F482214

General Info

Members Datasets Scaffolds Average Seq Length
820 390 813 174

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_10208655|Ga0207652_102086552
Length 170
Sequence MKALVALPILLFAVAAYAQNPSDAQIAQIVVTANQVDIDAGKLAESKATSADVKAFAKQMVTDHSGVNKQATALVKKLHVKPEPSDTSKSLAQGGKDNVAKLKGMKKGPAFDKAYIDHEVDYHQAVLDAMDKTLVPSAQNAELKDLLVKVRPAFVAHLEHAKMIQSKLGK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
3 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
4 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
5 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
6 2928163908 Burkholderia sp. 567 Isolate Unclassified
7 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
14 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
21 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
140 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
145 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
155 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
207 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
223 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
224 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
225 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
226 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
227 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
228 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
229 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
230 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
231 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
232 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
233 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
237 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
238 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
239 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
242 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
243 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
244 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
245 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
246 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
247 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
248 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
249 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
250 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
251 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
252 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
253 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
254 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
255 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
256 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
257 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
258 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
259 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
260 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
261 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
264 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
265 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
266 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
267 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
268 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
269 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
270 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
271 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
272 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
273 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
274 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
275 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
276 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
277 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
278 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
279 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
280 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
281 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
282 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
283 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
284 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
285 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
286 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
287 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
288 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
289 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
290 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
291 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
292 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
293 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
294 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
295 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
296 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
297 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
298 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
299 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
300 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
301 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
302 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
303 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
304 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
305 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
306 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
307 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
308 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
311 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
312 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
323 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
324 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
325 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
328 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
331 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
332 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
333 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
348 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
349 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
350 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
351 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
352 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
353 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
354 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
355 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
356 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
357 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
361 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
362 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
363 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
365 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
366 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
367 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
368 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
369 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
370 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
371 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
372 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
373 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
374 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
375 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
376 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
377 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
378 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
379 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
380 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
381 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
382 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
383 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
384 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
389 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
390 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.2
Metatranscriptomes 1.95
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.93
Nodule 0.12
Rhizoplane 3.05
Rhizosphere 85.61
Stem 0
Stem Tuber 0
Unclassified 3.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_516664 2162886007 Bacteria 4024
2 JGI24751J29686_10019403 3300002459 Bacteria 1407
3 JGI25156J39149_1002457 3300002705 Bacteria 6632
4 Ga0007409J51694_1028918 3300003575 Bacteria 592
5 Ga0007429J51699_1119903 3300003579 Bacteria 862
6 Ga0055533_1000106 3300003756 Bacteria 104514
7 Ga0055532_1000003 3300003758 Bacteria 494004
8 Ga0055527_1000006 3300003760 Bacteria 494004
9 Ga0055535_1000003 3300003761 Bacteria 494004
10 Ga0055542_1000007 3300003762 Bacteria 494004
11 Ga0055529_1000003 3300003763 Bacteria 494004
12 Ga0058863_11561367 3300004799 Bacteria 622
13 Ga0058861_11675737 3300004800 Bacteria 777
14 Ga0058860_11905593 3300004801 Bacteria 755
15 Ga0058862_12242253 3300004803 Bacteria 791
16 Ga0065714_10287893 3300005288 Bacteria 713
17 Ga0065712_10078899 3300005290 Bacteria 3285
18 Ga0065712_10217158 3300005290 Bacteria 1053
19 Ga0065712_10580926 3300005290 Unclassified 601
20 Ga0065715_10105044 3300005293 Bacteria 2918
21 Ga0065715_10163674 3300005293 Bacteria 1605
22 Ga0065715_10190385 3300005293 Unclassified 1419
23 Ga0065715_10470402 3300005293 Bacteria 807
24 Ga0065715_10474359 3300005293 Bacteria 803
25 Ga0065715_10509730 3300005293 Unclassified 772
26 Ga0065707_10201881 3300005295 Bacteria 1245
27 Ga0070658_10023101 3300005327 Bacteria 4992
28 Ga0070658_10036995 3300005327 Bacteria 3933
29 Ga0070658_10054974 3300005327 Bacteria 3233
30 Ga0070658_10074108 3300005327 Bacteria 2792
31 Ga0070658_10345699 3300005327 Bacteria 1273
32 Ga0070676_10030962 3300005328 Bacteria 3055
33 Ga0070676_10712836 3300005328 Bacteria 734
34 Ga0070683_100002995 3300005329 Bacteria 13552
35 Ga0070683_100007080 3300005329 Bacteria 9445
36 Ga0070683_100286171 3300005329 Bacteria 1568
37 Ga0070683_101255031 3300005329 Bacteria 712
38 Ga0070690_100023960 3300005330 Bacteria 3750
39 Ga0070690_100202494 3300005330 Bacteria 1382
40 Ga0070670_100004831 3300005331 Bacteria 11325
41 Ga0070670_100098196 3300005331 Bacteria 2520
42 Ga0070670_100208226 3300005331 Bacteria 1700
43 Ga0070670_100357260 3300005331 Bacteria 1284
44 Ga0070677_10003597 3300005333 Bacteria 5002
45 Ga0068869_100078407 3300005334 Bacteria 2460
46 Ga0068869_100151345 3300005334 Bacteria 1800
47 Ga0068869_100335011 3300005334 Unclassified 1230
48 Ga0070666_10733945 3300005335 Unclassified 725
49 Ga0070680_101339058 3300005336 Bacteria 620
50 Ga0070682_100830919 3300005337 Bacteria 753
51 Ga0070682_100892267 3300005337 Bacteria 730
52 Ga0068868_101168726 3300005338 Bacteria 710
53 Ga0070660_100008509 3300005339 Bacteria 7179
54 Ga0070660_100014681 3300005339 Bacteria 5651
55 Ga0070660_100059432 3300005339 Bacteria 2964
56 Ga0070689_100110044 3300005340 Bacteria 2190
57 Ga0070691_10447978 3300005341 Bacteria 737
58 Ga0070687_100022283 3300005343 Bacteria 2993
59 Ga0070661_100024170 3300005344 Bacteria 4358
60 Ga0070661_100155730 3300005344 Bacteria 1729
61 Ga0070661_100754303 3300005344 Bacteria 796
62 Ga0070668_100422383 3300005347 Bacteria 1142
63 Ga0070668_100504047 3300005347 Bacteria 1048
64 Ga0070668_100762933 3300005347 Bacteria 857
65 Ga0070669_100007291 3300005353 Bacteria 7932
66 Ga0070669_100145704 3300005353 Bacteria 1830
67 Ga0070669_100171445 3300005353 Bacteria 1692
68 Ga0070669_100331798 3300005353 Bacteria 1230
69 Ga0070669_100343456 3300005353 Bacteria 1210
70 Ga0070675_100119522 3300005354 Bacteria 2238
71 Ga0070671_100040564 3300005355 Bacteria 3867
72 Ga0070671_100117389 3300005355 Bacteria 2237
73 Ga0070671_100161307 3300005355 Bacteria 1895
74 Ga0070671_100350494 3300005355 Bacteria 1260
75 Ga0070671_100368251 3300005355 Bacteria 1227
76 Ga0070674_100026819 3300005356 Bacteria 3768
77 Ga0070674_100158544 3300005356 Bacteria 1715
78 Ga0070674_100578428 3300005356 Bacteria 946
79 Ga0070674_100720322 3300005356 Bacteria 855
80 Ga0070674_101538553 3300005356 Bacteria 599
81 Ga0070673_100014167 3300005364 Bacteria 5542
82 Ga0070673_100037552 3300005364 Bacteria 3692
83 Ga0070673_100341194 3300005364 Bacteria 1327
