F482300

General Info

Members Datasets Scaffolds Average Seq Length
822 365 1644 265

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10015922|Ga0111539_100159228
Length 315
Sequence MVAFSVATGPLLTVLDTPDLAKTPESQGLLPLATLHPLQSSGHVPRPGDKPMSETLKLLMEKDGAIGWIIFNQPEKRNAVSLEMWELMPKYVEDLASDDAIRVVVLRGAGDQAFVAGADISQFQERRRNMADQEEYGRISARGQDSLKKLGKPLLAMIHGYCVGGGVSIAISCDMRLASDQARFGVPAARLGLGYHYDGMDKLMHLVGPAYVKEIFFTARTDFSAQDAWRMGLVNQVVPKDQLESFTRDYAQTMARNAPLTLKAAKASVDQLVKPAAQRDTAMLDKLLADCFNSEDYQEGVRAFSEKRRPQFKGR

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
3 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
197 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
198 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
199 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
200 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
201 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
204 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
206 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
207 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
208 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
209 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
210 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
211 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
212 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
213 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
214 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
215 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
216 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
229 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
230 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
233 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
234 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
235 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
236 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
237 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
238 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
239 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
240 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
241 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
242 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
243 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
244 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
245 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
248 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
254 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
255 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
262 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
265 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
266 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
267 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
268 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
269 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
270 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
271 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
272 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
273 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
274 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
275 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
276 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
279 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
280 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
281 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
282 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
283 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
284 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
285 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
286 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
287 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
288 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
289 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
290 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
291 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
294 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
295 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
298 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
299 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
312 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
313 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
324 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
325 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
326 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
327 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
328 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
329 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
330 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
331 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
332 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
333 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
334 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
339 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
340 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
341 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
344 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
345 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
346 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
347 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
348 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
351 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
352 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
353 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
354 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
355 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
356 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
357 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
358 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
359 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
360 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
361 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
362 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
363 2643221584 Caulobacter sp. Root656 Isolate Unclassified
364 2818991435 Caulobacter henricii 536 Isolate Unclassified
365 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 0.49
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.7
Nodule 0
Rhizoplane 2.07
Rhizosphere 94.4
Stem 0
Stem Tuber 0
Unclassified 1.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10015922 3300009094 Bacteria 9340
2 JGI26129J50193_1001763 3300003349 Bacteria 1495
3 JGI26141J51220_1001183 3300003503 Bacteria 1566
4 Ga0055531_10005922 3300003794 Bacteria 7033
5 Ga0055531_10018452 3300003794 Bacteria 2878
6 JGI25405J52794_10006856 3300003911 Bacteria 2087
7 Ga0065704_10114398 3300005289 Bacteria 1892
8 Ga0065707_10021072 3300005295 Bacteria 1444
9 Ga0070676_10000793 3300005328 Bacteria 15592
10 Ga0070683_100053200 3300005329 Bacteria 3752
11 Ga0070670_100006323 3300005331 Bacteria 10024
12 Ga0068869_100014243 3300005334 Bacteria 5308
13 Ga0068869_100054193 3300005334 Bacteria 2918
14 Ga0070680_100003802 3300005336 Bacteria 11292
15 Ga0070680_100033641 3300005336 Bacteria 4133
16 Ga0070682_100001673 3300005337 Bacteria 12340
17 Ga0068868_100045142 3300005338 Bacteria 3447
18 Ga0068868_100048421 3300005338 Bacteria 3334
19 Ga0070660_100020417 3300005339 Bacteria 4867
20 Ga0070689_100042171 3300005340 Bacteria 3504
21 Ga0070689_100222325 3300005340 Bacteria 1549
22 Ga0070689_100248210 3300005340 Bacteria 1468
23 Ga0070691_10005053 3300005341 Bacteria 5997
24 Ga0070691_10009675 3300005341 Bacteria 4399
25 Ga0070687_100018607 3300005343 Bacteria 3217
26 Ga0070661_100006150 3300005344 Bacteria 8272
27 Ga0070692_10006918 3300005345 Bacteria 4960
28 Ga0070692_10020580 3300005345 Bacteria 3200
29 Ga0070669_100186355 3300005353 Bacteria 1626
30 Ga0070675_100569996 3300005354 Bacteria 1025
31 Ga0070671_100654030 3300005355 Bacteria 910
32 Ga0070673_100147455 3300005364 Bacteria 1990
33 Ga0070659_100005631 3300005366 Bacteria 9007
34 Ga0070703_10010258 3300005406 Bacteria 2641
35 Ga0070709_10016216 3300005434 Bacteria 4250
36 Ga0070709_10037672 3300005434 Bacteria 2955
37 Ga0070709_10130443 3300005434 Bacteria 1715
38 Ga0070709_10291900 3300005434 Bacteria 1188
