F482214
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 820 | 390 | 813 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300025921|Ga0207652_10208655|Ga0207652_102086552 |
| Length | 170 |
| Sequence | MKALVALPILLFAVAAYAQNPSDAQIAQIVVTANQVDIDAGKLAESKATSADVKAFAKQMVTDHSGVNKQATALVKKLHVKPEPSDTSKSLAQGGKDNVAKLKGMKKGPAFDKAYIDHEVDYHQAVLDAMDKTLVPSAQNAELKDLLVKVRPAFVAHLEHAKMIQSKLGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 3 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 4 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 5 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 6 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 7 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 10 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 21 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 91 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 92 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 93 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 97 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 111 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 145 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 155 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 212 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 214 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 215 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 216 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 217 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 221 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 222 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 223 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 224 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 226 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 230 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 232 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 237 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 238 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 239 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 242 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 243 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 246 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 247 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 248 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 249 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 250 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 251 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 252 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 253 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 254 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 255 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 256 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 257 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 258 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 259 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 260 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 261 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 262 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 263 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 312 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 313 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 314 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 315 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 316 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 317 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 320 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 321 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 322 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 323 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 324 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 325 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 326 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 327 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 328 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 329 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 330 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 332 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 333 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 355 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 356 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 357 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 358 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 362 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 363 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 366 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 368 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 369 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 370 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 371 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 381 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 382 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 384 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 390 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.2 |
| Metatranscriptomes | 1.95 |
| Isolates | 0.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.93 |
| Nodule | 0.12 |
| Rhizoplane | 3.05 |
| Rhizosphere | 85.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_516664 | 2162886007 | Bacteria | 4024 |
| 2 | JGI24751J29686_10019403 | 3300002459 | Bacteria | 1407 |
| 3 | JGI25156J39149_1002457 | 3300002705 | Bacteria | 6632 |
| 4 | Ga0007409J51694_1028918 | 3300003575 | Bacteria | 592 |
| 5 | Ga0007429J51699_1119903 | 3300003579 | Bacteria | 862 |
| 6 | Ga0055533_1000106 | 3300003756 | Bacteria | 104514 |
| 7 | Ga0055532_1000003 | 3300003758 | Bacteria | 494004 |
| 8 | Ga0055527_1000006 | 3300003760 | Bacteria | 494004 |
| 9 | Ga0055535_1000003 | 3300003761 | Bacteria | 494004 |
| 10 | Ga0055542_1000007 | 3300003762 | Bacteria | 494004 |
| 11 | Ga0055529_1000003 | 3300003763 | Bacteria | 494004 |
| 12 | Ga0058863_11561367 | 3300004799 | Bacteria | 622 |
| 13 | Ga0058861_11675737 | 3300004800 | Bacteria | 777 |
| 14 | Ga0058860_11905593 | 3300004801 | Bacteria | 755 |
| 15 | Ga0058862_12242253 | 3300004803 | Bacteria | 791 |
| 16 | Ga0065714_10287893 | 3300005288 | Bacteria | 713 |
| 17 | Ga0065712_10078899 | 3300005290 | Bacteria | 3285 |
| 18 | Ga0065712_10217158 | 3300005290 | Bacteria | 1053 |
| 19 | Ga0065712_10580926 | 3300005290 | Unclassified | 601 |
| 20 | Ga0065715_10105044 | 3300005293 | Bacteria | 2918 |
| 21 | Ga0065715_10163674 | 3300005293 | Bacteria | 1605 |
| 22 | Ga0065715_10190385 | 3300005293 | Unclassified | 1419 |
| 23 | Ga0065715_10470402 | 3300005293 | Bacteria | 807 |
| 24 | Ga0065715_10474359 | 3300005293 | Bacteria | 803 |
| 25 | Ga0065715_10509730 | 3300005293 | Unclassified | 772 |
| 26 | Ga0065707_10201881 | 3300005295 | Bacteria | 1245 |
| 27 | Ga0070658_10023101 | 3300005327 | Bacteria | 4992 |
| 28 | Ga0070658_10036995 | 3300005327 | Bacteria | 3933 |
| 29 | Ga0070658_10054974 | 3300005327 | Bacteria | 3233 |
| 30 | Ga0070658_10074108 | 3300005327 | Bacteria | 2792 |
| 31 | Ga0070658_10345699 | 3300005327 | Bacteria | 1273 |
| 32 | Ga0070676_10030962 | 3300005328 | Bacteria | 3055 |
| 33 | Ga0070676_10712836 | 3300005328 | Bacteria | 734 |
| 34 | Ga0070683_100002995 | 3300005329 | Bacteria | 13552 |
| 35 | Ga0070683_100007080 | 3300005329 | Bacteria | 9445 |
| 36 | Ga0070683_100286171 | 3300005329 | Bacteria | 1568 |
| 37 | Ga0070683_101255031 | 3300005329 | Bacteria | 712 |
| 38 | Ga0070690_100023960 | 3300005330 | Bacteria | 3750 |
| 39 | Ga0070690_100202494 | 3300005330 | Bacteria | 1382 |
| 40 | Ga0070670_100004831 | 3300005331 | Bacteria | 11325 |
| 41 | Ga0070670_100098196 | 3300005331 | Bacteria | 2520 |
| 42 | Ga0070670_100208226 | 3300005331 | Bacteria | 1700 |
| 43 | Ga0070670_100357260 | 3300005331 | Bacteria | 1284 |
| 44 | Ga0070677_10003597 | 3300005333 | Bacteria | 5002 |
| 45 | Ga0068869_100078407 | 3300005334 | Bacteria | 2460 |
| 46 | Ga0068869_100151345 | 3300005334 | Bacteria | 1800 |
| 47 | Ga0068869_100335011 | 3300005334 | Unclassified | 1230 |
| 48 | Ga0070666_10733945 | 3300005335 | Unclassified | 725 |
| 49 | Ga0070680_101339058 | 3300005336 | Bacteria | 620 |
| 50 | Ga0070682_100830919 | 3300005337 | Bacteria | 753 |
| 51 | Ga0070682_100892267 | 3300005337 | Bacteria | 730 |
| 52 | Ga0068868_101168726 | 3300005338 | Bacteria | 710 |
| 53 | Ga0070660_100008509 | 3300005339 | Bacteria | 7179 |
| 54 | Ga0070660_100014681 | 3300005339 | Bacteria | 5651 |
| 55 | Ga0070660_100059432 | 3300005339 | Bacteria | 2964 |
| 56 | Ga0070689_100110044 | 3300005340 | Bacteria | 2190 |
| 57 | Ga0070691_10447978 | 3300005341 | Bacteria | 737 |
| 58 | Ga0070687_100022283 | 3300005343 | Bacteria | 2993 |
| 59 | Ga0070661_100024170 | 3300005344 | Bacteria | 4358 |
| 60 | Ga0070661_100155730 | 3300005344 | Bacteria | 1729 |
| 61 | Ga0070661_100754303 | 3300005344 | Bacteria | 796 |
| 62 | Ga0070668_100422383 | 3300005347 | Bacteria | 1142 |
| 63 | Ga0070668_100504047 | 3300005347 | Bacteria | 1048 |
| 64 | Ga0070668_100762933 | 3300005347 | Bacteria | 857 |
| 65 | Ga0070669_100007291 | 3300005353 | Bacteria | 7932 |
| 66 | Ga0070669_100145704 | 3300005353 | Bacteria | 1830 |
| 67 | Ga0070669_100171445 | 3300005353 | Bacteria | 1692 |
| 68 | Ga0070669_100331798 | 3300005353 | Bacteria | 1230 |
| 69 | Ga0070669_100343456 | 3300005353 | Bacteria | 1210 |
| 70 | Ga0070675_100119522 | 3300005354 | Bacteria | 2238 |
| 71 | Ga0070671_100040564 | 3300005355 | Bacteria | 3867 |
| 72 | Ga0070671_100117389 | 3300005355 | Bacteria | 2237 |
| 73 | Ga0070671_100161307 | 3300005355 | Bacteria | 1895 |
| 74 | Ga0070671_100350494 | 3300005355 | Bacteria | 1260 |
| 75 | Ga0070671_100368251 | 3300005355 | Bacteria | 1227 |
| 76 | Ga0070674_100026819 | 3300005356 | Bacteria | 3768 |
| 77 | Ga0070674_100158544 | 3300005356 | Bacteria | 1715 |
| 78 | Ga0070674_100578428 | 3300005356 | Bacteria | 946 |
| 79 | Ga0070674_100720322 | 3300005356 | Bacteria | 855 |
| 80 | Ga0070674_101538553 | 3300005356 | Bacteria | 599 |
| 81 | Ga0070673_100014167 | 3300005364 | Bacteria | 5542 |
| 82 | Ga0070673_100037552 | 3300005364 | Bacteria | 3692 |
| 83 | Ga0070673_100341194 | 3300005364 | Bacteria | 1327 |
| 84 | Ga0070673_100502513 | 3300005364 | Bacteria | 1097 |
| 85 | Ga0070673_100520528 | 3300005364 | Bacteria | 1078 |
| 86 | Ga0070688_100061888 | 3300005365 | Bacteria | 2368 |
| 87 | Ga0070659_100125467 | 3300005366 | Bacteria | 2082 |
| 88 | Ga0070659_100582707 | 3300005366 | Bacteria | 960 |
| 89 | Ga0070659_100978566 | 3300005366 | Bacteria | 742 |
| 90 | Ga0070659_101397043 | 3300005366 | Unclassified | 622 |
| 91 | Ga0070667_100252286 | 3300005367 | Bacteria | 1577 |
| 92 | Ga0070713_100033336 | 3300005436 | Bacteria | 4123 |
| 93 | Ga0070711_100208905 | 3300005439 | Unclassified | 1511 |
| 94 | Ga0070705_100246899 | 3300005440 | Bacteria | 1251 |
| 95 | Ga0070700_100093368 | 3300005441 | Bacteria | 1968 |
| 96 | Ga0070700_101060162 | 3300005441 | Bacteria | 670 |
| 97 | Ga0070663_100084708 | 3300005455 | Bacteria | 2337 |
| 98 | Ga0070678_100021686 | 3300005456 | Bacteria | 4241 |
| 99 | Ga0070678_100027183 | 3300005456 | Bacteria | 3882 |
| 100 | Ga0070662_100017517 | 3300005457 | Bacteria | 4832 |
| 101 | Ga0070662_100106292 | 3300005457 | Bacteria | 2131 |
| 102 | Ga0070662_100311911 | 3300005457 | Bacteria | 1281 |
| 103 | Ga0070662_100904649 | 3300005457 | Unclassified | 753 |
| 104 | Ga0070681_10057879 | 3300005458 | Bacteria | 3856 |
| 105 | Ga0070681_10154905 | 3300005458 | Bacteria | 2217 |
| 106 | Ga0070681_11117500 | 3300005458 | Bacteria | 709 |
| 107 | Ga0068867_100097317 | 3300005459 | Bacteria | 2242 |
| 108 | Ga0068867_100525530 | 3300005459 | Bacteria | 1021 |
| 109 | Ga0068867_100752114 | 3300005459 | Bacteria | 865 |
| 110 | Ga0070685_10138819 | 3300005466 | Bacteria | 1528 |
| 111 | Ga0070685_10234243 | 3300005466 | Bacteria | 1209 |
| 112 | Ga0070706_100361743 | 3300005467 | Bacteria | 1352 |
| 113 | Ga0070706_100837088 | 3300005467 | Bacteria | 851 |
| 114 | Ga0070707_100791276 | 3300005468 | Bacteria | 912 |
| 115 | Ga0070699_100314086 | 3300005518 | Bacteria | 1407 |
| 116 | Ga0070679_100052050 | 3300005530 | Bacteria | 4079 |
| 117 | Ga0070679_100126332 | 3300005530 | Bacteria | 2540 |
| 118 | Ga0070679_100144488 | 3300005530 | Unclassified | 2357 |
| 119 | Ga0070679_100186138 | 3300005530 | Bacteria | 2047 |
| 120 | Ga0070679_100202026 | 3300005530 | Bacteria | 1953 |
| 121 | Ga0070684_100038153 | 3300005535 | Bacteria | 4125 |
| 122 | Ga0070684_100064760 | 3300005535 | Bacteria | 3207 |
| 123 | Ga0070697_100475335 | 3300005536 | Bacteria | 1091 |
| 124 | Ga0068853_100031187 | 3300005539 | Bacteria | 4508 |
| 125 | Ga0068853_100036362 | 3300005539 | Bacteria | 4186 |
| 126 | Ga0068853_100350530 | 3300005539 | Unclassified | 1373 |
| 127 | Ga0068853_100873110 | 3300005539 | Bacteria | 863 |
| 128 | Ga0070672_100044581 | 3300005543 | Bacteria | 3427 |
| 129 | Ga0070672_100324184 | 3300005543 | Bacteria | 1310 |
| 130 | Ga0070672_100478189 | 3300005543 | Bacteria | 1075 |
| 131 | Ga0070686_100003087 | 3300005544 | Bacteria | 9124 |
| 132 | Ga0070686_100023278 | 3300005544 | Bacteria | 3700 |
| 133 | Ga0070686_100034885 | 3300005544 | Bacteria | 3103 |
| 134 | Ga0070695_101091279 | 3300005545 | Bacteria | 653 |
| 135 | Ga0070696_100029166 | 3300005546 | Bacteria | 3769 |
| 136 | Ga0070693_100332079 | 3300005547 | Bacteria | 1035 |
| 137 | Ga0070693_100741568 | 3300005547 | Bacteria | 723 |
| 138 | Ga0070665_100050095 | 3300005548 | Bacteria | 4191 |
| 139 | Ga0070665_101255524 | 3300005548 | Bacteria | 751 |
| 140 | Ga0068855_100137880 | 3300005563 | Bacteria | 2783 |
| 141 | Ga0068855_100808215 | 3300005563 | Bacteria | 996 |
| 142 | Ga0068855_100862277 | 3300005563 | Bacteria | 959 |
| 143 | Ga0070664_100005782 | 3300005564 | Bacteria | 9976 |
| 144 | Ga0070664_100056589 | 3300005564 | Bacteria | 3332 |
| 145 | Ga0070664_100122149 | 3300005564 | Bacteria | 2281 |
| 146 | Ga0070664_100294207 | 3300005564 | Bacteria | 1466 |
| 147 | Ga0070664_100800774 | 3300005564 | Bacteria | 881 |
| 148 | Ga0068857_100002215 | 3300005577 | Bacteria | 15829 |
| 149 | Ga0068857_100043928 | 3300005577 | Bacteria | 3963 |