84 Ga0070673_100502513 3300005364 Bacteria 1097
85 Ga0070673_100520528 3300005364 Bacteria 1078
86 Ga0070688_100061888 3300005365 Bacteria 2368
87 Ga0070659_100125467 3300005366 Bacteria 2082
88 Ga0070659_100582707 3300005366 Bacteria 960
89 Ga0070659_100978566 3300005366 Bacteria 742
90 Ga0070659_101397043 3300005366 Unclassified 622
91 Ga0070667_100252286 3300005367 Bacteria 1577
92 Ga0070713_100033336 3300005436 Bacteria 4123
93 Ga0070711_100208905 3300005439 Unclassified 1511
94 Ga0070705_100246899 3300005440 Bacteria 1251
95 Ga0070700_100093368 3300005441 Bacteria 1968
96 Ga0070700_101060162 3300005441 Bacteria 670
97 Ga0070663_100084708 3300005455 Bacteria 2337
98 Ga0070678_100021686 3300005456 Bacteria 4241
99 Ga0070678_100027183 3300005456 Bacteria 3882
100 Ga0070662_100017517 3300005457 Bacteria 4832
101 Ga0070662_100106292 3300005457 Bacteria 2131
102 Ga0070662_100311911 3300005457 Bacteria 1281
103 Ga0070662_100904649 3300005457 Unclassified 753
104 Ga0070681_10057879 3300005458 Bacteria 3856
105 Ga0070681_10154905 3300005458 Bacteria 2217
106 Ga0070681_11117500 3300005458 Bacteria 709
107 Ga0068867_100097317 3300005459 Bacteria 2242
108 Ga0068867_100525530 3300005459 Bacteria 1021
109 Ga0068867_100752114 3300005459 Bacteria 865
110 Ga0070685_10138819 3300005466 Bacteria 1528
111 Ga0070685_10234243 3300005466 Bacteria 1209
112 Ga0070706_100361743 3300005467 Bacteria 1352
113 Ga0070706_100837088 3300005467 Bacteria 851
114 Ga0070707_100791276 3300005468 Bacteria 912
115 Ga0070699_100314086 3300005518 Bacteria 1407
116 Ga0070679_100052050 3300005530 Bacteria 4079
117 Ga0070679_100126332 3300005530 Bacteria 2540
118 Ga0070679_100144488 3300005530 Unclassified 2357
119 Ga0070679_100186138 3300005530 Bacteria 2047
120 Ga0070679_100202026 3300005530 Bacteria 1953
121 Ga0070684_100038153 3300005535 Bacteria 4125
122 Ga0070684_100064760 3300005535 Bacteria 3207
123 Ga0070697_100475335 3300005536 Bacteria 1091
124 Ga0068853_100031187 3300005539 Bacteria 4508
125 Ga0068853_100036362 3300005539 Bacteria 4186
126 Ga0068853_100350530 3300005539 Unclassified 1373
127 Ga0068853_100873110 3300005539 Bacteria 863
128 Ga0070672_100044581 3300005543 Bacteria 3427
129 Ga0070672_100324184 3300005543 Bacteria 1310
130 Ga0070672_100478189 3300005543 Bacteria 1075
131 Ga0070686_100003087 3300005544 Bacteria 9124
132 Ga0070686_100023278 3300005544 Bacteria 3700
133 Ga0070686_100034885 3300005544 Bacteria 3103
134 Ga0070695_101091279 3300005545 Bacteria 653
135 Ga0070696_100029166 3300005546 Bacteria 3769
136 Ga0070693_100332079 3300005547 Bacteria 1035
137 Ga0070693_100741568 3300005547 Bacteria 723
138 Ga0070665_100050095 3300005548 Bacteria 4191
139 Ga0070665_101255524 3300005548 Bacteria 751
140 Ga0068855_100137880 3300005563 Bacteria 2783
141 Ga0068855_100808215 3300005563 Bacteria 996
142 Ga0068855_100862277 3300005563 Bacteria 959
143 Ga0070664_100005782 3300005564 Bacteria 9976
144 Ga0070664_100056589 3300005564 Bacteria 3332
145 Ga0070664_100122149 3300005564 Bacteria 2281
146 Ga0070664_100294207 3300005564 Bacteria 1466
147 Ga0070664_100800774 3300005564 Bacteria 881
148 Ga0068857_100002215 3300005577 Bacteria 15829
149 Ga0068857_100043928 3300005577 Bacteria 3963
150 Ga0068857_100665241 3300005577 Bacteria 988
151 Ga0068854_100005064 3300005578 Bacteria 8300
152 Ga0068854_100027942 3300005578 Bacteria 3893
153 Ga0068854_100077457 3300005578 Bacteria 2447
154 Ga0068854_100367903 3300005578 Bacteria 1181
155 Ga0068856_100134150 3300005614 Bacteria 2481
156 Ga0068856_101176883 3300005614 Bacteria 783
157 Ga0070702_100117250 3300005615 Bacteria 1661
158 Ga0070702_100221209 3300005615 Bacteria 1266
159 Ga0070702_101036408 3300005615 Bacteria 652
160 Ga0068852_100001481 3300005616 Bacteria 15887
161 Ga0068852_100178273 3300005616 Bacteria 1996
162 Ga0068859_100452801 3300005617 Bacteria 1380
163 Ga0068864_100205277 3300005618 Bacteria 1812
164 Ga0068861_100114314 3300005719 Unclassified 2167
165 Ga0068861_100252695 3300005719 Bacteria 1505
166 Ga0068861_100656473 3300005719 Bacteria 970
167 Ga0068861_100777290 3300005719 Unclassified 897
168 Ga0068861_101722685 3300005719 Bacteria 620
169 Ga0068851_10032323 3300005834 Bacteria 2604
170 Ga0068851_10258457 3300005834 Bacteria 990
171 Ga0068858_100550975 3300005842 Bacteria 1116
172 Ga0068858_100621392 3300005842 Bacteria 1049
173 Ga0068858_101355116 3300005842 Bacteria 701
174 Ga0068860_100391286 3300005843 Bacteria 1374
175 Ga0068860_101130975 3300005843 Bacteria 803
176 Ga0068860_101299176 3300005843 Bacteria 748
177 Ga0068862_100020071 3300005844 Bacteria 5579
178 Ga0068862_100057518 3300005844 Bacteria 3335
179 Ga0068862_100061365 3300005844 Bacteria 3231
180 Ga0081455_10222054 3300005937 Bacteria 1399
181 Ga0081455_10360929 3300005937 Unclassified 1021
182 Ga0081539_10162043 3300005985 Bacteria 1065
183 Ga0075365_10013288 3300006038 Bacteria 4915
184 Ga0075365_10044114 3300006038 Bacteria 2921
185 Ga0075365_10241143 3300006038 Bacteria 1270
186 Ga0075368_10002746 3300006042 Bacteria 5811
187 Ga0075368_10167683 3300006042 Bacteria 922
188 Ga0075363_100032003 3300006048 Bacteria 2730
189 Ga0075363_100511373 3300006048 Bacteria 714
190 Ga0075364_10002943 3300006051 Bacteria 9602
191 Ga0075364_10009183 3300006051 Bacteria 5923
192 Ga0075364_10027187 3300006051 Bacteria 3653
193 Ga0075364_10029418 3300006051 Bacteria 3523
194 Ga0075364_10055278 3300006051 Bacteria 2597
195 Ga0075364_10199225 3300006051 Bacteria 1357
196 Ga0075364_10366090 3300006051 Bacteria 983
197 Ga0075364_10576417 3300006051 Bacteria 769
198 Ga0070712_100417814 3300006175 Bacteria 1111
199 Ga0075367_10004132 3300006178 Bacteria 7038
200 Ga0075367_10070238 3300006178 Bacteria 2104
201 Ga0075367_10098453 3300006178 Unclassified 1785
202 Ga0075367_10099391 3300006178 Bacteria 1777
203 Ga0075367_10232976 3300006178 Bacteria 1153
204 Ga0075369_10040665 3300006186 Bacteria 1988
205 Ga0075366_10005318 3300006195 Bacteria 6975
206 Ga0075366_10010729 3300006195 Bacteria 5151
207 Ga0075366_10223734 3300006195 Bacteria 1147
208 Ga0097621_100002665 3300006237 Bacteria 12215
209 Ga0075370_10016416 3300006353 Unclassified 3984
210 Ga0075370_10159966 3300006353 Bacteria 1321
211 Ga0068871_100012449 3300006358 Bacteria 6272
212 Ga0068871_100409566 3300006358 Bacteria 1209
213 Ga0068871_100642314 3300006358 Unclassified 968
214 Ga0075428_100165246 3300006844 Bacteria 2401
215 Ga0075428_100217649 3300006844 Bacteria 2063
216 Ga0075428_100658860 3300006844 Bacteria 1116
217 Ga0075430_100014465 3300006846 Bacteria 6722
218 Ga0075430_100015753 3300006846 Bacteria 6439
219 Ga0075430_100018336 3300006846 Bacteria 5957
220 Ga0075430_100055726 3300006846 Unclassified 3324
221 Ga0075431_100027502 3300006847 Bacteria 5837
222 Ga0075431_100055025 3300006847 Bacteria 4104
223 Ga0075431_100186972 3300006847 Bacteria 2124
224 Ga0075433_10335726 3300006852 Unclassified 1336
225 Ga0075434_100255521 3300006871 Bacteria 1771
226 Ga0075429_100085977 3300006880 Bacteria 2741
227 Ga0075429_100389083 3300006880 Bacteria 1221
228 Ga0075429_100828579 3300006880 Bacteria 810
229 Ga0068865_100010601 3300006881 Bacteria 5744
230 Ga0068865_100253843 3300006881 Bacteria 1389
231 Ga0075436_100150987 3300006914 Bacteria 1635
232 Ga0097620_100452843 3300006931 Bacteria 1380
233 Ga0097620_100660550 3300006931 Bacteria 1137
234 Ga0075435_100001843 3300007076 Bacteria 13754
235 Ga0105251_10014001 3300009011 Bacteria 4455
236 Ga0105240_10005746 3300009093 Bacteria 18400
237 Ga0105240_10019674 3300009093 Bacteria 9017
238 Ga0105240_10045107 3300009093 Bacteria 5595
239 Ga0105240_10078858 3300009093 Bacteria 4054
240 Ga0105240_10256088 3300009093 Bacteria 2021
241 Ga0105240_10298775 3300009093 Unclassified 1842
242 Ga0105240_10563346 3300009093 Bacteria 1259
243 Ga0111539_10025634 3300009094 Bacteria 7226
244 Ga0111539_10039209 3300009094 Bacteria 5711
245 Ga0111539_10045673 3300009094 Bacteria 5243
246 Ga0111539_10160097 3300009094 Bacteria 2633
247 Ga0111539_10831036 3300009094 Bacteria 1075
248 Ga0111539_11808429 3300009094 Bacteria 708
249 Ga0105245_10003049 3300009098 Bacteria 14991
250 Ga0105245_11972124 3300009098 Bacteria 637
251 Ga0114129_10002414 3300009147 Bacteria 25954
252 Ga0114129_10014182 3300009147 Bacteria 11356
253 Ga0114129_10043124 3300009147 Bacteria 6349
254 Ga0114129_10134488 3300009147 Bacteria 3393
255 Ga0114129_11567233 3300009147 Bacteria 807
256 Ga0114129_12726960 3300009147 Bacteria 588
257 Ga0105243_11143717 3300009148 Unclassified 789
258 Ga0105241_10080983 3300009174 Bacteria 2543
259 Ga0105241_10339129 3300009174 Bacteria 1302
260 Ga0105241_11543646 3300009174 Bacteria 640
261 Ga0105242_10017172 3300009176 Bacteria 5635
262 Ga0105242_10100004 3300009176 Bacteria 2455
263 Ga0105242_10450461 3300009176 Bacteria 1213
264 Ga0105242_11979846 3300009176 Bacteria 624
265 Ga0105248_10032778 3300009177 Bacteria 5804
266 Ga0105248_10048178 3300009177 Bacteria 4780
267 Ga0105248_10917763 3300009177 Bacteria 989
268 Ga0105237_10006745 3300009545 Bacteria 12679
269 Ga0105237_10009973 3300009545 Bacteria 10135
270 Ga0105237_10490361 3300009545 Unclassified 1235
271 Ga0105237_10539253 3300009545 Unclassified 1173
272 Ga0105237_10731415 3300009545 Bacteria 996
273 Ga0105238_10114637 3300009551 Bacteria 2674
274 Ga0105238_10176551 3300009551 Bacteria 2113
275 Ga0105238_10465376 3300009551 Bacteria 1262
276 Ga0105238_10811891 3300009551 Bacteria 951
277 Ga0105249_10158901 3300009553 Bacteria 2183
278 Ga0105249_10206579 3300009553 Bacteria 1925
279 Ga0105249_10306666 3300009553 Bacteria 1594
280 Ga0105249_10574388 3300009553 Bacteria 1180
281 Ga0105249_10773204 3300009553 Bacteria 1023
282 Ga0105249_10833128 3300009553 Unclassified 987
283 Ga0105249_11797861 3300009553 Unclassified 685
284 Ga0105239_10572925 3300010375 Bacteria 1287
285 Ga0105246_10240183 3300011119 Bacteria 1432
286 Ga0105246_10762132 3300011119 Bacteria 855
287 Ga0157373_10344323 3300013100 Bacteria 1063
288 Ga0157371_10043899 3300013102 Bacteria 3183
289 Ga0157370_10129235 3300013104 Bacteria 2357
290 Ga0157369_10008315 3300013105 Bacteria 11894
291 Ga0157369_10337300 3300013105 Bacteria 1566
292 Ga0157374_10266973 3300013296 Bacteria 1687
293 Ga0157374_10459611 3300013296 Bacteria 1275
294 Ga0157374_10531112 3300013296 Bacteria 1183
295 Ga0157374_10723451 3300013296 Bacteria 1009
296 Ga0157374_10767157 3300013296 Bacteria 979
297 Ga0157374_11712862 3300013296 Unclassified 653
298 Ga0157374_11844519 3300013296 Bacteria 630
299 Ga0157378_11418981 3300013297 Bacteria 737
300 Ga0163162_10048904 3300013306 Bacteria 4238
301 Ga0163162_10174546 3300013306 Bacteria 2274
302 Ga0163162_10381400 3300013306 Bacteria 1543
303 Ga0163162_10470494 3300013306 Bacteria 1388
304 Ga0163162_10533462 3300013306 Bacteria 1303
305 Ga0157372_10024167 3300013307 Bacteria 6595
306 Ga0157372_10099075 3300013307 Bacteria 3325
307 Ga0157372_10244328 3300013307 Bacteria 2083
308 Ga0157372_10722588 3300013307 Unclassified 1158
309 Ga0157375_10002486 3300013308 Bacteria 15969
310 Ga0157375_10033211 3300013308 Bacteria 4901
311 Ga0157375_10049471 3300013308 Bacteria 4119
312 Ga0157375_10209067 3300013308 Bacteria 2108
313 Ga0157375_10622696 3300013308 Bacteria 1237
314 Ga0157375_11581177 3300013308 Bacteria 775
315 Ga0163163_10060850 3300014325 Bacteria 3740
316 Ga0163163_10105277 3300014325 Bacteria 2847
317 Ga0163163_10393513 3300014325 Bacteria 1444
318 Ga0163163_12084883 3300014325 Bacteria 627
319 Ga0157380_10166462 3300014326 Bacteria 1922
320 Ga0157380_10281747 3300014326 Bacteria 1521
321 Ga0157380_10313111 3300014326 Bacteria 1452
322 Ga0157380_10714141 3300014326 Bacteria 1009
323 Ga0157380_10805201 3300014326 Bacteria 957
324 Ga0157377_10466724 3300014745 Bacteria 875
325 Ga0157377_10692460 3300014745 Bacteria 739
326 Ga0157379_10018611 3300014968 Bacteria 6124
327 Ga0157379_10585193 3300014968 Bacteria 1041
328 Ga0157376_10043397 3300014969 Bacteria 3691
329 Ga0182006_1095705 3300015261 Bacteria 1061
330 Ga0182005_1001056 3300015265 Bacteria 11661
331 Ga0163161_10781835 3300017792 Bacteria 801
332 Ga0197907_11031442 3300020069 Bacteria 2281
333 Ga0206356_10294918 3300020070 Bacteria 648
334 Ga0206356_11608615 3300020070 Bacteria 776
335 Ga0206355_1488022 3300020076 Bacteria 1457
336 Ga0206353_10654570 3300020082 Bacteria 756
337 Ga0224712_10157125 3300022467 Bacteria 1012