39 Ga0070714_100024230 3300005435 Bacteria 4993
40 Ga0070714_100095463 3300005435 Bacteria 2611
41 Ga0070713_100063446 3300005436 Bacteria 3098
42 Ga0070710_10011522 3300005437 Bacteria 4370
43 Ga0070701_10012533 3300005438 Bacteria 3828
44 Ga0070711_100289894 3300005439 Bacteria 1298
45 Ga0070705_100001541 3300005440 Bacteria 12106
46 Ga0070705_100012445 3300005440 Bacteria 4325
47 Ga0070705_100067945 3300005440 Bacteria 2143
48 Ga0070705_100145135 3300005440 Bacteria 1567
49 Ga0070705_100179905 3300005440 Bacteria 1431
50 Ga0070694_100002862 3300005444 Bacteria 10250
51 Ga0070694_100062381 3300005444 Bacteria 2546
52 Ga0070694_100083385 3300005444 Bacteria 2228
53 Ga0070694_100083706 3300005444 Bacteria 2224
54 Ga0070694_100150202 3300005444 Bacteria 1701
55 Ga0070708_100017829 3300005445 Bacteria 5932
56 Ga0070708_100117040 3300005445 Bacteria 2454
57 Ga0070708_100152271 3300005445 Bacteria 2151
58 Ga0070708_100176432 3300005445 Bacteria 1997
59 Ga0070708_100188658 3300005445 Bacteria 1928
60 Ga0070708_100223842 3300005445 Bacteria 1765
61 Ga0070708_100567085 3300005445 Bacteria 1071
62 Ga0070663_100006478 3300005455 Bacteria 7048
63 Ga0070662_100004269 3300005457 Bacteria 9017
64 Ga0070662_100041377 3300005457 Bacteria 3287
65 Ga0070662_100113285 3300005457 Bacteria 2069
66 Ga0070681_10134995 3300005458 Bacteria 2398
67 Ga0068867_100023047 3300005459 Bacteria 4455
68 Ga0068867_100071061 3300005459 Bacteria 2603
69 Ga0068867_100119021 3300005459 Bacteria 2038
70 Ga0068867_100405490 3300005459 Bacteria 1151
71 Ga0070706_100003700 3300005467 Bacteria 14959
72 Ga0070706_100022486 3300005467 Bacteria 5803
73 Ga0070706_100044670 3300005467 Bacteria 4093
74 Ga0070706_100055126 3300005467 Bacteria 3669
75 Ga0070706_100142694 3300005467 Bacteria 2236
76 Ga0070706_100165879 3300005467 Bacteria 2062
77 Ga0070706_100249406 3300005467 Bacteria 1657
78 Ga0070706_100302706 3300005467 Bacteria 1491
79 Ga0070706_100349187 3300005467 Bacteria 1379
80 Ga0070707_100010067 3300005468 Bacteria 8802
81 Ga0070707_100023782 3300005468 Bacteria 5795
82 Ga0070707_100024573 3300005468 Bacteria 5707
83 Ga0070707_100027792 3300005468 Bacteria 5382
84 Ga0070707_100037297 3300005468 Bacteria 4639
85 Ga0070707_100070800 3300005468 Bacteria 3359
86 Ga0070707_100118962 3300005468 Bacteria 2564
87 Ga0070707_100274988 3300005468 Bacteria 1637
88 Ga0070698_100003851 3300005471 Bacteria 16502
89 Ga0070698_100017393 3300005471 Bacteria 7577
90 Ga0070698_100056881 3300005471 Bacteria 3960
91 Ga0070698_100120810 3300005471 Bacteria 2580
92 Ga0070698_100180827 3300005471 Bacteria 2047
93 Ga0070698_100185422 3300005471 Bacteria 2018
94 Ga0070698_100293977 3300005471 Bacteria 1555
95 Ga0070698_100423221 3300005471 Bacteria 1266
96 Ga0070699_100007462 3300005518 Bacteria 9515
97 Ga0070699_100015873 3300005518 Bacteria 6465
98 Ga0070699_100139840 3300005518 Bacteria 2137
99 Ga0070699_100174656 3300005518 Bacteria 1905
100 Ga0070699_100290509 3300005518 Bacteria 1466
101 Ga0070699_100599405 3300005518 Bacteria 1004
102 Ga0070699_100782960 3300005518 Bacteria 873
103 Ga0070679_100007343 3300005530 Bacteria 10297
104 Ga0070684_100002889 3300005535 Bacteria 12766
105 Ga0070684_100215337 3300005535 Bacteria 1751
106 Ga0070684_100708288 3300005535 Bacteria 939
107 Ga0070697_100009746 3300005536 Bacteria 7492
108 Ga0070697_100010635 3300005536 Bacteria 7179
109 Ga0070697_100014866 3300005536 Bacteria 6108
110 Ga0070697_100032461 3300005536 Bacteria 4202
111 Ga0070697_100069609 3300005536 Bacteria 2882
112 Ga0070697_100182341 3300005536 Bacteria 1780
113 Ga0070697_100250963 3300005536 Bacteria 1513
114 Ga0070697_100313178 3300005536 Bacteria 1351
115 Ga0068853_100008059 3300005539 Bacteria 8450
116 Ga0070672_100027266 3300005543 Bacteria 4260
117 Ga0070672_100056641 3300005543 Bacteria 3075
118 Ga0070695_100000636 3300005545 Bacteria 18606
119 Ga0070695_100022317 3300005545 Bacteria 3882
120 Ga0070695_100026357 3300005545 Bacteria 3596
121 Ga0070695_100028689 3300005545 Bacteria 3454
122 Ga0070695_100033946 3300005545 Bacteria 3194
123 Ga0070695_100046104 3300005545 Bacteria 2781
124 Ga0070695_100140259 3300005545 Bacteria 1675
125 Ga0070696_100005376 3300005546 Bacteria 8543
126 Ga0070696_100016241 3300005546 Bacteria 5010
127 Ga0070696_100019606 3300005546 Bacteria 4582
128 Ga0070696_100176424 3300005546 Bacteria 1583
129 Ga0070696_100429775 3300005546 Bacteria 1038
130 Ga0070693_100000439 3300005547 Bacteria 18760
131 Ga0070665_100033904 3300005548 Bacteria 5135
132 Ga0070704_100011325 3300005549 Bacteria 5464
133 Ga0070704_100080049 3300005549 Bacteria 2402
134 Ga0070704_100138214 3300005549 Bacteria 1898
135 Ga0070704_100200943 3300005549 Bacteria 1609
136 Ga0070704_100578952 3300005549 Bacteria 984
137 Ga0068855_100008335 3300005563 Bacteria 12530
138 Ga0068855_100251753 3300005563 Bacteria 1970
139 Ga0070664_100011490 3300005564 Bacteria 7186
140 Ga0070664_100044947 3300005564 Bacteria 3730
141 Ga0068857_100087331 3300005577 Bacteria 2789
142 Ga0068857_100205522 3300005577 Bacteria 1796
143 Ga0068854_100018950 3300005578 Bacteria 4627
144 Ga0068856_100003850 3300005614 Bacteria 15057
145 Ga0070702_100044491 3300005615 Bacteria 2507
146 Ga0070702_100150563 3300005615 Bacteria 1493
147 Ga0068852_100332385 3300005616 Bacteria 1479
148 Ga0068859_100010219 3300005617 Bacteria 9445
149 Ga0068859_100274367 3300005617 Bacteria 1779
150 Ga0068859_100284965 3300005617 Bacteria 1745
151 Ga0068859_100523295 3300005617 Unclassified 1281
152 Ga0068859_100538958 3300005617 Bacteria 1262
153 Ga0068864_100034792 3300005618 Bacteria 4286
154 Ga0068866_10037697 3300005718 Bacteria 2376
155 Ga0068861_100008970 3300005719 Bacteria 6893
156 Ga0068870_10000417 3300005840 Bacteria 16024
157 Ga0068863_100051055 3300005841 Bacteria 3920
158 Ga0068863_100052978 3300005841 Bacteria 3845
159 Ga0068863_100105551 3300005841 Bacteria 2680
160 Ga0068863_100174629 3300005841 Bacteria 2062
161 Ga0068858_100008466 3300005842 Bacteria 9887
162 Ga0068858_100457394 3300005842 Bacteria 1230
163 Ga0068860_100013265 3300005843 Bacteria 8086
164 Ga0068860_100014518 3300005843 Bacteria 7708
165 Ga0068860_100114216 3300005843 Bacteria 2582
166 Ga0068860_100311240 3300005843 Bacteria 1544
167 Ga0068860_100400953 3300005843 Bacteria 1357
168 Ga0068860_100930692 3300005843 Bacteria 886
169 Ga0068862_100002631 3300005844 Bacteria 15813
170 Ga0068862_100010761 3300005844 Bacteria 7552
171 Ga0068862_100031412 3300005844 Bacteria 4483
172 Ga0081455_10000080 3300005937 Bacteria 104190
173 Ga0081455_10289956 3300005937 Bacteria 1179
174 Ga0081455_10305300 3300005937 Bacteria 1140
175 Ga0081538_10002864 3300005981 Bacteria 16489
176 Ga0081538_10034418 3300005981 Bacteria 3349
177 Ga0081538_10132849 3300005981 Bacteria 1166
178 Ga0081540_1015325 3300005983 Bacteria 4857
179 Ga0081540_1076719 3300005983 Bacteria 1521
180 Ga0070717_10003654 3300006028 Bacteria 11040
181 Ga0070717_10008837 3300006028 Bacteria 7546
182 Ga0070717_10024576 3300006028 Bacteria 4787
183 Ga0070717_10073007 3300006028 Bacteria 2867
184 Ga0070715_10037858 3300006163 Bacteria 1999
185 Ga0070712_100003108 3300006175 Bacteria 10238
186 Ga0070712_100023801 3300006175 Bacteria 4049
187 Ga0075370_10162314 3300006353 Bacteria 1312
188 Ga0075428_100001459 3300006844 Bacteria 25299
189 Ga0075428_100019877 3300006844 Bacteria 7435
190 Ga0075428_100033095 3300006844 Bacteria 5709
191 Ga0075428_100126034 3300006844 Bacteria 2787
192 Ga0075428_100244268 3300006844 Bacteria 1936
193 Ga0075428_100613608 3300006844 Bacteria 1161
194 Ga0075430_100000265 3300006846 Bacteria 36910
195 Ga0075430_100012586 3300006846 Bacteria 7203
196 Ga0075430_100021023 3300006846 Bacteria 5548
197 Ga0075430_100282136 3300006846 Unclassified 1374
198 Ga0075430_100553861 3300006846 Bacteria 948
199 Ga0075431_100004549 3300006847 Bacteria 13620
200 Ga0075431_100014486 3300006847 Bacteria 7977
201 Ga0075431_100090523 3300006847 Bacteria 3158
202 Ga0075431_100205865 3300006847 Bacteria 2012
203 Ga0075431_100359304 3300006847 Bacteria 1463
204 Ga0075431_100370403 3300006847 Bacteria 1437
205 Ga0075433_10004655 3300006852 Bacteria 10702
206 Ga0075433_10006568 3300006852 Bacteria 9207
207 Ga0075433_10020014 3300006852 Bacteria 5589
208 Ga0075433_10080670 3300006852 Bacteria 2868
209 Ga0075433_10153149 3300006852 Bacteria 2051
210 Ga0075433_10153415 3300006852 Unclassified 2049
211 Ga0075433_10187777 3300006852 Bacteria 1838
212 Ga0075433_10198252 3300006852 Bacteria 1785