| 150 | Ga0068857_100665241 | 3300005577 | Bacteria | 988 |
| 151 | Ga0068854_100005064 | 3300005578 | Bacteria | 8300 |
| 152 | Ga0068854_100027942 | 3300005578 | Bacteria | 3893 |
| 153 | Ga0068854_100077457 | 3300005578 | Bacteria | 2447 |
| 154 | Ga0068854_100367903 | 3300005578 | Bacteria | 1181 |
| 155 | Ga0068856_100134150 | 3300005614 | Bacteria | 2481 |
| 156 | Ga0068856_101176883 | 3300005614 | Bacteria | 783 |
| 157 | Ga0070702_100117250 | 3300005615 | Bacteria | 1661 |
| 158 | Ga0070702_100221209 | 3300005615 | Bacteria | 1266 |
| 159 | Ga0070702_101036408 | 3300005615 | Bacteria | 652 |
| 160 | Ga0068852_100001481 | 3300005616 | Bacteria | 15887 |
| 161 | Ga0068852_100178273 | 3300005616 | Bacteria | 1996 |
| 162 | Ga0068859_100452801 | 3300005617 | Bacteria | 1380 |
| 163 | Ga0068864_100205277 | 3300005618 | Bacteria | 1812 |
| 164 | Ga0068861_100114314 | 3300005719 | Unclassified | 2167 |
| 165 | Ga0068861_100252695 | 3300005719 | Bacteria | 1505 |
| 166 | Ga0068861_100656473 | 3300005719 | Bacteria | 970 |
| 167 | Ga0068861_100777290 | 3300005719 | Unclassified | 897 |
| 168 | Ga0068861_101722685 | 3300005719 | Bacteria | 620 |
| 169 | Ga0068851_10032323 | 3300005834 | Bacteria | 2604 |
| 170 | Ga0068851_10258457 | 3300005834 | Bacteria | 990 |
| 171 | Ga0068858_100550975 | 3300005842 | Bacteria | 1116 |
| 172 | Ga0068858_100621392 | 3300005842 | Bacteria | 1049 |
| 173 | Ga0068858_101355116 | 3300005842 | Bacteria | 701 |
| 174 | Ga0068860_100391286 | 3300005843 | Bacteria | 1374 |
| 175 | Ga0068860_101130975 | 3300005843 | Bacteria | 803 |
| 176 | Ga0068860_101299176 | 3300005843 | Bacteria | 748 |
| 177 | Ga0068862_100020071 | 3300005844 | Bacteria | 5579 |
| 178 | Ga0068862_100057518 | 3300005844 | Bacteria | 3335 |
| 179 | Ga0068862_100061365 | 3300005844 | Bacteria | 3231 |
| 180 | Ga0081455_10222054 | 3300005937 | Bacteria | 1399 |
| 181 | Ga0081455_10360929 | 3300005937 | Unclassified | 1021 |
| 182 | Ga0081539_10162043 | 3300005985 | Bacteria | 1065 |
| 183 | Ga0075365_10013288 | 3300006038 | Bacteria | 4915 |
| 184 | Ga0075365_10044114 | 3300006038 | Bacteria | 2921 |
| 185 | Ga0075365_10241143 | 3300006038 | Bacteria | 1270 |
| 186 | Ga0075368_10002746 | 3300006042 | Bacteria | 5811 |
| 187 | Ga0075368_10167683 | 3300006042 | Bacteria | 922 |
| 188 | Ga0075363_100032003 | 3300006048 | Bacteria | 2730 |
| 189 | Ga0075363_100511373 | 3300006048 | Bacteria | 714 |
| 190 | Ga0075364_10002943 | 3300006051 | Bacteria | 9602 |
| 191 | Ga0075364_10009183 | 3300006051 | Bacteria | 5923 |
| 192 | Ga0075364_10027187 | 3300006051 | Bacteria | 3653 |
| 193 | Ga0075364_10029418 | 3300006051 | Bacteria | 3523 |
| 194 | Ga0075364_10055278 | 3300006051 | Bacteria | 2597 |
| 195 | Ga0075364_10199225 | 3300006051 | Bacteria | 1357 |
| 196 | Ga0075364_10366090 | 3300006051 | Bacteria | 983 |
| 197 | Ga0075364_10576417 | 3300006051 | Bacteria | 769 |
| 198 | Ga0070712_100417814 | 3300006175 | Bacteria | 1111 |
| 199 | Ga0075367_10004132 | 3300006178 | Bacteria | 7038 |
| 200 | Ga0075367_10070238 | 3300006178 | Bacteria | 2104 |
| 201 | Ga0075367_10098453 | 3300006178 | Unclassified | 1785 |
| 202 | Ga0075367_10099391 | 3300006178 | Bacteria | 1777 |
| 203 | Ga0075367_10232976 | 3300006178 | Bacteria | 1153 |
| 204 | Ga0075369_10040665 | 3300006186 | Bacteria | 1988 |
| 205 | Ga0075366_10005318 | 3300006195 | Bacteria | 6975 |
| 206 | Ga0075366_10010729 | 3300006195 | Bacteria | 5151 |
| 207 | Ga0075366_10223734 | 3300006195 | Bacteria | 1147 |
| 208 | Ga0097621_100002665 | 3300006237 | Bacteria | 12215 |
| 209 | Ga0075370_10016416 | 3300006353 | Unclassified | 3984 |
| 210 | Ga0075370_10159966 | 3300006353 | Bacteria | 1321 |
| 211 | Ga0068871_100012449 | 3300006358 | Bacteria | 6272 |
| 212 | Ga0068871_100409566 | 3300006358 | Bacteria | 1209 |
| 213 | Ga0068871_100642314 | 3300006358 | Unclassified | 968 |
| 214 | Ga0075428_100165246 | 3300006844 | Bacteria | 2401 |
| 215 | Ga0075428_100217649 | 3300006844 | Bacteria | 2063 |
| 216 | Ga0075428_100658860 | 3300006844 | Bacteria | 1116 |
| 217 | Ga0075430_100014465 | 3300006846 | Bacteria | 6722 |
| 218 | Ga0075430_100015753 | 3300006846 | Bacteria | 6439 |
| 219 | Ga0075430_100018336 | 3300006846 | Bacteria | 5957 |
| 220 | Ga0075430_100055726 | 3300006846 | Unclassified | 3324 |
| 221 | Ga0075431_100027502 | 3300006847 | Bacteria | 5837 |
| 222 | Ga0075431_100055025 | 3300006847 | Bacteria | 4104 |
| 223 | Ga0075431_100186972 | 3300006847 | Bacteria | 2124 |
| 224 | Ga0075433_10335726 | 3300006852 | Unclassified | 1336 |
| 225 | Ga0075434_100255521 | 3300006871 | Bacteria | 1771 |
| 226 | Ga0075429_100085977 | 3300006880 | Bacteria | 2741 |
| 227 | Ga0075429_100389083 | 3300006880 | Bacteria | 1221 |
| 228 | Ga0075429_100828579 | 3300006880 | Bacteria | 810 |
| 229 | Ga0068865_100010601 | 3300006881 | Bacteria | 5744 |
| 230 | Ga0068865_100253843 | 3300006881 | Bacteria | 1389 |
| 231 | Ga0075436_100150987 | 3300006914 | Bacteria | 1635 |
| 232 | Ga0097620_100452843 | 3300006931 | Bacteria | 1380 |
| 233 | Ga0097620_100660550 | 3300006931 | Bacteria | 1137 |
| 234 | Ga0075435_100001843 | 3300007076 | Bacteria | 13754 |
| 235 | Ga0105251_10014001 | 3300009011 | Bacteria | 4455 |
| 236 | Ga0105240_10005746 | 3300009093 | Bacteria | 18400 |
| 237 | Ga0105240_10019674 | 3300009093 | Bacteria | 9017 |
| 238 | Ga0105240_10045107 | 3300009093 | Bacteria | 5595 |
| 239 | Ga0105240_10078858 | 3300009093 | Bacteria | 4054 |
| 240 | Ga0105240_10256088 | 3300009093 | Bacteria | 2021 |
| 241 | Ga0105240_10298775 | 3300009093 | Unclassified | 1842 |
| 242 | Ga0105240_10563346 | 3300009093 | Bacteria | 1259 |
| 243 | Ga0111539_10025634 | 3300009094 | Bacteria | 7226 |
| 244 | Ga0111539_10039209 | 3300009094 | Bacteria | 5711 |
| 245 | Ga0111539_10045673 | 3300009094 | Bacteria | 5243 |
| 246 | Ga0111539_10160097 | 3300009094 | Bacteria | 2633 |
| 247 | Ga0111539_10831036 | 3300009094 | Bacteria | 1075 |
| 248 | Ga0111539_11808429 | 3300009094 | Bacteria | 708 |
| 249 | Ga0105245_10003049 | 3300009098 | Bacteria | 14991 |
| 250 | Ga0105245_11972124 | 3300009098 | Bacteria | 637 |
| 251 | Ga0114129_10002414 | 3300009147 | Bacteria | 25954 |
| 252 | Ga0114129_10014182 | 3300009147 | Bacteria | 11356 |
| 253 | Ga0114129_10043124 | 3300009147 | Bacteria | 6349 |
| 254 | Ga0114129_10134488 | 3300009147 | Bacteria | 3393 |
| 255 | Ga0114129_11567233 | 3300009147 | Bacteria | 807 |
| 256 | Ga0114129_12726960 | 3300009147 | Bacteria | 588 |
| 257 | Ga0105243_11143717 | 3300009148 | Unclassified | 789 |
| 258 | Ga0105241_10080983 | 3300009174 | Bacteria | 2543 |
| 259 | Ga0105241_10339129 | 3300009174 | Bacteria | 1302 |
| 260 | Ga0105241_11543646 | 3300009174 | Bacteria | 640 |
| 261 | Ga0105242_10017172 | 3300009176 | Bacteria | 5635 |
| 262 | Ga0105242_10100004 | 3300009176 | Bacteria | 2455 |
| 263 | Ga0105242_10450461 | 3300009176 | Bacteria | 1213 |
| 264 | Ga0105242_11979846 | 3300009176 | Bacteria | 624 |
| 265 | Ga0105248_10032778 | 3300009177 | Bacteria | 5804 |
| 266 | Ga0105248_10048178 | 3300009177 | Bacteria | 4780 |
| 267 | Ga0105248_10917763 | 3300009177 | Bacteria | 989 |
| 268 | Ga0105237_10006745 | 3300009545 | Bacteria | 12679 |
| 269 | Ga0105237_10009973 | 3300009545 | Bacteria | 10135 |
| 270 | Ga0105237_10490361 | 3300009545 | Unclassified | 1235 |
| 271 | Ga0105237_10539253 | 3300009545 | Unclassified | 1173 |
| 272 | Ga0105237_10731415 | 3300009545 | Bacteria | 996 |
| 273 | Ga0105238_10114637 | 3300009551 | Bacteria | 2674 |
| 274 | Ga0105238_10176551 | 3300009551 | Bacteria | 2113 |
| 275 | Ga0105238_10465376 | 3300009551 | Bacteria | 1262 |
| 276 | Ga0105238_10811891 | 3300009551 | Bacteria | 951 |
| 277 | Ga0105249_10158901 | 3300009553 | Bacteria | 2183 |
| 278 | Ga0105249_10206579 | 3300009553 | Bacteria | 1925 |
| 279 | Ga0105249_10306666 | 3300009553 | Bacteria | 1594 |
| 280 | Ga0105249_10574388 | 3300009553 | Bacteria | 1180 |
| 281 | Ga0105249_10773204 | 3300009553 | Bacteria | 1023 |
| 282 | Ga0105249_10833128 | 3300009553 | Unclassified | 987 |
| 283 | Ga0105249_11797861 | 3300009553 | Unclassified | 685 |
| 284 | Ga0105239_10572925 | 3300010375 | Bacteria | 1287 |
| 285 | Ga0105246_10240183 | 3300011119 | Bacteria | 1432 |
| 286 | Ga0105246_10762132 | 3300011119 | Bacteria | 855 |
| 287 | Ga0157373_10344323 | 3300013100 | Bacteria | 1063 |
| 288 | Ga0157371_10043899 | 3300013102 | Bacteria | 3183 |
| 289 | Ga0157370_10129235 | 3300013104 | Bacteria | 2357 |
| 290 | Ga0157369_10008315 | 3300013105 | Bacteria | 11894 |
| 291 | Ga0157369_10337300 | 3300013105 | Bacteria | 1566 |
| 292 | Ga0157374_10266973 | 3300013296 | Bacteria | 1687 |
| 293 | Ga0157374_10459611 | 3300013296 | Bacteria | 1275 |
| 294 | Ga0157374_10531112 | 3300013296 | Bacteria | 1183 |
| 295 | Ga0157374_10723451 | 3300013296 | Bacteria | 1009 |
| 296 | Ga0157374_10767157 | 3300013296 | Bacteria | 979 |
| 297 | Ga0157374_11712862 | 3300013296 | Unclassified | 653 |
| 298 | Ga0157374_11844519 | 3300013296 | Bacteria | 630 |
| 299 | Ga0157378_11418981 | 3300013297 | Bacteria | 737 |
| 300 | Ga0163162_10048904 | 3300013306 | Bacteria | 4238 |
| 301 | Ga0163162_10174546 | 3300013306 | Bacteria | 2274 |
| 302 | Ga0163162_10381400 | 3300013306 | Bacteria | 1543 |
| 303 | Ga0163162_10470494 | 3300013306 | Bacteria | 1388 |
| 304 | Ga0163162_10533462 | 3300013306 | Bacteria | 1303 |
| 305 | Ga0157372_10024167 | 3300013307 | Bacteria | 6595 |
| 306 | Ga0157372_10099075 | 3300013307 | Bacteria | 3325 |
| 307 | Ga0157372_10244328 | 3300013307 | Bacteria | 2083 |
| 308 | Ga0157372_10722588 | 3300013307 | Unclassified | 1158 |
| 309 | Ga0157375_10002486 | 3300013308 | Bacteria | 15969 |
| 310 | Ga0157375_10033211 | 3300013308 | Bacteria | 4901 |
| 311 | Ga0157375_10049471 | 3300013308 | Bacteria | 4119 |
| 312 | Ga0157375_10209067 | 3300013308 | Bacteria | 2108 |
| 313 | Ga0157375_10622696 | 3300013308 | Bacteria | 1237 |
| 314 | Ga0157375_11581177 | 3300013308 | Bacteria | 775 |
| 315 | Ga0163163_10060850 | 3300014325 | Bacteria | 3740 |
| 316 | Ga0163163_10105277 | 3300014325 | Bacteria | 2847 |
| 317 | Ga0163163_10393513 | 3300014325 | Bacteria | 1444 |
| 318 | Ga0163163_12084883 | 3300014325 | Bacteria | 627 |
| 319 | Ga0157380_10166462 | 3300014326 | Bacteria | 1922 |
| 320 | Ga0157380_10281747 | 3300014326 | Bacteria | 1521 |
| 321 | Ga0157380_10313111 | 3300014326 | Bacteria | 1452 |
| 322 | Ga0157380_10714141 | 3300014326 | Bacteria | 1009 |
| 323 | Ga0157380_10805201 | 3300014326 | Bacteria | 957 |
| 324 | Ga0157377_10466724 | 3300014745 | Bacteria | 875 |
| 325 | Ga0157377_10692460 | 3300014745 | Bacteria | 739 |
| 326 | Ga0157379_10018611 | 3300014968 | Bacteria | 6124 |
| 327 | Ga0157379_10585193 | 3300014968 | Bacteria | 1041 |
| 328 | Ga0157376_10043397 | 3300014969 | Bacteria | 3691 |
| 329 | Ga0182006_1095705 | 3300015261 | Bacteria | 1061 |
| 330 | Ga0182005_1001056 | 3300015265 | Bacteria | 11661 |
| 331 | Ga0163161_10781835 | 3300017792 | Bacteria | 801 |
| 332 | Ga0197907_11031442 | 3300020069 | Bacteria | 2281 |
| 333 | Ga0206356_10294918 | 3300020070 | Bacteria | 648 |
| 334 | Ga0206356_11608615 | 3300020070 | Bacteria | 776 |
| 335 | Ga0206355_1488022 | 3300020076 | Bacteria | 1457 |
| 336 | Ga0206353_10654570 | 3300020082 | Bacteria | 756 |
| 337 | Ga0224712_10157125 | 3300022467 | Bacteria | 1012 |
| 338 | Ga0209674_100025 | 3300025226 | Bacteria | 515942 |
| 339 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 340 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 341 | Ga0209563_111377 | 3300025230 | Bacteria | 1257 |
| 342 | Ga0209258_100005 | 3300025242 | Bacteria | 1087938 |
| 343 | Ga0209258_100631 | 3300025242 | Bacteria | 27852 |
| 344 | Ga0209677_116394 | 3300025253 | Bacteria | 950 |
| 345 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 346 | Ga0209759_1000014 | 3300025256 | Bacteria | 396291 |
| 347 | Ga0209759_1006111 | 3300025256 | Bacteria | 4099 |
| 348 | Ga0209759_1006576 | 3300025256 | Bacteria | 3882 |
| 349 | Ga0209455_1000003 | 3300025272 | Bacteria | 1471893 |
| 350 | Ga0207697_10138571 | 3300025315 | Bacteria | 1054 |
| 351 | Ga0207656_10054906 | 3300025321 | Bacteria | 1733 |
| 352 | Ga0207713_1096069 | 3300025735 | Bacteria | 1032 |
| 353 | Ga0207645_10032291 | 3300025907 | Bacteria | 3365 |
| 354 | Ga0207645_10126009 | 3300025907 | Bacteria | 1665 |
| 355 | Ga0207705_10018268 | 3300025909 | Bacteria | 5014 |
| 356 | Ga0207705_10056271 | 3300025909 | Bacteria | 2835 |
| 357 | Ga0207705_10092716 | 3300025909 | Bacteria | 2213 |
| 358 | Ga0207705_10135182 | 3300025909 | Bacteria | 1837 |
| 359 | Ga0207654_10043214 | 3300025911 | Bacteria | 2554 |
| 360 | Ga0207654_10203311 | 3300025911 | Bacteria | 1305 |
| 361 | Ga0207654_10283671 | 3300025911 | Bacteria | 1121 |
| 362 | Ga0207707_10025774 | 3300025912 | Bacteria | 5142 |
| 363 | Ga0207695_10020911 | 3300025913 | Bacteria | 7479 |
| 364 | Ga0207695_10045514 | 3300025913 | Bacteria | 4657 |
| 365 | Ga0207695_10192766 | 3300025913 | Bacteria | 1955 |
| 366 | Ga0207695_10199383 | 3300025913 | Bacteria | 1916 |
| 367 | Ga0207695_10491307 | 3300025913 | Bacteria | 1109 |
| 368 | Ga0207695_10714125 | 3300025913 | Bacteria | 883 |
| 369 | Ga0207671_10021594 | 3300025914 | Bacteria | 4879 |
| 370 | Ga0207671_10099225 | 3300025914 | Unclassified | 2204 |
| 371 | Ga0207663_10213260 | 3300025916 | Unclassified | 1401 |
| 372 | Ga0207663_10644323 | 3300025916 | Bacteria | 836 |
| 373 | Ga0207660_11083634 | 3300025917 | Bacteria | 653 |
| 374 | Ga0207662_10059311 | 3300025918 | Bacteria | 2293 |
| 375 | Ga0207657_10053263 | 3300025919 | Bacteria | 3506 |
| 376 | Ga0207657_10055867 | 3300025919 | Bacteria | 3408 |
| 377 | Ga0207657_10086756 | 3300025919 | Bacteria | 2619 |
| 378 | Ga0207649_10010753 | 3300025920 | Bacteria | 5032 |
| 379 | Ga0207649_10485501 | 3300025920 | Bacteria | 937 |
| 380 | Ga0207652_10132486 | 3300025921 | Bacteria | 2224 |
| 381 | Ga0207652_10208655 | 3300025921 | Bacteria | 1759 |
| 382 | Ga0207652_10295542 | 3300025921 | Bacteria | 1462 |
| 383 | Ga0207652_10711493 | 3300025921 | Bacteria | 896 |
| 384 | Ga0207681_10198258 | 3300025923 | Bacteria | 1540 |
| 385 | Ga0207681_10228842 | 3300025923 | Bacteria | 1442 |
| 386 | Ga0207681_10315964 | 3300025923 | Bacteria | 1240 |
| 387 | Ga0207694_10246950 | 3300025924 | Bacteria | 1460 |
| 388 | Ga0207694_10313719 | 3300025924 | Bacteria | 1293 |
| 389 | Ga0207650_10072245 | 3300025925 | Bacteria | 2597 |