338 Ga0209674_100025 3300025226 Bacteria 515942
339 Ga0209672_100002 3300025228 Bacteria 1733325
340 Ga0209147_100003 3300025229 Bacteria 1733325
341 Ga0209563_111377 3300025230 Bacteria 1257
342 Ga0209258_100005 3300025242 Bacteria 1087938
343 Ga0209258_100631 3300025242 Bacteria 27852
344 Ga0209677_116394 3300025253 Bacteria 950
345 Ga0209148_1000006 3300025254 Bacteria 1733325
346 Ga0209759_1000014 3300025256 Bacteria 396291
347 Ga0209759_1006111 3300025256 Bacteria 4099
348 Ga0209759_1006576 3300025256 Bacteria 3882
349 Ga0209455_1000003 3300025272 Bacteria 1471893
350 Ga0207697_10138571 3300025315 Bacteria 1054
351 Ga0207656_10054906 3300025321 Bacteria 1733
352 Ga0207713_1096069 3300025735 Bacteria 1032
353 Ga0207645_10032291 3300025907 Bacteria 3365
354 Ga0207645_10126009 3300025907 Bacteria 1665
355 Ga0207705_10018268 3300025909 Bacteria 5014
356 Ga0207705_10056271 3300025909 Bacteria 2835
357 Ga0207705_10092716 3300025909 Bacteria 2213
358 Ga0207705_10135182 3300025909 Bacteria 1837
359 Ga0207654_10043214 3300025911 Bacteria 2554
360 Ga0207654_10203311 3300025911 Bacteria 1305
361 Ga0207654_10283671 3300025911 Bacteria 1121
362 Ga0207707_10025774 3300025912 Bacteria 5142
363 Ga0207695_10020911 3300025913 Bacteria 7479
364 Ga0207695_10045514 3300025913 Bacteria 4657
365 Ga0207695_10192766 3300025913 Bacteria 1955
366 Ga0207695_10199383 3300025913 Bacteria 1916
367 Ga0207695_10491307 3300025913 Bacteria 1109
368 Ga0207695_10714125 3300025913 Bacteria 883
369 Ga0207671_10021594 3300025914 Bacteria 4879
370 Ga0207671_10099225 3300025914 Unclassified 2204
371 Ga0207663_10213260 3300025916 Unclassified 1401
372 Ga0207663_10644323 3300025916 Bacteria 836
373 Ga0207660_11083634 3300025917 Bacteria 653
374 Ga0207662_10059311 3300025918 Bacteria 2293
375 Ga0207657_10053263 3300025919 Bacteria 3506
376 Ga0207657_10055867 3300025919 Bacteria 3408
377 Ga0207657_10086756 3300025919 Bacteria 2619
378 Ga0207649_10010753 3300025920 Bacteria 5032
379 Ga0207649_10485501 3300025920 Bacteria 937
380 Ga0207652_10132486 3300025921 Bacteria 2224
381 Ga0207652_10208655 3300025921 Bacteria 1759
382 Ga0207652_10295542 3300025921 Bacteria 1462
383 Ga0207652_10711493 3300025921 Bacteria 896
384 Ga0207681_10198258 3300025923 Bacteria 1540
385 Ga0207681_10228842 3300025923 Bacteria 1442
386 Ga0207681_10315964 3300025923 Bacteria 1240
387 Ga0207694_10246950 3300025924 Bacteria 1460
388 Ga0207694_10313719 3300025924 Bacteria 1293
389 Ga0207650_10072245 3300025925 Bacteria 2597
390 Ga0207650_10166185 3300025925 Bacteria 1751
391 Ga0207650_10207040 3300025925 Bacteria 1574
392 Ga0207650_10223967 3300025925 Bacteria 1515
393 Ga0207650_10274785 3300025925 Bacteria 1370
394 Ga0207650_10663817 3300025925 Bacteria 879
395 Ga0207659_10095692 3300025926 Bacteria 2228
396 Ga0207659_11210471 3300025926 Bacteria 649
397 Ga0207644_10035242 3300025931 Bacteria 3505
398 Ga0207644_10417277 3300025931 Bacteria 1099
399 Ga0207644_10555376 3300025931 Unclassified 951
400 Ga0207644_10713356 3300025931 Bacteria 837
401 Ga0207690_10047734 3300025932 Bacteria 2843
402 Ga0207690_10205205 3300025932 Bacteria 1499
403 Ga0207706_10278410 3300025933 Bacteria 1459
404 Ga0207706_11178659 3300025933 Bacteria 637
405 Ga0207706_11201053 3300025933 Bacteria 630
406 Ga0207686_10018573 3300025934 Bacteria 3939
407 Ga0207686_10349676 3300025934 Bacteria 1112
408 Ga0207670_10537145 3300025936 Bacteria 954
409 Ga0207670_10946004 3300025936 Unclassified 723
410 Ga0207669_10102123 3300025937 Bacteria 1899
411 Ga0207669_10120126 3300025937 Bacteria 1782
412 Ga0207669_10307278 3300025937 Bacteria 1208
413 Ga0207669_10932210 3300025937 Unclassified 727
414 Ga0207704_10046862 3300025938 Bacteria 2579
415 Ga0207704_10133108 3300025938 Bacteria 1726
416 Ga0207704_10187161 3300025938 Bacteria 1502
417 Ga0207704_10314710 3300025938 Bacteria 1205
418 Ga0207691_10017414 3300025940 Bacteria 6815
419 Ga0207691_10038054 3300025940 Bacteria 4451
420 Ga0207691_10045824 3300025940 Bacteria 4019
421 Ga0207691_10089593 3300025940 Bacteria 2759
422 Ga0207691_10194631 3300025940 Bacteria 1767
423 Ga0207691_10493836 3300025940 Bacteria 1040
424 Ga0207689_10232670 3300025942 Bacteria 1523
425 Ga0207689_10407221 3300025942 Bacteria 1134
426 Ga0207661_10007953 3300025944 Bacteria 7559
427 Ga0207661_10017056 3300025944 Bacteria 5365
428 Ga0207661_10130255 3300025944 Bacteria 2154
429 Ga0207661_11019596 3300025944 Bacteria 762
430 Ga0207679_10009078 3300025945 Bacteria 6353
431 Ga0207679_10273812 3300025945 Bacteria 1445
432 Ga0207679_10867155 3300025945 Bacteria 825
433 Ga0207679_10996617 3300025945 Bacteria 768
434 Ga0207667_10104968 3300025949 Bacteria 2915
435 Ga0207667_10816324 3300025949 Bacteria 928
436 Ga0207667_11153530 3300025949 Bacteria 756
437 Ga0207651_10004105 3300025960 Bacteria 7268
438 Ga0207651_10014615 3300025960 Bacteria 4539
439 Ga0207651_10237405 3300025960 Bacteria 1484
440 Ga0207651_10368841 3300025960 Bacteria 1214
441 Ga0207651_11191869 3300025960 Bacteria 684
442 Ga0207712_10706852 3300025961 Bacteria 880
443 Ga0207668_10081807 3300025972 Bacteria 2344
444 Ga0207668_10119487 3300025972 Bacteria 1993
445 Ga0207668_11154091 3300025972 Unclassified 695
446 Ga0207668_11339829 3300025972 Bacteria 645
447 Ga0207640_10003115 3300025981 Bacteria 8917
448 Ga0207640_10022032 3300025981 Bacteria 3807
449 Ga0207658_10064416 3300025986 Bacteria 2750
450 Ga0207658_10688639 3300025986 Bacteria 923
451 Ga0207658_10776628 3300025986 Bacteria 869
452 Ga0207658_11639006 3300025986 Bacteria 588
453 Ga0207703_10471050 3300026035 Bacteria 1176
454 Ga0207703_10477822 3300026035 Bacteria 1167
455 Ga0207639_10032496 3300026041 Bacteria 3841
456 Ga0207639_10039763 3300026041 Bacteria 3506
457 Ga0207639_10184021 3300026041 Bacteria 1779
458 Ga0207639_10810029 3300026041 Unclassified 873
459 Ga0207639_10972755 3300026041 Bacteria 794
460 Ga0207678_10024600 3300026067 Bacteria 5260
461 Ga0207678_10321525 3300026067 Bacteria 1331
462 Ga0207708_10663260 3300026075 Bacteria 889
463 Ga0207702_10014141 3300026078 Bacteria 6629
464 Ga0207702_10517143 3300026078 Bacteria 1165
465 Ga0207641_10210268 3300026088 Bacteria 1799
466 Ga0207648_10134648 3300026089 Bacteria 2176
467 Ga0207648_10253293 3300026089 Bacteria 1570
468 Ga0207648_10334722 3300026089 Bacteria 1362
469 Ga0207676_10114990 3300026095 Bacteria 2258
470 Ga0207676_10194780 3300026095 Bacteria 1786
471 Ga0207676_10888522 3300026095 Bacteria 873
472 Ga0207676_11198811 3300026095 Bacteria 752
473 Ga0207674_10020350 3300026116 Bacteria 7169
474 Ga0207674_10110524 3300026116 Bacteria 2724
475 Ga0207674_10405294 3300026116 Bacteria 1318
476 Ga0207674_10581078 3300026116 Bacteria 1082
477 Ga0207675_100068656 3300026118 Bacteria 3312
478 Ga0207675_100088650 3300026118 Bacteria 2906
479 Ga0207675_100088851 3300026118 Bacteria 2903
480 Ga0207675_100148061 3300026118 Unclassified 2233
481 Ga0207675_100156440 3300026118 Bacteria 2172
482 Ga0207675_100310536 3300026118 Bacteria 1538
483 Ga0207683_10005995 3300026121 Bacteria 10410
484 Ga0207683_10029686 3300026121 Bacteria 4735
485 Ga0207683_10194001 3300026121 Bacteria 1845
486 Ga0207698_10015209 3300026142 Bacteria 5148
487 Ga0207698_10486250 3300026142 Bacteria 1198
488 Ga0207698_10601157 3300026142 Bacteria 1084
489 Ga0209970_1034295 3300027614 Bacteria 890
490 Ga0209970_1063964 3300027614 Bacteria 678
491 Ga0209971_1119195 3300027682 Bacteria 649
492 Ga0209813_10021605 3300027866 Bacteria 1811
493 Ga0209813_10145314 3300027866 Bacteria 845
494 Ga0209974_10002822 3300027876 Bacteria 6307
495 Ga0207428_10012636 3300027907 Bacteria 7407
496 Ga0207428_10016644 3300027907 Bacteria 6323
497 Ga0207428_10087984 3300027907 Bacteria 2416
498 Ga0268265_10013423 3300028380 Bacteria 5566
499 Ga0268265_10132512 3300028380 Bacteria 2074
500 Ga0268265_10280602 3300028380 Bacteria 1490
501 Ga0268265_10833644 3300028380 Bacteria 901
502 Ga0268265_10847670 3300028380 Bacteria 894
503 Ga0268265_10857834 3300028380 Bacteria 889
504 Ga0268265_10917574 3300028380 Bacteria 861
505 Ga0268264_11236592 3300028381 Bacteria 757
506 Ga0268264_11391180 3300028381 Bacteria 712
507 Ga0307408_100020889 3300031548 Bacteria 4424
508 Ga0307408_100059723 3300031548 Bacteria 2776
509 Ga0307408_100272068 3300031548 Bacteria 1407
510 Ga0307408_100408263 3300031548 Bacteria 1168
511 Ga0307405_10005027 3300031731 Bacteria 6327
512 Ga0307405_10198294 3300031731 Bacteria 1456
513 Ga0307405_10370193 3300031731 Bacteria 1112
514 Ga0307405_10452828 3300031731 Bacteria 1018
515 Ga0307405_10491136 3300031731 Bacteria 982
516 Ga0307413_10011981 3300031824 Bacteria 4294
517 Ga0307413_10243129 3300031824 Bacteria 1330
518 Ga0307410_10024922 3300031852 Bacteria 3744
519 Ga0307410_10054566 3300031852 Bacteria 2710
520 Ga0307410_10073288 3300031852 Bacteria 2381
521 Ga0307410_10179087 3300031852 Bacteria 1604
522 Ga0307410_10400853 3300031852 Bacteria 1108
523 Ga0307410_10413844 3300031852 Bacteria 1092
524 Ga0307410_11389530 3300031852 Bacteria 616
525 Ga0307406_10052383 3300031901 Bacteria 2595
526 Ga0307406_10303290 3300031901 Bacteria 1228
527 Ga0307406_10635942 3300031901 Bacteria 884
528 Ga0307407_10808431 3300031903 Bacteria 714
529 Ga0307407_10865394 3300031903 Bacteria 691
530 Ga0307407_11224057 3300031903 Bacteria 587
531 Ga0307412_10218921 3300031911 Bacteria 1458
532 Ga0307412_11323303 3300031911 Bacteria 649
533 Ga0307409_100006003 3300031995 Bacteria 7081
534 Ga0307409_100008422 3300031995 Bacteria 6257
535 Ga0307409_100535134 3300031995 Bacteria 1147
536 Ga0307409_100647945 3300031995 Bacteria 1050
537 Ga0307409_100671789 3300031995 Bacteria 1032
538 Ga0307416_100147834 3300032002 Bacteria 2149
539 Ga0307416_100225204 3300032002 Bacteria 1802
540 Ga0307416_101187834 3300032002 Bacteria 868
541 Ga0307416_101872987 3300032002 Bacteria 703
542 Ga0307416_102248252 3300032002 Bacteria 646
543 Ga0307416_102386864 3300032002 Bacteria 628
544 Ga0307414_10084461 3300032004 Bacteria 2335
545 Ga0307411_10007472 3300032005 Bacteria 5571
546 Ga0307411_10530180 3300032005 Bacteria 1001
547 Ga0307411_10584850 3300032005 Bacteria 958
548 Ga0307411_11201590 3300032005 Bacteria 687
549 Ga0307415_100058848 3300032126 Bacteria 2647
550 Ga0307415_100114229 3300032126 Bacteria 2010
551 Ga0307415_100213796 3300032126 Bacteria 1540
552 Ga0307415_100540823 3300032126 Bacteria 1026
553 Ga0373958_0002597 3300034819 Bacteria 2544
554 Ga0373959_0007645 3300034820 Bacteria 1821
555 Ga0373929_0002645 3300035085 Bacteria 3281
556 Ga0373940_0006709 3300035088 Bacteria 2568
557 Ga0373949_0002564 3300035090 Bacteria 4620
558 Ga0373951_0003740 3300035091 Bacteria 3670
559 Ga0373952_0015623 3300035092 Bacteria 1534
560 Ga0373932_0002833 3300035112 Bacteria 4291
561 Ga0373939_0000369 3300035114 Bacteria 11356
562 Ga0373941_0012802 3300035115 Bacteria 2202
563 Ga0373961_0003344 3300035241 Bacteria 3987
564 Ga0373931_0063842 3300035691 Bacteria 1991
565 Ga0373925_0512489 3300037068 Bacteria 985
566 Ga0395899_0005318 3300037312 Bacteria 9994
567 Ga0395900_0011357 3300037418 Bacteria 9111
568 Ga0395898_0001658 3300037466 Bacteria 29919
569 Ga0395898_0016961 3300037466 Bacteria 7436
570 Ga0395905_0000221 3300037471 Bacteria 87203
571 Ga0395901_0101906 3300038443 Bacteria 3012
572 Ga0395901_0307725 3300038443 Bacteria 1642
573 Ga0242420_013092 3300038996 Bacteria 1410
574 Ga0436365_0814888 3300039437 Bacteria 602
575 Ga0436365_1297870 3300039437 Bacteria 1471
576 Ga0451793_0826448 3300041452 Bacteria 787
577 Ga0451807_2240801 3300041486 Bacteria 600
578 Ga0451849_0527925 3300041505 Bacteria 630
579 Ga0451853_0638581 3300041512 Bacteria 895
580 Ga0439431_0094843 3300041997 Bacteria 816
581 Ga0439433_0087482 3300041999 Bacteria 763
582 Ga0439445_0122493 3300042004 Bacteria 747
583 Ga0450922_012407 3300042124 Bacteria 827
584 Ga0450923_030540 3300042125 Bacteria 1096
585 Ga0450891_009864 3300042129 Bacteria 880
586 Ga0439435_0114416 3300042436 Bacteria 840
587 Ga0439460_0061302 3300042461 Bacteria 1148
588 Ga0451577_0269682 3300042876 Bacteria 1541
589 Ga0451577_0380296 3300042876 Bacteria 1281
590 Ga0466966_0072692 3300044684 Bacteria 2152
591 Ga0466961_0093328 3300044693 Bacteria 1899
592 Ga0466963_0013658 3300044694 Bacteria 4993
593 Ga0453684_0652671 3300044712 Bacteria 1148
594 Ga0466970_0036787 3300044765 Bacteria 2594
595 Ga0466960_0008243 3300044901 Bacteria 4262
596 Ga0466960_0150279 3300044901 Bacteria 1244