213 Ga0075433_10210340 3300006852 Bacteria 1728
214 Ga0075434_100001459 3300006871 Bacteria 19891
215 Ga0075434_100007481 3300006871 Bacteria 10106
216 Ga0075434_100011489 3300006871 Bacteria 8355
217 Ga0075434_100058483 3300006871 Bacteria 3831
218 Ga0075434_100059944 3300006871 Bacteria 3784
219 Ga0075434_100138924 3300006871 Bacteria 2449
220 Ga0075434_100292427 3300006871 Bacteria 1649
221 Ga0075434_100633867 3300006871 Bacteria 1087
222 Ga0075429_100015915 3300006880 Bacteria 6512
223 Ga0075429_100022420 3300006880 Bacteria 5476
224 Ga0075429_100251874 3300006880 Bacteria 1546
225 Ga0068865_100101730 3300006881 Bacteria 2105
226 Ga0075436_100112141 3300006914 Bacteria 1904
227 Ga0075436_100141566 3300006914 Bacteria 1690
228 Ga0097620_100010219 3300006931 Bacteria 9445
229 Ga0097620_100274367 3300006931 Bacteria 1779
230 Ga0097620_100284949 3300006931 Bacteria 1745
231 Ga0097620_100523286 3300006931 Unclassified 1281
232 Ga0097620_100538932 3300006931 Bacteria 1262
233 Ga0075435_100011676 3300007076 Bacteria 6475
234 Ga0075435_100023024 3300007076 Bacteria 4810
235 Ga0075435_100031176 3300007076 Unclassified 4198
236 Ga0099794_10006223 3300007265 Bacteria 4821
237 Ga0099794_10016228 3300007265 Bacteria 3300
238 Ga0099794_10021094 3300007265 Bacteria 2957
239 Ga0105240_10012584 3300009093 Bacteria 11671
240 Ga0105240_10394541 3300009093 Bacteria 1560
241 Ga0111539_10000552 3300009094 Bacteria 47861
242 Ga0111539_10002421 3300009094 Bacteria 24810
243 Ga0111539_10016584 3300009094 Bacteria 9133
244 Ga0111539_10112034 3300009094 Bacteria 3201
245 Ga0111539_10228495 3300009094 Bacteria 2167
246 Ga0111539_10308658 3300009094 Bacteria 1841
247 Ga0111539_10380674 3300009094 Bacteria 1643
248 Ga0111539_10416774 3300009094 Bacteria 1564
249 Ga0105245_10006782 3300009098 Bacteria 10041
250 Ga0105245_10296847 3300009098 Bacteria 1584
251 Ga0105245_10812686 3300009098 Bacteria 973
252 Ga0114129_10024537 3300009147 Bacteria 8542
253 Ga0114129_10027915 3300009147 Bacteria 7992
254 Ga0114129_10043842 3300009147 Bacteria 6294
255 Ga0114129_10045061 3300009147 Bacteria 6202
256 Ga0114129_10062038 3300009147 Bacteria 5223
257 Ga0114129_10074021 3300009147 Bacteria 4745
258 Ga0114129_10121728 3300009147 Bacteria 3590
259 Ga0114129_10167177 3300009147 Bacteria 3001
260 Ga0114129_10343404 3300009147 Bacteria 1979
261 Ga0114129_10344108 3300009147 Bacteria 1977
262 Ga0114129_10410112 3300009147 Bacteria 1784
263 Ga0114129_10499929 3300009147 Bacteria 1588
264 Ga0114129_10505962 3300009147 Bacteria 1577
265 Ga0114129_10609447 3300009147 Bacteria 1414
266 Ga0114129_10967122 3300009147 Bacteria 1074
267 Ga0105243_10201423 3300009148 Bacteria 1746
268 Ga0105242_10025688 3300009176 Bacteria 4664
269 Ga0105242_10111652 3300009176 Bacteria 2331
270 Ga0105242_10132703 3300009176 Bacteria 2152
271 Ga0105248_10171589 3300009177 Bacteria 2444
272 Ga0105248_10514679 3300009177 Bacteria 1349
273 Ga0105237_10152454 3300009545 Bacteria 2308
274 Ga0105237_10473481 3300009545 Bacteria 1258
275 Ga0105237_10704404 3300009545 Bacteria 1016
276 Ga0105238_10000267 3300009551 Bacteria 58437
277 Ga0105238_10435026 3300009551 Bacteria 1308
278 Ga0105249_10082495 3300009553 Bacteria 2991
279 Ga0105249_10185053 3300009553 Bacteria 2029
280 Ga0105249_10202046 3300009553 Bacteria 1945
281 Ga0105249_10416185 3300009553 Bacteria 1377
282 Ga0105239_10050761 3300010375 Bacteria 4548
283 Ga0105239_10250341 3300010375 Bacteria 1990
284 Ga0105239_10332631 3300010375 Bacteria 1714
285 Ga0105239_10409273 3300010375 Bacteria 1536
286 Ga0105246_10208200 3300011119 Bacteria 1525
287 Ga0105246_10345701 3300011119 Bacteria 1217
288 Ga0157373_10002202 3300013100 Bacteria 14755
289 Ga0157371_10245078 3300013102 Bacteria 1290
290 Ga0157369_10622698 3300013105 Bacteria 1113
291 Ga0157378_10052311 3300013297 Bacteria 3634
292 Ga0157378_10124196 3300013297 Bacteria 2383
293 Ga0163162_10006074 3300013306 Bacteria 11691
294 Ga0163162_10300736 3300013306 Bacteria 1736
295 Ga0157372_10152042 3300013307 Bacteria 2672
296 Ga0157372_10246565 3300013307 Bacteria 2073
297 Ga0157375_10084666 3300013308 Bacteria 3220
298 Ga0157375_10136690 3300013308 Bacteria 2575
299 Ga0157375_10311316 3300013308 Bacteria 1739
300 Ga0163163_10040461 3300014325 Bacteria 4551
301 Ga0157377_10189446 3300014745 Bacteria 1299
302 Ga0157379_10066585 3300014968 Bacteria 3220
303 Ga0157379_10184374 3300014968 Bacteria 1886
304 Ga0206356_11554582 3300020070 Bacteria 1901
305 Ga0213876_10003438 3300021384 Bacteria 9059
306 Ga0213876_10071427 3300021384 Bacteria 1833
307 Ga0209758_1002863 3300025297 Bacteria 16742
308 Ga0209050_1016882 3300025298 Bacteria 2951
309 Ga0209257_1000464 3300025304 Bacteria 74567
310 Ga0209257_1000966 3300025304 Bacteria 39401
311 Ga0207653_10072924 3300025885 Bacteria 1176
312 Ga0207692_10007206 3300025898 Bacteria 4545
313 Ga0207688_10002474 3300025901 Bacteria 9942
314 Ga0207680_10091709 3300025903 Bacteria 1934
315 Ga0207647_10090365 3300025904 Bacteria 1827
316 Ga0207647_10133726 3300025904 Bacteria 1456
317 Ga0207685_10017243 3300025905 Bacteria 2330
318 Ga0207699_10045772 3300025906 Bacteria 2555
319 Ga0207699_10080053 3300025906 Bacteria 2023
320 Ga0207645_10000290 3300025907 Bacteria 42058
321 Ga0207643_10000482 3300025908 Bacteria 25722
322 Ga0207684_10003244 3300025910 Bacteria 15956
323 Ga0207684_10016346 3300025910 Bacteria 6372
324 Ga0207684_10017320 3300025910 Bacteria 6180
325 Ga0207684_10028226 3300025910 Bacteria 4780
326 Ga0207684_10031690 3300025910 Bacteria 4497
327 Ga0207684_10040657 3300025910 Bacteria 3942
328 Ga0207684_10070356 3300025910 Bacteria 2973
329 Ga0207684_10086621 3300025910 Bacteria 2668
330 Ga0207684_10307191 3300025910 Bacteria 1367
331 Ga0207654_10038449 3300025911 Bacteria 2685
332 Ga0207654_10313613 3300025911 Bacteria 1070
333 Ga0207707_10001856 3300025912 Bacteria 19311
334 Ga0207695_10036347 3300025913 Bacteria 5326
335 Ga0207695_10154526 3300025913 Bacteria 2230
336 Ga0207695_10391639 3300025913 Bacteria 1274
337 Ga0207695_10471319 3300025913 Bacteria 1138
338 Ga0207671_10033725 3300025914 Bacteria 3807
339 Ga0207671_10117221 3300025914 Bacteria 2032
340 Ga0207671_10575607 3300025914 Bacteria 898
341 Ga0207693_10004676 3300025915 Bacteria 11535
342 Ga0207693_10009107 3300025915 Bacteria 8104
343 Ga0207693_10021174 3300025915 Bacteria 5169
344 Ga0207693_10024976 3300025915 Bacteria 4739
345 Ga0207663_10089790 3300025916 Bacteria 2035
346 Ga0207663_10111565 3300025916 Bacteria 1856
347 Ga0207660_10155373 3300025917 Bacteria 1761
348 Ga0207662_10022746 3300025918 Bacteria 3597
349 Ga0207657_10006680 3300025919 Bacteria 11926
350 Ga0207649_10002003 3300025920 Bacteria 11591
351 Ga0207652_10001521 3300025921 Bacteria 20469
352 Ga0207652_10030392 3300025921 Bacteria 4524
353 Ga0207646_10007629 3300025922 Bacteria 10952
354 Ga0207646_10012309 3300025922 Bacteria 8227
355 Ga0207646_10014773 3300025922 Bacteria 7398
356 Ga0207646_10018025 3300025922 Bacteria 6593
357 Ga0207646_10025619 3300025922 Bacteria 5394
358 Ga0207646_10027397 3300025922 Bacteria 5197
359 Ga0207646_10105866 3300025922 Bacteria 2523
360 Ga0207646_10116890 3300025922 Bacteria 2395
361 Ga0207646_10144610 3300025922 Bacteria 2142
362 Ga0207646_10153376 3300025922 Bacteria 2078
363 Ga0207646_10173305 3300025922 Bacteria 1948
364 Ga0207646_10463831 3300025922 Bacteria 1142
365 Ga0207681_10021290 3300025923 Bacteria 4120
366 Ga0207681_10030509 3300025923 Bacteria 3515
367 Ga0207681_10202725 3300025923 Bacteria 1524
368 Ga0207681_10633463 3300025923 Bacteria 886
369 Ga0207694_10001065 3300025924 Bacteria 23868
370 Ga0207650_10057561 3300025925 Bacteria 2891
371 Ga0207659_10407472 3300025926 Bacteria 1138
372 Ga0207687_10527835 3300025927 Bacteria 988
373 Ga0207700_10090045 3300025928 Bacteria 2420
374 Ga0207700_10091181 3300025928 Bacteria 2407
375 Ga0207664_10152772 3300025929 Bacteria 1962
376 Ga0207690_10001543 3300025932 Bacteria 14416
377 Ga0207690_10124660 3300025932 Bacteria 1876
378 Ga0207690_10160449 3300025932 Bacteria 1676
379 Ga0207706_10008540 3300025933 Bacteria 9437
380 Ga0207706_10042804 3300025933 Bacteria 4013
381 Ga0207706_10077655 3300025933 Bacteria 2920
382 Ga0207706_10136916 3300025933 Bacteria 2154
383 Ga0207686_10021917 3300025934 Bacteria 3673
384 Ga0207709_10334358 3300025935 Unclassified 1138
385 Ga0207670_10128068 3300025936 Bacteria 1855
386 Ga0207704_10304717 3300025938 Bacteria 1222
387 Ga0207665_10007771 3300025939 Bacteria 7079