| 390 | Ga0207650_10166185 | 3300025925 | Bacteria | 1751 |
| 391 | Ga0207650_10207040 | 3300025925 | Bacteria | 1574 |
| 392 | Ga0207650_10223967 | 3300025925 | Bacteria | 1515 |
| 393 | Ga0207650_10274785 | 3300025925 | Bacteria | 1370 |
| 394 | Ga0207650_10663817 | 3300025925 | Bacteria | 879 |
| 395 | Ga0207659_10095692 | 3300025926 | Bacteria | 2228 |
| 396 | Ga0207659_11210471 | 3300025926 | Bacteria | 649 |
| 397 | Ga0207644_10035242 | 3300025931 | Bacteria | 3505 |
| 398 | Ga0207644_10417277 | 3300025931 | Bacteria | 1099 |
| 399 | Ga0207644_10555376 | 3300025931 | Unclassified | 951 |
| 400 | Ga0207644_10713356 | 3300025931 | Bacteria | 837 |
| 401 | Ga0207690_10047734 | 3300025932 | Bacteria | 2843 |
| 402 | Ga0207690_10205205 | 3300025932 | Bacteria | 1499 |
| 403 | Ga0207706_10278410 | 3300025933 | Bacteria | 1459 |
| 404 | Ga0207706_11178659 | 3300025933 | Bacteria | 637 |
| 405 | Ga0207706_11201053 | 3300025933 | Bacteria | 630 |
| 406 | Ga0207686_10018573 | 3300025934 | Bacteria | 3939 |
| 407 | Ga0207686_10349676 | 3300025934 | Bacteria | 1112 |
| 408 | Ga0207670_10537145 | 3300025936 | Bacteria | 954 |
| 409 | Ga0207670_10946004 | 3300025936 | Unclassified | 723 |
| 410 | Ga0207669_10102123 | 3300025937 | Bacteria | 1899 |
| 411 | Ga0207669_10120126 | 3300025937 | Bacteria | 1782 |
| 412 | Ga0207669_10307278 | 3300025937 | Bacteria | 1208 |
| 413 | Ga0207669_10932210 | 3300025937 | Unclassified | 727 |
| 414 | Ga0207704_10046862 | 3300025938 | Bacteria | 2579 |
| 415 | Ga0207704_10133108 | 3300025938 | Bacteria | 1726 |
| 416 | Ga0207704_10187161 | 3300025938 | Bacteria | 1502 |
| 417 | Ga0207704_10314710 | 3300025938 | Bacteria | 1205 |
| 418 | Ga0207691_10017414 | 3300025940 | Bacteria | 6815 |
| 419 | Ga0207691_10038054 | 3300025940 | Bacteria | 4451 |
| 420 | Ga0207691_10045824 | 3300025940 | Bacteria | 4019 |
| 421 | Ga0207691_10089593 | 3300025940 | Bacteria | 2759 |
| 422 | Ga0207691_10194631 | 3300025940 | Bacteria | 1767 |
| 423 | Ga0207691_10493836 | 3300025940 | Bacteria | 1040 |
| 424 | Ga0207689_10232670 | 3300025942 | Bacteria | 1523 |
| 425 | Ga0207689_10407221 | 3300025942 | Bacteria | 1134 |
| 426 | Ga0207661_10007953 | 3300025944 | Bacteria | 7559 |
| 427 | Ga0207661_10017056 | 3300025944 | Bacteria | 5365 |
| 428 | Ga0207661_10130255 | 3300025944 | Bacteria | 2154 |
| 429 | Ga0207661_11019596 | 3300025944 | Bacteria | 762 |
| 430 | Ga0207679_10009078 | 3300025945 | Bacteria | 6353 |
| 431 | Ga0207679_10273812 | 3300025945 | Bacteria | 1445 |
| 432 | Ga0207679_10867155 | 3300025945 | Bacteria | 825 |
| 433 | Ga0207679_10996617 | 3300025945 | Bacteria | 768 |
| 434 | Ga0207667_10104968 | 3300025949 | Bacteria | 2915 |
| 435 | Ga0207667_10816324 | 3300025949 | Bacteria | 928 |
| 436 | Ga0207667_11153530 | 3300025949 | Bacteria | 756 |
| 437 | Ga0207651_10004105 | 3300025960 | Bacteria | 7268 |
| 438 | Ga0207651_10014615 | 3300025960 | Bacteria | 4539 |
| 439 | Ga0207651_10237405 | 3300025960 | Bacteria | 1484 |
| 440 | Ga0207651_10368841 | 3300025960 | Bacteria | 1214 |
| 441 | Ga0207651_11191869 | 3300025960 | Bacteria | 684 |
| 442 | Ga0207712_10706852 | 3300025961 | Bacteria | 880 |
| 443 | Ga0207668_10081807 | 3300025972 | Bacteria | 2344 |
| 444 | Ga0207668_10119487 | 3300025972 | Bacteria | 1993 |
| 445 | Ga0207668_11154091 | 3300025972 | Unclassified | 695 |
| 446 | Ga0207668_11339829 | 3300025972 | Bacteria | 645 |
| 447 | Ga0207640_10003115 | 3300025981 | Bacteria | 8917 |
| 448 | Ga0207640_10022032 | 3300025981 | Bacteria | 3807 |
| 449 | Ga0207658_10064416 | 3300025986 | Bacteria | 2750 |
| 450 | Ga0207658_10688639 | 3300025986 | Bacteria | 923 |
| 451 | Ga0207658_10776628 | 3300025986 | Bacteria | 869 |
| 452 | Ga0207658_11639006 | 3300025986 | Bacteria | 588 |
| 453 | Ga0207703_10471050 | 3300026035 | Bacteria | 1176 |
| 454 | Ga0207703_10477822 | 3300026035 | Bacteria | 1167 |
| 455 | Ga0207639_10032496 | 3300026041 | Bacteria | 3841 |
| 456 | Ga0207639_10039763 | 3300026041 | Bacteria | 3506 |
| 457 | Ga0207639_10184021 | 3300026041 | Bacteria | 1779 |
| 458 | Ga0207639_10810029 | 3300026041 | Unclassified | 873 |
| 459 | Ga0207639_10972755 | 3300026041 | Bacteria | 794 |
| 460 | Ga0207678_10024600 | 3300026067 | Bacteria | 5260 |
| 461 | Ga0207678_10321525 | 3300026067 | Bacteria | 1331 |
| 462 | Ga0207708_10663260 | 3300026075 | Bacteria | 889 |
| 463 | Ga0207702_10014141 | 3300026078 | Bacteria | 6629 |
| 464 | Ga0207702_10517143 | 3300026078 | Bacteria | 1165 |
| 465 | Ga0207641_10210268 | 3300026088 | Bacteria | 1799 |
| 466 | Ga0207648_10134648 | 3300026089 | Bacteria | 2176 |
| 467 | Ga0207648_10253293 | 3300026089 | Bacteria | 1570 |
| 468 | Ga0207648_10334722 | 3300026089 | Bacteria | 1362 |
| 469 | Ga0207676_10114990 | 3300026095 | Bacteria | 2258 |
| 470 | Ga0207676_10194780 | 3300026095 | Bacteria | 1786 |
| 471 | Ga0207676_10888522 | 3300026095 | Bacteria | 873 |
| 472 | Ga0207676_11198811 | 3300026095 | Bacteria | 752 |
| 473 | Ga0207674_10020350 | 3300026116 | Bacteria | 7169 |
| 474 | Ga0207674_10110524 | 3300026116 | Bacteria | 2724 |
| 475 | Ga0207674_10405294 | 3300026116 | Bacteria | 1318 |
| 476 | Ga0207674_10581078 | 3300026116 | Bacteria | 1082 |
| 477 | Ga0207675_100068656 | 3300026118 | Bacteria | 3312 |
| 478 | Ga0207675_100088650 | 3300026118 | Bacteria | 2906 |
| 479 | Ga0207675_100088851 | 3300026118 | Bacteria | 2903 |
| 480 | Ga0207675_100148061 | 3300026118 | Unclassified | 2233 |
| 481 | Ga0207675_100156440 | 3300026118 | Bacteria | 2172 |
| 482 | Ga0207675_100310536 | 3300026118 | Bacteria | 1538 |
| 483 | Ga0207683_10005995 | 3300026121 | Bacteria | 10410 |
| 484 | Ga0207683_10029686 | 3300026121 | Bacteria | 4735 |
| 485 | Ga0207683_10194001 | 3300026121 | Bacteria | 1845 |
| 486 | Ga0207698_10015209 | 3300026142 | Bacteria | 5148 |
| 487 | Ga0207698_10486250 | 3300026142 | Bacteria | 1198 |
| 488 | Ga0207698_10601157 | 3300026142 | Bacteria | 1084 |
| 489 | Ga0209970_1034295 | 3300027614 | Bacteria | 890 |
| 490 | Ga0209970_1063964 | 3300027614 | Bacteria | 678 |
| 491 | Ga0209971_1119195 | 3300027682 | Bacteria | 649 |
| 492 | Ga0209813_10021605 | 3300027866 | Bacteria | 1811 |
| 493 | Ga0209813_10145314 | 3300027866 | Bacteria | 845 |
| 494 | Ga0209974_10002822 | 3300027876 | Bacteria | 6307 |
| 495 | Ga0207428_10012636 | 3300027907 | Bacteria | 7407 |
| 496 | Ga0207428_10016644 | 3300027907 | Bacteria | 6323 |
| 497 | Ga0207428_10087984 | 3300027907 | Bacteria | 2416 |
| 498 | Ga0268265_10013423 | 3300028380 | Bacteria | 5566 |
| 499 | Ga0268265_10132512 | 3300028380 | Bacteria | 2074 |
| 500 | Ga0268265_10280602 | 3300028380 | Bacteria | 1490 |
| 501 | Ga0268265_10833644 | 3300028380 | Bacteria | 901 |
| 502 | Ga0268265_10847670 | 3300028380 | Bacteria | 894 |
| 503 | Ga0268265_10857834 | 3300028380 | Bacteria | 889 |
| 504 | Ga0268265_10917574 | 3300028380 | Bacteria | 861 |
| 505 | Ga0268264_11236592 | 3300028381 | Bacteria | 757 |
| 506 | Ga0268264_11391180 | 3300028381 | Bacteria | 712 |
| 507 | Ga0307408_100020889 | 3300031548 | Bacteria | 4424 |
| 508 | Ga0307408_100059723 | 3300031548 | Bacteria | 2776 |
| 509 | Ga0307408_100272068 | 3300031548 | Bacteria | 1407 |
| 510 | Ga0307408_100408263 | 3300031548 | Bacteria | 1168 |
| 511 | Ga0307405_10005027 | 3300031731 | Bacteria | 6327 |
| 512 | Ga0307405_10198294 | 3300031731 | Bacteria | 1456 |
| 513 | Ga0307405_10370193 | 3300031731 | Bacteria | 1112 |
| 514 | Ga0307405_10452828 | 3300031731 | Bacteria | 1018 |
| 515 | Ga0307405_10491136 | 3300031731 | Bacteria | 982 |
| 516 | Ga0307413_10011981 | 3300031824 | Bacteria | 4294 |
| 517 | Ga0307413_10243129 | 3300031824 | Bacteria | 1330 |
| 518 | Ga0307410_10024922 | 3300031852 | Bacteria | 3744 |
| 519 | Ga0307410_10054566 | 3300031852 | Bacteria | 2710 |
| 520 | Ga0307410_10073288 | 3300031852 | Bacteria | 2381 |
| 521 | Ga0307410_10179087 | 3300031852 | Bacteria | 1604 |
| 522 | Ga0307410_10400853 | 3300031852 | Bacteria | 1108 |
| 523 | Ga0307410_10413844 | 3300031852 | Bacteria | 1092 |
| 524 | Ga0307410_11389530 | 3300031852 | Bacteria | 616 |
| 525 | Ga0307406_10052383 | 3300031901 | Bacteria | 2595 |
| 526 | Ga0307406_10303290 | 3300031901 | Bacteria | 1228 |
| 527 | Ga0307406_10635942 | 3300031901 | Bacteria | 884 |
| 528 | Ga0307407_10808431 | 3300031903 | Bacteria | 714 |
| 529 | Ga0307407_10865394 | 3300031903 | Bacteria | 691 |
| 530 | Ga0307407_11224057 | 3300031903 | Bacteria | 587 |
| 531 | Ga0307412_10218921 | 3300031911 | Bacteria | 1458 |
| 532 | Ga0307412_11323303 | 3300031911 | Bacteria | 649 |
| 533 | Ga0307409_100006003 | 3300031995 | Bacteria | 7081 |
| 534 | Ga0307409_100008422 | 3300031995 | Bacteria | 6257 |
| 535 | Ga0307409_100535134 | 3300031995 | Bacteria | 1147 |
| 536 | Ga0307409_100647945 | 3300031995 | Bacteria | 1050 |
| 537 | Ga0307409_100671789 | 3300031995 | Bacteria | 1032 |
| 538 | Ga0307416_100147834 | 3300032002 | Bacteria | 2149 |
| 539 | Ga0307416_100225204 | 3300032002 | Bacteria | 1802 |
| 540 | Ga0307416_101187834 | 3300032002 | Bacteria | 868 |
| 541 | Ga0307416_101872987 | 3300032002 | Bacteria | 703 |
| 542 | Ga0307416_102248252 | 3300032002 | Bacteria | 646 |
| 543 | Ga0307416_102386864 | 3300032002 | Bacteria | 628 |
| 544 | Ga0307414_10084461 | 3300032004 | Bacteria | 2335 |
| 545 | Ga0307411_10007472 | 3300032005 | Bacteria | 5571 |
| 546 | Ga0307411_10530180 | 3300032005 | Bacteria | 1001 |
| 547 | Ga0307411_10584850 | 3300032005 | Bacteria | 958 |
| 548 | Ga0307411_11201590 | 3300032005 | Bacteria | 687 |
| 549 | Ga0307415_100058848 | 3300032126 | Bacteria | 2647 |
| 550 | Ga0307415_100114229 | 3300032126 | Bacteria | 2010 |
| 551 | Ga0307415_100213796 | 3300032126 | Bacteria | 1540 |
| 552 | Ga0307415_100540823 | 3300032126 | Bacteria | 1026 |
| 553 | Ga0373958_0002597 | 3300034819 | Bacteria | 2544 |
| 554 | Ga0373959_0007645 | 3300034820 | Bacteria | 1821 |
| 555 | Ga0373929_0002645 | 3300035085 | Bacteria | 3281 |
| 556 | Ga0373940_0006709 | 3300035088 | Bacteria | 2568 |
| 557 | Ga0373949_0002564 | 3300035090 | Bacteria | 4620 |
| 558 | Ga0373951_0003740 | 3300035091 | Bacteria | 3670 |
| 559 | Ga0373952_0015623 | 3300035092 | Bacteria | 1534 |
| 560 | Ga0373932_0002833 | 3300035112 | Bacteria | 4291 |
| 561 | Ga0373939_0000369 | 3300035114 | Bacteria | 11356 |
| 562 | Ga0373941_0012802 | 3300035115 | Bacteria | 2202 |
| 563 | Ga0373961_0003344 | 3300035241 | Bacteria | 3987 |
| 564 | Ga0373931_0063842 | 3300035691 | Bacteria | 1991 |
| 565 | Ga0373925_0512489 | 3300037068 | Bacteria | 985 |
| 566 | Ga0395899_0005318 | 3300037312 | Bacteria | 9994 |
| 567 | Ga0395900_0011357 | 3300037418 | Bacteria | 9111 |
| 568 | Ga0395898_0001658 | 3300037466 | Bacteria | 29919 |
| 569 | Ga0395898_0016961 | 3300037466 | Bacteria | 7436 |
| 570 | Ga0395905_0000221 | 3300037471 | Bacteria | 87203 |
| 571 | Ga0395901_0101906 | 3300038443 | Bacteria | 3012 |
| 572 | Ga0395901_0307725 | 3300038443 | Bacteria | 1642 |
| 573 | Ga0242420_013092 | 3300038996 | Bacteria | 1410 |
| 574 | Ga0436365_0814888 | 3300039437 | Bacteria | 602 |
| 575 | Ga0436365_1297870 | 3300039437 | Bacteria | 1471 |
| 576 | Ga0451793_0826448 | 3300041452 | Bacteria | 787 |
| 577 | Ga0451807_2240801 | 3300041486 | Bacteria | 600 |
| 578 | Ga0451849_0527925 | 3300041505 | Bacteria | 630 |
| 579 | Ga0451853_0638581 | 3300041512 | Bacteria | 895 |
| 580 | Ga0439431_0094843 | 3300041997 | Bacteria | 816 |
| 581 | Ga0439433_0087482 | 3300041999 | Bacteria | 763 |
| 582 | Ga0439445_0122493 | 3300042004 | Bacteria | 747 |
| 583 | Ga0450922_012407 | 3300042124 | Bacteria | 827 |
| 584 | Ga0450923_030540 | 3300042125 | Bacteria | 1096 |
| 585 | Ga0450891_009864 | 3300042129 | Bacteria | 880 |
| 586 | Ga0439435_0114416 | 3300042436 | Bacteria | 840 |
| 587 | Ga0439460_0061302 | 3300042461 | Bacteria | 1148 |
| 588 | Ga0451577_0269682 | 3300042876 | Bacteria | 1541 |
| 589 | Ga0451577_0380296 | 3300042876 | Bacteria | 1281 |
| 590 | Ga0466966_0072692 | 3300044684 | Bacteria | 2152 |
| 591 | Ga0466961_0093328 | 3300044693 | Bacteria | 1899 |
| 592 | Ga0466963_0013658 | 3300044694 | Bacteria | 4993 |
| 593 | Ga0453684_0652671 | 3300044712 | Bacteria | 1148 |
| 594 | Ga0466970_0036787 | 3300044765 | Bacteria | 2594 |
| 595 | Ga0466960_0008243 | 3300044901 | Bacteria | 4262 |
| 596 | Ga0466960_0150279 | 3300044901 | Bacteria | 1244 |
| 597 | Ga0466959_0042084 | 3300045049 | Bacteria | 3370 |
| 598 | Ga0466959_0415522 | 3300045049 | Bacteria | 913 |
| 599 | Ga0495590_0032781 | 3300046457 | Bacteria | 1817 |
| 600 | Ga0495629_0227159 | 3300046459 | Bacteria | 1287 |
| 601 | Ga0495629_0298426 | 3300046459 | Bacteria | 1104 |
| 602 | Ga0495638_0139239 | 3300046460 | Bacteria | 1418 |
| 603 | Ga0495582_0404235 | 3300046473 | Bacteria | 788 |
| 604 | Ga0495584_0005887 | 3300046491 | Bacteria | 6461 |
| 605 | Ga0495585_0084919 | 3300046492 | Bacteria | 1711 |
| 606 | Ga0495585_0148938 | 3300046492 | Bacteria | 1221 |
| 607 | Ga0495594_0024919 | 3300046499 | Bacteria | 3214 |
| 608 | Ga0495596_0096215 | 3300046500 | Bacteria | 1149 |
| 609 | Ga0495596_0339655 | 3300046500 | Bacteria | 584 |
| 610 | Ga0495583_0117600 | 3300046506 | Bacteria | 1121 |
| 611 | Ga0495606_0091161 | 3300046507 | Bacteria | 1874 |
| 612 | Ga0495616_0005117 | 3300046513 | Bacteria | 8147 |
| 613 | Ga0495631_0004533 | 3300046518 | Bacteria | 7378 |
| 614 | Ga0495632_0000065 | 3300046519 | Bacteria | 116086 |
| 615 | Ga0495632_0007394 | 3300046519 | Bacteria | 6905 |
| 616 | Ga0495643_0049459 | 3300046522 | Bacteria | 2267 |
| 617 | Ga0495643_0074698 | 3300046522 | Bacteria | 1775 |
| 618 | Ga0495643_0094119 | 3300046522 | Unclassified | 1542 |
| 619 | Ga0495644_0162550 | 3300046523 | Bacteria | 856 |
| 620 | Ga0495666_0115171 | 3300046526 | Bacteria | 1261 |
| 621 | Ga0495642_0003234 | 3300046528 | Bacteria | 6458 |
| 622 | Ga0495665_0199600 | 3300046531 | Bacteria | 1037 |
| 623 | Ga0495598_0154113 | 3300046537 | Bacteria | 804 |
| 624 | Ga0495609_0003991 | 3300046538 | Bacteria | 8240 |
| 625 | Ga0495609_0005423 | 3300046538 | Bacteria | 6707 |
| 626 | Ga0495597_0216174 | 3300046542 | Bacteria | 762 |
| 627 | Ga0495622_0098437 | 3300046557 | Bacteria | 1341 |
| 628 | Ga0495633_0102139 | 3300046558 | Bacteria | 1331 |
| 629 | Ga0495668_0000368 | 3300046616 | Bacteria | 59517 |
| 630 | Ga0495611_0002270 | 3300046648 | Bacteria | 8907 |