597 Ga0466959_0042084 3300045049 Bacteria 3370
598 Ga0466959_0415522 3300045049 Bacteria 913
599 Ga0495590_0032781 3300046457 Bacteria 1817
600 Ga0495629_0227159 3300046459 Bacteria 1287
601 Ga0495629_0298426 3300046459 Bacteria 1104
602 Ga0495638_0139239 3300046460 Bacteria 1418
603 Ga0495582_0404235 3300046473 Bacteria 788
604 Ga0495584_0005887 3300046491 Bacteria 6461
605 Ga0495585_0084919 3300046492 Bacteria 1711
606 Ga0495585_0148938 3300046492 Bacteria 1221
607 Ga0495594_0024919 3300046499 Bacteria 3214
608 Ga0495596_0096215 3300046500 Bacteria 1149
609 Ga0495596_0339655 3300046500 Bacteria 584
610 Ga0495583_0117600 3300046506 Bacteria 1121
611 Ga0495606_0091161 3300046507 Bacteria 1874
612 Ga0495616_0005117 3300046513 Bacteria 8147
613 Ga0495631_0004533 3300046518 Bacteria 7378
614 Ga0495632_0000065 3300046519 Bacteria 116086
615 Ga0495632_0007394 3300046519 Bacteria 6905
616 Ga0495643_0049459 3300046522 Bacteria 2267
617 Ga0495643_0074698 3300046522 Bacteria 1775
618 Ga0495643_0094119 3300046522 Unclassified 1542
619 Ga0495644_0162550 3300046523 Bacteria 856
620 Ga0495666_0115171 3300046526 Bacteria 1261
621 Ga0495642_0003234 3300046528 Bacteria 6458
622 Ga0495665_0199600 3300046531 Bacteria 1037
623 Ga0495598_0154113 3300046537 Bacteria 804
624 Ga0495609_0003991 3300046538 Bacteria 8240
625 Ga0495609_0005423 3300046538 Bacteria 6707
626 Ga0495597_0216174 3300046542 Bacteria 762
627 Ga0495622_0098437 3300046557 Bacteria 1341
628 Ga0495633_0102139 3300046558 Bacteria 1331
629 Ga0495668_0000368 3300046616 Bacteria 59517
630 Ga0495611_0002270 3300046648 Bacteria 8907
631 Ga0495611_0050329 3300046648 Bacteria 1876
632 Ga0495625_0215706 3300046660 Bacteria 1259
633 Ga0495625_0338843 3300046660 Unclassified 953
634 Ga0495659_0103640 3300046664 Bacteria 1104
635 Ga0495661_0035672 3300046665 Bacteria 3118
636 Ga0495661_0323104 3300046665 Bacteria 766
637 Ga0495661_0330361 3300046665 Bacteria 755
638 Ga0495657_0398064 3300046675 Bacteria 811
639 Ga0495658_0042545 3300046683 Bacteria 2537
640 Ga0495669_0000453 3300046684 Bacteria 19290
641 Ga0495669_0063817 3300046684 Bacteria 1671
642 Ga0495624_0426794 3300046690 Bacteria 795
643 Ga0495670_0137747 3300046691 Bacteria 1275
644 Ga0495649_0011217 3300046694 Bacteria 5267
645 Ga0495589_0067621 3300046794 Bacteria 1748
646 Ga0495589_0099556 3300046794 Bacteria 1407
647 Ga0495589_0196506 3300046794 Bacteria 953
648 Ga0495581_0256804 3300047315 Bacteria 1022
649 Ga0495636_0001337 3300047318 Bacteria 9361
650 Ga0495636_0004548 3300047318 Bacteria 5434
651 Ga0495672_0000272 3300047320 Bacteria 71551
652 Ga0495680_0032127 3300047322 Bacteria 4265
653 Ga0495683_0002553 3300047323 Bacteria 10938
654 Ga0495687_000126 3300047443 Bacteria 117879
655 Ga0495687_097271 3300047443 Bacteria 1112
656 Ga0495687_172039 3300047443 Bacteria 716
657 Ga0495677_0006066 3300047445 Bacteria 4569
658 Ga0495677_0063317 3300047445 Bacteria 1373
659 Ga0495685_194004 3300047447 Bacteria 652
660 Ga0495681_0033958 3300047470 Bacteria 2547
661 Ga0495686_0008011 3300047472 Bacteria 7832
662 Ga0495626_0001278 3300048091 Bacteria 20542
663 Ga0496100_0245396 3300048903 Bacteria 1323
664 Ga0496100_0863651 3300048903 Unclassified 710
665 Ga0496101_0013740 3300048904 Bacteria 5431
666 Ga0496102_0144723 3300048905 Bacteria 2230
667 Ga0496102_1168793 3300048905 Bacteria 689
668 Ga0496103_0040417 3300048906 Bacteria 2866
669 Ga0496104_0058526 3300048907 Bacteria 3648
670 Ga0496105_0499257 3300048908 Bacteria 955
671 Ga0496106_0104305 3300048909 Bacteria 2202
672 Ga0496107_0012066 3300048910 Bacteria 6026
673 Ga0496107_0455754 3300048910 Bacteria 950
674 Ga0496108_0998013 3300048911 Bacteria 715
675 Ga0496109_0975212 3300048912 Bacteria 785
676 Ga0496109_1214066 3300048912 Bacteria 691
677 Ga0496110_0115394 3300048913 Bacteria 2417
678 Ga0496110_0364870 3300048913 Bacteria 1316
679 Ga0496110_0611254 3300048913 Bacteria 988
680 Ga0496111_0169199 3300048914 Bacteria 1624
681 Ga0496111_0202054 3300048914 Bacteria 1477
682 Ga0496112_0061534 3300048915 Bacteria 3701
683 Ga0496112_0136614 3300048915 Bacteria 2421
684 Ga0496113_0092653 3300048916 Bacteria 2331
685 Ga0496113_0118079 3300048916 Bacteria 2071
686 Ga0496116_0025686 3300048919 Bacteria 4325
687 Ga0496116_0060264 3300048919 Bacteria 2462
688 Ga0496116_0062618 3300048919 Bacteria 2401
689 Ga0496117_0062315 3300048920 Bacteria 2556
690 Ga0496117_0178364 3300048920 Bacteria 1224
691 Ga0496118_0022238 3300048921 Bacteria 5552
692 Ga0496118_0129227 3300048921 Bacteria 1626
693 Ga0496118_0444891 3300048921 Bacteria 660
694 Ga0496121_0092046 3300048924 Bacteria 2365
695 Ga0496122_0140948 3300048925 Bacteria 1508
696 Ga0496123_0043530 3300048926 Bacteria 3082
697 Ga0496124_0102662 3300048927 Bacteria 2314
698 Ga0496124_0553118 3300048927 Unclassified 759
699 Ga0495682_0003100 3300049460 Bacteria 7532
700 Ga0501292_033517 3300049515 Bacteria 870
701 Ga0501299_010781 3300049522 Bacteria 1532
702 Ga0501032_0104319 3300049569 Bacteria 1878
703 Ga0501033_0212435 3300049570 Bacteria 1379
704 Ga0501034_0033336 3300049571 Bacteria 5226
705 Ga0501034_0227076 3300049571 Bacteria 1817
706 Ga0501034_0581786 3300049571 Bacteria 1026
707 Ga0501034_1167028 3300049571 Unclassified 649
708 Ga0501036_0069305 3300049572 Bacteria 2983
709 Ga0501037_0565056 3300049573 Bacteria 766
710 Ga0501038_0088150 3300049574 Bacteria 2605
711 Ga0501038_0346742 3300049574 Bacteria 1157
712 Ga0501039_0019780 3300049575 Bacteria 5161
713 Ga0501039_0886952 3300049575 Bacteria 694
714 Ga0501040_0038131 3300049576 Bacteria 3267
715 Ga0501041_0340215 3300049577 Bacteria 948
716 Ga0501042_0061209 3300049578 Bacteria 2690
717 Ga0501042_0157067 3300049578 Bacteria 1641
718 Ga0501042_0460714 3300049578 Unclassified 922
719 Ga0501043_0132350 3300049579 Bacteria 1954
720 Ga0501043_0253942 3300049579 Bacteria 1354
721 Ga0501046_0019314 3300049580 Bacteria 5654
722 Ga0501046_0405403 3300049580 Bacteria 984
723 Ga0501047_0118386 3300049581 Bacteria 2530
724 Ga0501048_0144138 3300049582 Bacteria 1685
725 Ga0501068_0082344 3300049584 Bacteria 1976
726 Ga0501069_0014033 3300049585 Bacteria 4279
727 Ga0501069_0050976 3300049585 Bacteria 2303
728 Ga0501071_0108343 3300049587 Bacteria 2052
729 Ga0501071_0610224 3300049587 Bacteria 839
730 Ga0501072_0247593 3300049588 Bacteria 1419
731 Ga0501072_0433530 3300049588 Bacteria 1041
732 Ga0501073_0043224 3300049589 Bacteria 3177
733 Ga0501075_0208892 3300049591 Bacteria 1489
734 Ga0501076_0011387 3300049592 Bacteria 6622
735 Ga0501076_0068323 3300049592 Unclassified 2839
736 Ga0501076_0323974 3300049592 Bacteria 1264
737 Ga0501076_0554700 3300049592 Bacteria 947
738 Ga0501076_0640850 3300049592 Bacteria 877
739 Ga0501233_099863 3300049668 Bacteria 766
740 Ga0501249_041481 3300049679 Bacteria 1044
741 Ga0501221_020958 3300049704 Bacteria 1283
742 Ga0501245_019463 3300049708 Unclassified 1052
743 Ga0501079_0289560 3300049741 Bacteria 1281
744 Ga0501079_0377647 3300049741 Bacteria 1111
745 Ga0501080_0057899 3300049742 Bacteria 3607
746 Ga0501080_0082510 3300049742 Bacteria 2986
747 Ga0501081_0123416 3300049743 Bacteria 1847
748 Ga0501265_053432 3300049762 Bacteria 642
749 Ga0501283_002389 3300049779 Bacteria 2440
750 Ga0501044_0112926 3300049823 Bacteria 2724
751 Ga0501044_0147432 3300049823 Bacteria 2337
752 Ga0501045_0085944 3300049824 Bacteria 2322
753 Ga0501045_0223735 3300049824 Unclassified 1401
754 nmdc:mga00v17_11298_c1 3300050491 Bacteria 4906
755 nmdc:mga00v17_14191_c1 3300050491 Bacteria 4441
756 nmdc:mga00v17_14397_c1 3300050491 Bacteria 4413
757 nmdc:mga00v17_151242_c1 3300050491 Bacteria 1492
758 nmdc:mga00v17_260390_c1 3300050491 Bacteria 1125
759 nmdc:mga00v17_260819_c1 3300050491 Bacteria 1124
760 nmdc:mga00v17_28521_c1 3300050491 Bacteria 3270
761 nmdc:mga0yw44_257631_c1 3300050492 Bacteria 1162
762 nmdc:mga0k408_14304_c1 3300050493 Bacteria 4368
763 nmdc:mga0k408_3437_c1 3300050493 Bacteria 8385
764 nmdc:mga0k408_426795_c1 3300050493 Unclassified 788
765 nmdc:mga0k408_81932_c1 3300050493 Bacteria 1890
766 nmdc:mga0k408_9704_c1 3300050493 Bacteria 5197
767 nmdc:mga06z11_115417_c1 3300050494 Bacteria 1492
768 nmdc:mga06z11_169725_c1 3300050494 Bacteria 1252
769 nmdc:mga06z11_302837_c1 3300050494 Bacteria 951
770 nmdc:mga04h51_117697_c1 3300050495 Bacteria 987
771 nmdc:mga04h51_169594_c1 3300050495 Bacteria 844
772 nmdc:mga07m45_123961_c1 3300050496 Bacteria 1493
773 nmdc:mga07m45_15404_c1 3300050496 Bacteria 4082
774 nmdc:mga05p37_185378_c1 3300050507 Bacteria 2530
775 nmdc:mga05p37_3369_c1 3300050507 Bacteria 18656
776 nmdc:mga05p37_445171_c1 3300050507 Bacteria 1501
777 nmdc:mga05p37_62226_c1 3300050507 Bacteria 4593
778 nmdc:mga05p37_67440_c1 3300050507 Unclassified 4402
779 nmdc:mga09592_140920_c1 3300050508 Bacteria 2078
780 nmdc:mga09592_503986_c1 3300050508 Bacteria 1042
781 nmdc:mga0qj67_105479_c1 3300050509 Bacteria 2274
782 nmdc:mga0qj67_29477_c1 3300050509 Bacteria 4263
783 nmdc:mga06r32_120617_c1 3300050510 Bacteria 2586
784 nmdc:mga06r32_323482_c1 3300050510 Unclassified 1527
785 nmdc:mga06r32_37428_c1 3300050510 Bacteria 4589
786 nmdc:mga06r32_761581_c1 3300050510 Bacteria 931
787 nmdc:mga06r32_763540_c1 3300050510 Bacteria 929
788 nmdc:mga08y16_155463_c1 3300050511 Bacteria 2377
789 nmdc:mga08y16_17018_c1 3300050511 Bacteria 7656
790 nmdc:mga08y16_40296_c1 3300050511 Bacteria 4897
791 nmdc:mga08y16_464704_c1 3300050511 Bacteria 1289
792 nmdc:mga08y16_627627_c1 3300050511 Bacteria 1081
793 nmdc:mga08y16_92015_c1 3300050511 Bacteria 3160
794 nmdc:mga0n895_223668_c1 3300050512 Bacteria 1910
795 nmdc:mga0n895_250539_c1 3300050512 Bacteria 1797
796 nmdc:mga0rr50_545_c1 3300050513 Bacteria 20207
797 nmdc:mga08x19_182406_c1 3300050514 Bacteria 1433
798 nmdc:mga0a205_395136_c1 3300050515 Unclassified 1247
799 Ga0500644_0239339 3300053088 Bacteria 762
800 Ga0500564_176831 3300053138 Bacteria 893
801 Ga0501084_0110597 3300054114 Bacteria 2309
802 Ga0501084_0419371 3300054114 Bacteria 1131
803 Ga0501084_0679944 3300054114 Bacteria 868
804 Ga0590075_054046 3300059424 Bacteria 1031
805 Ga0587093_034489 3300059478 Bacteria 743
806 Ga0587073_0042039 3300059492 Bacteria 1001
807 Ga0587115_042911 3300059626 Bacteria 712
808 Ga0587114_044203 3300059655 Bacteria 733
809 Ga0501082_0082508 3300060353 Bacteria 2774
810 Ga0501082_0094811 3300060353 Bacteria 2579
811 Ga0501082_0280222 3300060353 Bacteria 1451
812 Ga0501082_0990237 3300060353 Bacteria 735
813 Ga0530510_0307814 3300061734 Bacteria 1186

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10539253 Ga0105237_105392532 165
2 3300026118 Ga0207675_100310536 Ga0207675_1003105362 165
3 3300005331 Ga0070670_100357260 Ga0070670_1003572603 166
4 3300011119 Ga0105246_10240183 Ga0105246_102401832 166
5 3300014325 Ga0163163_10105277 Ga0163163_101052774 166
6 3300026075 Ga0207708_10663260 Ga0207708_106632602 166
7 3300005338 Ga0068868_101168726 Ga0068868_1011687261 167
8 3300006846 Ga0075430_100014465 Ga0075430_1000144654 167
9 3300009098 Ga0105245_10003049 Ga0105245_100030499 167
10 3300009176 Ga0105242_10100004 Ga0105242_101000044 167
11 3300009177 Ga0105248_10032778 Ga0105248_100327786 167
12 3300013296 Ga0157374_10459611 Ga0157374_104596113 167
13 3300013296 Ga0157374_11844519 Ga0157374_118445191 167
14 3300013306 Ga0163162_10048904 Ga0163162_100489044 167
15 3300013308 Ga0157375_10002486 Ga0157375_100024862 167
16 3300014325 Ga0163163_10060850 Ga0163163_100608502 167
17 3300014745 Ga0157377_10692460 Ga0157377_106924602 167
18 3300014968 Ga0157379_10018611 Ga0157379_100186116 167
19 3300044901 Ga0466960_0008243 Ga0466960_0008243_208_768 167
20 3300048903 Ga0496100_0863651 Ga0496100_0863651_85_597 167
21 3300048907 Ga0496104_0058526 Ga0496104_0058526_3037_3549 167
22 3300048913 Ga0496110_0115394 Ga0496110_0115394_1189_1701 167
23 3300048914 Ga0496111_0202054 Ga0496111_0202054_145_657 167
24 3300049576 Ga0501040_0038131 Ga0501040_0038131_1452_1964 167
25 3300049587 Ga0501071_0108343 Ga0501071_0108343_253_765 167
26 3300049592 Ga0501076_0011387 Ga0501076_0011387_3538_4050 167
27 3300049741 Ga0501079_0377647 Ga0501079_0377647_204_716 167
28 3300049742 Ga0501080_0082510 Ga0501080_0082510_2413_2925 167
29 3300049762 Ga0501265_053432 Ga0501265_053432_70_588 167
30 3300050493 nmdc:mga0k408_81932_c1 nmdc:mga0k408_81932_c1_990_1502 167
31 3300050495 nmdc:mga04h51_117697_c1 nmdc:mga04h51_117697_c1_56_568 167