388 Ga0207665_10010921 3300025939 Bacteria 5960
389 Ga0207665_10071103 3300025939 Bacteria 2375
390 Ga0207691_10023772 3300025940 Bacteria 5768
391 Ga0207691_10028497 3300025940 Bacteria 5229
392 Ga0207711_10072397 3300025941 Bacteria 2994
393 Ga0207711_10437492 3300025941 Bacteria 1217
394 Ga0207689_10000425 3300025942 Bacteria 39512
395 Ga0207689_10022145 3300025942 Bacteria 5344
396 Ga0207689_10074378 3300025942 Bacteria 2792
397 Ga0207689_10355861 3300025942 Bacteria 1217
398 Ga0207661_10208705 3300025944 Bacteria 1720
399 Ga0207679_10003606 3300025945 Bacteria 9604
400 Ga0207679_10057134 3300025945 Bacteria 2885
401 Ga0207667_10003229 3300025949 Bacteria 20130
402 Ga0207667_10395935 3300025949 Bacteria 1406
403 Ga0207712_10128958 3300025961 Bacteria 1924
404 Ga0207712_10194684 3300025961 Bacteria 1603
405 Ga0207712_10266535 3300025961 Bacteria 1391
406 Ga0207668_10066824 3300025972 Bacteria 2550
407 Ga0207640_10419046 3300025981 Bacteria 1095
408 Ga0207658_10360917 3300025986 Bacteria 1268
409 Ga0207677_10074544 3300026023 Bacteria 2408
410 Ga0207677_10118102 3300026023 Bacteria 1989
411 Ga0207703_10025235 3300026035 Bacteria 4674
412 Ga0207639_10075051 3300026041 Bacteria 2657
413 Ga0207678_10001467 3300026067 Bacteria 21633
414 Ga0207708_10008647 3300026075 Bacteria 7536
415 Ga0207708_10043639 3300026075 Bacteria 3417
416 Ga0207702_10017506 3300026078 Bacteria 5928
417 Ga0207641_10091593 3300026088 Bacteria 2661
418 Ga0207641_10236395 3300026088 Bacteria 1700
419 Ga0207648_10001313 3300026089 Bacteria 27657
420 Ga0207648_10013103 3300026089 Bacteria 7731
421 Ga0207648_10026736 3300026089 Bacteria 5125
422 Ga0207648_10051851 3300026089 Bacteria 3586
423 Ga0207648_10215846 3300026089 Bacteria 1704
424 Ga0207676_10616535 3300026095 Bacteria 1044
425 Ga0207674_10004140 3300026116 Bacteria 17546
426 Ga0207675_100016627 3300026118 Bacteria 6872
427 Ga0207675_100077230 3300026118 Bacteria 3119
428 Ga0207675_100179040 3300026118 Bacteria 2029
429 Ga0207675_100701789 3300026118 Bacteria 1021
430 Ga0209969_1001194 3300027360 Bacteria 3575
431 Ga0209981_1012538 3300027378 Bacteria 1174
432 Ga0210000_1001753 3300027462 Bacteria 3070
433 Ga0209995_1001173 3300027471 Bacteria 4026
434 Ga0209999_1004888 3300027543 Bacteria 2409
435 Ga0209588_1033496 3300027671 Bacteria 1647
436 Ga0209588_1042400 3300027671 Bacteria 1470
437 Ga0209971_1000005 3300027682 Bacteria 108671
438 Ga0209971_1034960 3300027682 Bacteria 1208
439 Ga0209966_1000010 3300027695 Bacteria 86172
440 Ga0209998_10000023 3300027717 Bacteria 65076
441 Ga0209974_10000464 3300027876 Bacteria 13490
442 Ga0207428_10000029 3300027907 Bacteria 241338
443 Ga0207428_10000173 3300027907 Bacteria 90064
444 Ga0207428_10031886 3300027907 Bacteria 4340
445 Ga0207428_10039995 3300027907 Bacteria 3806
446 Ga0207428_10196184 3300027907 Bacteria 1520
447 Ga0268266_10033883 3300028379 Bacteria 4340
448 Ga0268265_10005337 3300028380 Bacteria 8805
449 Ga0268265_10008618 3300028380 Bacteria 6892
450 Ga0268265_10020825 3300028380 Bacteria 4583
451 Ga0268264_10041562 3300028381 Bacteria 3804
452 Ga0268264_10096737 3300028381 Bacteria 2558
453 Ga0268264_10108453 3300028381 Bacteria 2427
454 Ga0268264_10532392 3300028381 Bacteria 1150
455 Ga0268264_10580791 3300028381 Bacteria 1102
456 Ga0268264_10683747 3300028381 Bacteria 1018
457 Ga0307515_10077383 3300028794 Bacteria 4395
458 Ga0307408_100008174 3300031548 Bacteria 6911
459 Ga0307408_100209065 3300031548 Bacteria 1585
460 Ga0307410_10067961 3300031852 Bacteria 2460
461 Ga0307409_100092962 3300031995 Bacteria 2477
462 Ga0307416_100030872 3300032002 Bacteria 4027
463 Ga0307416_100107843 3300032002 Bacteria 2445
464 Ga0307411_10040420 3300032005 Bacteria 2959
465 Ga0307411_10257952 3300032005 Unclassified 1375
466 Ga0307411_10600606 3300032005 Bacteria 946
467 Ga0316592_1010128 3300033524 Bacteria 1896
468 Ga0316587_1012054 3300033529 Bacteria 1402
469 Ga0316596_1030125 3300033541 Bacteria 1406
470 Ga0373948_0019911 3300034817 Bacteria 1273
471 Ga0373948_0021500 3300034817 Bacteria 1236
472 Ga0373926_0006175 3300035083 Bacteria 3971
473 Ga0373929_0034648 3300035085 Bacteria 1096
474 Ga0373934_0027204 3300035086 Bacteria 2221
475 Ga0373940_0018792 3300035088 Bacteria 1738
476 Ga0373940_0026031 3300035088 Bacteria 1528
477 Ga0373944_0003654 3300035089 Bacteria 3976
478 Ga0373949_0051195 3300035090 Bacteria 1041
479 Ga0373951_0006270 3300035091 Bacteria 2723
480 Ga0373951_0030118 3300035091 Bacteria 1276
481 Ga0373923_0013619 3300035111 Bacteria 3035
482 Ga0373932_0013222 3300035112 Bacteria 2048
483 Ga0373936_0003003 3300035113 Bacteria 6303
484 Ga0373939_0033505 3300035114 Bacteria 1501
485 Ga0373941_0061704 3300035115 Bacteria 1222
486 Ga0373945_0000323 3300035116 Bacteria 13637
487 Ga0373953_0005349 3300035117 Bacteria 4159
488 Ga0373956_0031301 3300035119 Bacteria 2331
489 Ga0373957_0097122 3300035120 Bacteria 1176
490 Ga0373960_0030791 3300035121 Bacteria 1496
491 Ga0373943_0003455 3300035170 Bacteria 7188
492 Ga0373946_0000032 3300035171 Bacteria 36803
493 Ga0373955_0014921 3300035172 Bacteria 3793
494 Ga0373955_0072796 3300035172 Bacteria 1925
495 Ga0373961_0007034 3300035241 Bacteria 2710
496 Ga0373924_0017982 3300035410 Bacteria 2719
497 Ga0373931_0023886 3300035691 Bacteria 3090
498 Ga0373931_0044302 3300035691 Bacteria 2346
499 Ga0373931_0064619 3300035691 Bacteria 1981
500 Ga0373935_0010227 3300035692 Bacteria 5621
501 Ga0373927_0003444 3300035695 Bacteria 11332
502 Ga0373927_0407601 3300035695 Bacteria 897
503 Ga0373933_0035343 3300035724 Bacteria 2918
504 Ga0373947_0001873 3300035725 Bacteria 12830
505 Ga0373947_0026394 3300035725 Bacteria 3394
506 Ga0373937_0011744 3300036401 Bacteria 7682
507 Ga0373925_0007019 3300037068 Bacteria 8226
508 Ga0395900_0038044 3300037418 Bacteria 4960
509 Ga0395900_0122249 3300037418 Bacteria 2671
510 Ga0395900_0313259 3300037418 Bacteria 1552
511 Ga0395898_0018171 3300037466 Bacteria 7175
512 Ga0395905_0003062 3300037471 Bacteria 18105
513 Ga0395905_0285278 3300037471 Bacteria 1538
514 Ga0395901_0001183 3300038443 Bacteria 27754
515 Ga0395901_0233777 3300038443 Bacteria 1919
516 Ga0395901_0426901 3300038443 Bacteria 1358
517 Ga0242420_007513 3300038996 Bacteria 1749
518 Ga0242420_016676 3300038996 Bacteria 1281
519 Ga0400483_057045 3300039062 Bacteria 2182
520 Ga0400483_260981 3300039062 Bacteria 1394
521 Ga0400489_32282 3300039093 Bacteria 123730
522 Ga0436365_0035886 3300039437 Bacteria 1754
523 Ga0436365_1385500 3300039437 Bacteria 2923
524 Ga0436365_1516850 3300039437 Bacteria 12326
525 Ga0436365_1888363 3300039437 Bacteria 2873
526 Ga0436360_1093231 3300039438 Bacteria 2797
527 Ga0436361_0262333 3300039447 Bacteria 4111
528 Ga0436362_0880168 3300039453 Bacteria 1848
529 Ga0436362_0907713 3300039453 Bacteria 1241
530 Ga0451837_0114825 3300041494 Bacteria 1099
531 Ga0451853_2024754 3300041512 Bacteria 1736
532 Ga0439441_010712 3300042001 Bacteria 1543
533 Ga0439448_0000854 3300042005 Bacteria 7431
534 Ga0439450_001090 3300042008 Bacteria 3847
535 Ga0450889_005474 3300042144 Bacteria 1265
536 Ga0439459_0001667 3300042438 Bacteria 3306
537 Ga0450893_0007512 3300042532 Bacteria 1772
538 Ga0451577_0008825 3300042876 Bacteria 9764
539 Ga0451577_0087844 3300042876 Bacteria 2774
540 Ga0453683_0006890 3300044673 Bacteria 7748
541 Ga0453683_0070313 3300044673 Bacteria 2189
542 Ga0453683_0133156 3300044673 Bacteria 1567
543 Ga0453683_0137363 3300044673 Bacteria 1542
544 Ga0466963_0012075 3300044694 Bacteria 5278
545 Ga0453684_0017192 3300044712 Bacteria 11233
546 Ga0453684_0158659 3300044712 Bacteria 2678
547 Ga0453684_0186435 3300044712 Bacteria 2431
548 Ga0453684_0190470 3300044712 Bacteria 2400
549 Ga0453684_0334123 3300044712 Bacteria 1713
550 Ga0466971_0090979 3300044719 Bacteria 1397
551 Ga0466970_0090772 3300044765 Bacteria 1658
552 Ga0466959_0031166 3300045049 Bacteria 3946
553 Ga0466959_0088805 3300045049 Bacteria 2222
554 Ga0451576_0000713 3300045051 Bacteria 67026
555 Ga0451576_0021384 3300045051 Bacteria 7031
556 Ga0451576_0025380 3300045051 Bacteria 6383
557 Ga0451576_0054349 3300045051 Bacteria 4193
558 Ga0451576_0079801 3300045051 Bacteria 3405
559 Ga0451576_0152459 3300045051 Bacteria 2410
560 Ga0451576_0172370 3300045051 Bacteria 2258
561 Ga0451576_0189894 3300045051 Unclassified 2145
562 Ga0451576_0292267 3300045051 Bacteria 1704
563 Ga0451576_1067556 3300045051 Bacteria 845
564 Ga0466958_0024793 3300045836 Bacteria 3530
565 Ga0466958_0043535 3300045836 Bacteria 2704