| 631 | Ga0495611_0050329 | 3300046648 | Bacteria | 1876 |
| 632 | Ga0495625_0215706 | 3300046660 | Bacteria | 1259 |
| 633 | Ga0495625_0338843 | 3300046660 | Unclassified | 953 |
| 634 | Ga0495659_0103640 | 3300046664 | Bacteria | 1104 |
| 635 | Ga0495661_0035672 | 3300046665 | Bacteria | 3118 |
| 636 | Ga0495661_0323104 | 3300046665 | Bacteria | 766 |
| 637 | Ga0495661_0330361 | 3300046665 | Bacteria | 755 |
| 638 | Ga0495657_0398064 | 3300046675 | Bacteria | 811 |
| 639 | Ga0495658_0042545 | 3300046683 | Bacteria | 2537 |
| 640 | Ga0495669_0000453 | 3300046684 | Bacteria | 19290 |
| 641 | Ga0495669_0063817 | 3300046684 | Bacteria | 1671 |
| 642 | Ga0495624_0426794 | 3300046690 | Bacteria | 795 |
| 643 | Ga0495670_0137747 | 3300046691 | Bacteria | 1275 |
| 644 | Ga0495649_0011217 | 3300046694 | Bacteria | 5267 |
| 645 | Ga0495589_0067621 | 3300046794 | Bacteria | 1748 |
| 646 | Ga0495589_0099556 | 3300046794 | Bacteria | 1407 |
| 647 | Ga0495589_0196506 | 3300046794 | Bacteria | 953 |
| 648 | Ga0495581_0256804 | 3300047315 | Bacteria | 1022 |
| 649 | Ga0495636_0001337 | 3300047318 | Bacteria | 9361 |
| 650 | Ga0495636_0004548 | 3300047318 | Bacteria | 5434 |
| 651 | Ga0495672_0000272 | 3300047320 | Bacteria | 71551 |
| 652 | Ga0495680_0032127 | 3300047322 | Bacteria | 4265 |
| 653 | Ga0495683_0002553 | 3300047323 | Bacteria | 10938 |
| 654 | Ga0495687_000126 | 3300047443 | Bacteria | 117879 |
| 655 | Ga0495687_097271 | 3300047443 | Bacteria | 1112 |
| 656 | Ga0495687_172039 | 3300047443 | Bacteria | 716 |
| 657 | Ga0495677_0006066 | 3300047445 | Bacteria | 4569 |
| 658 | Ga0495677_0063317 | 3300047445 | Bacteria | 1373 |
| 659 | Ga0495685_194004 | 3300047447 | Bacteria | 652 |
| 660 | Ga0495681_0033958 | 3300047470 | Bacteria | 2547 |
| 661 | Ga0495686_0008011 | 3300047472 | Bacteria | 7832 |
| 662 | Ga0495626_0001278 | 3300048091 | Bacteria | 20542 |
| 663 | Ga0496100_0245396 | 3300048903 | Bacteria | 1323 |
| 664 | Ga0496100_0863651 | 3300048903 | Unclassified | 710 |
| 665 | Ga0496101_0013740 | 3300048904 | Bacteria | 5431 |
| 666 | Ga0496102_0144723 | 3300048905 | Bacteria | 2230 |
| 667 | Ga0496102_1168793 | 3300048905 | Bacteria | 689 |
| 668 | Ga0496103_0040417 | 3300048906 | Bacteria | 2866 |
| 669 | Ga0496104_0058526 | 3300048907 | Bacteria | 3648 |
| 670 | Ga0496105_0499257 | 3300048908 | Bacteria | 955 |
| 671 | Ga0496106_0104305 | 3300048909 | Bacteria | 2202 |
| 672 | Ga0496107_0012066 | 3300048910 | Bacteria | 6026 |
| 673 | Ga0496107_0455754 | 3300048910 | Bacteria | 950 |
| 674 | Ga0496108_0998013 | 3300048911 | Bacteria | 715 |
| 675 | Ga0496109_0975212 | 3300048912 | Bacteria | 785 |
| 676 | Ga0496109_1214066 | 3300048912 | Bacteria | 691 |
| 677 | Ga0496110_0115394 | 3300048913 | Bacteria | 2417 |
| 678 | Ga0496110_0364870 | 3300048913 | Bacteria | 1316 |
| 679 | Ga0496110_0611254 | 3300048913 | Bacteria | 988 |
| 680 | Ga0496111_0169199 | 3300048914 | Bacteria | 1624 |
| 681 | Ga0496111_0202054 | 3300048914 | Bacteria | 1477 |
| 682 | Ga0496112_0061534 | 3300048915 | Bacteria | 3701 |
| 683 | Ga0496112_0136614 | 3300048915 | Bacteria | 2421 |
| 684 | Ga0496113_0092653 | 3300048916 | Bacteria | 2331 |
| 685 | Ga0496113_0118079 | 3300048916 | Bacteria | 2071 |
| 686 | Ga0496116_0025686 | 3300048919 | Bacteria | 4325 |
| 687 | Ga0496116_0060264 | 3300048919 | Bacteria | 2462 |
| 688 | Ga0496116_0062618 | 3300048919 | Bacteria | 2401 |
| 689 | Ga0496117_0062315 | 3300048920 | Bacteria | 2556 |
| 690 | Ga0496117_0178364 | 3300048920 | Bacteria | 1224 |
| 691 | Ga0496118_0022238 | 3300048921 | Bacteria | 5552 |
| 692 | Ga0496118_0129227 | 3300048921 | Bacteria | 1626 |
| 693 | Ga0496118_0444891 | 3300048921 | Bacteria | 660 |
| 694 | Ga0496121_0092046 | 3300048924 | Bacteria | 2365 |
| 695 | Ga0496122_0140948 | 3300048925 | Bacteria | 1508 |
| 696 | Ga0496123_0043530 | 3300048926 | Bacteria | 3082 |
| 697 | Ga0496124_0102662 | 3300048927 | Bacteria | 2314 |
| 698 | Ga0496124_0553118 | 3300048927 | Unclassified | 759 |
| 699 | Ga0495682_0003100 | 3300049460 | Bacteria | 7532 |
| 700 | Ga0501292_033517 | 3300049515 | Bacteria | 870 |
| 701 | Ga0501299_010781 | 3300049522 | Bacteria | 1532 |
| 702 | Ga0501032_0104319 | 3300049569 | Bacteria | 1878 |
| 703 | Ga0501033_0212435 | 3300049570 | Bacteria | 1379 |
| 704 | Ga0501034_0033336 | 3300049571 | Bacteria | 5226 |
| 705 | Ga0501034_0227076 | 3300049571 | Bacteria | 1817 |
| 706 | Ga0501034_0581786 | 3300049571 | Bacteria | 1026 |
| 707 | Ga0501034_1167028 | 3300049571 | Unclassified | 649 |
| 708 | Ga0501036_0069305 | 3300049572 | Bacteria | 2983 |
| 709 | Ga0501037_0565056 | 3300049573 | Bacteria | 766 |
| 710 | Ga0501038_0088150 | 3300049574 | Bacteria | 2605 |
| 711 | Ga0501038_0346742 | 3300049574 | Bacteria | 1157 |
| 712 | Ga0501039_0019780 | 3300049575 | Bacteria | 5161 |
| 713 | Ga0501039_0886952 | 3300049575 | Bacteria | 694 |
| 714 | Ga0501040_0038131 | 3300049576 | Bacteria | 3267 |
| 715 | Ga0501041_0340215 | 3300049577 | Bacteria | 948 |
| 716 | Ga0501042_0061209 | 3300049578 | Bacteria | 2690 |
| 717 | Ga0501042_0157067 | 3300049578 | Bacteria | 1641 |
| 718 | Ga0501042_0460714 | 3300049578 | Unclassified | 922 |
| 719 | Ga0501043_0132350 | 3300049579 | Bacteria | 1954 |
| 720 | Ga0501043_0253942 | 3300049579 | Bacteria | 1354 |
| 721 | Ga0501046_0019314 | 3300049580 | Bacteria | 5654 |
| 722 | Ga0501046_0405403 | 3300049580 | Bacteria | 984 |
| 723 | Ga0501047_0118386 | 3300049581 | Bacteria | 2530 |
| 724 | Ga0501048_0144138 | 3300049582 | Bacteria | 1685 |
| 725 | Ga0501068_0082344 | 3300049584 | Bacteria | 1976 |
| 726 | Ga0501069_0014033 | 3300049585 | Bacteria | 4279 |
| 727 | Ga0501069_0050976 | 3300049585 | Bacteria | 2303 |
| 728 | Ga0501071_0108343 | 3300049587 | Bacteria | 2052 |
| 729 | Ga0501071_0610224 | 3300049587 | Bacteria | 839 |
| 730 | Ga0501072_0247593 | 3300049588 | Bacteria | 1419 |
| 731 | Ga0501072_0433530 | 3300049588 | Bacteria | 1041 |
| 732 | Ga0501073_0043224 | 3300049589 | Bacteria | 3177 |
| 733 | Ga0501075_0208892 | 3300049591 | Bacteria | 1489 |
| 734 | Ga0501076_0011387 | 3300049592 | Bacteria | 6622 |
| 735 | Ga0501076_0068323 | 3300049592 | Unclassified | 2839 |
| 736 | Ga0501076_0323974 | 3300049592 | Bacteria | 1264 |
| 737 | Ga0501076_0554700 | 3300049592 | Bacteria | 947 |
| 738 | Ga0501076_0640850 | 3300049592 | Bacteria | 877 |
| 739 | Ga0501233_099863 | 3300049668 | Bacteria | 766 |
| 740 | Ga0501249_041481 | 3300049679 | Bacteria | 1044 |
| 741 | Ga0501221_020958 | 3300049704 | Bacteria | 1283 |
| 742 | Ga0501245_019463 | 3300049708 | Unclassified | 1052 |
| 743 | Ga0501079_0289560 | 3300049741 | Bacteria | 1281 |
| 744 | Ga0501079_0377647 | 3300049741 | Bacteria | 1111 |
| 745 | Ga0501080_0057899 | 3300049742 | Bacteria | 3607 |
| 746 | Ga0501080_0082510 | 3300049742 | Bacteria | 2986 |
| 747 | Ga0501081_0123416 | 3300049743 | Bacteria | 1847 |
| 748 | Ga0501265_053432 | 3300049762 | Bacteria | 642 |
| 749 | Ga0501283_002389 | 3300049779 | Bacteria | 2440 |
| 750 | Ga0501044_0112926 | 3300049823 | Bacteria | 2724 |
| 751 | Ga0501044_0147432 | 3300049823 | Bacteria | 2337 |
| 752 | Ga0501045_0085944 | 3300049824 | Bacteria | 2322 |
| 753 | Ga0501045_0223735 | 3300049824 | Unclassified | 1401 |
| 754 | nmdc:mga00v17_11298_c1 | 3300050491 | Bacteria | 4906 |
| 755 | nmdc:mga00v17_14191_c1 | 3300050491 | Bacteria | 4441 |
| 756 | nmdc:mga00v17_14397_c1 | 3300050491 | Bacteria | 4413 |
| 757 | nmdc:mga00v17_151242_c1 | 3300050491 | Bacteria | 1492 |
| 758 | nmdc:mga00v17_260390_c1 | 3300050491 | Bacteria | 1125 |
| 759 | nmdc:mga00v17_260819_c1 | 3300050491 | Bacteria | 1124 |
| 760 | nmdc:mga00v17_28521_c1 | 3300050491 | Bacteria | 3270 |
| 761 | nmdc:mga0yw44_257631_c1 | 3300050492 | Bacteria | 1162 |
| 762 | nmdc:mga0k408_14304_c1 | 3300050493 | Bacteria | 4368 |
| 763 | nmdc:mga0k408_3437_c1 | 3300050493 | Bacteria | 8385 |
| 764 | nmdc:mga0k408_426795_c1 | 3300050493 | Unclassified | 788 |
| 765 | nmdc:mga0k408_81932_c1 | 3300050493 | Bacteria | 1890 |
| 766 | nmdc:mga0k408_9704_c1 | 3300050493 | Bacteria | 5197 |
| 767 | nmdc:mga06z11_115417_c1 | 3300050494 | Bacteria | 1492 |
| 768 | nmdc:mga06z11_169725_c1 | 3300050494 | Bacteria | 1252 |
| 769 | nmdc:mga06z11_302837_c1 | 3300050494 | Bacteria | 951 |
| 770 | nmdc:mga04h51_117697_c1 | 3300050495 | Bacteria | 987 |
| 771 | nmdc:mga04h51_169594_c1 | 3300050495 | Bacteria | 844 |
| 772 | nmdc:mga07m45_123961_c1 | 3300050496 | Bacteria | 1493 |
| 773 | nmdc:mga07m45_15404_c1 | 3300050496 | Bacteria | 4082 |
| 774 | nmdc:mga05p37_185378_c1 | 3300050507 | Bacteria | 2530 |
| 775 | nmdc:mga05p37_3369_c1 | 3300050507 | Bacteria | 18656 |
| 776 | nmdc:mga05p37_445171_c1 | 3300050507 | Bacteria | 1501 |
| 777 | nmdc:mga05p37_62226_c1 | 3300050507 | Bacteria | 4593 |
| 778 | nmdc:mga05p37_67440_c1 | 3300050507 | Unclassified | 4402 |
| 779 | nmdc:mga09592_140920_c1 | 3300050508 | Bacteria | 2078 |
| 780 | nmdc:mga09592_503986_c1 | 3300050508 | Bacteria | 1042 |
| 781 | nmdc:mga0qj67_105479_c1 | 3300050509 | Bacteria | 2274 |
| 782 | nmdc:mga0qj67_29477_c1 | 3300050509 | Bacteria | 4263 |
| 783 | nmdc:mga06r32_120617_c1 | 3300050510 | Bacteria | 2586 |
| 784 | nmdc:mga06r32_323482_c1 | 3300050510 | Unclassified | 1527 |
| 785 | nmdc:mga06r32_37428_c1 | 3300050510 | Bacteria | 4589 |
| 786 | nmdc:mga06r32_761581_c1 | 3300050510 | Bacteria | 931 |
| 787 | nmdc:mga06r32_763540_c1 | 3300050510 | Bacteria | 929 |
| 788 | nmdc:mga08y16_155463_c1 | 3300050511 | Bacteria | 2377 |
| 789 | nmdc:mga08y16_17018_c1 | 3300050511 | Bacteria | 7656 |
| 790 | nmdc:mga08y16_40296_c1 | 3300050511 | Bacteria | 4897 |
| 791 | nmdc:mga08y16_464704_c1 | 3300050511 | Bacteria | 1289 |
| 792 | nmdc:mga08y16_627627_c1 | 3300050511 | Bacteria | 1081 |
| 793 | nmdc:mga08y16_92015_c1 | 3300050511 | Bacteria | 3160 |
| 794 | nmdc:mga0n895_223668_c1 | 3300050512 | Bacteria | 1910 |
| 795 | nmdc:mga0n895_250539_c1 | 3300050512 | Bacteria | 1797 |
| 796 | nmdc:mga0rr50_545_c1 | 3300050513 | Bacteria | 20207 |
| 797 | nmdc:mga08x19_182406_c1 | 3300050514 | Bacteria | 1433 |
| 798 | nmdc:mga0a205_395136_c1 | 3300050515 | Unclassified | 1247 |
| 799 | Ga0500644_0239339 | 3300053088 | Bacteria | 762 |
| 800 | Ga0500564_176831 | 3300053138 | Bacteria | 893 |
| 801 | Ga0501084_0110597 | 3300054114 | Bacteria | 2309 |
| 802 | Ga0501084_0419371 | 3300054114 | Bacteria | 1131 |
| 803 | Ga0501084_0679944 | 3300054114 | Bacteria | 868 |
| 804 | Ga0590075_054046 | 3300059424 | Bacteria | 1031 |
| 805 | Ga0587093_034489 | 3300059478 | Bacteria | 743 |
| 806 | Ga0587073_0042039 | 3300059492 | Bacteria | 1001 |
| 807 | Ga0587115_042911 | 3300059626 | Bacteria | 712 |
| 808 | Ga0587114_044203 | 3300059655 | Bacteria | 733 |
| 809 | Ga0501082_0082508 | 3300060353 | Bacteria | 2774 |
| 810 | Ga0501082_0094811 | 3300060353 | Bacteria | 2579 |
| 811 | Ga0501082_0280222 | 3300060353 | Bacteria | 1451 |
| 812 | Ga0501082_0990237 | 3300060353 | Bacteria | 735 |
| 813 | Ga0530510_0307814 | 3300061734 | Bacteria | 1186 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009545 | Ga0105237_10539253 | Ga0105237_105392532 | 165 |
| 2 | 3300026118 | Ga0207675_100310536 | Ga0207675_1003105362 | 165 |
| 3 | 3300005331 | Ga0070670_100357260 | Ga0070670_1003572603 | 166 |
| 4 | 3300011119 | Ga0105246_10240183 | Ga0105246_102401832 | 166 |
| 5 | 3300014325 | Ga0163163_10105277 | Ga0163163_101052774 | 166 |
| 6 | 3300026075 | Ga0207708_10663260 | Ga0207708_106632602 | 166 |
| 7 | 3300005338 | Ga0068868_101168726 | Ga0068868_1011687261 | 167 |
| 8 | 3300006846 | Ga0075430_100014465 | Ga0075430_1000144654 | 167 |
| 9 | 3300009098 | Ga0105245_10003049 | Ga0105245_100030499 | 167 |
| 10 | 3300009176 | Ga0105242_10100004 | Ga0105242_101000044 | 167 |
| 11 | 3300009177 | Ga0105248_10032778 | Ga0105248_100327786 | 167 |
| 12 | 3300013296 | Ga0157374_10459611 | Ga0157374_104596113 | 167 |
| 13 | 3300013296 | Ga0157374_11844519 | Ga0157374_118445191 | 167 |
| 14 | 3300013306 | Ga0163162_10048904 | Ga0163162_100489044 | 167 |
| 15 | 3300013308 | Ga0157375_10002486 | Ga0157375_100024862 | 167 |
| 16 | 3300014325 | Ga0163163_10060850 | Ga0163163_100608502 | 167 |
| 17 | 3300014745 | Ga0157377_10692460 | Ga0157377_106924602 | 167 |
| 18 | 3300014968 | Ga0157379_10018611 | Ga0157379_100186116 | 167 |
| 19 | 3300044901 | Ga0466960_0008243 | Ga0466960_0008243_208_768 | 167 |
| 20 | 3300048903 | Ga0496100_0863651 | Ga0496100_0863651_85_597 | 167 |
| 21 | 3300048907 | Ga0496104_0058526 | Ga0496104_0058526_3037_3549 | 167 |
| 22 | 3300048913 | Ga0496110_0115394 | Ga0496110_0115394_1189_1701 | 167 |
| 23 | 3300048914 | Ga0496111_0202054 | Ga0496111_0202054_145_657 | 167 |
| 24 | 3300049576 | Ga0501040_0038131 | Ga0501040_0038131_1452_1964 | 167 |
| 25 | 3300049587 | Ga0501071_0108343 | Ga0501071_0108343_253_765 | 167 |
| 26 | 3300049592 | Ga0501076_0011387 | Ga0501076_0011387_3538_4050 | 167 |
| 27 | 3300049741 | Ga0501079_0377647 | Ga0501079_0377647_204_716 | 167 |
| 28 | 3300049742 | Ga0501080_0082510 | Ga0501080_0082510_2413_2925 | 167 |
| 29 | 3300049762 | Ga0501265_053432 | Ga0501265_053432_70_588 | 167 |
| 30 | 3300050493 | nmdc:mga0k408_81932_c1 | nmdc:mga0k408_81932_c1_990_1502 | 167 |
| 31 | 3300050495 | nmdc:mga04h51_117697_c1 | nmdc:mga04h51_117697_c1_56_568 | 167 |
| 32 | 3300060353 | Ga0501082_0082508 | Ga0501082_0082508_1246_1758 | 167 |
| 33 | 3300005844 | Ga0068862_100057518 | Ga0068862_1000575184 | 168 |
| 34 | 3300005937 | Ga0081455_10222054 | Ga0081455_102220541 | 168 |
| 35 | 3300005985 | Ga0081539_10162043 | Ga0081539_101620431 | 168 |
| 36 | 3300013307 | Ga0157372_10099075 | Ga0157372_100990754 | 168 |
| 37 | 3300025933 | Ga0207706_11201053 | Ga0207706_112010531 | 168 |
| 38 | 3300028380 | Ga0268265_10132512 | Ga0268265_101325122 | 168 |
| 39 | 3300028380 | Ga0268265_10857834 | Ga0268265_108578341 | 168 |
| 40 | 3300031852 | Ga0307410_11389530 | Ga0307410_113895302 | 168 |
| 41 | 3300044901 | Ga0466960_0150279 | Ga0466960_0150279_44_568 | 168 |
| 42 | 3300005293 | Ga0065715_10190385 | Ga0065715_101903852 | 169 |
| 43 | 3300005329 | Ga0070683_101255031 | Ga0070683_1012550311 | 169 |
| 44 | 3300005330 | Ga0070690_100202494 | Ga0070690_1002024941 | 169 |
| 45 | 3300005334 | Ga0068869_100151345 | Ga0068869_1001513452 | 169 |
| 46 | 3300005335 | Ga0070666_10733945 | Ga0070666_107339451 | 169 |
| 47 | 3300005337 | Ga0070682_100830919 | Ga0070682_1008309192 | 169 |