32 3300060353 Ga0501082_0082508 Ga0501082_0082508_1246_1758 167
33 3300005844 Ga0068862_100057518 Ga0068862_1000575184 168
34 3300005937 Ga0081455_10222054 Ga0081455_102220541 168
35 3300005985 Ga0081539_10162043 Ga0081539_101620431 168
36 3300013307 Ga0157372_10099075 Ga0157372_100990754 168
37 3300025933 Ga0207706_11201053 Ga0207706_112010531 168
38 3300028380 Ga0268265_10132512 Ga0268265_101325122 168
39 3300028380 Ga0268265_10857834 Ga0268265_108578341 168
40 3300031852 Ga0307410_11389530 Ga0307410_113895302 168
41 3300044901 Ga0466960_0150279 Ga0466960_0150279_44_568 168
42 3300005293 Ga0065715_10190385 Ga0065715_101903852 169
43 3300005329 Ga0070683_101255031 Ga0070683_1012550311 169
44 3300005330 Ga0070690_100202494 Ga0070690_1002024941 169
45 3300005334 Ga0068869_100151345 Ga0068869_1001513452 169
46 3300005335 Ga0070666_10733945 Ga0070666_107339451 169
47 3300005337 Ga0070682_100830919 Ga0070682_1008309192 169
48 3300005340 Ga0070689_100110044 Ga0070689_1001100442 169
49 3300005347 Ga0070668_100504047 Ga0070668_1005040471 169
50 3300005353 Ga0070669_100007291 Ga0070669_10000729110 169
51 3300005365 Ga0070688_100061888 Ga0070688_1000618883 169
52 3300005366 Ga0070659_101397043 Ga0070659_1013970431 169
53 3300005440 Ga0070705_100246899 Ga0070705_1002468992 169
54 3300005441 Ga0070700_100093368 Ga0070700_1000933682 169
55 3300005518 Ga0070699_100314086 Ga0070699_1003140862 169
56 3300005530 Ga0070679_100202026 Ga0070679_1002020262 169
57 3300005544 Ga0070686_100034885 Ga0070686_1000348851 169
58 3300005563 Ga0068855_100808215 Ga0068855_1008082151 169
59 3300005564 Ga0070664_100800774 Ga0070664_1008007742 169
60 3300005615 Ga0070702_100117250 Ga0070702_1001172501 169
61 3300005615 Ga0070702_101036408 Ga0070702_1010364081 169
62 3300005618 Ga0068864_100205277 Ga0068864_1002052772 169
63 3300005719 Ga0068861_100777290 Ga0068861_1007772902 169
64 3300005843 Ga0068860_101299176 Ga0068860_1012991762 169
65 3300005844 Ga0068862_100020071 Ga0068862_1000200717 169
66 3300006051 Ga0075364_10002943 Ga0075364_100029436 169
67 3300006881 Ga0068865_100253843 Ga0068865_1002538432 169
68 3300009093 Ga0105240_10563346 Ga0105240_105633461 169
69 3300009094 Ga0111539_10045673 Ga0111539_100456733 169
70 3300009094 Ga0111539_11808429 Ga0111539_118084291 169
71 3300009553 Ga0105249_11797861 Ga0105249_117978611 169
72 3300013297 Ga0157378_11418981 Ga0157378_114189811 169
73 3300013306 Ga0163162_10470494 Ga0163162_104704942 169
74 3300013307 Ga0157372_10244328 Ga0157372_102443283 169
75 3300013308 Ga0157375_10033211 Ga0157375_100332114 169
76 3300014326 Ga0157380_10714141 Ga0157380_107141411 169
77 3300025315 Ga0207697_10138571 Ga0207697_101385711 169
78 3300025913 Ga0207695_10714125 Ga0207695_107141251 169
79 3300025921 Ga0207652_10208655 Ga0207652_102086552 169
80 3300025923 Ga0207681_10315964 Ga0207681_103159641 169
81 3300025925 Ga0207650_10166185 Ga0207650_101661851 169
82 3300025931 Ga0207644_10713356 Ga0207644_107133561 169
83 3300025938 Ga0207704_10187161 Ga0207704_101871612 169
84 3300025942 Ga0207689_10232670 Ga0207689_102326702 169
85 3300025944 Ga0207661_11019596 Ga0207661_110195961 169
86 3300025949 Ga0207667_11153530 Ga0207667_111535301 169
87 3300025972 Ga0207668_11154091 Ga0207668_111540911 169
88 3300026095 Ga0207676_10194780 Ga0207676_101947802 169
89 3300026095 Ga0207676_10888522 Ga0207676_108885222 169
90 3300026118 Ga0207675_100156440 Ga0207675_1001564401 169
91 3300027907 Ga0207428_10012636 Ga0207428_100126368 169
92 3300028380 Ga0268265_10013423 Ga0268265_100134237 169
93 3300028381 Ga0268264_11236592 Ga0268264_112365921 169
94 3300031548 Ga0307408_100059723 Ga0307408_1000597233 169
95 3300031731 Ga0307405_10198294 Ga0307405_101982942 169
96 3300031824 Ga0307413_10243129 Ga0307413_102431292 169
97 3300031852 Ga0307410_10054566 Ga0307410_100545663 169
98 3300031852 Ga0307410_10400853 Ga0307410_104008532 169
99 3300031901 Ga0307406_10303290 Ga0307406_103032901 169
100 3300031903 Ga0307407_10865394 Ga0307407_108653942 169
101 3300031903 Ga0307407_11224057 Ga0307407_112240571 169
102 3300031911 Ga0307412_10218921 Ga0307412_102189212 169
103 3300031995 Ga0307409_100006003 Ga0307409_1000060038 169
104 3300031995 Ga0307409_100535134 Ga0307409_1005351342 169
105 3300032005 Ga0307411_10530180 Ga0307411_105301802 169
106 3300032126 Ga0307415_100058848 Ga0307415_1000588482 169
107 3300037312 Ga0395899_0005318 Ga0395899_0005318_8180_8704 169
108 3300037418 Ga0395900_0011357 Ga0395900_0011357_6439_6963 169
109 3300037466 Ga0395898_0016961 Ga0395898_0016961_4885_5409 169
110 3300038443 Ga0395901_0101906 Ga0395901_0101906_340_864 169
111 3300045049 Ga0466959_0415522 Ga0466959_0415522_85_609 169
112 3300046491 Ga0495584_0005887 Ga0495584_0005887_1293_1802 169
113 3300046506 Ga0495583_0117600 Ga0495583_0117600_456_965 169
114 3300046513 Ga0495616_0005117 Ga0495616_0005117_6476_6985 169
115 3300046522 Ga0495643_0074698 Ga0495643_0074698_146_655 169
116 3300046616 Ga0495668_0000368 Ga0495668_0000368_2203_2712 169
117 3300046660 Ga0495625_0215706 Ga0495625_0215706_330_839 169
118 3300046665 Ga0495661_0035672 Ga0495661_0035672_1492_2001 169
119 3300046675 Ga0495657_0398064 Ga0495657_0398064_26_535 169
120 3300046684 Ga0495669_0000453 Ga0495669_0000453_17589_18098 169
121 3300046694 Ga0495649_0011217 Ga0495649_0011217_3081_3590 169
122 3300047318 Ga0495636_0004548 Ga0495636_0004548_4769_5278 169
123 3300047443 Ga0495687_097271 Ga0495687_097271_157_666 169
124 3300047445 Ga0495677_0006066 Ga0495677_0006066_2172_2681 169
125 3300047472 Ga0495686_0008011 Ga0495686_0008011_5349_5858 169
126 3300048915 Ga0496112_0061534 Ga0496112_0061534_319_843 169
127 3300048925 Ga0496122_0140948 Ga0496122_0140948_246_770 169
128 3300048926 Ga0496123_0043530 Ga0496123_0043530_1863_2387 169
129 3300049578 Ga0501042_0157067 Ga0501042_0157067_962_1540 169
130 3300049579 Ga0501043_0253942 Ga0501043_0253942_68_589 169
131 3300049824 Ga0501045_0223735 Ga0501045_0223735_76_597 169
132 3300050491 nmdc:mga00v17_11298_c1 nmdc:mga00v17_11298_c1_2717_3232 169
133 3300050511 nmdc:mga08y16_40296_c1 nmdc:mga08y16_40296_c1_2227_2754 169
134 iso_pu_bacteria 2751185846 2753570115 169
135 iso_pu_bacteria 2885270888 2885274753 169
136 iso_pu_bacteria 2904483920 2904486775 169
137 iso_pu_bacteria 8055266321 8055270608 169
138 3300005290 Ga0065712_10217158 Ga0065712_102171582 170
139 3300005290 Ga0065712_10580926 Ga0065712_105809261 170
140 3300005293 Ga0065715_10105044 Ga0065715_101050443 170
141 3300005327 Ga0070658_10074108 Ga0070658_100741083 170
142 3300005327 Ga0070658_10345699 Ga0070658_103456992 170
143 3300005355 Ga0070671_100368251 Ga0070671_1003682511 170
144 3300005364 Ga0070673_100502513 Ga0070673_1005025132 170
145 3300005456 Ga0070678_100021686 Ga0070678_1000216863 170
146 3300005459 Ga0068867_100525530 Ga0068867_1005255302 170
147 3300005530 Ga0070679_100186138 Ga0070679_1001861383 170
148 3300005543 Ga0070672_100324184 Ga0070672_1003241842 170
149 3300005548 Ga0070665_101255524 Ga0070665_1012555241 170
150 3300005719 Ga0068861_101722685 Ga0068861_1017226852 170
151 3300005842 Ga0068858_100621392 Ga0068858_1006213922 170
152 3300006038 Ga0075365_10241143 Ga0075365_102411432 170
153 3300006042 Ga0075368_10002746 Ga0075368_100027465 170
154 3300006048 Ga0075363_100032003 Ga0075363_1000320033 170
155 3300006051 Ga0075364_10055278 Ga0075364_100552784 170
156 3300006178 Ga0075367_10098453 Ga0075367_100984533 170
157 3300006178 Ga0075367_10232976 Ga0075367_102329761 170
158 3300006353 Ga0075370_10016416 Ga0075370_100164163 170
159 3300006846 Ga0075430_100055726 Ga0075430_1000557264 170
160 3300009093 Ga0105240_10005746 Ga0105240_1000574613 170
161 3300009093 Ga0105240_10298775 Ga0105240_102987753 170
162 3300009094 Ga0111539_10831036 Ga0111539_108310361 170
163 3300009098 Ga0105245_11972124 Ga0105245_119721241 170
164 3300009147 Ga0114129_10134488 Ga0114129_101344884 170
165 3300009147 Ga0114129_11567233 Ga0114129_115672332 170
166 3300009545 Ga0105237_10006745 Ga0105237_100067459 170
167 3300009545 Ga0105237_10490361 Ga0105237_104903612 170
168 3300009551 Ga0105238_10465376 Ga0105238_104653762 170
169 3300009553 Ga0105249_10158901 Ga0105249_101589012 170
170 3300013296 Ga0157374_10767157 Ga0157374_107671572 170
171 3300014326 Ga0157380_10281747 Ga0157380_102817472 170
172 3300017792 Ga0163161_10781835 Ga0163161_107818352 170
173 3300025909 Ga0207705_10018268 Ga0207705_100182684 170
174 3300025913 Ga0207695_10020911 Ga0207695_100209116 170
175 3300025914 Ga0207671_10021594 Ga0207671_100215945 170
176 3300025921 Ga0207652_10132486 Ga0207652_101324863 170
177 3300025940 Ga0207691_10038054 Ga0207691_100380542 170
178 3300025942 Ga0207689_10407221 Ga0207689_104072212 170
179 3300025986 Ga0207658_11639006 Ga0207658_116390061 170
180 3300026116 Ga0207674_10405294 Ga0207674_104052942 170
181 3300026121 Ga0207683_10029686 Ga0207683_100296864 170
182 3300031731 Ga0307405_10370193 Ga0307405_103701932 170
183 3300031911 Ga0307412_11323303 Ga0307412_113233031 170
184 3300032002 Ga0307416_102386864 Ga0307416_1023868641 170
185 3300037471 Ga0395905_0000221 Ga0395905_0000221_74187_74711 170
186 3300039437 Ga0436365_1297870 Ga0436365_1297870_371_883 170
187 3300041452 Ga0451793_0826448 Ga0451793_0826448_10_531 170
188 3300041505 Ga0451849_0527925 Ga0451849_0527925_34_555 170
189 3300042124 Ga0450922_012407 Ga0450922_012407_282_803 170
190 3300042125 Ga0450923_030540 Ga0450923_030540_369_890 170
191 3300046460 Ga0495638_0139239 Ga0495638_0139239_827_1348 170
192 3300048905 Ga0496102_0144723 Ga0496102_0144723_837_1358 170
193 3300048912 Ga0496109_1214066 Ga0496109_1214066_80_601 170
194 3300048920 Ga0496117_0178364 Ga0496117_0178364_154_675 170
195 3300048921 Ga0496118_0022238 Ga0496118_0022238_3657_4178 170
196 3300049585 Ga0501069_0050976 Ga0501069_0050976_1723_2244 170
197 3300049592 Ga0501076_0640850 Ga0501076_0640850_354_866 170
198 3300050491 nmdc:mga00v17_151242_c1 nmdc:mga00v17_151242_c1_391_903 170
199 3300050491 nmdc:mga00v17_28521_c1 nmdc:mga00v17_28521_c1_2663_3175 170
200 3300050493 nmdc:mga0k408_426795_c1 nmdc:mga0k408_426795_c1_86_598 170
201 3300050496 nmdc:mga07m45_15404_c1 nmdc:mga07m45_15404_c1_1499_2011 170
202 3300050507 nmdc:mga05p37_185378_c1 nmdc:mga05p37_185378_c1_1185_1697 170
203 3300050509 nmdc:mga0qj67_29477_c1 nmdc:mga0qj67_29477_c1_840_1352 170
204 3300050511 nmdc:mga08y16_464704_c1 nmdc:mga08y16_464704_c1_495_1010 170
205 3300050511 nmdc:mga08y16_92015_c1 nmdc:mga08y16_92015_c1_623_1141 170
206 3300050513 nmdc:mga0rr50_545_c1 nmdc:mga0rr50_545_c1_15575_16087 170
207 3300002459 JGI24751J29686_10019403 JGI24751J29686_100194032 171
208 3300003575 Ga0007409J51694_1028918 Ga0007409J51694_10289181 171
209 3300003579 Ga0007429J51699_1119903 Ga0007429J51699_11199031 171
210 3300004799 Ga0058863_11561367 Ga0058863_115613671 171
211 3300004800 Ga0058861_11675737 Ga0058861_116757371 171
212 3300004803 Ga0058862_12242253 Ga0058862_122422532 171
213 3300005288 Ga0065714_10287893 Ga0065714_102878932 171
214 3300005290 Ga0065712_10078899 Ga0065712_100788991 171
215 3300005293 Ga0065715_10470402 Ga0065715_104704021 171
216 3300005293 Ga0065715_10474359 Ga0065715_104743592 171
217 3300005293 Ga0065715_10509730 Ga0065715_105097301 171
218 3300005295 Ga0065707_10201881 Ga0065707_102018812 171
219 3300005328 Ga0070676_10030962 Ga0070676_100309622 171
220 3300005331 Ga0070670_100004831 Ga0070670_1000048319 171
221 3300005331 Ga0070670_100098196 Ga0070670_1000981962 171
222 3300005334 Ga0068869_100078407 Ga0068869_1000784072 171
223 3300005337 Ga0070682_100892267 Ga0070682_1008922671 171
224 3300005344 Ga0070661_100754303 Ga0070661_1007543031 171
225 3300005353 Ga0070669_100331798 Ga0070669_1003317982 171
226 3300005355 Ga0070671_100117389 Ga0070671_1001173891 171
227 3300005356 Ga0070674_101538553 Ga0070674_1015385531 171
228 3300005364 Ga0070673_100037552 Ga0070673_1000375523 171
229 3300005366 Ga0070659_100582707 Ga0070659_1005827072 171
230 3300005367 Ga0070667_100252286 Ga0070667_1002522861 171
231 3300005439 Ga0070711_100208905 Ga0070711_1002089053 171
232 3300005455 Ga0070663_100084708 Ga0070663_1000847082 171
233 3300005458 Ga0070681_10057879 Ga0070681_100578791 171
234 3300005459 Ga0068867_100752114 Ga0068867_1007521142 171
235 3300005466 Ga0070685_10138819 Ga0070685_101388192 171
236 3300005467 Ga0070706_100361743 Ga0070706_1003617433 171
237 3300005467 Ga0070706_100837088 Ga0070706_1008370881 171
238 3300005468 Ga0070707_100791276 Ga0070707_1007912761 171
239 3300005530 Ga0070679_100052050 Ga0070679_1000520502 171
240 3300005539 Ga0068853_100873110 Ga0068853_1008731102 171
241 3300005543 Ga0070672_100044581 Ga0070672_1000445814 171
242 3300005545 Ga0070695_101091279 Ga0070695_1010912792 171
243 3300005546 Ga0070696_100029166 Ga0070696_1000291661 171
244 3300005547 Ga0070693_100332079 Ga0070693_1003320791 171
245 3300005564 Ga0070664_100056589 Ga0070664_1000565893 171
246 3300005564 Ga0070664_100294207 Ga0070664_1002942073 171
247 3300005577 Ga0068857_100002215 Ga0068857_10000221511 171
248 3300005719 Ga0068861_100656473 Ga0068861_1006564732 171
249 3300005843 Ga0068860_101130975 Ga0068860_1011309752 171
250 3300005844 Ga0068862_100061365 Ga0068862_1000613653 171
251 3300006038 Ga0075365_10013288 Ga0075365_100132885 171
252 3300006038 Ga0075365_10044114 Ga0075365_100441142 171
253 3300006042 Ga0075368_10167683 Ga0075368_101676831 171
254 3300006048 Ga0075363_100511373 Ga0075363_1005113732 171
255 3300006051 Ga0075364_10027187 Ga0075364_100271873 171
256 3300006051 Ga0075364_10029418 Ga0075364_100294182 171
257 3300006051 Ga0075364_10366090 Ga0075364_103660902 171
258 3300006178 Ga0075367_10070238 Ga0075367_100702383 171
259 3300006178 Ga0075367_10099391 Ga0075367_100993913 171
260 3300006195 Ga0075366_10005318 Ga0075366_100053188 171
261 3300006195 Ga0075366_10010729 Ga0075366_100107295 171
262 3300006353 Ga0075370_10159966 Ga0075370_101599662 171
263 3300006358 Ga0068871_100642314 Ga0068871_1006423142 171
264 3300006852 Ga0075433_10335726 Ga0075433_103357262 171
265 3300006871 Ga0075434_100255521 Ga0075434_1002555213 171
266 3300006880 Ga0075429_100389083 Ga0075429_1003890832 171
267 3300006880 Ga0075429_100828579 Ga0075429_1008285792 171
268 3300006931 Ga0097620_100660550 Ga0097620_1006605502 171
269 3300009093 Ga0105240_10256088 Ga0105240_102560883 171
270 3300009094 Ga0111539_10025634 Ga0111539_100256342 171
271 3300009094 Ga0111539_10039209 Ga0111539_100392095 171
272 3300009147 Ga0114129_10002414 Ga0114129_1000241416 171
273 3300009147 Ga0114129_12726960 Ga0114129_127269601 171
274 3300009551 Ga0105238_10114637 Ga0105238_101146372 171
275 3300011119 Ga0105246_10762132 Ga0105246_107621322 171
276 3300013296 Ga0157374_10723451 Ga0157374_107234511 171
277 3300013306 Ga0163162_10381400 Ga0163162_103814003 171
278 3300013308 Ga0157375_10049471 Ga0157375_100494713 171
279 3300014325 Ga0163163_10393513 Ga0163163_103935132 171
280 3300014745 Ga0157377_10466724 Ga0157377_104667241 171
281 3300014968 Ga0157379_10585193 Ga0157379_105851932 171
282 3300020069 Ga0197907_11031442 Ga0197907_110314421 171
283 3300020070 Ga0206356_11608615 Ga0206356_116086152 171
284 3300020076 Ga0206355_1488022 Ga0206355_14880222 171
285 3300020082 Ga0206353_10654570 Ga0206353_106545701 171
286 3300022467 Ga0224712_10157125 Ga0224712_101571251 171
287 3300025907 Ga0207645_10032291 Ga0207645_100322915 171
288 3300025913 Ga0207695_10199383 Ga0207695_101993833 171
289 3300025916 Ga0207663_10213260 Ga0207663_102132603 171
290 3300025918 Ga0207662_10059311 Ga0207662_100593113 171
291 3300025920 Ga0207649_10485501 Ga0207649_104855012 171
292 3300025924 Ga0207694_10246950 Ga0207694_102469502 171
293 3300025925 Ga0207650_10072245 Ga0207650_100722454 171
294 3300025925 Ga0207650_10207040 Ga0207650_102070403 171
295 3300025925 Ga0207650_10223967 Ga0207650_102239671 171
296 3300025925 Ga0207650_10274785 Ga0207650_102747852 171
297 3300025936 Ga0207670_10537145 Ga0207670_105371452 171
298 3300025938 Ga0207704_10133108 Ga0207704_101331082 171
299 3300025940 Ga0207691_10045824 Ga0207691_100458245 171
300 3300025945 Ga0207679_10273812 Ga0207679_102738123 171
301 3300025949 Ga0207667_10816324 Ga0207667_108163242 171
302 3300025960 Ga0207651_10014615 Ga0207651_100146155 171
303 3300025986 Ga0207658_10776628 Ga0207658_107766282 171
304 3300026035 Ga0207703_10477822 Ga0207703_104778222 171
305 3300026041 Ga0207639_10184021 Ga0207639_101840212 171
306 3300026067 Ga0207678_10024600 Ga0207678_100246003 171
307 3300026089 Ga0207648_10253293 Ga0207648_102532931 171
308 3300026095 Ga0207676_10114990 Ga0207676_101149903 171
309 3300026095 Ga0207676_11198811 Ga0207676_111988112 171
310 3300026116 Ga0207674_10020350 Ga0207674_100203504 171
311 3300026118 Ga0207675_100088650 Ga0207675_1000886502 171
312 3300026118 Ga0207675_100088851 Ga0207675_1000888516 171
313 3300026121 Ga0207683_10005995 Ga0207683_100059955 171
314 3300027682 Ga0209971_1119195 Ga0209971_11191951 171
315 3300027866 Ga0209813_10021605 Ga0209813_100216052 171
316 3300027866 Ga0209813_10145314 Ga0209813_101453142 171
317 3300027907 Ga0207428_10016644 Ga0207428_100166445 171
318 3300027907 Ga0207428_10087984 Ga0207428_100879842 171
319 3300028380 Ga0268265_10280602 Ga0268265_102806022 171
320 3300028380 Ga0268265_10833644 Ga0268265_108336442 171
321 3300028380 Ga0268265_10847670 Ga0268265_108476702 171
322 3300028380 Ga0268265_10917574 Ga0268265_109175742 171
323 3300028381 Ga0268264_11391180 Ga0268264_113911801 171
324 3300031852 Ga0307410_10073288 Ga0307410_100732884 171
325 3300032002 Ga0307416_102248252 Ga0307416_1022482521 171
326 3300037068 Ga0373925_0512489 Ga0373925_0512489_32_547 171
327 3300038443 Ga0395901_0307725 Ga0395901_0307725_770_1294 171
328 3300039437 Ga0436365_0814888 Ga0436365_0814888_30_557 171
329 3300041486 Ga0451807_2240801 Ga0451807_2240801_53_577 171
330 3300041512 Ga0451853_0638581 Ga0451853_0638581_150_668 171
331 3300042436 Ga0439435_0114416 Ga0439435_0114416_145_666 171
332 3300042461 Ga0439460_0061302 Ga0439460_0061302_569_1084 171
333 3300046459 Ga0495629_0298426 Ga0495629_0298426_444_962 171
334 3300048910 Ga0496107_0455754 Ga0496107_0455754_134_649 171
335 3300048913 Ga0496110_0364870 Ga0496110_0364870_748_1266 171
336 3300048927 Ga0496124_0553118 Ga0496124_0553118_109_705 171
337 3300049569 Ga0501032_0104319 Ga0501032_0104319_415_936 171
338 3300049570 Ga0501033_0212435 Ga0501033_0212435_384_905 171
339 3300049571 Ga0501034_0033336 Ga0501034_0033336_3336_3857 171
340 3300049571 Ga0501034_0227076 Ga0501034_0227076_811_1332 171
341 3300049571 Ga0501034_0581786 Ga0501034_0581786_145_666 171
342 3300049572 Ga0501036_0069305 Ga0501036_0069305_1345_1866 171
343 3300049573 Ga0501037_0565056 Ga0501037_0565056_81_602 171
344 3300049574 Ga0501038_0088150 Ga0501038_0088150_311_832 171
345 3300049575 Ga0501039_0019780 Ga0501039_0019780_4518_5039 171
346 3300049575 Ga0501039_0886952 Ga0501039_0886952_122_643 171
347 3300049579 Ga0501043_0132350 Ga0501043_0132350_525_1046 171
348 3300049580 Ga0501046_0019314 Ga0501046_0019314_4977_5498 171
349 3300049581 Ga0501047_0118386 Ga0501047_0118386_765_1286 171
350 3300049584 Ga0501068_0082344 Ga0501068_0082344_457_978 171
351 3300049585 Ga0501069_0014033 Ga0501069_0014033_2523_3044 171
352 3300049588 Ga0501072_0247593 Ga0501072_0247593_641_1162 171
353 3300049589 Ga0501073_0043224 Ga0501073_0043224_2583_3104 171
354 3300049742 Ga0501080_0057899 Ga0501080_0057899_2109_2630 171
355 3300049823 Ga0501044_0112926 Ga0501044_0112926_82_603 171
356 3300049823 Ga0501044_0147432 Ga0501044_0147432_791_1312 171
357 3300050491 nmdc:mga00v17_14191_c1 nmdc:mga00v17_14191_c1_1538_2059 171
358 3300050491 nmdc:mga00v17_260390_c1 nmdc:mga00v17_260390_c1_171_692 171
359 3300050492 nmdc:mga0yw44_257631_c1 nmdc:mga0yw44_257631_c1_408_929 171
360 3300050493 nmdc:mga0k408_3437_c1 nmdc:mga0k408_3437_c1_3719_4240 171
361 3300050493 nmdc:mga0k408_9704_c1 nmdc:mga0k408_9704_c1_4132_4653 171
362 3300050494 nmdc:mga06z11_115417_c1 nmdc:mga06z11_115417_c1_28_549 171
363 3300050494 nmdc:mga06z11_169725_c1 nmdc:mga06z11_169725_c1_682_1203 171
364 3300050495 nmdc:mga04h51_169594_c1 nmdc:mga04h51_169594_c1_68_589 171
365 3300050496 nmdc:mga07m45_123961_c1 nmdc:mga07m45_123961_c1_854_1375 171
366 3300050507 nmdc:mga05p37_3369_c1 nmdc:mga05p37_3369_c1_17555_18073 171
367 3300050508 nmdc:mga09592_503986_c1 nmdc:mga09592_503986_c1_343_864 171
368 3300050510 nmdc:mga06r32_323482_c1 nmdc:mga06r32_323482_c1_135_665 171
369 3300050511 nmdc:mga08y16_155463_c1 nmdc:mga08y16_155463_c1_1106_1627 171
370 3300050511 nmdc:mga08y16_17018_c1 nmdc:mga08y16_17018_c1_3035_3556 171
371 3300050512 nmdc:mga0n895_250539_c1 nmdc:mga0n895_250539_c1_48_563 171
372 3300050515 nmdc:mga0a205_395136_c1 nmdc:mga0a205_395136_c1_113_628 171
373 3300053138 Ga0500564_176831 Ga0500564_176831_21_539 171
374 3300004801 Ga0058860_11905593 Ga0058860_119055931 172
375 3300005293 Ga0065715_10163674 Ga0065715_101636743 172
376 3300005327 Ga0070658_10023101 Ga0070658_100231017 172
377 3300005327 Ga0070658_10054974 Ga0070658_100549742 172
378 3300005329 Ga0070683_100002995 Ga0070683_1000029954 172
379 3300005329 Ga0070683_100007080 Ga0070683_1000070806 172
380 3300005329 Ga0070683_100286171 Ga0070683_1002861712 172
381 3300005330 Ga0070690_100023960 Ga0070690_1000239606 172
382 3300005331 Ga0070670_100208226 Ga0070670_1002082262 172
383 3300005334 Ga0068869_100335011 Ga0068869_1003350112 172
384 3300005336 Ga0070680_101339058 Ga0070680_1013390581 172
385 3300005339 Ga0070660_100008509 Ga0070660_1000085093 172
386 3300005339 Ga0070660_100059432 Ga0070660_1000594322 172
387 3300005343 Ga0070687_100022283 Ga0070687_1000222832 172
388 3300005344 Ga0070661_100024170 Ga0070661_1000241702 172
389 3300005344 Ga0070661_100155730 Ga0070661_1001557303 172
390 3300005347 Ga0070668_100422383 Ga0070668_1004223832 172
391 3300005347 Ga0070668_100762933 Ga0070668_1007629332 172
392 3300005353 Ga0070669_100145704 Ga0070669_1001457042 172
393 3300005353 Ga0070669_100343456 Ga0070669_1003434562 172
394 3300005354 Ga0070675_100119522 Ga0070675_1001195223 172
395 3300005355 Ga0070671_100161307 Ga0070671_1001613072 172
396 3300005355 Ga0070671_100350494 Ga0070671_1003504942 172
397 3300005356 Ga0070674_100026819 Ga0070674_1000268192 172
398 3300005356 Ga0070674_100578428 Ga0070674_1005784281 172
399 3300005356 Ga0070674_100720322 Ga0070674_1007203222 172
400 3300005364 Ga0070673_100014167 Ga0070673_1000141674 172
401 3300005364 Ga0070673_100341194 Ga0070673_1003411942 172
402 3300005364 Ga0070673_100520528 Ga0070673_1005205281 172
403 3300005366 Ga0070659_100125467 Ga0070659_1001254673 172
404 3300005436 Ga0070713_100033336 Ga0070713_1000333362 172
405 3300005441 Ga0070700_101060162 Ga0070700_1010601621 172
406 3300005456 Ga0070678_100027183 Ga0070678_1000271835 172
407 3300005457 Ga0070662_100017517 Ga0070662_1000175173 172
408 3300005457 Ga0070662_100106292 Ga0070662_1001062923 172
409 3300005457 Ga0070662_100311911 Ga0070662_1003119111 172
410 3300005457 Ga0070662_100904649 Ga0070662_1009046492 172
411 3300005458 Ga0070681_10154905 Ga0070681_101549052 172
412 3300005458 Ga0070681_11117500 Ga0070681_111175001 172
413 3300005459 Ga0068867_100097317 Ga0068867_1000973172 172
414 3300005466 Ga0070685_10234243 Ga0070685_102342433 172
415 3300005535 Ga0070684_100038153 Ga0070684_1000381531 172
416 3300005535 Ga0070684_100064760 Ga0070684_1000647604 172
417 3300005539 Ga0068853_100036362 Ga0068853_1000363627 172
418 3300005539 Ga0068853_100350530 Ga0068853_1003505302 172
419 3300005544 Ga0070686_100003087 Ga0070686_1000030877 172
420 3300005544 Ga0070686_100023278 Ga0070686_1000232785 172
421 3300005547 Ga0070693_100741568 Ga0070693_1007415681 172
422 3300005548 Ga0070665_100050095 Ga0070665_1000500953 172
423 3300005563 Ga0068855_100137880 Ga0068855_1001378802 172
424 3300005564 Ga0070664_100005782 Ga0070664_10000578211 172
425 3300005564 Ga0070664_100122149 Ga0070664_1001221493 172
426 3300005577 Ga0068857_100043928 Ga0068857_1000439285 172
427 3300005577 Ga0068857_100665241 Ga0068857_1006652411 172
428 3300005578 Ga0068854_100005064 Ga0068854_1000050648 172
429 3300005578 Ga0068854_100027942 Ga0068854_1000279425 172
430 3300005578 Ga0068854_100367903 Ga0068854_1003679031 172
431 3300005614 Ga0068856_100134150 Ga0068856_1001341502 172
432 3300005614 Ga0068856_101176883 Ga0068856_1011768831 172
433 3300005615 Ga0070702_100221209 Ga0070702_1002212092 172
434 3300005616 Ga0068852_100001481 Ga0068852_1000014817 172
435 3300005616 Ga0068852_100178273 Ga0068852_1001782733 172
436 3300005617 Ga0068859_100452801 Ga0068859_1004528012 172
437 3300005719 Ga0068861_100114314 Ga0068861_1001143144 172
438 3300005719 Ga0068861_100252695 Ga0068861_1002526951 172
439 3300005834 Ga0068851_10032323 Ga0068851_100323233 172
440 3300005834 Ga0068851_10258457 Ga0068851_102584571 172
441 3300005842 Ga0068858_100550975 Ga0068858_1005509752 172
442 3300005843 Ga0068860_100391286 Ga0068860_1003912861 172
443 3300005937 Ga0081455_10360929 Ga0081455_103609292 172
444 3300006051 Ga0075364_10009183 Ga0075364_100091836 172
445 3300006051 Ga0075364_10576417 Ga0075364_105764172 172
446 3300006178 Ga0075367_10004132 Ga0075367_100041329 172
447 3300006195 Ga0075366_10223734 Ga0075366_102237342 172
448 3300006237 Ga0097621_100002665 Ga0097621_1000026654 172
449 3300006358 Ga0068871_100012449 Ga0068871_1000124497 172
450 3300006844 Ga0075428_100165246 Ga0075428_1001652463 172
451 3300006844 Ga0075428_100217649 Ga0075428_1002176492 172
452 3300006844 Ga0075428_100658860 Ga0075428_1006588601 172
453 3300006846 Ga0075430_100015753 Ga0075430_1000157536 172
454 3300006846 Ga0075430_100018336 Ga0075430_1000183362 172
455 3300006847 Ga0075431_100027502 Ga0075431_1000275025 172
456 3300006847 Ga0075431_100055025 Ga0075431_1000550254 172
457 3300006847 Ga0075431_100186972 Ga0075431_1001869722 172
458 3300006880 Ga0075429_100085977 Ga0075429_1000859774 172
459 3300006881 Ga0068865_100010601 Ga0068865_1000106016 172
460 3300006914 Ga0075436_100150987 Ga0075436_1001509872 172
461 3300006931 Ga0097620_100452843 Ga0097620_1004528432 172
462 3300007076 Ga0075435_100001843 Ga0075435_1000018439 172
463 3300009093 Ga0105240_10045107 Ga0105240_100451078 172
464 3300009094 Ga0111539_10160097 Ga0111539_101600973 172
465 3300009147 Ga0114129_10014182 Ga0114129_1001418211 172
466 3300009147 Ga0114129_10043124 Ga0114129_100431246 172
467 3300009148 Ga0105243_11143717 Ga0105243_111437171 172
468 3300009174 Ga0105241_10080983 Ga0105241_100809833 172
469 3300009174 Ga0105241_10339129 Ga0105241_103391292 172
470 3300009174 Ga0105241_11543646 Ga0105241_115436461 172
471 3300009176 Ga0105242_10017172 Ga0105242_100171722 172
472 3300009176 Ga0105242_10450461 Ga0105242_104504612 172
473 3300009176 Ga0105242_11979846 Ga0105242_119798461 172
474 3300009177 Ga0105248_10048178 Ga0105248_100481786 172
475 3300009177 Ga0105248_10917763 Ga0105248_109177632 172
476 3300009545 Ga0105237_10731415 Ga0105237_107314151 172
477 3300009551 Ga0105238_10811891 Ga0105238_108118912 172
478 3300009553 Ga0105249_10206579 Ga0105249_102065791 172
479 3300009553 Ga0105249_10306666 Ga0105249_103066663 172
480 3300009553 Ga0105249_10574388 Ga0105249_105743883 172
481 3300009553 Ga0105249_10773204 Ga0105249_107732041 172
482 3300009553 Ga0105249_10833128 Ga0105249_108331282 172
483 3300013100 Ga0157373_10344323 Ga0157373_103443231 172
484 3300013102 Ga0157371_10043899 Ga0157371_100438993 172
485 3300013104 Ga0157370_10129235 Ga0157370_101292354 172
486 3300013105 Ga0157369_10008315 Ga0157369_100083153 172
487 3300013296 Ga0157374_10266973 Ga0157374_102669732 172
488 3300013296 Ga0157374_11712862 Ga0157374_117128621 172
489 3300013306 Ga0163162_10174546 Ga0163162_101745463 172
490 3300013307 Ga0157372_10024167 Ga0157372_100241675 172
491 3300013308 Ga0157375_10209067 Ga0157375_102090673 172
492 3300014325 Ga0163163_12084883 Ga0163163_120848831 172
493 3300014326 Ga0157380_10166462 Ga0157380_101664623 172
494 3300014326 Ga0157380_10313111 Ga0157380_103131111 172
495 3300014326 Ga0157380_10805201 Ga0157380_108052012 172
496 3300014969 Ga0157376_10043397 Ga0157376_100433975 172
497 3300025242 Ga0209258_100631 Ga0209258_10063111 172
498 3300025256 Ga0209759_1006111 Ga0209759_10061112 172
499 3300025321 Ga0207656_10054906 Ga0207656_100549062 172
500 3300025909 Ga0207705_10092716 Ga0207705_100927162 172
501 3300025909 Ga0207705_10135182 Ga0207705_101351823 172
502 3300025911 Ga0207654_10043214 Ga0207654_100432143 172
503 3300025911 Ga0207654_10203311 Ga0207654_102033112 172
504 3300025911 Ga0207654_10283671 Ga0207654_102836712 172
505 3300025913 Ga0207695_10192766 Ga0207695_101927663 172
506 3300025913 Ga0207695_10491307 Ga0207695_104913072 172
507 3300025917 Ga0207660_11083634 Ga0207660_110836342 172
508 3300025919 Ga0207657_10053263 Ga0207657_100532632 172
509 3300025920 Ga0207649_10010753 Ga0207649_100107533 172
510 3300025923 Ga0207681_10228842 Ga0207681_102288422 172
511 3300025924 Ga0207694_10313719 Ga0207694_103137192 172
512 3300025925 Ga0207650_10663817 Ga0207650_106638172 172
513 3300025926 Ga0207659_10095692 Ga0207659_100956923 172
514 3300025931 Ga0207644_10417277 Ga0207644_104172771 172
515 3300025931 Ga0207644_10555376 Ga0207644_105553762 172
516 3300025932 Ga0207690_10205205 Ga0207690_102052052 172
517 3300025933 Ga0207706_10278410 Ga0207706_102784102 172
518 3300025934 Ga0207686_10018573 Ga0207686_100185732 172
519 3300025934 Ga0207686_10349676 Ga0207686_103496762 172
520 3300025936 Ga0207670_10946004 Ga0207670_109460041 172
521 3300025937 Ga0207669_10120126 Ga0207669_101201261 172
522 3300025937 Ga0207669_10307278 Ga0207669_103072783 172
523 3300025937 Ga0207669_10932210 Ga0207669_109322101 172
524 3300025938 Ga0207704_10046862 Ga0207704_100468623 172
525 3300025938 Ga0207704_10314710 Ga0207704_103147102 172
526 3300025940 Ga0207691_10017414 Ga0207691_100174144 172
527 3300025940 Ga0207691_10089593 Ga0207691_100895932 172
528 3300025940 Ga0207691_10194631 Ga0207691_101946313 172
529 3300025944 Ga0207661_10007953 Ga0207661_100079534 172
530 3300025944 Ga0207661_10017056 Ga0207661_100170564 172
531 3300025944 Ga0207661_10130255 Ga0207661_101302553 172
532 3300025945 Ga0207679_10009078 Ga0207679_100090784 172
533 3300025945 Ga0207679_10867155 Ga0207679_108671552 172
534 3300025949 Ga0207667_10104968 Ga0207667_101049682 172
535 3300025960 Ga0207651_10004105 Ga0207651_100041056 172
536 3300025960 Ga0207651_10237405 Ga0207651_102374052 172
537 3300025960 Ga0207651_10368841 Ga0207651_103688412 172
538 3300025960 Ga0207651_11191869 Ga0207651_111918691 172
539 3300025961 Ga0207712_10706852 Ga0207712_107068522 172
540 3300025972 Ga0207668_10081807 Ga0207668_100818075 172
541 3300025972 Ga0207668_10119487 Ga0207668_101194874 172
542 3300025972 Ga0207668_11339829 Ga0207668_113398291 172
543 3300025981 Ga0207640_10003115 Ga0207640_100031159 172
544 3300025981 Ga0207640_10022032 Ga0207640_100220323 172
545 3300026035 Ga0207703_10471050 Ga0207703_104710502 172
546 3300026041 Ga0207639_10039763 Ga0207639_100397631 172
547 3300026041 Ga0207639_10810029 Ga0207639_108100292 172
548 3300026041 Ga0207639_10972755 Ga0207639_109727551 172
549 3300026067 Ga0207678_10321525 Ga0207678_103215252 172
550 3300026078 Ga0207702_10014141 Ga0207702_100141416 172
551 3300026078 Ga0207702_10517143 Ga0207702_105171433 172
552 3300026088 Ga0207641_10210268 Ga0207641_102102682 172
553 3300026089 Ga0207648_10134648 Ga0207648_101346483 172
554 3300026089 Ga0207648_10334722 Ga0207648_103347223 172
555 3300026116 Ga0207674_10110524 Ga0207674_101105243 172
556 3300026116 Ga0207674_10581078 Ga0207674_105810781 172
557 3300026118 Ga0207675_100068656 Ga0207675_1000686564 172
558 3300026118 Ga0207675_100148061 Ga0207675_1001480612 172
559 3300026121 Ga0207683_10194001 Ga0207683_101940014 172
560 3300026142 Ga0207698_10015209 Ga0207698_100152095 172
561 3300026142 Ga0207698_10601157 Ga0207698_106011572 172
562 3300027614 Ga0209970_1034295 Ga0209970_10342952 172
563 3300031548 Ga0307408_100020889 Ga0307408_1000208893 172
564 3300031548 Ga0307408_100272068 Ga0307408_1002720683 172
565 3300031548 Ga0307408_100408263 Ga0307408_1004082632 172
566 3300031731 Ga0307405_10005027 Ga0307405_100050273 172
567 3300031731 Ga0307405_10452828 Ga0307405_104528282 172
568 3300031731 Ga0307405_10491136 Ga0307405_104911362 172
569 3300031824 Ga0307413_10011981 Ga0307413_100119812 172
570 3300031852 Ga0307410_10024922 Ga0307410_100249223 172
571 3300031852 Ga0307410_10413844 Ga0307410_104138442 172
572 3300031901 Ga0307406_10052383 Ga0307406_100523832 172
573 3300031901 Ga0307406_10635942 Ga0307406_106359422 172
574 3300031903 Ga0307407_10808431 Ga0307407_108084311 172
575 3300031995 Ga0307409_100008422 Ga0307409_1000084223 172
576 3300031995 Ga0307409_100647945 Ga0307409_1006479451 172
577 3300031995 Ga0307409_100671789 Ga0307409_1006717892 172
578 3300032002 Ga0307416_100147834 Ga0307416_1001478343 172
579 3300032002 Ga0307416_100225204 Ga0307416_1002252043 172
580 3300032002 Ga0307416_101187834 Ga0307416_1011878341 172
581 3300032002 Ga0307416_101872987 Ga0307416_1018729871 172
582 3300032004 Ga0307414_10084461 Ga0307414_100844612 172
583 3300032005 Ga0307411_10007472 Ga0307411_100074724 172
584 3300032005 Ga0307411_10584850 Ga0307411_105848502 172
585 3300032126 Ga0307415_100114229 Ga0307415_1001142292 172
586 3300032126 Ga0307415_100213796 Ga0307415_1002137962 172
587 3300032126 Ga0307415_100540823 Ga0307415_1005408232 172
588 3300034819 Ga0373958_0002597 Ga0373958_0002597_691_1215 172
589 3300034820 Ga0373959_0007645 Ga0373959_0007645_1043_1567 172
590 3300035085 Ga0373929_0002645 Ga0373929_0002645_1065_1589 172
591 3300035088 Ga0373940_0006709 Ga0373940_0006709_130_654 172
592 3300035090 Ga0373949_0002564 Ga0373949_0002564_3274_3798 172
593 3300035091 Ga0373951_0003740 Ga0373951_0003740_997_1521 172
594 3300035092 Ga0373952_0015623 Ga0373952_0015623_233_757 172
595 3300035112 Ga0373932_0002833 Ga0373932_0002833_3530_4054 172
596 3300035114 Ga0373939_0000369 Ga0373939_0000369_1156_1680 172
597 3300035115 Ga0373941_0012802 Ga0373941_0012802_1153_1677 172
598 3300035241 Ga0373961_0003344 Ga0373961_0003344_1840_2364 172
599 3300035691 Ga0373931_0063842 Ga0373931_0063842_234_758 172
600 3300041997 Ga0439431_0094843 Ga0439431_0094843_228_806 172
601 3300041999 Ga0439433_0087482 Ga0439433_0087482_206_730 172
602 3300042004 Ga0439445_0122493 Ga0439445_0122493_21_548 172
603 3300042876 Ga0451577_0380296 Ga0451577_0380296_101_622 172
604 3300044694 Ga0466963_0013658 Ga0466963_0013658_2848_3369 172
605 3300046459 Ga0495629_0227159 Ga0495629_0227159_427_954 172
606 3300046473 Ga0495582_0404235 Ga0495582_0404235_159_683 172
607 3300046492 Ga0495585_0084919 Ga0495585_0084919_677_1198 172
608 3300046499 Ga0495594_0024919 Ga0495594_0024919_2170_2691 172
609 3300046519 Ga0495632_0000065 Ga0495632_0000065_83285_83812 172
610 3300046526 Ga0495666_0115171 Ga0495666_0115171_52_573 172
611 3300046531 Ga0495665_0199600 Ga0495665_0199600_44_565 172
612 3300046537 Ga0495598_0154113 Ga0495598_0154113_229_747 172
613 3300046538 Ga0495609_0005423 Ga0495609_0005423_4508_5047 172
614 3300046557 Ga0495622_0098437 Ga0495622_0098437_804_1325 172
615 3300046558 Ga0495633_0102139 Ga0495633_0102139_286_804 172
616 3300046664 Ga0495659_0103640 Ga0495659_0103640_100_618 172
617 3300046683 Ga0495658_0042545 Ga0495658_0042545_745_1272 172
618 3300046684 Ga0495669_0063817 Ga0495669_0063817_256_774 172
619 3300046690 Ga0495624_0426794 Ga0495624_0426794_13_534 172
620 3300047318 Ga0495636_0001337 Ga0495636_0001337_6067_6627 172
621 3300047320 Ga0495672_0000272 Ga0495672_0000272_32747_33316 172
622 3300047443 Ga0495687_000126 Ga0495687_000126_75244_75783 172
623 3300048091 Ga0495626_0001278 Ga0495626_0001278_8124_8645 172
624 3300048903 Ga0496100_0245396 Ga0496100_0245396_539_1060 172
625 3300048905 Ga0496102_1168793 Ga0496102_1168793_148_672 172
626 3300048914 Ga0496111_0169199 Ga0496111_0169199_32_553 172
627 3300049515 Ga0501292_033517 Ga0501292_033517_50_574 172
628 3300049522 Ga0501299_010781 Ga0501299_010781_288_812 172
629 3300049574 Ga0501038_0346742 Ga0501038_0346742_476_1003 172
630 3300049577 Ga0501041_0340215 Ga0501041_0340215_177_704 172
631 3300049578 Ga0501042_0061209 Ga0501042_0061209_1740_2261 172
632 3300049578 Ga0501042_0460714 Ga0501042_0460714_130_654 172
633 3300049580 Ga0501046_0405403 Ga0501046_0405403_327_848 172
634 3300049582 Ga0501048_0144138 Ga0501048_0144138_794_1321 172
635 3300049587 Ga0501071_0610224 Ga0501071_0610224_175_693 172
636 3300049588 Ga0501072_0433530 Ga0501072_0433530_19_546 172
637 3300049591 Ga0501075_0208892 Ga0501075_0208892_424_951 172
638 3300049592 Ga0501076_0068323 Ga0501076_0068323_2062_2586 172
639 3300049592 Ga0501076_0323974 Ga0501076_0323974_212_733 172
640 3300049592 Ga0501076_0554700 Ga0501076_0554700_395_913 172
641 3300049668 Ga0501233_099863 Ga0501233_099863_202_726 172
642 3300049679 Ga0501249_041481 Ga0501249_041481_107_631 172
643 3300049704 Ga0501221_020958 Ga0501221_020958_301_825 172
644 3300049708 Ga0501245_019463 Ga0501245_019463_177_701 172
645 3300049741 Ga0501079_0289560 Ga0501079_0289560_70_600 172
646 3300049743 Ga0501081_0123416 Ga0501081_0123416_278_805 172
647 3300049779 Ga0501283_002389 Ga0501283_002389_1361_1885 172
648 3300049824 Ga0501045_0085944 Ga0501045_0085944_1126_1647 172
649 3300050491 nmdc:mga00v17_14397_c1 nmdc:mga00v17_14397_c1_3468_4007 172
650 3300050493 nmdc:mga0k408_14304_c1 nmdc:mga0k408_14304_c1_529_1068 172
651 3300050494 nmdc:mga06z11_302837_c1 nmdc:mga06z11_302837_c1_277_816 172
652 3300050507 nmdc:mga05p37_445171_c1 nmdc:mga05p37_445171_c1_40_567 172
653 3300050507 nmdc:mga05p37_62226_c1 nmdc:mga05p37_62226_c1_939_1457 172
654 3300050507 nmdc:mga05p37_67440_c1 nmdc:mga05p37_67440_c1_2576_3133 172
655 3300050508 nmdc:mga09592_140920_c1 nmdc:mga09592_140920_c1_779_1297 172
656 3300050509 nmdc:mga0qj67_105479_c1 nmdc:mga0qj67_105479_c1_502_1020 172
657 3300050510 nmdc:mga06r32_120617_c1 nmdc:mga06r32_120617_c1_173_697 172
658 3300050510 nmdc:mga06r32_37428_c1 nmdc:mga06r32_37428_c1_195_713 172
659 3300050510 nmdc:mga06r32_761581_c1 nmdc:mga06r32_761581_c1_292_816 172
660 3300050510 nmdc:mga06r32_763540_c1 nmdc:mga06r32_763540_c1_185_703 172
661 3300050511 nmdc:mga08y16_627627_c1 nmdc:mga08y16_627627_c1_398_955 172
662 3300050512 nmdc:mga0n895_223668_c1 nmdc:mga0n895_223668_c1_68_631 172
663 3300050514 nmdc:mga08x19_182406_c1 nmdc:mga08x19_182406_c1_110_628 172
664 3300054114 Ga0501084_0110597 Ga0501084_0110597_170_691 172
665 3300054114 Ga0501084_0419371 Ga0501084_0419371_544_1062 172
666 3300054114 Ga0501084_0679944 Ga0501084_0679944_147_671 172
667 3300059478 Ga0587093_034489 Ga0587093_034489_92_616 172
668 3300059492 Ga0587073_0042039 Ga0587073_0042039_357_881 172
669 3300059626 Ga0587115_042911 Ga0587115_042911_74_598 172
670 3300059655 Ga0587114_044203 Ga0587114_044203_95_625 172
671 3300060353 Ga0501082_0094811 Ga0501082_0094811_1092_1613 172
672 3300060353 Ga0501082_0280222 Ga0501082_0280222_444_971 172
673 3300060353 Ga0501082_0990237 Ga0501082_0990237_94_618 172
674 3300061734 Ga0530510_0307814 Ga0530510_0307814_314_832 172
675 3300002705 JGI25156J39149_1002457 JGI25156J39149_10024576 173
676 3300003756 Ga0055533_1000106 Ga0055533_100010684 173
677 3300003758 Ga0055532_1000003 Ga0055532_1000003115 173
678 3300003760 Ga0055527_1000006 Ga0055527_1000006339 173
679 3300003761 Ga0055535_1000003 Ga0055535_1000003115 173
680 3300003762 Ga0055542_1000007 Ga0055542_1000007115 173
681 3300003763 Ga0055529_1000003 Ga0055529_1000003339 173
682 3300005339 Ga0070660_100014681 Ga0070660_1000146815 173
683 3300005366 Ga0070659_100978566 Ga0070659_1009785661 173
684 3300005530 Ga0070679_100126332 Ga0070679_1001263323 173
685 3300005530 Ga0070679_100144488 Ga0070679_1001444883 173
686 3300005536 Ga0070697_100475335 Ga0070697_1004753352 173
687 3300005539 Ga0068853_100031187 Ga0068853_1000311872 173
688 3300005563 Ga0068855_100862277 Ga0068855_1008622772 173
689 3300006051 Ga0075364_10199225 Ga0075364_101992253 173
690 3300006175 Ga0070712_100417814 Ga0070712_1004178141 173
691 3300006186 Ga0075369_10040665 Ga0075369_100406653 173
692 3300006358 Ga0068871_100409566 Ga0068871_1004095662 173
693 3300009011 Ga0105251_10014001 Ga0105251_100140013 173
694 3300009093 Ga0105240_10019674 Ga0105240_100196743 173
695 3300009093 Ga0105240_10078858 Ga0105240_100788584 173
696 3300009545 Ga0105237_10009973 Ga0105237_100099738 173
697 3300013105 Ga0157369_10337300 Ga0157369_103373002 173
698 3300013296 Ga0157374_10531112 Ga0157374_105311121 173
699 3300013307 Ga0157372_10722588 Ga0157372_107225882 173
700 3300013308 Ga0157375_10622696 Ga0157375_106226962 173
701 3300013308 Ga0157375_11581177 Ga0157375_115811772 173
702 3300025226 Ga0209674_100025 Ga0209674_100025115 173
703 3300025228 Ga0209672_100002 Ga0209672_1000021015 173
704 3300025229 Ga0209147_100003 Ga0209147_1000031015 173
705 3300025230 Ga0209563_111377 Ga0209563_1113773 173
706 3300025242 Ga0209258_100005 Ga0209258_100005657 173
707 3300025253 Ga0209677_116394 Ga0209677_1163942 173
708 3300025254 Ga0209148_1000006 Ga0209148_10000061015 173
709 3300025256 Ga0209759_1000014 Ga0209759_1000014340 173
710 3300025256 Ga0209759_1006576 Ga0209759_10065764 173
711 3300025272 Ga0209455_1000003 Ga0209455_10000031015 173
712 3300025735 Ga0207713_1096069 Ga0207713_10960691 173
713 3300025912 Ga0207707_10025774 Ga0207707_100257746 173
714 3300025913 Ga0207695_10045514 Ga0207695_100455143 173
715 3300025914 Ga0207671_10099225 Ga0207671_100992252 173
716 3300025919 Ga0207657_10055867 Ga0207657_100558673 173
717 3300025921 Ga0207652_10295542 Ga0207652_102955421 173
718 3300025921 Ga0207652_10711493 Ga0207652_107114932 173
719 3300025932 Ga0207690_10047734 Ga0207690_100477343 173
720 3300025933 Ga0207706_11178659 Ga0207706_111786591 173
721 3300025986 Ga0207658_10064416 Ga0207658_100644164 173
722 3300026041 Ga0207639_10032496 Ga0207639_100324961 173
723 3300026142 Ga0207698_10486250 Ga0207698_104862503 173
724 3300031852 Ga0307410_10179087 Ga0307410_101790872 173
725 3300032005 Ga0307411_11201590 Ga0307411_112015901 173
726 3300037466 Ga0395898_0001658 Ga0395898_0001658_1428_1964 173
727 3300046457 Ga0495590_0032781 Ga0495590_0032781_1105_1638 173
728 3300046492 Ga0495585_0148938 Ga0495585_0148938_628_1152 173
729 3300046500 Ga0495596_0096215 Ga0495596_0096215_33_557 173
730 3300046500 Ga0495596_0339655 Ga0495596_0339655_21_545 173
731 3300046507 Ga0495606_0091161 Ga0495606_0091161_639_1163 173
732 3300046518 Ga0495631_0004533 Ga0495631_0004533_1735_2259 173
733 3300046519 Ga0495632_0007394 Ga0495632_0007394_4498_5022 173
734 3300046522 Ga0495643_0049459 Ga0495643_0049459_38_562 173
735 3300046522 Ga0495643_0094119 Ga0495643_0094119_426_950 173
736 3300046523 Ga0495644_0162550 Ga0495644_0162550_68_592 173
737 3300046528 Ga0495642_0003234 Ga0495642_0003234_2050_2574 173
738 3300046538 Ga0495609_0003991 Ga0495609_0003991_5718_6242 173
739 3300046542 Ga0495597_0216174 Ga0495597_0216174_185_709 173
740 3300046648 Ga0495611_0002270 Ga0495611_0002270_3248_3772 173
741 3300046648 Ga0495611_0050329 Ga0495611_0050329_1339_1863 173
742 3300046660 Ga0495625_0338843 Ga0495625_0338843_389_913 173
743 3300046665 Ga0495661_0323104 Ga0495661_0323104_75_599 173
744 3300046665 Ga0495661_0330361 Ga0495661_0330361_209_733 173
745 3300046691 Ga0495670_0137747 Ga0495670_0137747_259_783 173
746 3300046794 Ga0495589_0067621 Ga0495589_0067621_34_558 173
747 3300046794 Ga0495589_0099556 Ga0495589_0099556_805_1329 173
748 3300046794 Ga0495589_0196506 Ga0495589_0196506_133_666 173
749 3300047322 Ga0495680_0032127 Ga0495680_0032127_1402_1935 173
750 3300047323 Ga0495683_0002553 Ga0495683_0002553_1665_2189 173
751 3300047443 Ga0495687_172039 Ga0495687_172039_137_670 173
752 3300047445 Ga0495677_0063317 Ga0495677_0063317_811_1335 173
753 3300047447 Ga0495685_194004 Ga0495685_194004_41_565 173
754 3300047470 Ga0495681_0033958 Ga0495681_0033958_1493_2017 173
755 3300048904 Ga0496101_0013740 Ga0496101_0013740_3345_3878 173
756 3300048906 Ga0496103_0040417 Ga0496103_0040417_89_622 173
757 3300048911 Ga0496108_0998013 Ga0496108_0998013_168_701 173
758 3300048912 Ga0496109_0975212 Ga0496109_0975212_27_560 173
759 3300048913 Ga0496110_0611254 Ga0496110_0611254_353_886 173
760 3300048915 Ga0496112_0136614 Ga0496112_0136614_627_1160 173
761 3300048916 Ga0496113_0092653 Ga0496113_0092653_445_978 173
762 3300048921 Ga0496118_0444891 Ga0496118_0444891_91_624 173
763 3300049460 Ga0495682_0003100 Ga0495682_0003100_6562_7086 173
764 3300049571 Ga0501034_1167028 Ga0501034_1167028_20_616 173
765 3300050491 nmdc:mga00v17_260819_c1 nmdc:mga00v17_260819_c1_289_864 173
766 3300053088 Ga0500644_0239339 Ga0500644_0239339_88_621 173
767 3300059424 Ga0590075_054046 Ga0590075_054046_453_974 173
768 3300005327 Ga0070658_10036995 Ga0070658_100369953 174
769 3300005328 Ga0070676_10712836 Ga0070676_107128361 174
770 3300005333 Ga0070677_10003597 Ga0070677_100035977 174
771 3300005341 Ga0070691_10447978 Ga0070691_104479781 174
772 3300005353 Ga0070669_100171445 Ga0070669_1001714452 174
773 3300005355 Ga0070671_100040564 Ga0070671_1000405642 174
774 3300005356 Ga0070674_100158544 Ga0070674_1001585441 174
775 3300005543 Ga0070672_100478189 Ga0070672_1004781892 174
776 3300005578 Ga0068854_100077457 Ga0068854_1000774573 174
777 3300005842 Ga0068858_101355116 Ga0068858_1013551161 174
778 3300009551 Ga0105238_10176551 Ga0105238_101765512 174
779 3300010375 Ga0105239_10572925 Ga0105239_105729251 174
780 3300013306 Ga0163162_10533462 Ga0163162_105334621 174
781 3300015261 Ga0182006_1095705 Ga0182006_10957052 174
782 3300015265 Ga0182005_1001056 Ga0182005_10010562 174
783 3300020070 Ga0206356_10294918 Ga0206356_102949181 174
784 3300025907 Ga0207645_10126009 Ga0207645_101260091 174
785 3300025909 Ga0207705_10056271 Ga0207705_100562712 174
786 3300025916 Ga0207663_10644323 Ga0207663_106443231 174
787 3300025919 Ga0207657_10086756 Ga0207657_100867563 174
788 3300025923 Ga0207681_10198258 Ga0207681_101982582 174
789 3300025926 Ga0207659_11210471 Ga0207659_112104711 174
790 3300025931 Ga0207644_10035242 Ga0207644_100352423 174
791 3300025937 Ga0207669_10102123 Ga0207669_101021231 174
792 3300025940 Ga0207691_10493836 Ga0207691_104938361 174
793 3300025945 Ga0207679_10996617 Ga0207679_109966171 174
794 3300025986 Ga0207658_10688639 Ga0207658_106886392 174
795 3300027614 Ga0209970_1063964 Ga0209970_10639641 174
796 3300027876 Ga0209974_10002822 Ga0209974_100028223 174
797 3300038996 Ga0242420_013092 Ga0242420_013092_209_772 174
798 3300042129 Ga0450891_009864 Ga0450891_009864_263_787 174
799 3300042876 Ga0451577_0269682 Ga0451577_0269682_869_1432 174
800 3300044712 Ga0453684_0652671 Ga0453684_0652671_358_921 174
801 3300047315 Ga0495581_0256804 Ga0495581_0256804_15_560 174
802 3300048908 Ga0496105_0499257 Ga0496105_0499257_377_928 174
803 3300048909 Ga0496106_0104305 Ga0496106_0104305_894_1457 174
804 3300048910 Ga0496107_0012066 Ga0496107_0012066_4593_5117 174
805 3300048916 Ga0496113_0118079 Ga0496113_0118079_128_679 174
806 3300048919 Ga0496116_0025686 Ga0496116_0025686_1945_2472 174
807 3300048919 Ga0496116_0060264 Ga0496116_0060264_28_579 174
808 3300048919 Ga0496116_0062618 Ga0496116_0062618_1768_2319 174
809 3300048920 Ga0496117_0062315 Ga0496117_0062315_236_787 174
810 3300048921 Ga0496118_0129227 Ga0496118_0129227_217_768 174
811 3300048924 Ga0496121_0092046 Ga0496121_0092046_1106_1657 174
812 3300048927 Ga0496124_0102662 Ga0496124_0102662_1745_2296 174
813 iso_pu_bacteria 2928157003 2928161052 174
814 iso_pu_bacteria 2928163908 2928166008 174
815 iso_pu_bacteria 2981990288 2981991279 174
816 3300044684 Ga0466966_0072692 Ga0466966_0072692_1534_2082 175
817 3300044693 Ga0466961_0093328 Ga0466961_0093328_986_1534 175
818 3300044765 Ga0466970_0036787 Ga0466970_0036787_493_1041 175
819 3300045049 Ga0466959_0042084 Ga0466959_0042084_1005_1553 175
820 2162886007 SwRhRL2b_contig_516664 SwRhRL2b_0479.00000370 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13628

DUF4142

Domain of unknown function (DUF4142)

21

164

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ffe-assembly2.cif.gz_B copm in the ag-bound form (by soaking) 0.8641 26 172
5fej-assembly4.cif.gz_D copm in the cu(i)-bound form 0.8625 27 172
2qf9-assembly1.cif.gz_B crystal structure of putative secreted protein duf305 from streptomyces coelicolor 0.8595 29 174
3bt5-assembly1.cif.gz_A crystal structure of duf305 fragment from deinococcus radiodurans 0.8591 29 172
5ffb-assembly1.cif.gz_A copm in the apo form 0.8581 27 172
ID Description Score Start End Superfamily
af_Q9CA10_47_189_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.9322 116 173 1.20.140.40
3fseA02 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8689 30 176 1.20.1260.10
5fejD00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8625 27 172 1.20.1260.10
3bt5A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8591 29 172 1.20.1260.10
5fejA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8583 27 172 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A2W4TGW5-F1-model_v4 DUF4142 domain-containing protein 1.001 24 174
AF-A0A2C9A4E8-F1-model_v4 deleted 1 33 176
AF-A0A419ZVP3-F1-model_v4 Putative outer membrane protein 0.9971 38 179
AF-A0A140HLC9-F1-model_v4 Membrane protein 0.9915 22 174
AF-A0A529MCR8-F1-model_v4 DUF4142 domain-containing protein 0.9911 35 173

Feature Viewer

pLDDT pTM Quality
88.96 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map