Bacteria 10866
741 nmdc:mga05p37_125791_c1 3300050507 Bacteria 3148
742 nmdc:mga05p37_14014_c1 3300050507 Bacteria 9616
743 nmdc:mga05p37_16953_c2 3300050507 Bacteria 8298
744 nmdc:mga05p37_185163_c1 3300050507 Bacteria 2532
745 nmdc:mga05p37_336294_c1 3300050507 Bacteria 1782
746 nmdc:mga05p37_363355_c1 3300050507 Bacteria 1701
747 nmdc:mga05p37_47939_c1 3300050507 Bacteria 5254
748 nmdc:mga05p37_567064_c1 3300050507 Bacteria 1289
749 nmdc:mga05p37_821299_c1 3300050507 Unclassified 1014
750 nmdc:mga05p37_846977_c1 3300050507 Bacteria 993
751 nmdc:mga05p37_90563_c1 3300050507 Bacteria 3769
752 nmdc:mga09592_120401_c1 3300050508 Bacteria 2254
753 nmdc:mga09592_299516_c1 3300050508 Bacteria 1394
754 nmdc:mga09592_316169_c1 3300050508 Bacteria 1353
755 nmdc:mga09592_482685_c1 3300050508 Unclassified 1068
756 nmdc:mga09592_589126_c1 3300050508 Unclassified 953
757 nmdc:mga09592_74849_c1 3300050508 Bacteria 2878
758 nmdc:mga09592_924067_c1 3300050508 Unclassified 732
759 nmdc:mga0qj67_135024_c1 3300050509 Bacteria 1999
760 nmdc:mga0qj67_2553_c1 3300050509 Bacteria 13010
761 nmdc:mga0qj67_768065_c1 3300050509 Unclassified 764
762 nmdc:mga0qj67_943803_c1 3300050509 Bacteria 678
763 nmdc:mga06r32_2038628_c1 3300050510 Unclassified 507
764 nmdc:mga06r32_260479_c1 3300050510 Unclassified 1722
765 nmdc:mga06r32_269546_c1 3300050510 Bacteria 1690
766 nmdc:mga06r32_6112_c1 3300050510 Bacteria 10812
767 nmdc:mga06r32_80345_c1 3300050510 Bacteria 3173
768 nmdc:mga08y16_12426_c1 3300050511 Bacteria 8960
769 nmdc:mga08y16_157303_c1 3300050511 Bacteria 2362
770 nmdc:mga08y16_166876_c1 3300050511 Bacteria 2287
771 nmdc:mga08y16_178333_c1 3300050511 Unclassified 2207
772 nmdc:mga08y16_2581_c1 3300050511 Bacteria 18625
773 nmdc:mga08y16_341595_c1 3300050511 Bacteria 1539
774 nmdc:mga08y16_35118_c1 3300050511 Bacteria 5266
775 nmdc:mga08y16_36811_c1 3300050511 Bacteria 5139
776 nmdc:mga08y16_476597_c1 3300050511 Bacteria 1270
777 nmdc:mga08y16_48059_c1 3300050511 Unclassified 4465
778 nmdc:mga08y16_502320_c1 3300050511 Bacteria 1232
779 nmdc:mga08y16_54590_c1 3300050511 Unclassified 4175
780 nmdc:mga08y16_5959_c1 3300050511 Bacteria 12782
781 nmdc:mga08y16_714712_c1 3300050511 Unclassified 1000
782 nmdc:mga08y16_72823_c1 3300050511 Bacteria 3580
783 nmdc:mga08y16_89018_c1 3300050511 Unclassified 3217
784 nmdc:mga0n895_1188749_c1 3300050512 Unclassified 737
785 nmdc:mga0n895_205640_c1 3300050512 Bacteria 1999
786 nmdc:mga0n895_233325_c1 3300050512 Bacteria 1868
787 nmdc:mga0n895_25979_c1 3300050512 Bacteria 5539
788 nmdc:mga0n895_31523_c1 3300050512 Bacteria 5077
789 nmdc:mga0n895_442938_c1 3300050512 Bacteria 1312
790 nmdc:mga0n895_445897_c1 3300050512 Bacteria 1307
791 nmdc:mga0n895_59434_c1 3300050512 Bacteria 3771
792 nmdc:mga0n895_61590_c1 3300050512 Unclassified 3705
793 nmdc:mga0n895_6_c1 3300050512 Bacteria 122829
794 nmdc:mga0n895_997898_c1 3300050512 Bacteria 819
795 nmdc:mga0rr50_1258735_c1 3300050513 Unclassified 628
796 nmdc:mga0rr50_145219_c1 3300050513 Bacteria 1912
797 nmdc:mga0rr50_23335_c1 3300050513 Bacteria 4265
798 nmdc:mga0rr50_332750_c1 3300050513 Bacteria 1275
799 nmdc:mga0rr50_74701_c1 3300050513 Unclassified 2596
800 nmdc:mga0rr50_7_c1 3300050513 Bacteria 297175