| 48 | 3300005340 | Ga0070689_100110044 | Ga0070689_1001100442 | 169 |
| 49 | 3300005347 | Ga0070668_100504047 | Ga0070668_1005040471 | 169 |
| 50 | 3300005353 | Ga0070669_100007291 | Ga0070669_10000729110 | 169 |
| 51 | 3300005365 | Ga0070688_100061888 | Ga0070688_1000618883 | 169 |
| 52 | 3300005366 | Ga0070659_101397043 | Ga0070659_1013970431 | 169 |
| 53 | 3300005440 | Ga0070705_100246899 | Ga0070705_1002468992 | 169 |
| 54 | 3300005441 | Ga0070700_100093368 | Ga0070700_1000933682 | 169 |
| 55 | 3300005518 | Ga0070699_100314086 | Ga0070699_1003140862 | 169 |
| 56 | 3300005530 | Ga0070679_100202026 | Ga0070679_1002020262 | 169 |
| 57 | 3300005544 | Ga0070686_100034885 | Ga0070686_1000348851 | 169 |
| 58 | 3300005563 | Ga0068855_100808215 | Ga0068855_1008082151 | 169 |
| 59 | 3300005564 | Ga0070664_100800774 | Ga0070664_1008007742 | 169 |
| 60 | 3300005615 | Ga0070702_100117250 | Ga0070702_1001172501 | 169 |
| 61 | 3300005615 | Ga0070702_101036408 | Ga0070702_1010364081 | 169 |
| 62 | 3300005618 | Ga0068864_100205277 | Ga0068864_1002052772 | 169 |
| 63 | 3300005719 | Ga0068861_100777290 | Ga0068861_1007772902 | 169 |
| 64 | 3300005843 | Ga0068860_101299176 | Ga0068860_1012991762 | 169 |
| 65 | 3300005844 | Ga0068862_100020071 | Ga0068862_1000200717 | 169 |
| 66 | 3300006051 | Ga0075364_10002943 | Ga0075364_100029436 | 169 |
| 67 | 3300006881 | Ga0068865_100253843 | Ga0068865_1002538432 | 169 |
| 68 | 3300009093 | Ga0105240_10563346 | Ga0105240_105633461 | 169 |
| 69 | 3300009094 | Ga0111539_10045673 | Ga0111539_100456733 | 169 |
| 70 | 3300009094 | Ga0111539_11808429 | Ga0111539_118084291 | 169 |
| 71 | 3300009553 | Ga0105249_11797861 | Ga0105249_117978611 | 169 |
| 72 | 3300013297 | Ga0157378_11418981 | Ga0157378_114189811 | 169 |
| 73 | 3300013306 | Ga0163162_10470494 | Ga0163162_104704942 | 169 |
| 74 | 3300013307 | Ga0157372_10244328 | Ga0157372_102443283 | 169 |
| 75 | 3300013308 | Ga0157375_10033211 | Ga0157375_100332114 | 169 |
| 76 | 3300014326 | Ga0157380_10714141 | Ga0157380_107141411 | 169 |
| 77 | 3300025315 | Ga0207697_10138571 | Ga0207697_101385711 | 169 |
| 78 | 3300025913 | Ga0207695_10714125 | Ga0207695_107141251 | 169 |
| 79 | 3300025921 | Ga0207652_10208655 | Ga0207652_102086552 | 169 |
| 80 | 3300025923 | Ga0207681_10315964 | Ga0207681_103159641 | 169 |
| 81 | 3300025925 | Ga0207650_10166185 | Ga0207650_101661851 | 169 |
| 82 | 3300025931 | Ga0207644_10713356 | Ga0207644_107133561 | 169 |
| 83 | 3300025938 | Ga0207704_10187161 | Ga0207704_101871612 | 169 |
| 84 | 3300025942 | Ga0207689_10232670 | Ga0207689_102326702 | 169 |
| 85 | 3300025944 | Ga0207661_11019596 | Ga0207661_110195961 | 169 |
| 86 | 3300025949 | Ga0207667_11153530 | Ga0207667_111535301 | 169 |
| 87 | 3300025972 | Ga0207668_11154091 | Ga0207668_111540911 | 169 |
| 88 | 3300026095 | Ga0207676_10194780 | Ga0207676_101947802 | 169 |
| 89 | 3300026095 | Ga0207676_10888522 | Ga0207676_108885222 | 169 |
| 90 | 3300026118 | Ga0207675_100156440 | Ga0207675_1001564401 | 169 |
| 91 | 3300027907 | Ga0207428_10012636 | Ga0207428_100126368 | 169 |
| 92 | 3300028380 | Ga0268265_10013423 | Ga0268265_100134237 | 169 |
| 93 | 3300028381 | Ga0268264_11236592 | Ga0268264_112365921 | 169 |
| 94 | 3300031548 | Ga0307408_100059723 | Ga0307408_1000597233 | 169 |
| 95 | 3300031731 | Ga0307405_10198294 | Ga0307405_101982942 | 169 |
| 96 | 3300031824 | Ga0307413_10243129 | Ga0307413_102431292 | 169 |
| 97 | 3300031852 | Ga0307410_10054566 | Ga0307410_100545663 | 169 |
| 98 | 3300031852 | Ga0307410_10400853 | Ga0307410_104008532 | 169 |
| 99 | 3300031901 | Ga0307406_10303290 | Ga0307406_103032901 | 169 |
| 100 | 3300031903 | Ga0307407_10865394 | Ga0307407_108653942 | 169 |
| 101 | 3300031903 | Ga0307407_11224057 | Ga0307407_112240571 | 169 |
| 102 | 3300031911 | Ga0307412_10218921 | Ga0307412_102189212 | 169 |
| 103 | 3300031995 | Ga0307409_100006003 | Ga0307409_1000060038 | 169 |
| 104 | 3300031995 | Ga0307409_100535134 | Ga0307409_1005351342 | 169 |
| 105 | 3300032005 | Ga0307411_10530180 | Ga0307411_105301802 | 169 |
| 106 | 3300032126 | Ga0307415_100058848 | Ga0307415_1000588482 | 169 |
| 107 | 3300037312 | Ga0395899_0005318 | Ga0395899_0005318_8180_8704 | 169 |
| 108 | 3300037418 | Ga0395900_0011357 | Ga0395900_0011357_6439_6963 | 169 |
| 109 | 3300037466 | Ga0395898_0016961 | Ga0395898_0016961_4885_5409 | 169 |
| 110 | 3300038443 | Ga0395901_0101906 | Ga0395901_0101906_340_864 | 169 |
| 111 | 3300045049 | Ga0466959_0415522 | Ga0466959_0415522_85_609 | 169 |
| 112 | 3300046491 | Ga0495584_0005887 | Ga0495584_0005887_1293_1802 | 169 |
| 113 | 3300046506 | Ga0495583_0117600 | Ga0495583_0117600_456_965 | 169 |
| 114 | 3300046513 | Ga0495616_0005117 | Ga0495616_0005117_6476_6985 | 169 |
| 115 | 3300046522 | Ga0495643_0074698 | Ga0495643_0074698_146_655 | 169 |
| 116 | 3300046616 | Ga0495668_0000368 | Ga0495668_0000368_2203_2712 | 169 |
| 117 | 3300046660 | Ga0495625_0215706 | Ga0495625_0215706_330_839 | 169 |
| 118 | 3300046665 | Ga0495661_0035672 | Ga0495661_0035672_1492_2001 | 169 |
| 119 | 3300046675 | Ga0495657_0398064 | Ga0495657_0398064_26_535 | 169 |
| 120 | 3300046684 | Ga0495669_0000453 | Ga0495669_0000453_17589_18098 | 169 |
| 121 | 3300046694 | Ga0495649_0011217 | Ga0495649_0011217_3081_3590 | 169 |
| 122 | 3300047318 | Ga0495636_0004548 | Ga0495636_0004548_4769_5278 | 169 |
| 123 | 3300047443 | Ga0495687_097271 | Ga0495687_097271_157_666 | 169 |
| 124 | 3300047445 | Ga0495677_0006066 | Ga0495677_0006066_2172_2681 | 169 |
| 125 | 3300047472 | Ga0495686_0008011 | Ga0495686_0008011_5349_5858 | 169 |
| 126 | 3300048915 | Ga0496112_0061534 | Ga0496112_0061534_319_843 | 169 |
| 127 | 3300048925 | Ga0496122_0140948 | Ga0496122_0140948_246_770 | 169 |
| 128 | 3300048926 | Ga0496123_0043530 | Ga0496123_0043530_1863_2387 | 169 |
| 129 | 3300049578 | Ga0501042_0157067 | Ga0501042_0157067_962_1540 | 169 |
| 130 | 3300049579 | Ga0501043_0253942 | Ga0501043_0253942_68_589 | 169 |
| 131 | 3300049824 | Ga0501045_0223735 | Ga0501045_0223735_76_597 | 169 |
| 132 | 3300050491 | nmdc:mga00v17_11298_c1 | nmdc:mga00v17_11298_c1_2717_3232 | 169 |
| 133 | 3300050511 | nmdc:mga08y16_40296_c1 | nmdc:mga08y16_40296_c1_2227_2754 | 169 |
| 134 | iso_pu_bacteria | 2751185846 | 2753570115 | 169 |
| 135 | iso_pu_bacteria | 2885270888 | 2885274753 | 169 |
| 136 | iso_pu_bacteria | 2904483920 | 2904486775 | 169 |
| 137 | iso_pu_bacteria | 8055266321 | 8055270608 | 169 |
| 138 | 3300005290 | Ga0065712_10217158 | Ga0065712_102171582 | 170 |
| 139 | 3300005290 | Ga0065712_10580926 | Ga0065712_105809261 | 170 |
| 140 | 3300005293 | Ga0065715_10105044 | Ga0065715_101050443 | 170 |
| 141 | 3300005327 | Ga0070658_10074108 | Ga0070658_100741083 | 170 |
| 142 | 3300005327 | Ga0070658_10345699 | Ga0070658_103456992 | 170 |
| 143 | 3300005355 | Ga0070671_100368251 | Ga0070671_1003682511 | 170 |
| 144 | 3300005364 | Ga0070673_100502513 | Ga0070673_1005025132 | 170 |
| 145 | 3300005456 | Ga0070678_100021686 | Ga0070678_1000216863 | 170 |
| 146 | 3300005459 | Ga0068867_100525530 | Ga0068867_1005255302 | 170 |
| 147 | 3300005530 | Ga0070679_100186138 | Ga0070679_1001861383 | 170 |
| 148 | 3300005543 | Ga0070672_100324184 | Ga0070672_1003241842 | 170 |
| 149 | 3300005548 | Ga0070665_101255524 | Ga0070665_1012555241 | 170 |
| 150 | 3300005719 | Ga0068861_101722685 | Ga0068861_1017226852 | 170 |
| 151 | 3300005842 | Ga0068858_100621392 | Ga0068858_1006213922 | 170 |
| 152 | 3300006038 | Ga0075365_10241143 | Ga0075365_102411432 | 170 |
| 153 | 3300006042 | Ga0075368_10002746 | Ga0075368_100027465 | 170 |
| 154 | 3300006048 | Ga0075363_100032003 | Ga0075363_1000320033 | 170 |
| 155 | 3300006051 | Ga0075364_10055278 | Ga0075364_100552784 | 170 |
| 156 | 3300006178 | Ga0075367_10098453 | Ga0075367_100984533 | 170 |
| 157 | 3300006178 | Ga0075367_10232976 | Ga0075367_102329761 | 170 |
| 158 | 3300006353 | Ga0075370_10016416 | Ga0075370_100164163 | 170 |
| 159 | 3300006846 | Ga0075430_100055726 | Ga0075430_1000557264 | 170 |
| 160 | 3300009093 | Ga0105240_10005746 | Ga0105240_1000574613 | 170 |
| 161 | 3300009093 | Ga0105240_10298775 | Ga0105240_102987753 | 170 |
| 162 | 3300009094 | Ga0111539_10831036 | Ga0111539_108310361 | 170 |
| 163 | 3300009098 | Ga0105245_11972124 | Ga0105245_119721241 | 170 |
| 164 | 3300009147 | Ga0114129_10134488 | Ga0114129_101344884 | 170 |
| 165 | 3300009147 | Ga0114129_11567233 | Ga0114129_115672332 | 170 |
| 166 | 3300009545 | Ga0105237_10006745 | Ga0105237_100067459 | 170 |
| 167 | 3300009545 | Ga0105237_10490361 | Ga0105237_104903612 | 170 |
| 168 | 3300009551 | Ga0105238_10465376 | Ga0105238_104653762 | 170 |
| 169 | 3300009553 | Ga0105249_10158901 | Ga0105249_101589012 | 170 |
| 170 | 3300013296 | Ga0157374_10767157 | Ga0157374_107671572 | 170 |
| 171 | 3300014326 | Ga0157380_10281747 | Ga0157380_102817472 | 170 |
| 172 | 3300017792 | Ga0163161_10781835 | Ga0163161_107818352 | 170 |
| 173 | 3300025909 | Ga0207705_10018268 | Ga0207705_100182684 | 170 |
| 174 | 3300025913 | Ga0207695_10020911 | Ga0207695_100209116 | 170 |
| 175 | 3300025914 | Ga0207671_10021594 | Ga0207671_100215945 | 170 |
| 176 | 3300025921 | Ga0207652_10132486 | Ga0207652_101324863 | 170 |
| 177 | 3300025940 | Ga0207691_10038054 | Ga0207691_100380542 | 170 |
| 178 | 3300025942 | Ga0207689_10407221 | Ga0207689_104072212 | 170 |
| 179 | 3300025986 | Ga0207658_11639006 | Ga0207658_116390061 | 170 |
| 180 | 3300026116 | Ga0207674_10405294 | Ga0207674_104052942 | 170 |
| 181 | 3300026121 | Ga0207683_10029686 | Ga0207683_100296864 | 170 |
| 182 | 3300031731 | Ga0307405_10370193 | Ga0307405_103701932 | 170 |
| 183 | 3300031911 | Ga0307412_11323303 | Ga0307412_113233031 | 170 |
| 184 | 3300032002 | Ga0307416_102386864 | Ga0307416_1023868641 | 170 |
| 185 | 3300037471 | Ga0395905_0000221 | Ga0395905_0000221_74187_74711 | 170 |
| 186 | 3300039437 | Ga0436365_1297870 | Ga0436365_1297870_371_883 | 170 |
| 187 | 3300041452 | Ga0451793_0826448 | Ga0451793_0826448_10_531 | 170 |
| 188 | 3300041505 | Ga0451849_0527925 | Ga0451849_0527925_34_555 | 170 |
| 189 | 3300042124 | Ga0450922_012407 | Ga0450922_012407_282_803 | 170 |
| 190 | 3300042125 | Ga0450923_030540 | Ga0450923_030540_369_890 | 170 |
| 191 | 3300046460 | Ga0495638_0139239 | Ga0495638_0139239_827_1348 | 170 |
| 192 | 3300048905 | Ga0496102_0144723 | Ga0496102_0144723_837_1358 | 170 |
| 193 | 3300048912 | Ga0496109_1214066 | Ga0496109_1214066_80_601 | 170 |
| 194 | 3300048920 | Ga0496117_0178364 | Ga0496117_0178364_154_675 | 170 |
| 195 | 3300048921 | Ga0496118_0022238 | Ga0496118_0022238_3657_4178 | 170 |
| 196 | 3300049585 | Ga0501069_0050976 | Ga0501069_0050976_1723_2244 | 170 |
| 197 | 3300049592 | Ga0501076_0640850 | Ga0501076_0640850_354_866 | 170 |
| 198 | 3300050491 | nmdc:mga00v17_151242_c1 | nmdc:mga00v17_151242_c1_391_903 | 170 |
| 199 | 3300050491 | nmdc:mga00v17_28521_c1 | nmdc:mga00v17_28521_c1_2663_3175 | 170 |
| 200 | 3300050493 | nmdc:mga0k408_426795_c1 | nmdc:mga0k408_426795_c1_86_598 | 170 |
| 201 | 3300050496 | nmdc:mga07m45_15404_c1 | nmdc:mga07m45_15404_c1_1499_2011 | 170 |
| 202 | 3300050507 | nmdc:mga05p37_185378_c1 | nmdc:mga05p37_185378_c1_1185_1697 | 170 |
| 203 | 3300050509 | nmdc:mga0qj67_29477_c1 | nmdc:mga0qj67_29477_c1_840_1352 | 170 |
| 204 | 3300050511 | nmdc:mga08y16_464704_c1 | nmdc:mga08y16_464704_c1_495_1010 | 170 |
| 205 | 3300050511 | nmdc:mga08y16_92015_c1 | nmdc:mga08y16_92015_c1_623_1141 | 170 |
| 206 | 3300050513 | nmdc:mga0rr50_545_c1 | nmdc:mga0rr50_545_c1_15575_16087 | 170 |
| 207 | 3300002459 | JGI24751J29686_10019403 | JGI24751J29686_100194032 | 171 |
| 208 | 3300003575 | Ga0007409J51694_1028918 | Ga0007409J51694_10289181 | 171 |
| 209 | 3300003579 | Ga0007429J51699_1119903 | Ga0007429J51699_11199031 | 171 |
| 210 | 3300004799 | Ga0058863_11561367 | Ga0058863_115613671 | 171 |
| 211 | 3300004800 | Ga0058861_11675737 | Ga0058861_116757371 | 171 |
| 212 | 3300004803 | Ga0058862_12242253 | Ga0058862_122422532 | 171 |
| 213 | 3300005288 | Ga0065714_10287893 | Ga0065714_102878932 | 171 |
| 214 | 3300005290 | Ga0065712_10078899 | Ga0065712_100788991 | 171 |
| 215 | 3300005293 | Ga0065715_10470402 | Ga0065715_104704021 | 171 |
| 216 | 3300005293 | Ga0065715_10474359 | Ga0065715_104743592 | 171 |
| 217 | 3300005293 | Ga0065715_10509730 | Ga0065715_105097301 | 171 |
| 218 | 3300005295 | Ga0065707_10201881 | Ga0065707_102018812 | 171 |
| 219 | 3300005328 | Ga0070676_10030962 | Ga0070676_100309622 | 171 |
| 220 | 3300005331 | Ga0070670_100004831 | Ga0070670_1000048319 | 171 |
| 221 | 3300005331 | Ga0070670_100098196 | Ga0070670_1000981962 | 171 |
| 222 | 3300005334 | Ga0068869_100078407 | Ga0068869_1000784072 | 171 |
| 223 | 3300005337 | Ga0070682_100892267 | Ga0070682_1008922671 | 171 |
| 224 | 3300005344 | Ga0070661_100754303 | Ga0070661_1007543031 | 171 |
| 225 | 3300005353 | Ga0070669_100331798 | Ga0070669_1003317982 | 171 |
| 226 | 3300005355 | Ga0070671_100117389 | Ga0070671_1001173891 | 171 |
| 227 | 3300005356 | Ga0070674_101538553 | Ga0070674_1015385531 | 171 |
| 228 | 3300005364 | Ga0070673_100037552 | Ga0070673_1000375523 | 171 |
| 229 | 3300005366 | Ga0070659_100582707 | Ga0070659_1005827072 | 171 |
| 230 | 3300005367 | Ga0070667_100252286 | Ga0070667_1002522861 | 171 |
| 231 | 3300005439 | Ga0070711_100208905 | Ga0070711_1002089053 | 171 |
| 232 | 3300005455 | Ga0070663_100084708 | Ga0070663_1000847082 | 171 |
| 233 | 3300005458 | Ga0070681_10057879 | Ga0070681_100578791 | 171 |
| 234 | 3300005459 | Ga0068867_100752114 | Ga0068867_1007521142 | 171 |
| 235 | 3300005466 | Ga0070685_10138819 | Ga0070685_101388192 | 171 |
| 236 | 3300005467 | Ga0070706_100361743 | Ga0070706_1003617433 | 171 |
| 237 | 3300005467 | Ga0070706_100837088 | Ga0070706_1008370881 | 171 |
| 238 | 3300005468 | Ga0070707_100791276 | Ga0070707_1007912761 | 171 |
| 239 | 3300005530 | Ga0070679_100052050 | Ga0070679_1000520502 | 171 |
| 240 | 3300005539 | Ga0068853_100873110 | Ga0068853_1008731102 | 171 |
| 241 | 3300005543 | Ga0070672_100044581 | Ga0070672_1000445814 | 171 |
| 242 | 3300005545 | Ga0070695_101091279 | Ga0070695_1010912792 | 171 |
| 243 | 3300005546 | Ga0070696_100029166 | Ga0070696_1000291661 | 171 |
| 244 | 3300005547 | Ga0070693_100332079 | Ga0070693_1003320791 | 171 |
| 245 | 3300005564 | Ga0070664_100056589 | Ga0070664_1000565893 | 171 |
| 246 | 3300005564 | Ga0070664_100294207 | Ga0070664_1002942073 | 171 |
| 247 | 3300005577 | Ga0068857_100002215 | Ga0068857_10000221511 | 171 |