566 Ga0466958_0057061 3300045836 Bacteria 2373
567 Ga0466958_0078248 3300045836 Bacteria 2032
568 Ga0495592_0114088 3300046454 Bacteria 1909
569 Ga0495590_0000222 3300046457 Bacteria 31112
570 Ga0495641_0013237 3300046461 Bacteria 4547
571 Ga0495651_0025285 3300046462 Bacteria 4621
572 Ga0495653_0014165 3300046463 Bacteria 6500
573 Ga0495650_0036998 3300046471 Bacteria 2129
574 Ga0495580_0007988 3300046472 Bacteria 8455
575 Ga0495582_0023126 3300046473 Bacteria 3400
576 Ga0495664_0002074 3300046477 Bacteria 10720
577 Ga0495664_0106561 3300046477 Bacteria 1690
578 Ga0495608_0008196 3300046511 Bacteria 7336
579 Ga0495610_0001074 3300046512 Bacteria 25046
580 Ga0495628_0011997 3300046516 Bacteria 7309
581 Ga0495631_0005432 3300046518 Bacteria 6671
582 Ga0495642_0030298 3300046528 Bacteria 2164
583 Ga0495652_0064443 3300046529 Bacteria 3082
584 Ga0495652_0071677 3300046529 Bacteria 2890
585 Ga0495652_0129548 3300046529 Bacteria 1999
586 Ga0495654_0052964 3300046530 Bacteria 1974
587 Ga0495665_0034725 3300046531 Bacteria 2697
588 Ga0495640_0071724 3300046533 Bacteria 2323
589 Ga0495587_0076449 3300046536 Bacteria 1944
590 Ga0495597_0039480 3300046542 Bacteria 2114
591 Ga0495645_0329779 3300046543 Bacteria 988
592 Ga0495667_0058356 3300046559 Bacteria 2536
593 Ga0495656_0093820 3300046615 Bacteria 1377
594 Ga0495634_0113260 3300046642 Bacteria 1742
595 Ga0495634_0160769 3300046642 Bacteria 1416
596 Ga0495625_0000025 3300046660 Bacteria 267383
597 Ga0495635_0005259 3300046663 Bacteria 9005
598 Ga0495635_0007799 3300046663 Bacteria 7474
599 Ga0495635_0012750 3300046663 Bacteria 5889
600 Ga0495659_0053287 3300046664 Bacteria 1478
601 Ga0495659_0107212 3300046664 Bacteria 1088
602 Ga0495659_0119775 3300046664 Unclassified 1035
603 Ga0495657_0006207 3300046675 Bacteria 9373
604 Ga0495657_0052073 3300046675 Bacteria 2746
605 Ga0495657_0164118 3300046675 Bacteria 1372
606 Ga0495599_0008558 3300046678 Bacteria 6228
607 Ga0495599_0027042 3300046678 Bacteria 3595
608 Ga0495623_0036047 3300046679 Bacteria 3170
609 Ga0495646_0090159 3300046680 Bacteria 1772
610 Ga0495646_0124509 3300046680 Bacteria 1456
611 Ga0495647_0057432 3300046681 Bacteria 1528
612 Ga0495669_0059642 3300046684 Bacteria 1724
613 Ga0495613_0075441 3300046689 Bacteria 2455
614 Ga0495624_0001199 3300046690 Bacteria 20509
615 Ga0495600_0005292 3300046809 Bacteria 7771
616 Ga0495600_0008716 3300046809 Bacteria 6240
617 Ga0495600_0061280 3300046809 Bacteria 2457
618 Ga0495600_0296780 3300046809 Bacteria 1020
619 Ga0495660_0044308 3300046810 Bacteria 2448
620 Ga0495660_0058838 3300046810 Bacteria 2068
621 Ga0495581_0012869 3300047315 Bacteria 4847
622 Ga0495604_0108153 3300047317 Bacteria 2031
623 Ga0495636_0012878 3300047318 Bacteria 3315
624 Ga0495674_0006440 3300047319 Bacteria 11256
625 Ga0495674_0036658 3300047319 Bacteria 4413
626 Ga0495674_0276476 3300047319 Bacteria 1377
627 Ga0495674_0364444 3300047319 Bacteria 1171
628 Ga0495672_0050082 3300047320 Bacteria 2469
629 Ga0495680_0006294 3300047322 Bacteria 11057
630 Ga0495680_0014077 3300047322 Bacteria 6949
631 Ga0495680_0022948 3300047322 Bacteria 5194
632 Ga0495681_0014234 3300047470 Bacteria 4575
633 Ga0495684_0004583 3300047471 Bacteria 10801
634 Ga0495684_0042941 3300047471 Bacteria 3461
635 Ga0495686_0000338 3300047472 Bacteria 77121
636 Ga0495593_0073372 3300047673 Bacteria 1775
637 Ga0495602_0048762 3300048088 Bacteria 3801
638 Ga0495602_0201876 3300048088 Bacteria 1516
639 Ga0496100_0062492 3300048903 Bacteria 2458
640 Ga0496102_0001681 3300048905 Bacteria 19422
641 Ga0496103_0104296 3300048906 Bacteria 1797
642 Ga0496104_0064553 3300048907 Bacteria 3473
643 Ga0496105_0033341 3300048908 Bacteria 4228
644 Ga0496106_0072923 3300048909 Bacteria 2626
645 Ga0496106_0091634 3300048909 Bacteria 2347
646 Ga0496106_0299321 3300048909 Bacteria 1290
647 Ga0496108_0049956 3300048911 Bacteria 3499
648 Ga0496109_0088024 3300048912 Bacteria 2869
649 Ga0496110_0054419 3300048913 Bacteria 3520
650 Ga0496110_0471112 3300048913 Bacteria 1144
651 Ga0496111_0028654 3300048914 Bacteria 3948
652 Ga0496112_0019059 3300048915 Bacteria 6468
653 Ga0496112_0218434 3300048915 Bacteria 1862
654 Ga0496113_0071245 3300048916 Bacteria 2644
655 Ga0496113_0135034 3300048916 Bacteria 1938
656 Ga0495678_001352 3300049459 Bacteria 19593
657 Ga0501033_0217433 3300049570 Bacteria 1361
658 Ga0501034_0019780 3300049571 Bacteria 6882
659 Ga0501039_0110624 3300049575 Bacteria 2147
660 Ga0501039_0319434 3300049575 Bacteria 1221
661 Ga0501040_0033474 3300049576 Bacteria 3481
662 Ga0501040_0036262 3300049576 Bacteria 3345
663 Ga0501040_0190489 3300049576 Bacteria 1455
664 Ga0501041_0011242 3300049577 Bacteria 5289
665 Ga0501042_0005993 3300049578 Bacteria 7868
666 Ga0501042_0350426 3300049578 Bacteria 1068
667 Ga0501043_0293573 3300049579 Bacteria 1244
668 Ga0501046_0001215 3300049580 Bacteria 24954
669 Ga0501046_0062058 3300049580 Bacteria 2921
670 Ga0501046_0098995 3300049580 Bacteria 2239
671 Ga0501046_0139327 3300049580 Bacteria 1837
672 Ga0501046_0316777 3300049580 Bacteria 1137
673 Ga0501047_0034945 3300049581 Bacteria 4854
674 Ga0501047_0177937 3300049581 Bacteria 1994
675 Ga0501048_0016907 3300049582 Bacteria 5378
676 Ga0501068_0094879 3300049584 Bacteria 1844
677 Ga0501068_0143480 3300049584 Bacteria 1498
678 Ga0501070_0513622 3300049586 Bacteria 962
679 Ga0501071_0153728 3300049587 Bacteria 1717
680 Ga0501072_0055798 3300049588 Bacteria 3113
681 Ga0501072_0111028 3300049588 Bacteria 2183
682 Ga0501072_0115943 3300049588 Bacteria 2133
683 Ga0501072_0130408 3300049588 Bacteria 2003
684 Ga0501072_0179278 3300049588 Unclassified 1690
685 Ga0501072_0219457 3300049588 Bacteria 1515
686 Ga0501072_0222637 3300049588 Bacteria 1504
687 Ga0501072_0244683 3300049588 Unclassified 1429
688 Ga0501073_0144285 3300049589 Bacteria 1650
689 Ga0501074_0137996 3300049590 Bacteria 1744
690 Ga0501075_0019213 3300049591 Bacteria 4955
691 Ga0501075_0070812 3300049591 Bacteria 2635
692 Ga0501075_0199197 3300049591 Bacteria 1527
693 Ga0501075_0231623 3300049591 Bacteria 1408
694 Ga0501075_0339449 3300049591 Bacteria 1145
695 Ga0501076_0040847 3300049592 Bacteria 3646
696 Ga0501076_0044540 3300049592 Bacteria 3500
697 Ga0501076_0147004 3300049592 Bacteria 1916
698 Ga0501076_0238501 3300049592 Bacteria 1487
699 Ga0501077_0060818 3300049593 Bacteria 2397
700 Ga0501077_0085745 3300049593 Bacteria 1996
701 Ga0501077_0169172 3300049593 Bacteria 1388
702 Ga0501077_0272994 3300049593 Bacteria 1076
703 Ga0501079_0001522 3300049741 Bacteria 16405
704 Ga0501079_0018145 3300049741 Bacteria 5375
705 Ga0501079_0088028 3300049741 Bacteria 2404
706 Ga0501079_0095766 3300049741 Bacteria 2301
707 Ga0501079_0102422 3300049741 Bacteria 2220
708 Ga0501079_0198637 3300049741 Bacteria 1566
709 Ga0501080_0037206 3300049742 Bacteria 4544
710 Ga0501080_0062924 3300049742 Bacteria 3453
711 Ga0501080_0306841 3300049742 Bacteria 1439
712 Ga0501080_0448153 3300049742 Bacteria 1157
713 Ga0501081_0007340 3300049743 Bacteria 7155
714 Ga0501081_0008352 3300049743 Bacteria 6721
715 Ga0501081_0010136 3300049743 Bacteria 6149
716 Ga0501081_0016249 3300049743 Bacteria 4919
717 Ga0501081_0045425 3300049743 Bacteria 3016
718 Ga0501081_0215590 3300049743 Bacteria 1395
719 Ga0501081_0276735 3300049743 Bacteria 1228
720 Ga0501081_0422107 3300049743 Bacteria 989
721 Ga0501083_0003868 3300049744 Bacteria 10516
722 Ga0501083_0033558 3300049744 Bacteria 3514
723 Ga0501083_0199242 3300049744 Unclassified 1306
724 Ga0501035_0095058 3300049822 Bacteria 2620
725 Ga0501035_0184554 3300049822 Bacteria 1796
726 Ga0501045_0000520 3300049824 Bacteria 23954
727 Ga0501045_0162641 3300049824 Bacteria 1662
728 nmdc:mga05p37_160213_c1 3300050507 Bacteria 2749
729 nmdc:mga05p37_164769_c1 3300050507 Bacteria 2706
730 nmdc:mga05p37_167236_c1 3300050507 Bacteria 2683
731 nmdc:mga05p37_19295_c1 3300050507 Bacteria 8247
732 nmdc:mga05p37_238200_c1 3300050507 Bacteria 2189
733 nmdc:mga05p37_294159_c1 3300050507 Bacteria 1932
734 nmdc:mga05p37_43467_c1 3300050507 Bacteria 5528
735 nmdc:mga05p37_451133_c1 3300050507 Bacteria 1488
736 nmdc:mga05p37_495970_c1 3300050507 Bacteria 1403
737 nmdc:mga05p37_51659_c1 3300050507 Bacteria 5054
738 nmdc:mga05p37_5792_c1 3300050507 Bacteria 14524
739 nmdc:mga05p37_66560_c1 3300050507 Bacteria 4432
740 nmdc:mga09592_1074_c1 3300050508 Bacteria 21728
741 nmdc:mga09592_14902_c1 3300050508 Bacteria 6349
742 nmdc:mga09592_268420_c1 3300050508 Bacteria 1480
743 nmdc:mga09592_29989_c1 3300050508 Bacteria 4526
744 nmdc:mga0qj67_152987_c1 3300050509 Bacteria 1871
745 nmdc:mga0qj67_165979_c1 3300050509 Bacteria 1793
746 nmdc:mga0qj67_36401_c1 3300050509 Bacteria 3850
747 nmdc:mga0qj67_879_c1 3300050509 Bacteria 20594
748 nmdc:mga06r32_112235_c1 3300050510 Bacteria 2682
749 nmdc:mga06r32_1589_c1 3300050510 Bacteria 20468
750 nmdc:mga06r32_184928_c1 3300050510 Bacteria 2070
751 nmdc:mga06r32_191691_c1 3300050510 Bacteria 2031
752 nmdc:mga06r32_203283_c1 3300050510 Bacteria 1968
753 nmdc:mga06r32_25763_c1 3300050510 Bacteria 5475
754 nmdc:mga06r32_4707_c1 3300050510 Bacteria 12267
755 nmdc:mga06r32_4801_c1 3300050510 Bacteria 12163
756 nmdc:mga08y16_104186_c1 3300050511 Bacteria 2953
757 nmdc:mga08y16_399776_c1 3300050511 Bacteria 1406
758 nmdc:mga08y16_41470_c1 3300050511 Bacteria 4822
759 nmdc:mga08y16_525_c1 3300050511 Bacteria 35391
760 nmdc:mga08y16_5815_c1 3300050511 Bacteria 9543
761 nmdc:mga08y16_6274_c1 3300050511 Bacteria 12463
762 nmdc:mga0n895_121732_c1 3300050512 Bacteria 2630
763 nmdc:mga0n895_169573_c1 3300050512 Bacteria 2215
764 nmdc:mga0n895_188625_c1 3300050512 Bacteria 2093
765 nmdc:mga0n895_223455_c1 3300050512 Bacteria 1911
766 nmdc:mga0n895_2726_c1 3300050512 Bacteria 13932
767 nmdc:mga0n895_29135_c1 3300050512 Bacteria 5261
768 nmdc:mga0n895_409299_c1 3300050512 Bacteria 1372
769 nmdc:mga0n895_43817_c1 3300050512 Bacteria 4362
770 nmdc:mga0n895_46950_c1 3300050512 Bacteria 4221
771 nmdc:mga0n895_81845_c1 3300050512 Bacteria 3218
772 nmdc:mga0rr50_1117_c1 3300050513 Bacteria 14584
773 nmdc:mga0rr50_13282_c1 3300050513 Bacteria 5356
774 nmdc:mga0rr50_144140_c1 3300050513 Bacteria 1919
775 nmdc:mga0rr50_150423_c1 3300050513 Bacteria 1881
776 nmdc:mga0rr50_29421_c1 3300050513 Bacteria 3874
777 nmdc:mga0rr50_40745_c1 3300050513 Bacteria 3379
778 nmdc:mga08x19_103444_c1 3300050514 Bacteria 1892
779 nmdc:mga08x19_13439_c1 3300050514 Bacteria 4951
780 nmdc:mga08x19_189707_c1 3300050514 Unclassified 1406
781 nmdc:mga08x19_283815_c1 3300050514 Bacteria 1148
782 nmdc:mga08x19_401138_c1 3300050514 Bacteria 962
783 nmdc:mga08x19_49880_c1 3300050514 Bacteria 2685
784 nmdc:mga0a205_103361_c1 3300050515 Bacteria 2748
785 nmdc:mga0a205_122794_c1 3300050515 Bacteria 2497
786 nmdc:mga0a205_18346_c1 3300050515 Bacteria 6576
787 nmdc:mga0a205_185479_c1 3300050515 Bacteria 1973
788 nmdc:mga0a205_27975_c1 3300050515 Bacteria 5387
789 nmdc:mga0a205_29852_c1 3300050515 Bacteria 5218
790 nmdc:mga0a205_49195_c1 3300050515 Bacteria 4069
791 nmdc:mga0a205_92925_c1 3300050515 Bacteria 2915
792 Ga0495612_0057017 3300053078 Bacteria 1613
793 Ga0495612_0082212 3300053078 Bacteria 1354
794 Ga0495595_0006193 3300053084 Bacteria 4868
795 Ga0495595_0117518 3300053084 Bacteria 1294
796 Ga0495619_0006072 3300053085 Bacteria 7652
797 Ga0495619_0141714 3300053085 Bacteria 1656
798 Ga0500578_0000174 3300053086 Bacteria 77215
799 Ga0500644_0062797 3300053088 Bacteria 1314
800 Ga0500562_003392 3300053108 Bacteria 3985
801 Ga0500594_0000305 3300053118 Bacteria 11070
802 Ga0500568_0011869 3300053139 Bacteria 4024
803 Ga0500568_0021578 3300053139 Bacteria 2768
804 Ga0500622_0000230 3300053156 Bacteria 58164
805 Ga0501084_0005407 3300054114 Bacteria 10470
806 Ga0501084_0011856 3300054114 Bacteria 7215
807 Ga0501084_0024808 3300054114 Bacteria 5004
808 Ga0501084_0203575 3300054114 Bacteria 1670
809 Ga0590071_012106 3300059421 Bacteria 2022
810 Ga0501082_0001952 3300060353 Bacteria 18158
811 Ga0501082_0012110 3300060353 Bacteria 7411
812 Ga0501082_0046800 3300060353 Bacteria 3728
813 Ga0501082_0049123 3300060353 Bacteria 3638
814 Ga0501082_0068634 3300060353 Bacteria 3052
815 Ga0501082_0069376 3300060353 Bacteria 3035
816 Ga0530510_0033605 3300061734 Bacteria 3692
817 2585155233 2582581280 Bacteria 5994497
818 2585198777 2582581293 Bacteria 5907401
819 2643780103 2643221552 Bacteria 5708754
820 2643931519 2643221584 Bacteria 5511711
821 2819538986 2818991435 Bacteria 5433759
822 2819647861 2818991454 Bacteria 5563326
823 Ga0111539_10015922
824 JGI26129J50193_1001763
825 JGI26141J51220_1001183
826 Ga0055531_10005922
827 Ga0055531_10018452
828 JGI25405J52794_10006856
829 Ga0065704_10114398
830 Ga0065707_10021072
831 Ga0070676_10000793
832 Ga0070683_100053200
833 Ga0070670_100006323
834 Ga0068869_100014243
835 Ga0068869_100054193
836 Ga0070680_100003802
837 Ga0070680_100033641
838 Ga0070682_100001673
839 Ga0068868_100045142
840 Ga0068868_100048421
841 Ga0070660_100020417
842 Ga0070689_100042171
843 Ga0070689_100222325
844 Ga0070689_100248210
845 Ga0070691_10005053
846 Ga0070691_10009675
847 Ga0070687_100018607
848 Ga0070661_100006150
849 Ga0070692_10006918
850 Ga0070692_10020580
851 Ga0070669_100186355
852 Ga0070675_100569996
853 Ga0070671_100654030
854 Ga0070673_100147455
855 Ga0070659_100005631
856 Ga0070703_10010258
857 Ga0070709_10016216
858 Ga0070709_10037672
859 Ga0070709_10130443
860 Ga0070709_10291900
861 Ga0070714_100024230
862 Ga0070714_100095463
863 Ga0070713_100063446
864 Ga0070710_10011522
865 Ga0070701_10012533
866 Ga0070711_100289894
867 Ga0070705_100001541
868 Ga0070705_100012445
869 Ga0070705_100067945
870 Ga0070705_100145135
871 Ga0070705_100179905
872 Ga0070694_100002862
873 Ga0070694_100062381
874 Ga0070694_100083385
875 Ga0070694_100083706
876 Ga0070694_100150202
877 Ga0070708_100017829
878 Ga0070708_100117040
879 Ga0070708_100152271
880 Ga0070708_100176432
881 Ga0070708_100188658
882 Ga0070708_100223842
883 Ga0070708_100567085
884 Ga0070663_100006478
885 Ga0070662_100004269
886 Ga0070662_100041377
887 Ga0070662_100113285
888 Ga0070681_10134995
889 Ga0068867_100023047
890 Ga0068867_100071061
891 Ga0068867_100119021
892 Ga0068867_100405490
893 Ga0070706_100003700
894 Ga0070706_100022486
895 Ga0070706_100044670
896 Ga0070706_100055126
897 Ga0070706_100142694
898 Ga0070706_100165879
899 Ga0070706_100249406
900 Ga0070706_100302706
901 Ga0070706_100349187
902 Ga0070707_100010067
903 Ga0070707_100023782
904 Ga0070707_100024573
905 Ga0070707_100027792
906 Ga0070707_100037297
907 Ga0070707_100070800
908 Ga0070707_100118962
909 Ga0070707_100274988
910 Ga0070698_100003851
911 Ga0070698_100017393
912 Ga0070698_100056881
913 Ga0070698_100120810
914 Ga0070698_100180827
915 Ga0070698_100185422
916 Ga0070698_100293977
917 Ga0070698_100423221
918 Ga0070699_100007462
919 Ga0070699_100015873
920 Ga0070699_100139840
921 Ga0070699_100174656
922 Ga0070699_100290509
923 Ga0070699_100599405
924 Ga0070699_100782960
925 Ga0070679_100007343
926 Ga0070684_100002889
927 Ga0070684_100215337
928 Ga0070684_100708288
929 Ga0070697_100009746
930 Ga0070697_100010635
931 Ga0070697_100014866
932 Ga0070697_100032461
933 Ga0070697_100069609
934 Ga0070697_100182341
935 Ga0070697_100250963
936 Ga0070697_100313178
937 Ga0068853_100008059
938 Ga0070672_100027266
939 Ga0070672_100056641
940 Ga0070695_100000636
941 Ga0070695_100022317
942 Ga0070695_100026357
943 Ga0070695_100028689
944 Ga0070695_100033946
945 Ga0070695_100046104
946 Ga0070695_100140259
947 Ga0070696_100005376
948 Ga0070696_100016241
949 Ga0070696_100019606
950 Ga0070696_100176424
951 Ga0070696_100429775
952 Ga0070693_100000439
953 Ga0070665_100033904
954 Ga0070704_100011325
955 Ga0070704_100080049
956 Ga0070704_100138214
957 Ga0070704_100200943
958 Ga0070704_100578952
959 Ga0068855_100008335
960 Ga0068855_100251753
961 Ga0070664_100011490
962 Ga0070664_100044947
963 Ga0068857_100087331
964 Ga0068857_100205522
965 Ga0068854_100018950
966 Ga0068856_100003850
967 Ga0070702_100044491
968 Ga0070702_100150563
969 Ga0068852_100332385
970 Ga0068859_100010219
971 Ga0068859_100274367
972 Ga0068859_100284965
973 Ga0068859_100523295
974 Ga0068859_100538958
975 Ga0068864_100034792
976 Ga0068866_10037697
977 Ga0068861_100008970
978 Ga0068870_10000417
979 Ga0068863_100051055
980 Ga0068863_100052978
981 Ga0068863_100105551
982 Ga0068863_100174629
983 Ga0068858_100008466
984 Ga0068858_100457394
985 Ga0068860_100013265
986 Ga0068860_100014518
987 Ga0068860_100114216
988 Ga0068860_100311240
989 Ga0068860_100400953
990 Ga0068860_100930692
991 Ga0068862_100002631
992 Ga0068862_100010761
993 Ga0068862_100031412
994 Ga0081455_10000080
995 Ga0081455_10289956
996 Ga0081455_10305300
997 Ga0081538_10002864
998 Ga0081538_10034418
999 Ga0081538_10132849
1000 Ga0081540_1015325
1001 Ga0081540_1076719
1002 Ga0070717_10003654
1003 Ga0070717_10008837
1004 Ga0070717_10024576
1005 Ga0070717_10073007
1006 Ga0070715_10037858
1007 Ga0070712_100003108
1008 Ga0070712_100023801
1009 Ga0075370_10162314
1010 Ga0075428_100001459
1011 Ga0075428_100019877
1012 Ga0075428_100033095
1013 Ga0075428_100126034
1014 Ga0075428_100244268
1015 Ga0075428_100613608
1016 Ga0075430_100000265
1017 Ga0075430_100012586
1018 Ga0075430_100021023
1019 Ga0075430_100282136
1020 Ga0075430_100553861
1021 Ga0075431_100004549
1022 Ga0075431_100014486
1023 Ga0075431_100090523
1024 Ga0075431_100205865
1025 Ga0075431_100359304
1026 Ga0075431_100370403
1027 Ga0075433_10004655
1028 Ga0075433_10006568
1029 Ga0075433_10020014
1030 Ga0075433_10080670
1031 Ga0075433_10153149
1032 Ga0075433_10153415
1033 Ga0075433_10187777
1034 Ga0075433_10198252
1035 Ga0075433_10210340
1036 Ga0075434_100001459
1037 Ga0075434_100007481
1038 Ga0075434_100011489
1039 Ga0075434_100058483
1040 Ga0075434_100059944
1041 Ga0075434_100138924
1042 Ga0075434_100292427
1043 Ga0075434_100633867
1044 Ga0075429_100015915
1045 Ga0075429_100022420
1046 Ga0075429_100251874
1047 Ga0068865_100101730
1048 Ga0075436_100112141
1049 Ga0075436_100141566
1050 Ga0097620_100010219
1051 Ga0097620_100274367
1052 Ga0097620_100284949
1053 Ga0097620_100523286
1054 Ga0097620_100538932
1055 Ga0075435_100011676
1056 Ga0075435_100023024
1057 Ga0075435_100031176
1058 Ga0099794_10006223
1059 Ga0099794_10016228
1060 Ga0099794_10021094
1061 Ga0105240_10012584
1062 Ga0105240_10394541
1063 Ga0111539_10000552
1064 Ga0111539_10002421
1065 Ga0111539_10016584
1066 Ga0111539_10112034
1067 Ga0111539_10228495
1068 Ga0111539_10308658
1069 Ga0111539_10380674
1070 Ga0111539_10416774
1071 Ga0105245_10006782
1072 Ga0105245_10296847
1073 Ga0105245_10812686
1074 Ga0114129_10024537
1075 Ga0114129_10027915
1076 Ga0114129_10043842
1077 Ga0114129_10045061
1078 Ga0114129_10062038
1079 Ga0114129_10074021
1080 Ga0114129_10121728
1081 Ga0114129_10167177
1082 Ga0114129_10343404
1083 Ga0114129_10344108
1084 Ga0114129_10410112
1085 Ga0114129_10499929
1086 Ga0114129_10505962
1087 Ga0114129_10609447
1088 Ga0114129_10967122
1089 Ga0105243_10201423
1090 Ga0105242_10025688
1091 Ga0105242_10111652
1092 Ga0105242_10132703
1093 Ga0105248_10171589
1094 Ga0105248_10514679
1095 Ga0105237_10152454
1096 Ga0105237_10473481
1097 Ga0105237_10704404
1098 Ga0105238_10000267
1099 Ga0105238_10435026
1100 Ga0105249_10082495
1101 Ga0105249_10185053
1102 Ga0105249_10202046
1103 Ga0105249_10416185
1104 Ga0105239_10050761
1105 Ga0105239_10250341
1106 Ga0105239_10332631
1107 Ga0105239_10409273
1108 Ga0105246_10208200
1109 Ga0105246_10345701
1110 Ga0157373_10002202
1111 Ga0157371_10245078
1112 Ga0157369_10622698
1113 Ga0157378_10052311
1114 Ga0157378_10124196
1115 Ga0163162_10006074
1116 Ga0163162_10300736
1117 Ga0157372_10152042
1118 Ga0157372_10246565
1119 Ga0157375_10084666
1120 Ga0157375_10136690
1121 Ga0157375_10311316
1122 Ga0163163_10040461
1123 Ga0157377_10189446
1124 Ga0157379_10066585
1125 Ga0157379_10184374
1126 Ga0206356_11554582
1127 Ga0213876_10003438
1128 Ga0213876_10071427
1129 Ga0209758_1002863
1130 Ga0209050_1016882
1131 Ga0209257_1000464
1132 Ga0209257_1000966
1133 Ga0207653_10072924
1134 Ga0207692_10007206
1135 Ga0207688_10002474
1136 Ga0207680_10091709
1137 Ga0207647_10090365
1138 Ga0207647_10133726
1139 Ga0207685_10017243
1140 Ga0207699_10045772
1141 Ga0207699_10080053
1142 Ga0207645_10000290
1143 Ga0207643_10000482
1144 Ga0207684_10003244
1145 Ga0207684_10016346
1146 Ga0207684_10017320
1147 Ga0207684_10028226
1148 Ga0207684_10031690
1149 Ga0207684_10040657
1150 Ga0207684_10070356
1151 Ga0207684_10086621
1152 Ga0207684_10307191
1153 Ga0207654_10038449
1154 Ga0207654_10313613
1155 Ga0207707_10001856
1156 Ga0207695_10036347
1157 Ga0207695_10154526
1158 Ga0207695_10391639
1159 Ga0207695_10471319
1160 Ga0207671_10033725
1161 Ga0207671_10117221
1162 Ga0207671_10575607
1163 Ga0207693_10004676
1164 Ga0207693_10009107
1165 Ga0207693_10021174
1166 Ga0207693_10024976
1167 Ga0207663_10089790
1168 Ga0207663_10111565
1169 Ga0207660_10155373
1170 Ga0207662_10022746
1171 Ga0207657_10006680
1172 Ga0207649_10002003
1173 Ga0207652_10001521
1174 Ga0207652_10030392
1175 Ga0207646_10007629
1176 Ga0207646_10012309
1177 Ga0207646_10014773
1178 Ga0207646_10018025
1179 Ga0207646_10025619
1180 Ga0207646_10027397
1181 Ga0207646_10105866
1182 Ga0207646_10116890
1183 Ga0207646_10144610
1184 Ga0207646_10153376
1185 Ga0207646_10173305
1186 Ga0207646_10463831
1187 Ga0207681_10021290
1188 Ga0207681_10030509
1189 Ga0207681_10202725
1190 Ga0207681_10633463
1191 Ga0207694_10001065
1192 Ga0207650_10057561
1193 Ga0207659_10407472
1194 Ga0207687_10527835
1195 Ga0207700_10090045
1196 Ga0207700_10091181
1197 Ga0207664_10152772
1198 Ga0207690_10001543
1199 Ga0207690_10124660
1200 Ga0207690_10160449
1201 Ga0207706_10008540
1202 Ga0207706_10042804
1203 Ga0207706_10077655
1204 Ga0207706_10136916
1205 Ga0207686_10021917
1206 Ga0207709_10334358
1207 Ga0207670_10128068
1208 Ga0207704_10304717
1209 Ga0207665_10007771
1210 Ga0207665_10010921
1211 Ga0207665_10071103
1212 Ga0207691_10023772
1213 Ga0207691_10028497
1214 Ga0207711_10072397
1215 Ga0207711_10437492
1216 Ga0207689_10000425
1217 Ga0207689_10022145
1218 Ga0207689_10074378
1219 Ga0207689_10355861
1220 Ga0207661_10208705
1221 Ga0207679_10003606
1222 Ga0207679_10057134
1223 Ga0207667_10003229
1224 Ga0207667_10395935
1225 Ga0207712_10128958
1226 Ga0207712_10194684
1227 Ga0207712_10266535
1228 Ga0207668_10066824
1229 Ga0207640_10419046
1230 Ga0207658_10360917
1231 Ga0207677_10074544
1232 Ga0207677_10118102
1233 Ga0207703_10025235
1234 Ga0207639_10075051
1235 Ga0207678_10001467
1236 Ga0207708_10008647
1237 Ga0207708_10043639
1238 Ga0207702_10017506
1239 Ga0207641_10091593
1240 Ga0207641_10236395
1241 Ga0207648_10001313
1242 Ga0207648_10013103
1243 Ga0207648_10026736
1244 Ga0207648_10051851
1245 Ga0207648_10215846
1246 Ga0207676_10616535
1247 Ga0207674_10004140
1248 Ga0207675_100016627
1249 Ga0207675_100077230
1250 Ga0207675_100179040
1251 Ga0207675_100701789
1252 Ga0209969_1001194
1253 Ga0209981_1012538
1254 Ga0210000_1001753
1255 Ga0209995_1001173
1256 Ga0209999_1004888
1257 Ga0209588_1033496
1258 Ga0209588_1042400
1259 Ga0209971_1000005
1260 Ga0209971_1034960
1261 Ga0209966_1000010
1262 Ga0209998_10000023
1263 Ga0209974_10000464
1264 Ga0207428_10000029
1265 Ga0207428_10000173
1266 Ga0207428_10031886
1267 Ga0207428_10039995
1268 Ga0207428_10196184
1269 Ga0268266_10033883
1270 Ga0268265_10005337
1271 Ga0268265_10008618
1272 Ga0268265_10020825
1273 Ga0268264_10041562
1274 Ga0268264_10096737
1275 Ga0268264_10108453
1276 Ga0268264_10532392
1277 Ga0268264_10580791
1278 Ga0268264_10683747
1279 Ga0307515_10077383
1280 Ga0307408_100008174
1281 Ga0307408_100209065
1282 Ga0307410_10067961
1283 Ga0307409_100092962
1284 Ga0307416_100030872
1285 Ga0307416_100107843
1286 Ga0307411_10040420
1287 Ga0307411_10257952
1288 Ga0307411_10600606
1289 Ga0316592_1010128
1290 Ga0316587_1012054
1291 Ga0316596_1030125
1292 Ga0373948_0019911
1293 Ga0373948_0021500
1294 Ga0373926_0006175
1295 Ga0373929_0034648
1296 Ga0373934_0027204
1297 Ga0373940_0018792
1298 Ga0373940_0026031
1299 Ga0373944_0003654
1300 Ga0373949_0051195
1301 Ga0373951_0006270
1302 Ga0373951_0030118
1303 Ga0373923_0013619
1304 Ga0373932_0013222
1305 Ga0373936_0003003
1306 Ga0373939_0033505
1307 Ga0373941_0061704
1308 Ga0373945_0000323
1309 Ga0373953_0005349
1310 Ga0373956_0031301
1311 Ga0373957_0097122
1312 Ga0373960_0030791
1313 Ga0373943_0003455
1314 Ga0373946_0000032
1315 Ga0373955_0014921
1316 Ga0373955_0072796
1317 Ga0373961_0007034
1318 Ga0373924_0017982
1319 Ga0373931_0023886
1320 Ga0373931_0044302
1321 Ga0373931_0064619
1322 Ga0373935_0010227
1323 Ga0373927_0003444
1324 Ga0373927_0407601
1325 Ga0373933_0035343
1326 Ga0373947_0001873
1327 Ga0373947_0026394
1328 Ga0373937_0011744
1329 Ga0373925_0007019
1330 Ga0395900_0038044
1331 Ga0395900_0122249
1332 Ga0395900_0313259
1333 Ga0395898_0018171
1334 Ga0395905_0003062
1335 Ga0395905_0285278
1336 Ga0395901_0001183
1337 Ga0395901_0233777
1338 Ga0395901_0426901
1339 Ga0242420_007513
1340 Ga0242420_016676
1341 Ga0400483_057045
1342 Ga0400483_260981
1343 Ga0400489_32282
1344 Ga0436365_0035886
1345 Ga0436365_1385500
1346 Ga0436365_1516850
1347 Ga0436365_1888363
1348 Ga0436360_1093231
1349 Ga0436361_0262333
1350 Ga0436362_0880168
1351 Ga0436362_0907713
1352 Ga0451837_0114825
1353 Ga0451853_2024754
1354 Ga0439441_010712
1355 Ga0439448_0000854
1356 Ga0439450_001090
1357 Ga0450889_005474
1358 Ga0439459_0001667
1359 Ga0450893_0007512
1360 Ga0451577_0008825
1361 Ga0451577_0087844
1362 Ga0453683_0006890
1363 Ga0453683_0070313
1364 Ga0453683_0133156
1365 Ga0453683_0137363