801 nmdc:mga08x19_159034_c1 3300050514 Bacteria 1534
802 nmdc:mga08x19_161777_c1 3300050514 Bacteria 1521
803 nmdc:mga08x19_49365_c1 3300050514 Bacteria 2698
804 nmdc:mga08x19_67_c1 3300050514 Bacteria 80016
805 nmdc:mga0a205_216922_c1 3300050515 Bacteria 1800
806 nmdc:mga0a205_268763_c1 3300050515 Unclassified 1582
807 nmdc:mga0a205_362434_c1 3300050515 Bacteria 1316
808 nmdc:mga0a205_47146_c1 3300050515 Bacteria 4157
809 nmdc:mga0a205_495383_c1 3300050515 Unclassified 1079
810 nmdc:mga0a205_67486_c1 3300050515 Unclassified 3455
811 nmdc:mga0a205_689522_c1 3300050515 Unclassified 872
812 nmdc:mga0a205_90130_c1 3300050515 Bacteria 2963
813 nmdc:mga0a205_968554_c1 3300050515 Unclassified 698
814 Ga0495619_0299821 3300053085 Bacteria 1113
815 Ga0501084_0917221 3300054114 Unclassified 737
816 Ga0587084_028964 3300059477 Unclassified 880
817 Ga0587077_008132 3300059493 Bacteria 1552
818 Ga0587101_094268 3300059623 Unclassified 586
819 Ga0587117_001467 3300059627 Bacteria 2004
820 Ga0587071_026294 3300060344 Bacteria 1097
821 Ga0587111_0009054 3300060346 Bacteria 1668
822 Ga0587111_0134958 3300060346 Unclassified 649
823 Ga0530510_0898206 3300061734 Bacteria 677
824 Ga0097621_100401199
825 ARcpr5yngRDRAFT_c015761
826 JGI24746J21847_1017555
827 JGI25406J46586_10000191
828 JGI25406J46586_10011690
829 JGI25406J46586_10194635
830 Ga0007410J51695_1058436
831 Ga0007409J51694_1099884
832 Ga0007416J51690_1070261
833 Ga0032354_1113736
834 Ga0058858_1192668
835 Ga0058858_1396011
836 Ga0058859_10071507
837 Ga0058859_11564696
838 Ga0058859_11572019
839 Ga0058859_11648162
840 Ga0058859_11651765
841 Ga0058859_11721032
842 Ga0058859_11796824
843 Ga0058859_11799877
844 Ga0058863_10051321
845 Ga0058863_10133683
846 Ga0058860_10059000
847 Ga0058860_10099214
848 Ga0058860_11472822
849 Ga0058860_11524806
850 Ga0058860_12052082
851 Ga0058862_10272084
852 Ga0065714_10047208
853 Ga0065714_10100875
854 Ga0065712_10208227
855 Ga0065712_10394087
856 Ga0065715_10015782
857 Ga0065715_10129483
858 Ga0065715_10321296
859 Ga0065715_10569228
860 Ga0065715_10646683
861 Ga0065707_10042440
862 Ga0065707_10120598
863 Ga0065707_10320942
864 Ga0070676_10007251
865 Ga0070676_10073938
866 Ga0070676_10480545
867 Ga0070676_10548552
868 Ga0070676_11054214
869 Ga0070683_100570547
870 Ga0070690_100002003
871 Ga0070690_100268258
872 Ga0070690_100403544
873 Ga0070690_100950260
874 Ga0070690_101198142
875 Ga0070670_100001562
876 Ga0070670_100015895
877 Ga0070670_100022899
878 Ga0070670_100798551
879 Ga0070670_100821320
880 Ga0070677_10011811
881 Ga0070677_10047400
882 Ga0070677_10222570
883 Ga0068869_100013297
884 Ga0068869_100222037
885 Ga0068869_100395709
886 Ga0068869_100540617
887 Ga0070666_10051919
888 Ga0070666_10156515
889 Ga0070666_10205308
890 Ga0070666_10207554
891 Ga0070666_10583671
892 Ga0070666_10700690
893 Ga0070666_10840683
894 Ga0070680_100490234
895 Ga0068868_101315850
896 Ga0070689_100025501
897 Ga0070689_100041645
898 Ga0070689_100074781
899 Ga0070689_100131936
900 Ga0070689_100154751
901 Ga0070689_100422724
902 Ga0070691_10716230
903 Ga0070687_100044394
904 Ga0070687_100120027
905 Ga0070687_100123109
906 Ga0070661_100097223
907 Ga0070661_100200614
908 Ga0070692_10148666
909 Ga0070692_10204022
910 Ga0070692_10532565
911 Ga0070668_100024393