| 248 | 3300005719 | Ga0068861_100656473 | Ga0068861_1006564732 | 171 |
| 249 | 3300005843 | Ga0068860_101130975 | Ga0068860_1011309752 | 171 |
| 250 | 3300005844 | Ga0068862_100061365 | Ga0068862_1000613653 | 171 |
| 251 | 3300006038 | Ga0075365_10013288 | Ga0075365_100132885 | 171 |
| 252 | 3300006038 | Ga0075365_10044114 | Ga0075365_100441142 | 171 |
| 253 | 3300006042 | Ga0075368_10167683 | Ga0075368_101676831 | 171 |
| 254 | 3300006048 | Ga0075363_100511373 | Ga0075363_1005113732 | 171 |
| 255 | 3300006051 | Ga0075364_10027187 | Ga0075364_100271873 | 171 |
| 256 | 3300006051 | Ga0075364_10029418 | Ga0075364_100294182 | 171 |
| 257 | 3300006051 | Ga0075364_10366090 | Ga0075364_103660902 | 171 |
| 258 | 3300006178 | Ga0075367_10070238 | Ga0075367_100702383 | 171 |
| 259 | 3300006178 | Ga0075367_10099391 | Ga0075367_100993913 | 171 |
| 260 | 3300006195 | Ga0075366_10005318 | Ga0075366_100053188 | 171 |
| 261 | 3300006195 | Ga0075366_10010729 | Ga0075366_100107295 | 171 |
| 262 | 3300006353 | Ga0075370_10159966 | Ga0075370_101599662 | 171 |
| 263 | 3300006358 | Ga0068871_100642314 | Ga0068871_1006423142 | 171 |
| 264 | 3300006852 | Ga0075433_10335726 | Ga0075433_103357262 | 171 |
| 265 | 3300006871 | Ga0075434_100255521 | Ga0075434_1002555213 | 171 |
| 266 | 3300006880 | Ga0075429_100389083 | Ga0075429_1003890832 | 171 |
| 267 | 3300006880 | Ga0075429_100828579 | Ga0075429_1008285792 | 171 |
| 268 | 3300006931 | Ga0097620_100660550 | Ga0097620_1006605502 | 171 |
| 269 | 3300009093 | Ga0105240_10256088 | Ga0105240_102560883 | 171 |
| 270 | 3300009094 | Ga0111539_10025634 | Ga0111539_100256342 | 171 |
| 271 | 3300009094 | Ga0111539_10039209 | Ga0111539_100392095 | 171 |
| 272 | 3300009147 | Ga0114129_10002414 | Ga0114129_1000241416 | 171 |
| 273 | 3300009147 | Ga0114129_12726960 | Ga0114129_127269601 | 171 |
| 274 | 3300009551 | Ga0105238_10114637 | Ga0105238_101146372 | 171 |
| 275 | 3300011119 | Ga0105246_10762132 | Ga0105246_107621322 | 171 |
| 276 | 3300013296 | Ga0157374_10723451 | Ga0157374_107234511 | 171 |
| 277 | 3300013306 | Ga0163162_10381400 | Ga0163162_103814003 | 171 |
| 278 | 3300013308 | Ga0157375_10049471 | Ga0157375_100494713 | 171 |
| 279 | 3300014325 | Ga0163163_10393513 | Ga0163163_103935132 | 171 |
| 280 | 3300014745 | Ga0157377_10466724 | Ga0157377_104667241 | 171 |
| 281 | 3300014968 | Ga0157379_10585193 | Ga0157379_105851932 | 171 |
| 282 | 3300020069 | Ga0197907_11031442 | Ga0197907_110314421 | 171 |
| 283 | 3300020070 | Ga0206356_11608615 | Ga0206356_116086152 | 171 |
| 284 | 3300020076 | Ga0206355_1488022 | Ga0206355_14880222 | 171 |
| 285 | 3300020082 | Ga0206353_10654570 | Ga0206353_106545701 | 171 |
| 286 | 3300022467 | Ga0224712_10157125 | Ga0224712_101571251 | 171 |
| 287 | 3300025907 | Ga0207645_10032291 | Ga0207645_100322915 | 171 |
| 288 | 3300025913 | Ga0207695_10199383 | Ga0207695_101993833 | 171 |
| 289 | 3300025916 | Ga0207663_10213260 | Ga0207663_102132603 | 171 |
| 290 | 3300025918 | Ga0207662_10059311 | Ga0207662_100593113 | 171 |
| 291 | 3300025920 | Ga0207649_10485501 | Ga0207649_104855012 | 171 |
| 292 | 3300025924 | Ga0207694_10246950 | Ga0207694_102469502 | 171 |
| 293 | 3300025925 | Ga0207650_10072245 | Ga0207650_100722454 | 171 |
| 294 | 3300025925 | Ga0207650_10207040 | Ga0207650_102070403 | 171 |
| 295 | 3300025925 | Ga0207650_10223967 | Ga0207650_102239671 | 171 |
| 296 | 3300025925 | Ga0207650_10274785 | Ga0207650_102747852 | 171 |
| 297 | 3300025936 | Ga0207670_10537145 | Ga0207670_105371452 | 171 |
| 298 | 3300025938 | Ga0207704_10133108 | Ga0207704_101331082 | 171 |
| 299 | 3300025940 | Ga0207691_10045824 | Ga0207691_100458245 | 171 |
| 300 | 3300025945 | Ga0207679_10273812 | Ga0207679_102738123 | 171 |
| 301 | 3300025949 | Ga0207667_10816324 | Ga0207667_108163242 | 171 |
| 302 | 3300025960 | Ga0207651_10014615 | Ga0207651_100146155 | 171 |
| 303 | 3300025986 | Ga0207658_10776628 | Ga0207658_107766282 | 171 |
| 304 | 3300026035 | Ga0207703_10477822 | Ga0207703_104778222 | 171 |
| 305 | 3300026041 | Ga0207639_10184021 | Ga0207639_101840212 | 171 |
| 306 | 3300026067 | Ga0207678_10024600 | Ga0207678_100246003 | 171 |
| 307 | 3300026089 | Ga0207648_10253293 | Ga0207648_102532931 | 171 |
| 308 | 3300026095 | Ga0207676_10114990 | Ga0207676_101149903 | 171 |
| 309 | 3300026095 | Ga0207676_11198811 | Ga0207676_111988112 | 171 |
| 310 | 3300026116 | Ga0207674_10020350 | Ga0207674_100203504 | 171 |
| 311 | 3300026118 | Ga0207675_100088650 | Ga0207675_1000886502 | 171 |
| 312 | 3300026118 | Ga0207675_100088851 | Ga0207675_1000888516 | 171 |
| 313 | 3300026121 | Ga0207683_10005995 | Ga0207683_100059955 | 171 |
| 314 | 3300027682 | Ga0209971_1119195 | Ga0209971_11191951 | 171 |
| 315 | 3300027866 | Ga0209813_10021605 | Ga0209813_100216052 | 171 |
| 316 | 3300027866 | Ga0209813_10145314 | Ga0209813_101453142 | 171 |
| 317 | 3300027907 | Ga0207428_10016644 | Ga0207428_100166445 | 171 |
| 318 | 3300027907 | Ga0207428_10087984 | Ga0207428_100879842 | 171 |
| 319 | 3300028380 | Ga0268265_10280602 | Ga0268265_102806022 | 171 |
| 320 | 3300028380 | Ga0268265_10833644 | Ga0268265_108336442 | 171 |
| 321 | 3300028380 | Ga0268265_10847670 | Ga0268265_108476702 | 171 |
| 322 | 3300028380 | Ga0268265_10917574 | Ga0268265_109175742 | 171 |
| 323 | 3300028381 | Ga0268264_11391180 | Ga0268264_113911801 | 171 |
| 324 | 3300031852 | Ga0307410_10073288 | Ga0307410_100732884 | 171 |
| 325 | 3300032002 | Ga0307416_102248252 | Ga0307416_1022482521 | 171 |
| 326 | 3300037068 | Ga0373925_0512489 | Ga0373925_0512489_32_547 | 171 |
| 327 | 3300038443 | Ga0395901_0307725 | Ga0395901_0307725_770_1294 | 171 |
| 328 | 3300039437 | Ga0436365_0814888 | Ga0436365_0814888_30_557 | 171 |
| 329 | 3300041486 | Ga0451807_2240801 | Ga0451807_2240801_53_577 | 171 |
| 330 | 3300041512 | Ga0451853_0638581 | Ga0451853_0638581_150_668 | 171 |
| 331 | 3300042436 | Ga0439435_0114416 | Ga0439435_0114416_145_666 | 171 |
| 332 | 3300042461 | Ga0439460_0061302 | Ga0439460_0061302_569_1084 | 171 |
| 333 | 3300046459 | Ga0495629_0298426 | Ga0495629_0298426_444_962 | 171 |
| 334 | 3300048910 | Ga0496107_0455754 | Ga0496107_0455754_134_649 | 171 |
| 335 | 3300048913 | Ga0496110_0364870 | Ga0496110_0364870_748_1266 | 171 |
| 336 | 3300048927 | Ga0496124_0553118 | Ga0496124_0553118_109_705 | 171 |
| 337 | 3300049569 | Ga0501032_0104319 | Ga0501032_0104319_415_936 | 171 |
| 338 | 3300049570 | Ga0501033_0212435 | Ga0501033_0212435_384_905 | 171 |
| 339 | 3300049571 | Ga0501034_0033336 | Ga0501034_0033336_3336_3857 | 171 |
| 340 | 3300049571 | Ga0501034_0227076 | Ga0501034_0227076_811_1332 | 171 |
| 341 | 3300049571 | Ga0501034_0581786 | Ga0501034_0581786_145_666 | 171 |
| 342 | 3300049572 | Ga0501036_0069305 | Ga0501036_0069305_1345_1866 | 171 |
| 343 | 3300049573 | Ga0501037_0565056 | Ga0501037_0565056_81_602 | 171 |
| 344 | 3300049574 | Ga0501038_0088150 | Ga0501038_0088150_311_832 | 171 |
| 345 | 3300049575 | Ga0501039_0019780 | Ga0501039_0019780_4518_5039 | 171 |
| 346 | 3300049575 | Ga0501039_0886952 | Ga0501039_0886952_122_643 | 171 |
| 347 | 3300049579 | Ga0501043_0132350 | Ga0501043_0132350_525_1046 | 171 |
| 348 | 3300049580 | Ga0501046_0019314 | Ga0501046_0019314_4977_5498 | 171 |
| 349 | 3300049581 | Ga0501047_0118386 | Ga0501047_0118386_765_1286 | 171 |
| 350 | 3300049584 | Ga0501068_0082344 | Ga0501068_0082344_457_978 | 171 |
| 351 | 3300049585 | Ga0501069_0014033 | Ga0501069_0014033_2523_3044 | 171 |
| 352 | 3300049588 | Ga0501072_0247593 | Ga0501072_0247593_641_1162 | 171 |
| 353 | 3300049589 | Ga0501073_0043224 | Ga0501073_0043224_2583_3104 | 171 |
| 354 | 3300049742 | Ga0501080_0057899 | Ga0501080_0057899_2109_2630 | 171 |
| 355 | 3300049823 | Ga0501044_0112926 | Ga0501044_0112926_82_603 | 171 |
| 356 | 3300049823 | Ga0501044_0147432 | Ga0501044_0147432_791_1312 | 171 |
| 357 | 3300050491 | nmdc:mga00v17_14191_c1 | nmdc:mga00v17_14191_c1_1538_2059 | 171 |
| 358 | 3300050491 | nmdc:mga00v17_260390_c1 | nmdc:mga00v17_260390_c1_171_692 | 171 |
| 359 | 3300050492 | nmdc:mga0yw44_257631_c1 | nmdc:mga0yw44_257631_c1_408_929 | 171 |
| 360 | 3300050493 | nmdc:mga0k408_3437_c1 | nmdc:mga0k408_3437_c1_3719_4240 | 171 |
| 361 | 3300050493 | nmdc:mga0k408_9704_c1 | nmdc:mga0k408_9704_c1_4132_4653 | 171 |
| 362 | 3300050494 | nmdc:mga06z11_115417_c1 | nmdc:mga06z11_115417_c1_28_549 | 171 |
| 363 | 3300050494 | nmdc:mga06z11_169725_c1 | nmdc:mga06z11_169725_c1_682_1203 | 171 |
| 364 | 3300050495 | nmdc:mga04h51_169594_c1 | nmdc:mga04h51_169594_c1_68_589 | 171 |
| 365 | 3300050496 | nmdc:mga07m45_123961_c1 | nmdc:mga07m45_123961_c1_854_1375 | 171 |
| 366 | 3300050507 | nmdc:mga05p37_3369_c1 | nmdc:mga05p37_3369_c1_17555_18073 | 171 |
| 367 | 3300050508 | nmdc:mga09592_503986_c1 | nmdc:mga09592_503986_c1_343_864 | 171 |
| 368 | 3300050510 | nmdc:mga06r32_323482_c1 | nmdc:mga06r32_323482_c1_135_665 | 171 |
| 369 | 3300050511 | nmdc:mga08y16_155463_c1 | nmdc:mga08y16_155463_c1_1106_1627 | 171 |
| 370 | 3300050511 | nmdc:mga08y16_17018_c1 | nmdc:mga08y16_17018_c1_3035_3556 | 171 |
| 371 | 3300050512 | nmdc:mga0n895_250539_c1 | nmdc:mga0n895_250539_c1_48_563 | 171 |
| 372 | 3300050515 | nmdc:mga0a205_395136_c1 | nmdc:mga0a205_395136_c1_113_628 | 171 |
| 373 | 3300053138 | Ga0500564_176831 | Ga0500564_176831_21_539 | 171 |
| 374 | 3300004801 | Ga0058860_11905593 | Ga0058860_119055931 | 172 |
| 375 | 3300005293 | Ga0065715_10163674 | Ga0065715_101636743 | 172 |
| 376 | 3300005327 | Ga0070658_10023101 | Ga0070658_100231017 | 172 |
| 377 | 3300005327 | Ga0070658_10054974 | Ga0070658_100549742 | 172 |
| 378 | 3300005329 | Ga0070683_100002995 | Ga0070683_1000029954 | 172 |
| 379 | 3300005329 | Ga0070683_100007080 | Ga0070683_1000070806 | 172 |
| 380 | 3300005329 | Ga0070683_100286171 | Ga0070683_1002861712 | 172 |
| 381 | 3300005330 | Ga0070690_100023960 | Ga0070690_1000239606 | 172 |
| 382 | 3300005331 | Ga0070670_100208226 | Ga0070670_1002082262 | 172 |
| 383 | 3300005334 | Ga0068869_100335011 | Ga0068869_1003350112 | 172 |
| 384 | 3300005336 | Ga0070680_101339058 | Ga0070680_1013390581 | 172 |
| 385 | 3300005339 | Ga0070660_100008509 | Ga0070660_1000085093 | 172 |
| 386 | 3300005339 | Ga0070660_100059432 | Ga0070660_1000594322 | 172 |
| 387 | 3300005343 | Ga0070687_100022283 | Ga0070687_1000222832 | 172 |
| 388 | 3300005344 | Ga0070661_100024170 | Ga0070661_1000241702 | 172 |
| 389 | 3300005344 | Ga0070661_100155730 | Ga0070661_1001557303 | 172 |
| 390 | 3300005347 | Ga0070668_100422383 | Ga0070668_1004223832 | 172 |
| 391 | 3300005347 | Ga0070668_100762933 | Ga0070668_1007629332 | 172 |
| 392 | 3300005353 | Ga0070669_100145704 | Ga0070669_1001457042 | 172 |
| 393 | 3300005353 | Ga0070669_100343456 | Ga0070669_1003434562 | 172 |
| 394 | 3300005354 | Ga0070675_100119522 | Ga0070675_1001195223 | 172 |
| 395 | 3300005355 | Ga0070671_100161307 | Ga0070671_1001613072 | 172 |
| 396 | 3300005355 | Ga0070671_100350494 | Ga0070671_1003504942 | 172 |
| 397 | 3300005356 | Ga0070674_100026819 | Ga0070674_1000268192 | 172 |
| 398 | 3300005356 | Ga0070674_100578428 | Ga0070674_1005784281 | 172 |
| 399 | 3300005356 | Ga0070674_100720322 | Ga0070674_1007203222 | 172 |
| 400 | 3300005364 | Ga0070673_100014167 | Ga0070673_1000141674 | 172 |
| 401 | 3300005364 | Ga0070673_100341194 | Ga0070673_1003411942 | 172 |
| 402 | 3300005364 | Ga0070673_100520528 | Ga0070673_1005205281 | 172 |
| 403 | 3300005366 | Ga0070659_100125467 | Ga0070659_1001254673 | 172 |
| 404 | 3300005436 | Ga0070713_100033336 | Ga0070713_1000333362 | 172 |
| 405 | 3300005441 | Ga0070700_101060162 | Ga0070700_1010601621 | 172 |
| 406 | 3300005456 | Ga0070678_100027183 | Ga0070678_1000271835 | 172 |
| 407 | 3300005457 | Ga0070662_100017517 | Ga0070662_1000175173 | 172 |
| 408 | 3300005457 | Ga0070662_100106292 | Ga0070662_1001062923 | 172 |
| 409 | 3300005457 | Ga0070662_100311911 | Ga0070662_1003119111 | 172 |
| 410 | 3300005457 | Ga0070662_100904649 | Ga0070662_1009046492 | 172 |
| 411 | 3300005458 | Ga0070681_10154905 | Ga0070681_101549052 | 172 |
| 412 | 3300005458 | Ga0070681_11117500 | Ga0070681_111175001 | 172 |
| 413 | 3300005459 | Ga0068867_100097317 | Ga0068867_1000973172 | 172 |
| 414 | 3300005466 | Ga0070685_10234243 | Ga0070685_102342433 | 172 |
| 415 | 3300005535 | Ga0070684_100038153 | Ga0070684_1000381531 | 172 |
| 416 | 3300005535 | Ga0070684_100064760 | Ga0070684_1000647604 | 172 |
| 417 | 3300005539 | Ga0068853_100036362 | Ga0068853_1000363627 | 172 |
| 418 | 3300005539 | Ga0068853_100350530 | Ga0068853_1003505302 | 172 |
| 419 | 3300005544 | Ga0070686_100003087 | Ga0070686_1000030877 | 172 |
| 420 | 3300005544 | Ga0070686_100023278 | Ga0070686_1000232785 | 172 |
| 421 | 3300005547 | Ga0070693_100741568 | Ga0070693_1007415681 | 172 |
| 422 | 3300005548 | Ga0070665_100050095 | Ga0070665_1000500953 | 172 |
| 423 | 3300005563 | Ga0068855_100137880 | Ga0068855_1001378802 | 172 |
| 424 | 3300005564 | Ga0070664_100005782 | Ga0070664_10000578211 | 172 |
| 425 | 3300005564 | Ga0070664_100122149 | Ga0070664_1001221493 | 172 |
| 426 | 3300005577 | Ga0068857_100043928 | Ga0068857_1000439285 | 172 |
| 427 | 3300005577 | Ga0068857_100665241 | Ga0068857_1006652411 | 172 |
| 428 | 3300005578 | Ga0068854_100005064 | Ga0068854_1000050648 | 172 |
| 429 | 3300005578 | Ga0068854_100027942 | Ga0068854_1000279425 | 172 |
| 430 | 3300005578 | Ga0068854_100367903 | Ga0068854_1003679031 | 172 |
| 431 | 3300005614 | Ga0068856_100134150 | Ga0068856_1001341502 | 172 |
| 432 | 3300005614 | Ga0068856_101176883 | Ga0068856_1011768831 | 172 |
| 433 | 3300005615 | Ga0070702_100221209 | Ga0070702_1002212092 | 172 |
| 434 | 3300005616 | Ga0068852_100001481 | Ga0068852_1000014817 | 172 |
| 435 | 3300005616 | Ga0068852_100178273 | Ga0068852_1001782733 | 172 |
| 436 | 3300005617 | Ga0068859_100452801 | Ga0068859_1004528012 | 172 |
| 437 | 3300005719 | Ga0068861_100114314 | Ga0068861_1001143144 | 172 |
| 438 | 3300005719 | Ga0068861_100252695 | Ga0068861_1002526951 | 172 |
| 439 | 3300005834 | Ga0068851_10032323 | Ga0068851_100323233 | 172 |
| 440 | 3300005834 | Ga0068851_10258457 | Ga0068851_102584571 | 172 |
| 441 | 3300005842 | Ga0068858_100550975 | Ga0068858_1005509752 | 172 |
| 442 | 3300005843 | Ga0068860_100391286 | Ga0068860_1003912861 | 172 |
| 443 | 3300005937 | Ga0081455_10360929 | Ga0081455_103609292 | 172 |
| 444 | 3300006051 | Ga0075364_10009183 | Ga0075364_100091836 | 172 |
| 445 | 3300006051 | Ga0075364_10576417 | Ga0075364_105764172 | 172 |