1366 Ga0466963_0012075
1367 Ga0453684_0017192
1368 Ga0453684_0158659
1369 Ga0453684_0186435
1370 Ga0453684_0190470
1371 Ga0453684_0334123
1372 Ga0466971_0090979
1373 Ga0466970_0090772
1374 Ga0466959_0031166
1375 Ga0466959_0088805
1376 Ga0451576_0000713
1377 Ga0451576_0021384
1378 Ga0451576_0025380
1379 Ga0451576_0054349
1380 Ga0451576_0079801
1381 Ga0451576_0152459
1382 Ga0451576_0172370
1383 Ga0451576_0189894
1384 Ga0451576_0292267
1385 Ga0451576_1067556
1386 Ga0466958_0024793
1387 Ga0466958_0043535
1388 Ga0466958_0057061
1389 Ga0466958_0078248
1390 Ga0495592_0114088
1391 Ga0495590_0000222
1392 Ga0495641_0013237
1393 Ga0495651_0025285
1394 Ga0495653_0014165
1395 Ga0495650_0036998
1396 Ga0495580_0007988
1397 Ga0495582_0023126
1398 Ga0495664_0002074
1399 Ga0495664_0106561
1400 Ga0495608_0008196
1401 Ga0495610_0001074
1402 Ga0495628_0011997
1403 Ga0495631_0005432
1404 Ga0495642_0030298
1405 Ga0495652_0064443
1406 Ga0495652_0071677
1407 Ga0495652_0129548
1408 Ga0495654_0052964
1409 Ga0495665_0034725
1410 Ga0495640_0071724
1411 Ga0495587_0076449
1412 Ga0495597_0039480
1413 Ga0495645_0329779
1414 Ga0495667_0058356
1415 Ga0495656_0093820
1416 Ga0495634_0113260
1417 Ga0495634_0160769
1418 Ga0495625_0000025
1419 Ga0495635_0005259
1420 Ga0495635_0007799
1421 Ga0495635_0012750
1422 Ga0495659_0053287
1423 Ga0495659_0107212
1424 Ga0495659_0119775
1425 Ga0495657_0006207
1426 Ga0495657_0052073
1427 Ga0495657_0164118
1428 Ga0495599_0008558
1429 Ga0495599_0027042
1430 Ga0495623_0036047
1431 Ga0495646_0090159
1432 Ga0495646_0124509
1433 Ga0495647_0057432
1434 Ga0495669_0059642
1435 Ga0495613_0075441
1436 Ga0495624_0001199
1437 Ga0495600_0005292
1438 Ga0495600_0008716
1439 Ga0495600_0061280
1440 Ga0495600_0296780
1441 Ga0495660_0044308
1442 Ga0495660_0058838
1443 Ga0495581_0012869
1444 Ga0495604_0108153
1445 Ga0495636_0012878
1446 Ga0495674_0006440
1447 Ga0495674_0036658
1448 Ga0495674_0276476
1449 Ga0495674_0364444
1450 Ga0495672_0050082
1451 Ga0495680_0006294
1452 Ga0495680_0014077
1453 Ga0495680_0022948
1454 Ga0495681_0014234
1455 Ga0495684_0004583
1456 Ga0495684_0042941
1457 Ga0495686_0000338
1458 Ga0495593_0073372
1459 Ga0495602_0048762
1460 Ga0495602_0201876
1461 Ga0496100_0062492
1462 Ga0496102_0001681
1463 Ga0496103_0104296
1464 Ga0496104_0064553
1465 Ga0496105_0033341
1466 Ga0496106_0072923
1467 Ga0496106_0091634
1468 Ga0496106_0299321
1469 Ga0496108_0049956
1470 Ga0496109_0088024
1471 Ga0496110_0054419
1472 Ga0496110_0471112
1473 Ga0496111_0028654
1474 Ga0496112_0019059
1475 Ga0496112_0218434
1476 Ga0496113_0071245
1477 Ga0496113_0135034
1478 Ga0495678_001352
1479 Ga0501033_0217433
1480 Ga0501034_0019780
1481 Ga0501039_0110624
1482 Ga0501039_0319434
1483 Ga0501040_0033474
1484 Ga0501040_0036262
1485 Ga0501040_0190489
1486 Ga0501041_0011242
1487 Ga0501042_0005993
1488 Ga0501042_0350426
1489 Ga0501043_0293573
1490 Ga0501046_0001215
1491 Ga0501046_0062058
1492 Ga0501046_0098995
1493 Ga0501046_0139327
1494 Ga0501046_0316777
1495 Ga0501047_0034945
1496 Ga0501047_0177937
1497 Ga0501048_0016907
1498 Ga0501068_0094879
1499 Ga0501068_0143480
1500 Ga0501070_0513622
1501 Ga0501071_0153728
1502 Ga0501072_0055798
1503 Ga0501072_0111028
1504 Ga0501072_0115943
1505 Ga0501072_0130408
1506 Ga0501072_0179278
1507 Ga0501072_0219457
1508 Ga0501072_0222637
1509 Ga0501072_0244683
1510 Ga0501073_0144285
1511 Ga0501074_0137996
1512 Ga0501075_0019213
1513 Ga0501075_0070812
1514 Ga0501075_0199197
1515 Ga0501075_0231623
1516 Ga0501075_0339449
1517 Ga0501076_0040847
1518 Ga0501076_0044540
1519 Ga0501076_0147004
1520 Ga0501076_0238501
1521 Ga0501077_0060818
1522 Ga0501077_0085745
1523 Ga0501077_0169172
1524 Ga0501077_0272994
1525 Ga0501079_0001522
1526 Ga0501079_0018145
1527 Ga0501079_0088028
1528 Ga0501079_0095766
1529 Ga0501079_0102422
1530 Ga0501079_0198637
1531 Ga0501080_0037206
1532 Ga0501080_0062924
1533 Ga0501080_0306841
1534 Ga0501080_0448153
1535 Ga0501081_0007340
1536 Ga0501081_0008352
1537 Ga0501081_0010136
1538 Ga0501081_0016249
1539 Ga0501081_0045425
1540 Ga0501081_0215590
1541 Ga0501081_0276735
1542 Ga0501081_0422107
1543 Ga0501083_0003868
1544 Ga0501083_0033558
1545 Ga0501083_0199242
1546 Ga0501035_0095058
1547 Ga0501035_0184554
1548 Ga0501045_0000520
1549 Ga0501045_0162641
1550 nmdc:mga05p37_160213_c1
1551 nmdc:mga05p37_164769_c1
1552 nmdc:mga05p37_167236_c1
1553 nmdc:mga05p37_19295_c1
1554 nmdc:mga05p37_238200_c1
1555 nmdc:mga05p37_294159_c1
1556 nmdc:mga05p37_43467_c1
1557 nmdc:mga05p37_451133_c1
1558 nmdc:mga05p37_495970_c1
1559 nmdc:mga05p37_51659_c1
1560 nmdc:mga05p37_5792_c1
1561 nmdc:mga05p37_66560_c1
1562 nmdc:mga09592_1074_c1
1563 nmdc:mga09592_14902_c1
1564 nmdc:mga09592_268420_c1
1565 nmdc:mga09592_29989_c1
1566 nmdc:mga0qj67_152987_c1
1567 nmdc:mga0qj67_165979_c1
1568 nmdc:mga0qj67_36401_c1
1569 nmdc:mga0qj67_879_c1
1570 nmdc:mga06r32_112235_c1
1571 nmdc:mga06r32_1589_c1
1572 nmdc:mga06r32_184928_c1
1573 nmdc:mga06r32_191691_c1
1574 nmdc:mga06r32_203283_c1
1575 nmdc:mga06r32_25763_c1
1576 nmdc:mga06r32_4707_c1
1577 nmdc:mga06r32_4801_c1
1578 nmdc:mga08y16_104186_c1
1579 nmdc:mga08y16_399776_c1
1580 nmdc:mga08y16_41470_c1
1581 nmdc:mga08y16_525_c1
1582 nmdc:mga08y16_5815_c1
1583 nmdc:mga08y16_6274_c1
1584 nmdc:mga0n895_121732_c1
1585 nmdc:mga0n895_169573_c1
1586 nmdc:mga0n895_188625_c1
1587 nmdc:mga0n895_223455_c1
1588 nmdc:mga0n895_2726_c1
1589 nmdc:mga0n895_29135_c1
1590 nmdc:mga0n895_409299_c1
1591 nmdc:mga0n895_43817_c1
1592 nmdc:mga0n895_46950_c1
1593 nmdc:mga0n895_81845_c1
1594 nmdc:mga0rr50_1117_c1
1595 nmdc:mga0rr50_13282_c1
1596 nmdc:mga0rr50_144140_c1
1597 nmdc:mga0rr50_150423_c1
1598 nmdc:mga0rr50_29421_c1
1599 nmdc:mga0rr50_40745_c1
1600 nmdc:mga08x19_103444_c1
1601 nmdc:mga08x19_13439_c1
1602 nmdc:mga08x19_189707_c1
1603 nmdc:mga08x19_283815_c1
1604 nmdc:mga08x19_401138_c1
1605 nmdc:mga08x19_49880_c1
1606 nmdc:mga0a205_103361_c1
1607 nmdc:mga0a205_122794_c1
1608 nmdc:mga0a205_18346_c1
1609 nmdc:mga0a205_185479_c1
1610 nmdc:mga0a205_27975_c1
1611 nmdc:mga0a205_29852_c1
1612 nmdc:mga0a205_49195_c1
1613 nmdc:mga0a205_92925_c1
1614 Ga0495612_0057017
1615 Ga0495612_0082212
1616 Ga0495595_0006193
1617 Ga0495595_0117518
1618 Ga0495619_0006072
1619 Ga0495619_0141714
1620 Ga0500578_0000174
1621 Ga0500644_0062797
1622 Ga0500562_003392
1623 Ga0500594_0000305
1624 Ga0500568_0011869
1625 Ga0500568_0021578
1626 Ga0500622_0000230
1627 Ga0501084_0005407
1628 Ga0501084_0011856
1629 Ga0501084_0024808
1630 Ga0501084_0203575
1631 Ga0590071_012106
1632 Ga0501082_0001952
1633 Ga0501082_0012110
1634 Ga0501082_0046800
1635 Ga0501082_0049123
1636 Ga0501082_0068634
1637 Ga0501082_0069376
1638 Ga0530510_0033605
1639 2585155233
1640 2585198777
1641 2643780103
1642 2643931519
1643 2819538986
1644 2819647861

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

61

315

0.97

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

66

314

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k2n-assembly1.cif.gz_A crystal structure of an enoyl-coa hydratase/ carnithine racemase from magnetospirillum magneticum 0.9592 6 267
5c9g-assembly2.cif.gz_F crystal structure of a putative enoyl-coa hydratase/isomerase family protein from hyphomonas neptunium 0.941 9 267
4wcz-assembly2.cif.gz_E crystal structure of a putative enoyl-coa hydratase/isomerase from novosphingobium aromaticivorans 0.9361 9 264
4wcz-assembly2.cif.gz_E crystal structure of a putative enoyl-coa hydratase/isomerase from novosphingobium aromaticivorans 0.9289 9 264
4di1-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase echa17 from mycobacterium marinum 0.9275 6 246
ID Description Score Start End Superfamily
5c9gA01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9588 9 207 3.90.226.10
4k2nA01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9549 7 209 3.90.226.10
5o34B01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9526 11 207 3.90.226.10
3hrxF01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9468 10 209 3.90.226.10
af_B7F9R1_37_234_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9449 18 207 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A7W5DEL8-F1-model_v4 Enoyl-CoA hydratase/carnithine racemase 0.9876 9 267 GO:0006635
GO:0016829
AF-A0A7Y4X639-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9811 6 267 GO:0004300
GO:0006635
AF-A0A3B9J6E3-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9795 11 206 GO:0004300
GO:0006635
AF-A0A7C6I609-F1-model_v4 deleted 0.978 9 255
AF-A0A3B9C5N2-F1-model_v4 deleted 0.9777 7 218

Map