912 Ga0070668_100206312
913 Ga0070668_100292043
914 Ga0070668_101108177
915 Ga0070668_101160737
916 Ga0070669_100000757
917 Ga0070669_100028157
918 Ga0070669_100037540
919 Ga0070669_100116240
920 Ga0070669_100304709
921 Ga0070669_100382364
922 Ga0070669_100479147
923 Ga0070675_100000121
924 Ga0070675_100017747
925 Ga0070675_100023004
926 Ga0070675_100083671
927 Ga0070675_100096023
928 Ga0070675_100138116
929 Ga0070675_100231069
930 Ga0070675_100325907
931 Ga0070675_100835199
932 Ga0070671_100027306
933 Ga0070671_100047495
934 Ga0070671_100451708
935 Ga0070674_100003046
936 Ga0070674_100592472
937 Ga0070674_100619667
938 Ga0070674_101259067
939 Ga0070673_100038736
940 Ga0070673_100044145
941 Ga0070673_100236046
942 Ga0070673_100416706
943 Ga0070688_100006887
944 Ga0070688_100051748
945 Ga0070688_100083752
946 Ga0070688_100106696
947 Ga0070688_100180142
948 Ga0070688_100467404
949 Ga0070667_100044380
950 Ga0070667_100280794
951 Ga0070667_100596811
952 Ga0070703_10216170
953 Ga0070703_10336424
954 Ga0070709_11113255
955 Ga0070713_100967910
956 Ga0070701_10016711
957 Ga0070701_10093035
958 Ga0070701_10360642
959 Ga0070705_100236176
960 Ga0070705_100465276
961 Ga0070705_100518155
962 Ga0070700_100275571
963 Ga0070700_100692072
964 Ga0070700_100879150
965 Ga0070694_100005209
966 Ga0070694_100010647
967 Ga0070694_100032663
968 Ga0070694_100242238
969 Ga0070694_100574857
970 Ga0070694_101332320
971 Ga0070708_100758366
972 Ga0070708_101047007
973 Ga0070678_100488567
974 Ga0070678_100542422
975 Ga0070662_100061685
976 Ga0070662_100295618
977 Ga0070662_100350598
978 Ga0070662_100402793
979 Ga0070662_100907671
980 Ga0070662_101364543
981 Ga0070681_10426533
982 Ga0068867_100067964
983 Ga0068867_100149607
984 Ga0068867_100181301
985 Ga0068867_100948915
986 Ga0070685_10023516
987 Ga0070685_10033064
988 Ga0070685_10044817
989 Ga0070685_10073767
990 Ga0070685_10131169
991 Ga0070685_10380088
992 Ga0070706_100190249
993 Ga0070706_100444759
994 Ga0070706_100697006
995 Ga0070706_100828984
996 Ga0070706_100840982
997 Ga0070707_100030488
998 Ga0070707_100033449
999 Ga0070707_100238874
1000 Ga0070707_100488396
1001 Ga0070707_101330764
1002 Ga0070698_100027538
1003 Ga0070698_100090648
1004 Ga0070698_100126839
1005 Ga0070698_101278128
1006 Ga0070698_101672266
1007 Ga0070699_100000553
1008 Ga0070699_100030973
1009 Ga0070699_100082154
1010 Ga0070699_100263853
1011 Ga0070699_101828742
1012 Ga0070684_100729920
1013 Ga0070697_100101516
1014 Ga0070697_100131502
1015 Ga0070697_100487599
1016 Ga0070672_100007408
1017 Ga0070672_100021138
1018 Ga0070672_100110702
1019 Ga0070672_100327209
1020 Ga0070672_100357753
1021 Ga0070672_100507324
1022 Ga0070672_100802544
1023 Ga0070686_100042435
1024 Ga0070686_100080478
1025 Ga0070686_100173527
1026 Ga0070686_100784679
1027 Ga0070686_101050977
1028 Ga0070695_100190944
1029 Ga0070695_100413680
1030 Ga0070695_101364933
1031 Ga0070695_101547173
1032 Ga0070696_100028060
1033 Ga0070696_100047809
1034 Ga0070696_100081877
1035 Ga0070696_100955426
1036 Ga0070665_100180872
1037 Ga0070665_101274835
1038 Ga0070665_102161612
1039 Ga0070704_100005992
1040 Ga0070704_100030187
1041 Ga0070704_100036994
1042 Ga0070704_100086029
1043 Ga0070704_100122218
1044 Ga0070704_100381568
1045 Ga0070664_100025349
1046 Ga0070664_100026394
1047 Ga0070664_100241580
1048 Ga0070664_100320071
1049 Ga0070664_101348391
1050 Ga0068857_100069047
1051 Ga0068857_100095717
1052 Ga0068857_100359218
1053 Ga0068857_100405638
1054 Ga0068857_100812388
1055 Ga0068857_101284066
1056 Ga0070702_100182833
1057 Ga0070702_100213615
1058 Ga0070702_100892913
1059 Ga0068852_101579679
1060 Ga0068859_100000730
1061 Ga0068859_100001253
1062 Ga0068859_100004340
1063 Ga0068859_100091551
1064 Ga0068859_100286335
1065 Ga0068859_100526866
1066 Ga0068859_100918525
1067 Ga0068859_101004660
1068 Ga0068859_101129931
1069 Ga0068859_101515254
1070 Ga0068859_101691998
1071 Ga0068859_102893461
1072 Ga0068864_100009147
1073 Ga0068864_100034304
1074 Ga0068864_100366142
1075 Ga0068864_101447682
1076 Ga0068864_102368581
1077 Ga0068866_10785066
1078 Ga0068861_100077310
1079 Ga0068861_100899433
1080 Ga0068861_101127151
1081 Ga0068861_101187799
1082 Ga0068870_10122017
1083 Ga0068870_10235360
1084 Ga0068870_10916522
1085 Ga0068863_100001411
1086 Ga0068863_100026428
1087 Ga0068858_100016190
1088 Ga0068858_100028953
1089 Ga0068858_100040340
1090 Ga0068858_100168893
1091 Ga0068858_101350863
1092 Ga0068860_100005789
1093 Ga0068860_100201695
1094 Ga0068860_100401146
1095 Ga0068860_102591144
1096 Ga0068862_100008247
1097 Ga0068862_100160485
1098 Ga0068862_100324872
1099 Ga0068862_100348154
1100 Ga0068862_100774741
1101 Ga0068862_100830880
1102 Ga0068862_101658211
1103 Ga0081455_10800867
1104 Ga0081539_10000047
1105 Ga0081539_10000175
1106 Ga0081539_10002917
1107 Ga0070716_100209180
1108 Ga0097621_100019510
1109 Ga0068871_100479028
1110 Ga0075428_100007083
1111 Ga0075428_100048555
1112 Ga0075428_100064041
1113 Ga0075428_100075038
1114 Ga0075428_100093723
1115 Ga0075428_100095081
1116 Ga0075428_100160794
1117 Ga0075428_100872996
1118 Ga0075430_100002832
1119 Ga0075430_100271426
1120 Ga0075430_100301560
1121 Ga0075430_100482439
1122 Ga0075431_100001359
1123 Ga0075431_100079364
1124 Ga0075431_100135108
1125 Ga0075431_100619743
1126 Ga0075433_10053439
1127 Ga0075433_10124988
1128 Ga0075433_10274642
1129 Ga0075433_10287243
1130 Ga0075433_10547664
1131 Ga0075434_100022942
1132 Ga0075434_100031687
1133 Ga0075434_100075345
1134 Ga0075434_100118207
1135 Ga0075434_100252178
1136 Ga0075434_101048653
1137 Ga0075434_101068144
1138 Ga0075434_101645864
1139 Ga0075429_100009790
1140 Ga0075429_100230364
1141 Ga0075429_100383275
1142 Ga0075429_100405831
1143 Ga0075429_101219230
1144 Ga0068865_100067873
1145 Ga0068865_100114245
1146 Ga0068865_100212050
1147 Ga0068865_101046448
1148 Ga0068865_101162144
1149 Ga0075436_100000806
1150 Ga0075436_100205728
1151 Ga0097620_100000730
1152 Ga0097620_100001253
1153 Ga0097620_100004340
1154 Ga0097620_100091549
1155 Ga0097620_100286319
1156 Ga0097620_100526876
1157 Ga0097620_100918534
1158 Ga0097620_101004761
1159 Ga0097620_101130087
1160 Ga0097620_101515209
1161 Ga0097620_101691529
1162 Ga0097620_102894074
1163 Ga0075435_100000267
1164 Ga0075435_100013520
1165 Ga0075435_100065622
1166 Ga0075435_100275568
1167 Ga0075435_100520884
1168 Ga0111539_10000810
1169 Ga0111539_10003655
1170 Ga0111539_10009096
1171 Ga0111539_10009153
1172 Ga0111539_10010337
1173 Ga0111539_10047424
1174 Ga0111539_10063870
1175 Ga0111539_10206121