| 446 | 3300006178 | Ga0075367_10004132 | Ga0075367_100041329 | 172 |
| 447 | 3300006195 | Ga0075366_10223734 | Ga0075366_102237342 | 172 |
| 448 | 3300006237 | Ga0097621_100002665 | Ga0097621_1000026654 | 172 |
| 449 | 3300006358 | Ga0068871_100012449 | Ga0068871_1000124497 | 172 |
| 450 | 3300006844 | Ga0075428_100165246 | Ga0075428_1001652463 | 172 |
| 451 | 3300006844 | Ga0075428_100217649 | Ga0075428_1002176492 | 172 |
| 452 | 3300006844 | Ga0075428_100658860 | Ga0075428_1006588601 | 172 |
| 453 | 3300006846 | Ga0075430_100015753 | Ga0075430_1000157536 | 172 |
| 454 | 3300006846 | Ga0075430_100018336 | Ga0075430_1000183362 | 172 |
| 455 | 3300006847 | Ga0075431_100027502 | Ga0075431_1000275025 | 172 |
| 456 | 3300006847 | Ga0075431_100055025 | Ga0075431_1000550254 | 172 |
| 457 | 3300006847 | Ga0075431_100186972 | Ga0075431_1001869722 | 172 |
| 458 | 3300006880 | Ga0075429_100085977 | Ga0075429_1000859774 | 172 |
| 459 | 3300006881 | Ga0068865_100010601 | Ga0068865_1000106016 | 172 |
| 460 | 3300006914 | Ga0075436_100150987 | Ga0075436_1001509872 | 172 |
| 461 | 3300006931 | Ga0097620_100452843 | Ga0097620_1004528432 | 172 |
| 462 | 3300007076 | Ga0075435_100001843 | Ga0075435_1000018439 | 172 |
| 463 | 3300009093 | Ga0105240_10045107 | Ga0105240_100451078 | 172 |
| 464 | 3300009094 | Ga0111539_10160097 | Ga0111539_101600973 | 172 |
| 465 | 3300009147 | Ga0114129_10014182 | Ga0114129_1001418211 | 172 |
| 466 | 3300009147 | Ga0114129_10043124 | Ga0114129_100431246 | 172 |
| 467 | 3300009148 | Ga0105243_11143717 | Ga0105243_111437171 | 172 |
| 468 | 3300009174 | Ga0105241_10080983 | Ga0105241_100809833 | 172 |
| 469 | 3300009174 | Ga0105241_10339129 | Ga0105241_103391292 | 172 |
| 470 | 3300009174 | Ga0105241_11543646 | Ga0105241_115436461 | 172 |
| 471 | 3300009176 | Ga0105242_10017172 | Ga0105242_100171722 | 172 |
| 472 | 3300009176 | Ga0105242_10450461 | Ga0105242_104504612 | 172 |
| 473 | 3300009176 | Ga0105242_11979846 | Ga0105242_119798461 | 172 |
| 474 | 3300009177 | Ga0105248_10048178 | Ga0105248_100481786 | 172 |
| 475 | 3300009177 | Ga0105248_10917763 | Ga0105248_109177632 | 172 |
| 476 | 3300009545 | Ga0105237_10731415 | Ga0105237_107314151 | 172 |
| 477 | 3300009551 | Ga0105238_10811891 | Ga0105238_108118912 | 172 |
| 478 | 3300009553 | Ga0105249_10206579 | Ga0105249_102065791 | 172 |
| 479 | 3300009553 | Ga0105249_10306666 | Ga0105249_103066663 | 172 |
| 480 | 3300009553 | Ga0105249_10574388 | Ga0105249_105743883 | 172 |
| 481 | 3300009553 | Ga0105249_10773204 | Ga0105249_107732041 | 172 |
| 482 | 3300009553 | Ga0105249_10833128 | Ga0105249_108331282 | 172 |
| 483 | 3300013100 | Ga0157373_10344323 | Ga0157373_103443231 | 172 |
| 484 | 3300013102 | Ga0157371_10043899 | Ga0157371_100438993 | 172 |
| 485 | 3300013104 | Ga0157370_10129235 | Ga0157370_101292354 | 172 |
| 486 | 3300013105 | Ga0157369_10008315 | Ga0157369_100083153 | 172 |
| 487 | 3300013296 | Ga0157374_10266973 | Ga0157374_102669732 | 172 |
| 488 | 3300013296 | Ga0157374_11712862 | Ga0157374_117128621 | 172 |
| 489 | 3300013306 | Ga0163162_10174546 | Ga0163162_101745463 | 172 |
| 490 | 3300013307 | Ga0157372_10024167 | Ga0157372_100241675 | 172 |
| 491 | 3300013308 | Ga0157375_10209067 | Ga0157375_102090673 | 172 |
| 492 | 3300014325 | Ga0163163_12084883 | Ga0163163_120848831 | 172 |
| 493 | 3300014326 | Ga0157380_10166462 | Ga0157380_101664623 | 172 |
| 494 | 3300014326 | Ga0157380_10313111 | Ga0157380_103131111 | 172 |
| 495 | 3300014326 | Ga0157380_10805201 | Ga0157380_108052012 | 172 |
| 496 | 3300014969 | Ga0157376_10043397 | Ga0157376_100433975 | 172 |
| 497 | 3300025242 | Ga0209258_100631 | Ga0209258_10063111 | 172 |
| 498 | 3300025256 | Ga0209759_1006111 | Ga0209759_10061112 | 172 |
| 499 | 3300025321 | Ga0207656_10054906 | Ga0207656_100549062 | 172 |
| 500 | 3300025909 | Ga0207705_10092716 | Ga0207705_100927162 | 172 |
| 501 | 3300025909 | Ga0207705_10135182 | Ga0207705_101351823 | 172 |
| 502 | 3300025911 | Ga0207654_10043214 | Ga0207654_100432143 | 172 |
| 503 | 3300025911 | Ga0207654_10203311 | Ga0207654_102033112 | 172 |
| 504 | 3300025911 | Ga0207654_10283671 | Ga0207654_102836712 | 172 |
| 505 | 3300025913 | Ga0207695_10192766 | Ga0207695_101927663 | 172 |
| 506 | 3300025913 | Ga0207695_10491307 | Ga0207695_104913072 | 172 |
| 507 | 3300025917 | Ga0207660_11083634 | Ga0207660_110836342 | 172 |
| 508 | 3300025919 | Ga0207657_10053263 | Ga0207657_100532632 | 172 |
| 509 | 3300025920 | Ga0207649_10010753 | Ga0207649_100107533 | 172 |
| 510 | 3300025923 | Ga0207681_10228842 | Ga0207681_102288422 | 172 |
| 511 | 3300025924 | Ga0207694_10313719 | Ga0207694_103137192 | 172 |
| 512 | 3300025925 | Ga0207650_10663817 | Ga0207650_106638172 | 172 |
| 513 | 3300025926 | Ga0207659_10095692 | Ga0207659_100956923 | 172 |
| 514 | 3300025931 | Ga0207644_10417277 | Ga0207644_104172771 | 172 |
| 515 | 3300025931 | Ga0207644_10555376 | Ga0207644_105553762 | 172 |
| 516 | 3300025932 | Ga0207690_10205205 | Ga0207690_102052052 | 172 |
| 517 | 3300025933 | Ga0207706_10278410 | Ga0207706_102784102 | 172 |
| 518 | 3300025934 | Ga0207686_10018573 | Ga0207686_100185732 | 172 |
| 519 | 3300025934 | Ga0207686_10349676 | Ga0207686_103496762 | 172 |
| 520 | 3300025936 | Ga0207670_10946004 | Ga0207670_109460041 | 172 |
| 521 | 3300025937 | Ga0207669_10120126 | Ga0207669_101201261 | 172 |
| 522 | 3300025937 | Ga0207669_10307278 | Ga0207669_103072783 | 172 |
| 523 | 3300025937 | Ga0207669_10932210 | Ga0207669_109322101 | 172 |
| 524 | 3300025938 | Ga0207704_10046862 | Ga0207704_100468623 | 172 |
| 525 | 3300025938 | Ga0207704_10314710 | Ga0207704_103147102 | 172 |
| 526 | 3300025940 | Ga0207691_10017414 | Ga0207691_100174144 | 172 |
| 527 | 3300025940 | Ga0207691_10089593 | Ga0207691_100895932 | 172 |
| 528 | 3300025940 | Ga0207691_10194631 | Ga0207691_101946313 | 172 |
| 529 | 3300025944 | Ga0207661_10007953 | Ga0207661_100079534 | 172 |
| 530 | 3300025944 | Ga0207661_10017056 | Ga0207661_100170564 | 172 |
| 531 | 3300025944 | Ga0207661_10130255 | Ga0207661_101302553 | 172 |
| 532 | 3300025945 | Ga0207679_10009078 | Ga0207679_100090784 | 172 |
| 533 | 3300025945 | Ga0207679_10867155 | Ga0207679_108671552 | 172 |
| 534 | 3300025949 | Ga0207667_10104968 | Ga0207667_101049682 | 172 |
| 535 | 3300025960 | Ga0207651_10004105 | Ga0207651_100041056 | 172 |
| 536 | 3300025960 | Ga0207651_10237405 | Ga0207651_102374052 | 172 |
| 537 | 3300025960 | Ga0207651_10368841 | Ga0207651_103688412 | 172 |
| 538 | 3300025960 | Ga0207651_11191869 | Ga0207651_111918691 | 172 |
| 539 | 3300025961 | Ga0207712_10706852 | Ga0207712_107068522 | 172 |
| 540 | 3300025972 | Ga0207668_10081807 | Ga0207668_100818075 | 172 |
| 541 | 3300025972 | Ga0207668_10119487 | Ga0207668_101194874 | 172 |
| 542 | 3300025972 | Ga0207668_11339829 | Ga0207668_113398291 | 172 |
| 543 | 3300025981 | Ga0207640_10003115 | Ga0207640_100031159 | 172 |
| 544 | 3300025981 | Ga0207640_10022032 | Ga0207640_100220323 | 172 |
| 545 | 3300026035 | Ga0207703_10471050 | Ga0207703_104710502 | 172 |
| 546 | 3300026041 | Ga0207639_10039763 | Ga0207639_100397631 | 172 |
| 547 | 3300026041 | Ga0207639_10810029 | Ga0207639_108100292 | 172 |
| 548 | 3300026041 | Ga0207639_10972755 | Ga0207639_109727551 | 172 |
| 549 | 3300026067 | Ga0207678_10321525 | Ga0207678_103215252 | 172 |
| 550 | 3300026078 | Ga0207702_10014141 | Ga0207702_100141416 | 172 |
| 551 | 3300026078 | Ga0207702_10517143 | Ga0207702_105171433 | 172 |
| 552 | 3300026088 | Ga0207641_10210268 | Ga0207641_102102682 | 172 |
| 553 | 3300026089 | Ga0207648_10134648 | Ga0207648_101346483 | 172 |
| 554 | 3300026089 | Ga0207648_10334722 | Ga0207648_103347223 | 172 |
| 555 | 3300026116 | Ga0207674_10110524 | Ga0207674_101105243 | 172 |
| 556 | 3300026116 | Ga0207674_10581078 | Ga0207674_105810781 | 172 |
| 557 | 3300026118 | Ga0207675_100068656 | Ga0207675_1000686564 | 172 |
| 558 | 3300026118 | Ga0207675_100148061 | Ga0207675_1001480612 | 172 |
| 559 | 3300026121 | Ga0207683_10194001 | Ga0207683_101940014 | 172 |
| 560 | 3300026142 | Ga0207698_10015209 | Ga0207698_100152095 | 172 |
| 561 | 3300026142 | Ga0207698_10601157 | Ga0207698_106011572 | 172 |
| 562 | 3300027614 | Ga0209970_1034295 | Ga0209970_10342952 | 172 |
| 563 | 3300031548 | Ga0307408_100020889 | Ga0307408_1000208893 | 172 |
| 564 | 3300031548 | Ga0307408_100272068 | Ga0307408_1002720683 | 172 |
| 565 | 3300031548 | Ga0307408_100408263 | Ga0307408_1004082632 | 172 |
| 566 | 3300031731 | Ga0307405_10005027 | Ga0307405_100050273 | 172 |
| 567 | 3300031731 | Ga0307405_10452828 | Ga0307405_104528282 | 172 |
| 568 | 3300031731 | Ga0307405_10491136 | Ga0307405_104911362 | 172 |
| 569 | 3300031824 | Ga0307413_10011981 | Ga0307413_100119812 | 172 |
| 570 | 3300031852 | Ga0307410_10024922 | Ga0307410_100249223 | 172 |
| 571 | 3300031852 | Ga0307410_10413844 | Ga0307410_104138442 | 172 |
| 572 | 3300031901 | Ga0307406_10052383 | Ga0307406_100523832 | 172 |
| 573 | 3300031901 | Ga0307406_10635942 | Ga0307406_106359422 | 172 |
| 574 | 3300031903 | Ga0307407_10808431 | Ga0307407_108084311 | 172 |
| 575 | 3300031995 | Ga0307409_100008422 | Ga0307409_1000084223 | 172 |
| 576 | 3300031995 | Ga0307409_100647945 | Ga0307409_1006479451 | 172 |
| 577 | 3300031995 | Ga0307409_100671789 | Ga0307409_1006717892 | 172 |
| 578 | 3300032002 | Ga0307416_100147834 | Ga0307416_1001478343 | 172 |
| 579 | 3300032002 | Ga0307416_100225204 | Ga0307416_1002252043 | 172 |
| 580 | 3300032002 | Ga0307416_101187834 | Ga0307416_1011878341 | 172 |
| 581 | 3300032002 | Ga0307416_101872987 | Ga0307416_1018729871 | 172 |
| 582 | 3300032004 | Ga0307414_10084461 | Ga0307414_100844612 | 172 |
| 583 | 3300032005 | Ga0307411_10007472 | Ga0307411_100074724 | 172 |
| 584 | 3300032005 | Ga0307411_10584850 | Ga0307411_105848502 | 172 |
| 585 | 3300032126 | Ga0307415_100114229 | Ga0307415_1001142292 | 172 |
| 586 | 3300032126 | Ga0307415_100213796 | Ga0307415_1002137962 | 172 |
| 587 | 3300032126 | Ga0307415_100540823 | Ga0307415_1005408232 | 172 |
| 588 | 3300034819 | Ga0373958_0002597 | Ga0373958_0002597_691_1215 | 172 |
| 589 | 3300034820 | Ga0373959_0007645 | Ga0373959_0007645_1043_1567 | 172 |
| 590 | 3300035085 | Ga0373929_0002645 | Ga0373929_0002645_1065_1589 | 172 |
| 591 | 3300035088 | Ga0373940_0006709 | Ga0373940_0006709_130_654 | 172 |
| 592 | 3300035090 | Ga0373949_0002564 | Ga0373949_0002564_3274_3798 | 172 |
| 593 | 3300035091 | Ga0373951_0003740 | Ga0373951_0003740_997_1521 | 172 |
| 594 | 3300035092 | Ga0373952_0015623 | Ga0373952_0015623_233_757 | 172 |
| 595 | 3300035112 | Ga0373932_0002833 | Ga0373932_0002833_3530_4054 | 172 |
| 596 | 3300035114 | Ga0373939_0000369 | Ga0373939_0000369_1156_1680 | 172 |
| 597 | 3300035115 | Ga0373941_0012802 | Ga0373941_0012802_1153_1677 | 172 |
| 598 | 3300035241 | Ga0373961_0003344 | Ga0373961_0003344_1840_2364 | 172 |
| 599 | 3300035691 | Ga0373931_0063842 | Ga0373931_0063842_234_758 | 172 |
| 600 | 3300041997 | Ga0439431_0094843 | Ga0439431_0094843_228_806 | 172 |
| 601 | 3300041999 | Ga0439433_0087482 | Ga0439433_0087482_206_730 | 172 |
| 602 | 3300042004 | Ga0439445_0122493 | Ga0439445_0122493_21_548 | 172 |
| 603 | 3300042876 | Ga0451577_0380296 | Ga0451577_0380296_101_622 | 172 |
| 604 | 3300044694 | Ga0466963_0013658 | Ga0466963_0013658_2848_3369 | 172 |
| 605 | 3300046459 | Ga0495629_0227159 | Ga0495629_0227159_427_954 | 172 |
| 606 | 3300046473 | Ga0495582_0404235 | Ga0495582_0404235_159_683 | 172 |
| 607 | 3300046492 | Ga0495585_0084919 | Ga0495585_0084919_677_1198 | 172 |
| 608 | 3300046499 | Ga0495594_0024919 | Ga0495594_0024919_2170_2691 | 172 |
| 609 | 3300046519 | Ga0495632_0000065 | Ga0495632_0000065_83285_83812 | 172 |
| 610 | 3300046526 | Ga0495666_0115171 | Ga0495666_0115171_52_573 | 172 |
| 611 | 3300046531 | Ga0495665_0199600 | Ga0495665_0199600_44_565 | 172 |
| 612 | 3300046537 | Ga0495598_0154113 | Ga0495598_0154113_229_747 | 172 |
| 613 | 3300046538 | Ga0495609_0005423 | Ga0495609_0005423_4508_5047 | 172 |
| 614 | 3300046557 | Ga0495622_0098437 | Ga0495622_0098437_804_1325 | 172 |
| 615 | 3300046558 | Ga0495633_0102139 | Ga0495633_0102139_286_804 | 172 |
| 616 | 3300046664 | Ga0495659_0103640 | Ga0495659_0103640_100_618 | 172 |
| 617 | 3300046683 | Ga0495658_0042545 | Ga0495658_0042545_745_1272 | 172 |
| 618 | 3300046684 | Ga0495669_0063817 | Ga0495669_0063817_256_774 | 172 |
| 619 | 3300046690 | Ga0495624_0426794 | Ga0495624_0426794_13_534 | 172 |
| 620 | 3300047318 | Ga0495636_0001337 | Ga0495636_0001337_6067_6627 | 172 |
| 621 | 3300047320 | Ga0495672_0000272 | Ga0495672_0000272_32747_33316 | 172 |
| 622 | 3300047443 | Ga0495687_000126 | Ga0495687_000126_75244_75783 | 172 |
| 623 | 3300048091 | Ga0495626_0001278 | Ga0495626_0001278_8124_8645 | 172 |
| 624 | 3300048903 | Ga0496100_0245396 | Ga0496100_0245396_539_1060 | 172 |
| 625 | 3300048905 | Ga0496102_1168793 | Ga0496102_1168793_148_672 | 172 |
| 626 | 3300048914 | Ga0496111_0169199 | Ga0496111_0169199_32_553 | 172 |
| 627 | 3300049515 | Ga0501292_033517 | Ga0501292_033517_50_574 | 172 |
| 628 | 3300049522 | Ga0501299_010781 | Ga0501299_010781_288_812 | 172 |
| 629 | 3300049574 | Ga0501038_0346742 | Ga0501038_0346742_476_1003 | 172 |
| 630 | 3300049577 | Ga0501041_0340215 | Ga0501041_0340215_177_704 | 172 |
| 631 | 3300049578 | Ga0501042_0061209 | Ga0501042_0061209_1740_2261 | 172 |
| 632 | 3300049578 | Ga0501042_0460714 | Ga0501042_0460714_130_654 | 172 |
| 633 | 3300049580 | Ga0501046_0405403 | Ga0501046_0405403_327_848 | 172 |
| 634 | 3300049582 | Ga0501048_0144138 | Ga0501048_0144138_794_1321 | 172 |
| 635 | 3300049587 | Ga0501071_0610224 | Ga0501071_0610224_175_693 | 172 |
| 636 | 3300049588 | Ga0501072_0433530 | Ga0501072_0433530_19_546 | 172 |
| 637 | 3300049591 | Ga0501075_0208892 | Ga0501075_0208892_424_951 | 172 |
| 638 | 3300049592 | Ga0501076_0068323 | Ga0501076_0068323_2062_2586 | 172 |
| 639 | 3300049592 | Ga0501076_0323974 | Ga0501076_0323974_212_733 | 172 |
| 640 | 3300049592 | Ga0501076_0554700 | Ga0501076_0554700_395_913 | 172 |
| 641 | 3300049668 | Ga0501233_099863 | Ga0501233_099863_202_726 | 172 |
| 642 | 3300049679 | Ga0501249_041481 | Ga0501249_041481_107_631 | 172 |
| 643 | 3300049704 | Ga0501221_020958 | Ga0501221_020958_301_825 | 172 |
| 644 | 3300049708 | Ga0501245_019463 | Ga0501245_019463_177_701 | 172 |
| 645 | 3300049741 | Ga0501079_0289560 | Ga0501079_0289560_70_600 | 172 |