1176 Ga0111539_10283744
1177 Ga0111539_10296524
1178 Ga0111539_10449902
1179 Ga0111539_10507308
1180 Ga0111539_11032975
1181 Ga0111539_11455053
1182 Ga0105245_10656290
1183 Ga0105247_10013444
1184 Ga0105247_10595404
1185 Ga0114129_10021195
1186 Ga0114129_10030036
1187 Ga0114129_10048846
1188 Ga0114129_10084437
1189 Ga0114129_10269786
1190 Ga0114129_10305666
1191 Ga0114129_10334801
1192 Ga0114129_10354645
1193 Ga0114129_10375571
1194 Ga0114129_10914392
1195 Ga0114129_11213102
1196 Ga0114129_12650429
1197 Ga0105243_10593974
1198 Ga0105243_10877492
1199 Ga0105243_11216664
1200 Ga0105243_11714072
1201 Ga0105243_12148053
1202 Ga0105243_12251236
1203 Ga0105242_10227694
1204 Ga0105242_10229138
1205 Ga0105242_10565389
1206 Ga0105242_11296581
1207 Ga0105242_11636858
1208 Ga0105242_13035302
1209 Ga0105248_10000871
1210 Ga0105248_10006333
1211 Ga0105248_10095215
1212 Ga0105248_10237950
1213 Ga0105248_10352025
1214 Ga0105248_10764786
1215 Ga0105248_12268962
1216 Ga0105237_12619633
1217 Ga0105249_10043818
1218 Ga0105249_10730676
1219 Ga0105249_10869173
1220 Ga0105249_11411979
1221 Ga0105246_10032370
1222 Ga0105246_10537905
1223 Ga0157319_1010625
1224 Ga0157374_10813759
1225 Ga0157378_10113894
1226 Ga0157378_10175452
1227 Ga0157378_12974815
1228 Ga0163162_10037092
1229 Ga0163162_10044148
1230 Ga0163162_10506803
1231 Ga0163162_10802775
1232 Ga0157375_10000800
1233 Ga0157375_10009094
1234 Ga0157375_10188172
1235 Ga0157375_11601246
1236 Ga0157375_11957549
1237 Ga0157375_12182625
1238 Ga0163163_10003949
1239 Ga0163163_10009812
1240 Ga0157380_10014879
1241 Ga0157380_10080366
1242 Ga0157380_10093700
1243 Ga0157380_10264958
1244 Ga0157380_10377662
1245 Ga0157380_12246530
1246 Ga0157377_10167510
1247 Ga0157377_10474982
1248 Ga0157379_10000641
1249 Ga0157379_10176467
1250 Ga0157379_10259651
1251 Ga0157379_10916558
1252 Ga0157376_10296663
1253 Ga0157376_10366346
1254 Ga0163161_10022156
1255 Ga0163161_10075551
1256 Ga0163161_10355442
1257 Ga0207673_1011185
1258 Ga0207697_10000863
1259 Ga0207697_10131966
1260 Ga0207697_10395785
1261 Ga0207682_10008116
1262 Ga0207682_10012819
1263 Ga0207682_10015675
1264 Ga0207642_10639446
1265 Ga0207710_10019360
1266 Ga0207710_10395092
1267 Ga0207688_10026729
1268 Ga0207688_10982932
1269 Ga0207680_10011450
1270 Ga0207680_10056231
1271 Ga0207680_10126299
1272 Ga0207680_10133338
1273 Ga0207680_10583214
1274 Ga0207647_10235920
1275 Ga0207699_10426555
1276 Ga0207645_10028865
1277 Ga0207645_10050501
1278 Ga0207645_10240031
1279 Ga0207645_10286843
1280 Ga0207645_10452862
1281 Ga0207643_10002040
1282 Ga0207643_10088845
1283 Ga0207684_10458333
1284 Ga0207684_10657026
1285 Ga0207684_11631220
1286 Ga0207707_10819225
1287 Ga0207707_11209978
1288 Ga0207660_10339978
1289 Ga0207662_10074842
1290 Ga0207662_10140438
1291 Ga0207662_11298251
1292 Ga0207649_10151629
1293 Ga0207646_10044281
1294 Ga0207646_10053237
1295 Ga0207646_10057766
1296 Ga0207646_10080161
1297 Ga0207646_10134015
1298 Ga0207646_10184443
1299 Ga0207681_10000773
1300 Ga0207681_10030418
1301 Ga0207681_10072302
1302 Ga0207681_10173791
1303 Ga0207681_10224980
1304 Ga0207681_10372947
1305 Ga0207650_10001285
1306 Ga0207650_10013683
1307 Ga0207650_10169582
1308 Ga0207650_10210317
1309 Ga0207650_10726524
1310 Ga0207659_10000354
1311 Ga0207659_10004329
1312 Ga0207659_10014022
1313 Ga0207659_10014457
1314 Ga0207659_10033325
1315 Ga0207659_10195113
1316 Ga0207659_10739323
1317 Ga0207687_10487588
1318 Ga0207644_10039486
1319 Ga0207644_10413981
1320 Ga0207644_10988863
1321 Ga0207706_10005798
1322 Ga0207706_10012423
1323 Ga0207706_10021330
1324 Ga0207706_10053091
1325 Ga0207706_10250689
1326 Ga0207706_10496387
1327 Ga0207686_10036528
1328 Ga0207686_10172441
1329 Ga0207686_10252252
1330 Ga0207686_10668268
1331 Ga0207709_10726120
1332 Ga0207670_10057419
1333 Ga0207670_10081928
1334 Ga0207670_10085144
1335 Ga0207670_10414498
1336 Ga0207670_10538657
1337 Ga0207704_10089601
1338 Ga0207704_10567368
1339 Ga0207704_11009565
1340 Ga0207665_10936022
1341 Ga0207691_10019254
1342 Ga0207691_10027605
1343 Ga0207691_10085258
1344 Ga0207691_10351655
1345 Ga0207691_10602869
1346 Ga0207691_10793812
1347 Ga0207691_10820687
1348 Ga0207711_10014128
1349 Ga0207711_10025914
1350 Ga0207711_10222303
1351 Ga0207711_10525063
1352 Ga0207689_10010464
1353 Ga0207689_10054561
1354 Ga0207689_10130207
1355 Ga0207689_10146160
1356 Ga0207689_10324337
1357 Ga0207689_11248514
1358 Ga0207689_11410840
1359 Ga0207679_10004995
1360 Ga0207679_10022183
1361 Ga0207679_11263849
1362 Ga0207679_11501112
1363 Ga0207651_10008095
1364 Ga0207651_10008325
1365 Ga0207651_10040961
1366 Ga0207651_10121324
1367 Ga0207712_10048908
1368 Ga0207712_10108062
1369 Ga0207712_11114362
1370 Ga0207668_10010185
1371 Ga0207668_10186302
1372 Ga0207668_10195732
1373 Ga0207668_10388208
1374 Ga0207668_10781398
1375 Ga0207658_10007254
1376 Ga0207658_10981901
1377 Ga0207677_10351250
1378 Ga0207703_10007495
1379 Ga0207703_10007513
1380 Ga0207703_10018737
1381 Ga0207703_10122198
1382 Ga0207703_10153419
1383 Ga0207639_10408227
1384 Ga0207708_10016206
1385 Ga0207708_10105835
1386 Ga0207708_10127681
1387 Ga0207708_10160474
1388 Ga0207708_10194212
1389 Ga0207641_10002926
1390 Ga0207641_10114065
1391 Ga0207641_12226509
1392 Ga0207648_10038158
1393 Ga0207648_10245917
1394 Ga0207648_10940887
1395 Ga0207676_10018818
1396 Ga0207676_10027564
1397 Ga0207676_10043772
1398 Ga0207676_10254868
1399 Ga0207676_10390320
1400 Ga0207674_10030726
1401 Ga0207674_10322017
1402 Ga0207674_10400688
1403 Ga0207674_10451388
1404 Ga0207674_10596723
1405 Ga0207674_11022389
1406 Ga0207674_11672518
1407 Ga0207675_100002363
1408 Ga0207675_100023053
1409 Ga0207675_100108695
1410 Ga0207675_100201121
1411 Ga0207675_100792564
1412 Ga0207675_101481540
1413 Ga0207675_101822964
1414 Ga0207683_10105306
1415 Ga0207683_10425531
1416 Ga0207683_10706537
1417 Ga0209983_1107278
1418 Ga0207428_10000257
1419 Ga0207428_10007238
1420 Ga0207428_10038155
1421 Ga0207428_10053533
1422 Ga0207428_10096069
1423 Ga0207428_10108257
1424 Ga0207428_10127979
1425 Ga0207428_10141657
1426 Ga0207428_10183016
1427 Ga0207428_10458793
1428 Ga0207428_10548068
1429 Ga0207428_10876415
1430 Ga0268266_10038083
1431 Ga0268266_10815742
1432 Ga0268265_10000914
1433 Ga0268265_10105620
1434 Ga0268265_10234240
1435 Ga0268265_10637809
1436 Ga0268265_10649068
1437 Ga0268265_10853686
1438 Ga0268265_11036573
1439 Ga0268265_11553642
1440 Ga0268264_10008603
1441 Ga0268264_10178693
1442 Ga0268264_10391675
1443 Ga0268264_10879554
1444 Ga0265776_112851
1445 Ga0307408_100079448
1446 Ga0307408_100084950
1447 Ga0307408_100111872
1448 Ga0307408_100506243
1449 Ga0307405_10029123
1450 Ga0307405_10345932
1451 Ga0307405_11032348
1452 Ga0307413_11160325
1453 Ga0307410_10088518
1454 Ga0307410_10974188
1455 Ga0307406_10008106
1456 Ga0307407_10263276
1457 Ga0307412_10003150
1458 Ga0307409_100837825
1459 Ga0307416_100762269
1460 Ga0307414_10089624
1461 Ga0307414_10800070
1462 Ga0307411_10031212
1463 Ga0307411_10095793
1464 Ga0307411_10457597
1465 Ga0307415_100007727
1466 Ga0307415_100033468
1467 Ga0373958_0028530
1468 Ga0373940_0040753
1469 Ga0373952_0206636
1470 Ga0373939_0323111
1471 Ga0373939_0340778
1472 Ga0373941_0337407
1473 Ga0373953_0064582
1474 Ga0373957_0011830
1475 Ga0373955_0086046
1476 Ga0373931_0540165
1477 Ga0373933_0294321
1478 Ga0373933_0694711
1479 Ga0373937_0001625
1480 Ga0373937_0013638
1481 Ga0373937_0314219
1482 Ga0373937_0583037
1483 Ga0373937_1017568
1484 Ga0373937_1764152
1485 Ga0373925_0556929
1486 Ga0395898_1765914
1487 Ga0395905_1868840
1488 Ga0242420_059273
1489 Ga0436362_0662616
1490 Ga0436362_1033597
1491 Ga0439439_0108253
1492 Ga0439433_0081418
1493 Ga0439455_0268680
1494 Ga0439446_0042445
1495 Ga0439446_0157965
1496 Ga0439464_0203032
1497 Ga0439460_0055124
1498 Ga0439440_0050493
1499 Ga0453684_1966810
1500 Ga0451576_0066916
1501 Ga0451576_0868840
1502 Ga0495591_109541
1503 Ga0495608_0194702
1504 Ga0495628_0180706
1505 Ga0495630_0265816
1506 Ga0495630_0439150
1507 Ga0495643_0166905
1508 Ga0495644_0169634
1509 Ga0495644_0428582
1510 Ga0495642_0057611
1511 Ga0495652_0211501
1512 Ga0495652_1024184
1513 Ga0495640_0597294
1514 Ga0495586_0062089
1515 Ga0495586_0063796
1516 Ga0495586_0220496
1517 Ga0495586_0333672
1518 Ga0495598_0002149
1519 Ga0495598_0003065
1520 Ga0495598_0161585
1521 Ga0495609_0165631
1522 Ga0495621_0001066
1523 Ga0495621_0022380
1524 Ga0495621_0075672
1525 Ga0495621_0094353
1526 Ga0495633_0032830
1527 Ga0495633_0139325
1528 Ga0495633_0475692
1529 Ga0495667_0000216
1530 Ga0495656_0272240
1531 Ga0495634_0097959
1532 Ga0495635_0136059
1533 Ga0495659_0064883
1534 Ga0495659_0081227
1535 Ga0495657_0046672
1536 Ga0495658_0302808
1537 Ga0495669_0169440
1538 Ga0495613_0049271
1539 Ga0495613_0142312
1540 Ga0495670_0159362
1541 Ga0495670_0203359
1542 Ga0495600_0636938
1543 Ga0495636_0129585
1544 Ga0495636_0189868
1545 Ga0495674_0111629
1546 Ga0495676_0989718
1547 Ga0495677_0095075
1548 Ga0495677_0154507
1549 Ga0495684_0064858
1550 Ga0495602_1062127
1551 Ga0496104_0592410
1552 Ga0496109_1249466
1553 Ga0496110_1899285
1554 Ga0496114_0311303
1555 Ga0496114_1088783
1556 Ga0501295_147527
1557 Ga0501298_009016
1558 Ga0501076_1251406
1559 Ga0501259_131099
1560 Ga0501079_0470985
1561 Ga0501045_0078678
1562 nmdc:mga05p37_1010553_c1
1563 nmdc:mga05p37_10747_c1
1564 nmdc:mga05p37_125791_c1
1565 nmdc:mga05p37_14014_c1
1566 nmdc:mga05p37_16953_c2
1567 nmdc:mga05p37_185163_c1
1568 nmdc:mga05p37_336294_c1
1569 nmdc:mga05p37_363355_c1
1570 nmdc:mga05p37_47939_c1
1571 nmdc:mga05p37_567064_c1
1572 nmdc:mga05p37_821299_c1
1573 nmdc:mga05p37_846977_c1
1574 nmdc:mga05p37_90563_c1
1575 nmdc:mga09592_120401_c1
1576 nmdc:mga09592_299516_c1
1577 nmdc:mga09592_316169_c1
1578 nmdc:mga09592_482685_c1
1579 nmdc:mga09592_589126_c1
1580 nmdc:mga09592_74849_c1
1581 nmdc:mga09592_924067_c1
1582 nmdc:mga0qj67_135024_c1
1583 nmdc:mga0qj67_2553_c1
1584 nmdc:mga0qj67_768065_c1
1585 nmdc:mga0qj67_943803_c1
1586 nmdc:mga06r32_2038628_c1
1587 nmdc:mga06r32_260479_c1
1588 nmdc:mga06r32_269546_c1
1589 nmdc:mga06r32_6112_c1
1590 nmdc:mga06r32_80345_c1
1591 nmdc:mga08y16_12426_c1
1592 nmdc:mga08y16_157303_c1
1593 nmdc:mga08y16_166876_c1
1594 nmdc:mga08y16_178333_c1
1595 nmdc:mga08y16_2581_c1
1596 nmdc:mga08y16_341595_c1
1597 nmdc:mga08y16_35118_c1
1598 nmdc:mga08y16_36811_c1
1599 nmdc:mga08y16_476597_c1
1600 nmdc:mga08y16_48059_c1
1601 nmdc:mga08y16_502320_c1
1602 nmdc:mga08y16_54590_c1
1603 nmdc:mga08y16_5959_c1
1604 nmdc:mga08y16_714712_c1
1605 nmdc:mga08y16_72823_c1
1606 nmdc:mga08y16_89018_c1
1607 nmdc:mga0n895_1188749_c1
1608 nmdc:mga0n895_205640_c1
1609 nmdc:mga0n895_233325_c1
1610 nmdc:mga0n895_25979_c1
1611 nmdc:mga0n895_31523_c1
1612 nmdc:mga0n895_442938_c1
1613 nmdc:mga0n895_445897_c1
1614 nmdc:mga0n895_59434_c1
1615 nmdc:mga0n895_61590_c1
1616 nmdc:mga0n895_6_c1
1617 nmdc:mga0n895_997898_c1
1618 nmdc:mga0rr50_1258735_c1
1619 nmdc:mga0rr50_145219_c1
1620 nmdc:mga0rr50_23335_c1
1621 nmdc:mga0rr50_332750_c1
1622 nmdc:mga0rr50_74701_c1
1623 nmdc:mga0rr50_7_c1
1624 nmdc:mga08x19_159034_c1
1625 nmdc:mga08x19_161777_c1
1626 nmdc:mga08x19_49365_c1
1627 nmdc:mga08x19_67_c1
1628 nmdc:mga0a205_216922_c1
1629 nmdc:mga0a205_268763_c1
1630 nmdc:mga0a205_362434_c1
1631 nmdc:mga0a205_47146_c1
1632 nmdc:mga0a205_495383_c1
1633 nmdc:mga0a205_67486_c1
1634 nmdc:mga0a205_689522_c1
1635 nmdc:mga0a205_90130_c1
1636 nmdc:mga0a205_968554_c1
1637 Ga0495619_0299821
1638 Ga0501084_0917221
1639 Ga0587084_028964
1640 Ga0587077_008132
1641 Ga0587101_094268
1642 Ga0587117_001467
1643 Ga0587071_026294
1644 Ga0587111_0009054
1645 Ga0587111_0134958
1646 Ga0530510_0898206

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

12

113

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.817 39 72
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.816 39 72
8d0k-assembly1.cif.gz_F human cst-dna polymerase alpha/primase preinitiation complex bound to 4xtel-foldback template - prim2c advanced pic 0.8106 38 72
7og2-assembly1.cif.gz_B crystal structure of pseudoalteromonas luteoviolacea l-amino acid oxidase 0.7882 38 72
8foe-assembly1.cif.gz_1 cryo-em structure of s. cerevisiae dna polymerase alpha-primase complex bound to a template dna 0.7805 38 72
ID Description Score Start End Superfamily
4fxdB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.816 39 72 2.40.50.730
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7872 37 96 2.40.50.140
af_P87307_123_212_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7728 36 116 2.40.50.140
1l1oE00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7645 35 116 2.40.50.140
3rlfA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7627 37 97 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A383CUF3-F1-model_v4 OB domain-containing protein 0.9472 32 123
AF-A0A2E5V8J4-F1-model_v4 Uncharacterized protein 0.9347 23 122
AF-A0A2V8I9N4-F1-model_v4 DUF5666 domain-containing protein 0.9347 39 119
AF-A0A7C2J476-F1-model_v4 DUF5666 domain-containing protein 0.9337 31 121
AF-A0A0S1YL88-F1-model_v4 deleted 0.931 23 125

Map