| 646 | 3300049743 | Ga0501081_0123416 | Ga0501081_0123416_278_805 | 172 |
| 647 | 3300049779 | Ga0501283_002389 | Ga0501283_002389_1361_1885 | 172 |
| 648 | 3300049824 | Ga0501045_0085944 | Ga0501045_0085944_1126_1647 | 172 |
| 649 | 3300050491 | nmdc:mga00v17_14397_c1 | nmdc:mga00v17_14397_c1_3468_4007 | 172 |
| 650 | 3300050493 | nmdc:mga0k408_14304_c1 | nmdc:mga0k408_14304_c1_529_1068 | 172 |
| 651 | 3300050494 | nmdc:mga06z11_302837_c1 | nmdc:mga06z11_302837_c1_277_816 | 172 |
| 652 | 3300050507 | nmdc:mga05p37_445171_c1 | nmdc:mga05p37_445171_c1_40_567 | 172 |
| 653 | 3300050507 | nmdc:mga05p37_62226_c1 | nmdc:mga05p37_62226_c1_939_1457 | 172 |
| 654 | 3300050507 | nmdc:mga05p37_67440_c1 | nmdc:mga05p37_67440_c1_2576_3133 | 172 |
| 655 | 3300050508 | nmdc:mga09592_140920_c1 | nmdc:mga09592_140920_c1_779_1297 | 172 |
| 656 | 3300050509 | nmdc:mga0qj67_105479_c1 | nmdc:mga0qj67_105479_c1_502_1020 | 172 |
| 657 | 3300050510 | nmdc:mga06r32_120617_c1 | nmdc:mga06r32_120617_c1_173_697 | 172 |
| 658 | 3300050510 | nmdc:mga06r32_37428_c1 | nmdc:mga06r32_37428_c1_195_713 | 172 |
| 659 | 3300050510 | nmdc:mga06r32_761581_c1 | nmdc:mga06r32_761581_c1_292_816 | 172 |
| 660 | 3300050510 | nmdc:mga06r32_763540_c1 | nmdc:mga06r32_763540_c1_185_703 | 172 |
| 661 | 3300050511 | nmdc:mga08y16_627627_c1 | nmdc:mga08y16_627627_c1_398_955 | 172 |
| 662 | 3300050512 | nmdc:mga0n895_223668_c1 | nmdc:mga0n895_223668_c1_68_631 | 172 |
| 663 | 3300050514 | nmdc:mga08x19_182406_c1 | nmdc:mga08x19_182406_c1_110_628 | 172 |
| 664 | 3300054114 | Ga0501084_0110597 | Ga0501084_0110597_170_691 | 172 |
| 665 | 3300054114 | Ga0501084_0419371 | Ga0501084_0419371_544_1062 | 172 |
| 666 | 3300054114 | Ga0501084_0679944 | Ga0501084_0679944_147_671 | 172 |
| 667 | 3300059478 | Ga0587093_034489 | Ga0587093_034489_92_616 | 172 |
| 668 | 3300059492 | Ga0587073_0042039 | Ga0587073_0042039_357_881 | 172 |
| 669 | 3300059626 | Ga0587115_042911 | Ga0587115_042911_74_598 | 172 |
| 670 | 3300059655 | Ga0587114_044203 | Ga0587114_044203_95_625 | 172 |
| 671 | 3300060353 | Ga0501082_0094811 | Ga0501082_0094811_1092_1613 | 172 |
| 672 | 3300060353 | Ga0501082_0280222 | Ga0501082_0280222_444_971 | 172 |
| 673 | 3300060353 | Ga0501082_0990237 | Ga0501082_0990237_94_618 | 172 |
| 674 | 3300061734 | Ga0530510_0307814 | Ga0530510_0307814_314_832 | 172 |
| 675 | 3300002705 | JGI25156J39149_1002457 | JGI25156J39149_10024576 | 173 |
| 676 | 3300003756 | Ga0055533_1000106 | Ga0055533_100010684 | 173 |
| 677 | 3300003758 | Ga0055532_1000003 | Ga0055532_1000003115 | 173 |
| 678 | 3300003760 | Ga0055527_1000006 | Ga0055527_1000006339 | 173 |
| 679 | 3300003761 | Ga0055535_1000003 | Ga0055535_1000003115 | 173 |
| 680 | 3300003762 | Ga0055542_1000007 | Ga0055542_1000007115 | 173 |
| 681 | 3300003763 | Ga0055529_1000003 | Ga0055529_1000003339 | 173 |
| 682 | 3300005339 | Ga0070660_100014681 | Ga0070660_1000146815 | 173 |
| 683 | 3300005366 | Ga0070659_100978566 | Ga0070659_1009785661 | 173 |
| 684 | 3300005530 | Ga0070679_100126332 | Ga0070679_1001263323 | 173 |
| 685 | 3300005530 | Ga0070679_100144488 | Ga0070679_1001444883 | 173 |
| 686 | 3300005536 | Ga0070697_100475335 | Ga0070697_1004753352 | 173 |
| 687 | 3300005539 | Ga0068853_100031187 | Ga0068853_1000311872 | 173 |
| 688 | 3300005563 | Ga0068855_100862277 | Ga0068855_1008622772 | 173 |
| 689 | 3300006051 | Ga0075364_10199225 | Ga0075364_101992253 | 173 |
| 690 | 3300006175 | Ga0070712_100417814 | Ga0070712_1004178141 | 173 |
| 691 | 3300006186 | Ga0075369_10040665 | Ga0075369_100406653 | 173 |
| 692 | 3300006358 | Ga0068871_100409566 | Ga0068871_1004095662 | 173 |
| 693 | 3300009011 | Ga0105251_10014001 | Ga0105251_100140013 | 173 |
| 694 | 3300009093 | Ga0105240_10019674 | Ga0105240_100196743 | 173 |
| 695 | 3300009093 | Ga0105240_10078858 | Ga0105240_100788584 | 173 |
| 696 | 3300009545 | Ga0105237_10009973 | Ga0105237_100099738 | 173 |
| 697 | 3300013105 | Ga0157369_10337300 | Ga0157369_103373002 | 173 |
| 698 | 3300013296 | Ga0157374_10531112 | Ga0157374_105311121 | 173 |
| 699 | 3300013307 | Ga0157372_10722588 | Ga0157372_107225882 | 173 |
| 700 | 3300013308 | Ga0157375_10622696 | Ga0157375_106226962 | 173 |
| 701 | 3300013308 | Ga0157375_11581177 | Ga0157375_115811772 | 173 |
| 702 | 3300025226 | Ga0209674_100025 | Ga0209674_100025115 | 173 |
| 703 | 3300025228 | Ga0209672_100002 | Ga0209672_1000021015 | 173 |
| 704 | 3300025229 | Ga0209147_100003 | Ga0209147_1000031015 | 173 |
| 705 | 3300025230 | Ga0209563_111377 | Ga0209563_1113773 | 173 |
| 706 | 3300025242 | Ga0209258_100005 | Ga0209258_100005657 | 173 |
| 707 | 3300025253 | Ga0209677_116394 | Ga0209677_1163942 | 173 |
| 708 | 3300025254 | Ga0209148_1000006 | Ga0209148_10000061015 | 173 |
| 709 | 3300025256 | Ga0209759_1000014 | Ga0209759_1000014340 | 173 |
| 710 | 3300025256 | Ga0209759_1006576 | Ga0209759_10065764 | 173 |
| 711 | 3300025272 | Ga0209455_1000003 | Ga0209455_10000031015 | 173 |
| 712 | 3300025735 | Ga0207713_1096069 | Ga0207713_10960691 | 173 |
| 713 | 3300025912 | Ga0207707_10025774 | Ga0207707_100257746 | 173 |
| 714 | 3300025913 | Ga0207695_10045514 | Ga0207695_100455143 | 173 |
| 715 | 3300025914 | Ga0207671_10099225 | Ga0207671_100992252 | 173 |
| 716 | 3300025919 | Ga0207657_10055867 | Ga0207657_100558673 | 173 |
| 717 | 3300025921 | Ga0207652_10295542 | Ga0207652_102955421 | 173 |
| 718 | 3300025921 | Ga0207652_10711493 | Ga0207652_107114932 | 173 |
| 719 | 3300025932 | Ga0207690_10047734 | Ga0207690_100477343 | 173 |
| 720 | 3300025933 | Ga0207706_11178659 | Ga0207706_111786591 | 173 |
| 721 | 3300025986 | Ga0207658_10064416 | Ga0207658_100644164 | 173 |
| 722 | 3300026041 | Ga0207639_10032496 | Ga0207639_100324961 | 173 |
| 723 | 3300026142 | Ga0207698_10486250 | Ga0207698_104862503 | 173 |
| 724 | 3300031852 | Ga0307410_10179087 | Ga0307410_101790872 | 173 |
| 725 | 3300032005 | Ga0307411_11201590 | Ga0307411_112015901 | 173 |
| 726 | 3300037466 | Ga0395898_0001658 | Ga0395898_0001658_1428_1964 | 173 |
| 727 | 3300046457 | Ga0495590_0032781 | Ga0495590_0032781_1105_1638 | 173 |
| 728 | 3300046492 | Ga0495585_0148938 | Ga0495585_0148938_628_1152 | 173 |
| 729 | 3300046500 | Ga0495596_0096215 | Ga0495596_0096215_33_557 | 173 |
| 730 | 3300046500 | Ga0495596_0339655 | Ga0495596_0339655_21_545 | 173 |
| 731 | 3300046507 | Ga0495606_0091161 | Ga0495606_0091161_639_1163 | 173 |
| 732 | 3300046518 | Ga0495631_0004533 | Ga0495631_0004533_1735_2259 | 173 |
| 733 | 3300046519 | Ga0495632_0007394 | Ga0495632_0007394_4498_5022 | 173 |
| 734 | 3300046522 | Ga0495643_0049459 | Ga0495643_0049459_38_562 | 173 |
| 735 | 3300046522 | Ga0495643_0094119 | Ga0495643_0094119_426_950 | 173 |
| 736 | 3300046523 | Ga0495644_0162550 | Ga0495644_0162550_68_592 | 173 |
| 737 | 3300046528 | Ga0495642_0003234 | Ga0495642_0003234_2050_2574 | 173 |
| 738 | 3300046538 | Ga0495609_0003991 | Ga0495609_0003991_5718_6242 | 173 |
| 739 | 3300046542 | Ga0495597_0216174 | Ga0495597_0216174_185_709 | 173 |
| 740 | 3300046648 | Ga0495611_0002270 | Ga0495611_0002270_3248_3772 | 173 |
| 741 | 3300046648 | Ga0495611_0050329 | Ga0495611_0050329_1339_1863 | 173 |
| 742 | 3300046660 | Ga0495625_0338843 | Ga0495625_0338843_389_913 | 173 |
| 743 | 3300046665 | Ga0495661_0323104 | Ga0495661_0323104_75_599 | 173 |
| 744 | 3300046665 | Ga0495661_0330361 | Ga0495661_0330361_209_733 | 173 |
| 745 | 3300046691 | Ga0495670_0137747 | Ga0495670_0137747_259_783 | 173 |
| 746 | 3300046794 | Ga0495589_0067621 | Ga0495589_0067621_34_558 | 173 |
| 747 | 3300046794 | Ga0495589_0099556 | Ga0495589_0099556_805_1329 | 173 |
| 748 | 3300046794 | Ga0495589_0196506 | Ga0495589_0196506_133_666 | 173 |
| 749 | 3300047322 | Ga0495680_0032127 | Ga0495680_0032127_1402_1935 | 173 |
| 750 | 3300047323 | Ga0495683_0002553 | Ga0495683_0002553_1665_2189 | 173 |
| 751 | 3300047443 | Ga0495687_172039 | Ga0495687_172039_137_670 | 173 |
| 752 | 3300047445 | Ga0495677_0063317 | Ga0495677_0063317_811_1335 | 173 |
| 753 | 3300047447 | Ga0495685_194004 | Ga0495685_194004_41_565 | 173 |
| 754 | 3300047470 | Ga0495681_0033958 | Ga0495681_0033958_1493_2017 | 173 |
| 755 | 3300048904 | Ga0496101_0013740 | Ga0496101_0013740_3345_3878 | 173 |
| 756 | 3300048906 | Ga0496103_0040417 | Ga0496103_0040417_89_622 | 173 |
| 757 | 3300048911 | Ga0496108_0998013 | Ga0496108_0998013_168_701 | 173 |
| 758 | 3300048912 | Ga0496109_0975212 | Ga0496109_0975212_27_560 | 173 |
| 759 | 3300048913 | Ga0496110_0611254 | Ga0496110_0611254_353_886 | 173 |
| 760 | 3300048915 | Ga0496112_0136614 | Ga0496112_0136614_627_1160 | 173 |
| 761 | 3300048916 | Ga0496113_0092653 | Ga0496113_0092653_445_978 | 173 |
| 762 | 3300048921 | Ga0496118_0444891 | Ga0496118_0444891_91_624 | 173 |
| 763 | 3300049460 | Ga0495682_0003100 | Ga0495682_0003100_6562_7086 | 173 |
| 764 | 3300049571 | Ga0501034_1167028 | Ga0501034_1167028_20_616 | 173 |
| 765 | 3300050491 | nmdc:mga00v17_260819_c1 | nmdc:mga00v17_260819_c1_289_864 | 173 |
| 766 | 3300053088 | Ga0500644_0239339 | Ga0500644_0239339_88_621 | 173 |
| 767 | 3300059424 | Ga0590075_054046 | Ga0590075_054046_453_974 | 173 |
| 768 | 3300005327 | Ga0070658_10036995 | Ga0070658_100369953 | 174 |
| 769 | 3300005328 | Ga0070676_10712836 | Ga0070676_107128361 | 174 |
| 770 | 3300005333 | Ga0070677_10003597 | Ga0070677_100035977 | 174 |
| 771 | 3300005341 | Ga0070691_10447978 | Ga0070691_104479781 | 174 |
| 772 | 3300005353 | Ga0070669_100171445 | Ga0070669_1001714452 | 174 |
| 773 | 3300005355 | Ga0070671_100040564 | Ga0070671_1000405642 | 174 |
| 774 | 3300005356 | Ga0070674_100158544 | Ga0070674_1001585441 | 174 |
| 775 | 3300005543 | Ga0070672_100478189 | Ga0070672_1004781892 | 174 |
| 776 | 3300005578 | Ga0068854_100077457 | Ga0068854_1000774573 | 174 |
| 777 | 3300005842 | Ga0068858_101355116 | Ga0068858_1013551161 | 174 |
| 778 | 3300009551 | Ga0105238_10176551 | Ga0105238_101765512 | 174 |
| 779 | 3300010375 | Ga0105239_10572925 | Ga0105239_105729251 | 174 |
| 780 | 3300013306 | Ga0163162_10533462 | Ga0163162_105334621 | 174 |
| 781 | 3300015261 | Ga0182006_1095705 | Ga0182006_10957052 | 174 |
| 782 | 3300015265 | Ga0182005_1001056 | Ga0182005_10010562 | 174 |
| 783 | 3300020070 | Ga0206356_10294918 | Ga0206356_102949181 | 174 |
| 784 | 3300025907 | Ga0207645_10126009 | Ga0207645_101260091 | 174 |
| 785 | 3300025909 | Ga0207705_10056271 | Ga0207705_100562712 | 174 |
| 786 | 3300025916 | Ga0207663_10644323 | Ga0207663_106443231 | 174 |
| 787 | 3300025919 | Ga0207657_10086756 | Ga0207657_100867563 | 174 |
| 788 | 3300025923 | Ga0207681_10198258 | Ga0207681_101982582 | 174 |
| 789 | 3300025926 | Ga0207659_11210471 | Ga0207659_112104711 | 174 |
| 790 | 3300025931 | Ga0207644_10035242 | Ga0207644_100352423 | 174 |
| 791 | 3300025937 | Ga0207669_10102123 | Ga0207669_101021231 | 174 |
| 792 | 3300025940 | Ga0207691_10493836 | Ga0207691_104938361 | 174 |
| 793 | 3300025945 | Ga0207679_10996617 | Ga0207679_109966171 | 174 |
| 794 | 3300025986 | Ga0207658_10688639 | Ga0207658_106886392 | 174 |
| 795 | 3300027614 | Ga0209970_1063964 | Ga0209970_10639641 | 174 |
| 796 | 3300027876 | Ga0209974_10002822 | Ga0209974_100028223 | 174 |
| 797 | 3300038996 | Ga0242420_013092 | Ga0242420_013092_209_772 | 174 |
| 798 | 3300042129 | Ga0450891_009864 | Ga0450891_009864_263_787 | 174 |
| 799 | 3300042876 | Ga0451577_0269682 | Ga0451577_0269682_869_1432 | 174 |
| 800 | 3300044712 | Ga0453684_0652671 | Ga0453684_0652671_358_921 | 174 |
| 801 | 3300047315 | Ga0495581_0256804 | Ga0495581_0256804_15_560 | 174 |
| 802 | 3300048908 | Ga0496105_0499257 | Ga0496105_0499257_377_928 | 174 |
| 803 | 3300048909 | Ga0496106_0104305 | Ga0496106_0104305_894_1457 | 174 |
| 804 | 3300048910 | Ga0496107_0012066 | Ga0496107_0012066_4593_5117 | 174 |
| 805 | 3300048916 | Ga0496113_0118079 | Ga0496113_0118079_128_679 | 174 |
| 806 | 3300048919 | Ga0496116_0025686 | Ga0496116_0025686_1945_2472 | 174 |
| 807 | 3300048919 | Ga0496116_0060264 | Ga0496116_0060264_28_579 | 174 |
| 808 | 3300048919 | Ga0496116_0062618 | Ga0496116_0062618_1768_2319 | 174 |
| 809 | 3300048920 | Ga0496117_0062315 | Ga0496117_0062315_236_787 | 174 |
| 810 | 3300048921 | Ga0496118_0129227 | Ga0496118_0129227_217_768 | 174 |
| 811 | 3300048924 | Ga0496121_0092046 | Ga0496121_0092046_1106_1657 | 174 |
| 812 | 3300048927 | Ga0496124_0102662 | Ga0496124_0102662_1745_2296 | 174 |
| 813 | iso_pu_bacteria | 2928157003 | 2928161052 | 174 |
| 814 | iso_pu_bacteria | 2928163908 | 2928166008 | 174 |
| 815 | iso_pu_bacteria | 2981990288 | 2981991279 | 174 |
| 816 | 3300044684 | Ga0466966_0072692 | Ga0466966_0072692_1534_2082 | 175 |
| 817 | 3300044693 | Ga0466961_0093328 | Ga0466961_0093328_986_1534 | 175 |
| 818 | 3300044765 | Ga0466970_0036787 | Ga0466970_0036787_493_1041 | 175 |
| 819 | 3300045049 | Ga0466959_0042084 | Ga0466959_0042084_1005_1553 | 175 |
| 820 | 2162886007 | SwRhRL2b_contig_516664 | SwRhRL2b_0479.00000370 | 179 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ffe-assembly2.cif.gz_B | copm in the ag-bound form (by soaking) | 0.8641 | 26 | 172 |
| 5fej-assembly4.cif.gz_D | copm in the cu(i)-bound form | 0.8625 | 27 | 172 |
| 2qf9-assembly1.cif.gz_B | crystal structure of putative secreted protein duf305 from streptomyces coelicolor | 0.8595 | 29 | 174 |
| 3bt5-assembly1.cif.gz_A | crystal structure of duf305 fragment from deinococcus radiodurans | 0.8591 | 29 | 172 |
| 5ffb-assembly1.cif.gz_A | copm in the apo form | 0.8581 | 27 | 172 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9CA10_47_189_1.20.140.40 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein | 0.9322 | 116 | 173 | 1.20.140.40 |
| 3fseA02 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8689 | 30 | 176 | 1.20.1260.10 |
| 5fejD00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8625 | 27 | 172 | 1.20.1260.10 |
| 3bt5A00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8591 | 29 | 172 | 1.20.1260.10 |
| 5fejA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8583 | 27 | 172 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W4TGW5-F1-model_v4 | DUF4142 domain-containing protein | 1.001 | 24 | 174 |
|
| AF-A0A2C9A4E8-F1-model_v4 | deleted | 1 | 33 | 176 |
|
| AF-A0A419ZVP3-F1-model_v4 | Putative outer membrane protein | 0.9971 | 38 | 179 |
|
| AF-A0A140HLC9-F1-model_v4 | Membrane protein | 0.9915 | 22 | 174 |
|
| AF-A0A529MCR8-F1-model_v4 | DUF4142 domain-containing protein | 0.9911 | 35 | 173 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar