F482182
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 819 | 369 | 789 | 167 |
Family's Representative Sequence
| Representative Sequence | 3300039438|Ga0436360_0439840|Ga0436360_0439840_162_674 |
| Length | 170 |
| Sequence | MTLQRTDEDDTLMALDPLDVVERVLSAENLAFDRTDDGDIAFSLTGDWRDYEMWFAWRPDAECLQLCLSMDHKAAAGGARDGAHQLVNLINQRVWLGHFEVWADEGEVVFRHAMALPGAERPSMAQAASMIDAAMEAADRFFPAFNFLIAEGRTAEDAMASCMFETVGQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 3 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 4 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 5 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 6 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 7 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 8 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 9 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 10 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 11 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 12 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 13 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 14 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 15 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 16 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 17 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 18 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 19 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 20 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 21 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 22 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 23 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 24 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 25 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 26 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 27 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 28 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 29 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 30 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 31 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 32 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 33 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 40 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 122 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 123 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 174 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 183 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 184 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 186 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 187 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 191 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 194 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 195 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 198 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 199 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 202 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 203 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 208 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 217 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 221 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 222 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 223 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 224 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 225 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 226 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 227 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 230 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 231 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 232 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 233 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 234 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 235 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 236 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 237 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 238 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 239 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 240 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 241 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 242 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 291 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 294 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 295 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 299 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 300 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 301 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 302 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 303 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 304 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 305 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 306 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 307 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 308 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 309 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 319 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 320 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 323 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 324 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 325 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 326 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 327 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 328 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 329 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 330 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 331 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 332 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 334 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 335 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 336 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 337 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 338 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 339 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 340 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 341 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 342 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 343 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 344 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 345 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 346 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 347 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 348 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 349 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 351 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 352 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 354 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 355 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 356 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 357 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 358 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 359 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 360 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 361 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 363 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 365 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 366 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 367 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 368 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 369 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.97 |
| Metatranscriptomes | 0.37 |
| Isolates | 3.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.32 |
| Nodule | 0.24 |
| Rhizoplane | 3.66 |
| Rhizosphere | 69.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10026786 | 3300003215 | Bacteria | 2034 |
| 2 | JGI25153J46596_10033714 | 3300003215 | Bacteria | 1685 |
| 3 | rootH1_10009031 | 3300003316 | Bacteria | 3697 |
| 4 | Ga0055537_1001821 | 3300003773 | Bacteria | 7720 |
| 5 | Ga0055536_1005613 | 3300003781 | Bacteria | 6079 |
| 6 | Ga0055536_1005776 | 3300003781 | Bacteria | 5962 |
| 7 | Ga0055536_1005867 | 3300003781 | Bacteria | 5893 |
| 8 | Ga0055528_1007241 | 3300003790 | Bacteria | 4926 |
| 9 | Ga0055530_10001660 | 3300003791 | Bacteria | 15828 |
| 10 | Ga0055530_10007010 | 3300003791 | Bacteria | 4855 |
| 11 | Ga0055540_1031330 | 3300003792 | Bacteria | 1223 |
| 12 | Ga0055531_10000948 | 3300003794 | Bacteria | 23325 |
| 13 | Ga0055531_10001668 | 3300003794 | Bacteria | 15997 |
| 14 | Ga0055531_10002505 | 3300003794 | Bacteria | 12241 |
| 15 | Ga0055531_10016422 | 3300003794 | Bacteria | 3194 |
| 16 | Ga0055531_10065554 | 3300003794 | Bacteria | 863 |
| 17 | Ga0065165_1001299 | 3300005262 | Bacteria | 28025 |
| 18 | Ga0065165_1005120 | 3300005262 | Bacteria | 7591 |
| 19 | Ga0070658_10182987 | 3300005327 | Bacteria | 1764 |
| 20 | Ga0070658_10338648 | 3300005327 | Bacteria | 1286 |
| 21 | Ga0070658_11058063 | 3300005327 | Bacteria | 706 |
| 22 | Ga0070676_11213114 | 3300005328 | Bacteria | 574 |
| 23 | Ga0070670_100000035 | 3300005331 | Bacteria | 157570 |
| 24 | Ga0070670_100015841 | 3300005331 | Bacteria | 6469 |
| 25 | Ga0070670_100203772 | 3300005331 | Bacteria | 1719 |
| 26 | Ga0070670_101331338 | 3300005331 | Bacteria | 658 |
| 27 | Ga0070677_10326022 | 3300005333 | Bacteria | 788 |
| 28 | Ga0068869_100091453 | 3300005334 | Bacteria | 2289 |
| 29 | Ga0068869_101159370 | 3300005334 | Bacteria | 678 |
| 30 | Ga0070666_10058966 | 3300005335 | Bacteria | 2596 |
| 31 | Ga0070666_10060309 | 3300005335 | Bacteria | 2567 |
| 32 | Ga0070680_100008070 | 3300005336 | Bacteria | 8041 |
| 33 | Ga0070680_100052344 | 3300005336 | Bacteria | 3332 |
| 34 | Ga0068868_100069231 | 3300005338 | Bacteria | 2812 |
| 35 | Ga0070660_100428071 | 3300005339 | Bacteria | 1096 |
| 36 | Ga0070689_100345440 | 3300005340 | Bacteria | 1247 |
| 37 | Ga0070691_10006344 | 3300005341 | Bacteria | 5404 |
| 38 | Ga0070692_10215857 | 3300005345 | Bacteria | 1131 |
| 39 | Ga0070668_100002182 | 3300005347 | Bacteria | 14344 |
| 40 | Ga0070668_100003540 | 3300005347 | Bacteria | 11519 |
| 41 | Ga0070668_100003652 | 3300005347 | Bacteria | 11349 |
| 42 | Ga0070668_100007003 | 3300005347 | Bacteria | 8356 |
| 43 | Ga0070668_100011492 | 3300005347 | Bacteria | 6592 |
| 44 | Ga0070669_100021322 | 3300005353 | Bacteria | 4630 |
| 45 | Ga0070671_100007055 | 3300005355 | Bacteria | 8998 |
| 46 | Ga0070671_100060840 | 3300005355 | Bacteria | 3144 |
| 47 | Ga0070671_101058102 | 3300005355 | Bacteria | 712 |
| 48 | Ga0070674_100840396 | 3300005356 | Bacteria | 796 |
| 49 | Ga0070673_100178716 | 3300005364 | Bacteria | 1816 |
| 50 | Ga0070659_100008075 | 3300005366 | Bacteria | 7673 |
| 51 | Ga0070659_100019781 | 3300005366 | Bacteria | 5110 |
| 52 | Ga0070667_100000711 | 3300005367 | Bacteria | 32094 |
| 53 | Ga0070667_100028886 | 3300005367 | Bacteria | 4617 |
| 54 | Ga0070667_100038720 | 3300005367 | Bacteria | 3998 |
| 55 | Ga0070667_100063073 | 3300005367 | Bacteria | 3140 |
| 56 | Ga0070667_100203998 | 3300005367 | Bacteria | 1755 |
| 57 | Ga0070709_10676013 | 3300005434 | Bacteria | 801 |
| 58 | Ga0070678_100685511 | 3300005456 | Bacteria | 922 |
| 59 | Ga0070662_100038594 | 3300005457 | Bacteria | 3393 |
| 60 | Ga0070681_10028637 | 3300005458 | Bacteria | 5601 |
| 61 | Ga0070679_100040692 | 3300005530 | Bacteria | 4624 |
| 62 | Ga0070679_100068678 | 3300005530 | Bacteria | 3534 |
| 63 | Ga0070684_100833253 | 3300005535 | Bacteria | 863 |
| 64 | Ga0068853_100036715 | 3300005539 | Bacteria | 4168 |
| 65 | Ga0068853_100248127 | 3300005539 | Bacteria | 1633 |
| 66 | Ga0068853_100327918 | 3300005539 | Bacteria | 1420 |
| 67 | Ga0068853_100361875 | 3300005539 | Bacteria | 1352 |
| 68 | Ga0068853_101296962 | 3300005539 | Bacteria | 704 |
| 69 | Ga0070672_100726181 | 3300005543 | Bacteria | 871 |
| 70 | Ga0070665_100000433 | 3300005548 | Bacteria | 60988 |
| 71 | Ga0070665_100001010 | 3300005548 | Bacteria | 35486 |
| 72 | Ga0070665_100002102 | 3300005548 | Bacteria | 22306 |
| 73 | Ga0070665_100032211 | 3300005548 | Bacteria | 5276 |
| 74 | Ga0070665_100154207 | 3300005548 | Bacteria | 2299 |
| 75 | Ga0070665_100624307 | 3300005548 | Bacteria | 1091 |
| 76 | Ga0070665_101341945 | 3300005548 | Bacteria | 725 |
| 77 | Ga0068855_100030575 | 3300005563 | Bacteria | 6438 |
| 78 | Ga0068855_100044548 | 3300005563 | Bacteria | 5250 |
| 79 | Ga0068855_100048970 | 3300005563 | Bacteria | 4986 |
| 80 | Ga0068855_100136357 | 3300005563 | Bacteria | 2800 |
| 81 | Ga0068855_100209393 | 3300005563 | Bacteria | 2192 |
| 82 | Ga0068855_100499687 | 3300005563 | Bacteria | 1322 |
| 83 | Ga0068855_100633725 | 3300005563 | Bacteria | 1150 |
| 84 | Ga0068855_101479207 | 3300005563 | Bacteria | 698 |
| 85 | Ga0068855_101624985 | 3300005563 | Bacteria | 661 |
| 86 | Ga0070664_100184765 | 3300005564 | Bacteria | 1855 |
| 87 | Ga0070664_100204087 | 3300005564 | Bacteria | 1765 |
| 88 | Ga0070664_101028008 | 3300005564 | Bacteria | 775 |
| 89 | Ga0068857_100180497 | 3300005577 | Bacteria | 1921 |
| 90 | Ga0068857_100707406 | 3300005577 | Bacteria | 957 |
| 91 | Ga0068854_100149457 | 3300005578 | Bacteria | 1800 |
| 92 | Ga0068856_100161846 | 3300005614 | Bacteria | 2248 |
| 93 | Ga0068856_100702250 | 3300005614 | Bacteria | 1032 |
| 94 | Ga0068852_100612675 | 3300005616 | Bacteria | 1094 |
| 95 | Ga0068859_100002125 | 3300005617 | Bacteria | 20174 |
| 96 | Ga0068859_100067285 | 3300005617 | Bacteria | 3617 |
| 97 | Ga0068859_100115644 | 3300005617 | Bacteria | 2747 |
| 98 | Ga0068859_100231589 | 3300005617 | Bacteria | 1936 |
| 99 | Ga0068864_100000102 | 3300005618 | Bacteria | 82743 |
| 100 | Ga0068864_100000165 | 3300005618 | Bacteria | 60874 |
| 101 | Ga0068864_100008059 | 3300005618 | Bacteria | 8688 |
| 102 | Ga0068864_100027772 | 3300005618 | Bacteria | 4782 |
| 103 | Ga0068870_10067776 | 3300005840 | Bacteria | 1937 |
| 104 | Ga0068863_100000128 | 3300005841 | Bacteria | 79841 |
| 105 | Ga0068863_100002006 | 3300005841 | Bacteria | 20201 |
| 106 | Ga0068863_100009403 | 3300005841 | Bacteria | 9543 |
| 107 | Ga0068863_100037082 | 3300005841 | Bacteria | 4642 |
| 108 | Ga0068863_100095785 | 3300005841 | Bacteria | 2817 |
| 109 | Ga0068863_100599018 | 3300005841 | Bacteria | 1091 |
| 110 | Ga0068858_100000117 | 3300005842 | Bacteria | 83778 |
| 111 | Ga0068858_100015866 | 3300005842 | Bacteria | 7081 |
| 112 | Ga0068858_100143483 | 3300005842 | Bacteria | 2242 |
| 113 | Ga0068860_100000100 | 3300005843 | Bacteria | 144580 |
| 114 | Ga0068860_100000157 | 3300005843 | Bacteria | 110717 |
| 115 | Ga0068860_100012420 | 3300005843 | Bacteria | 8389 |
| 116 | Ga0068860_100033952 | 3300005843 | Bacteria | 4894 |
| 117 | Ga0068860_100574747 | 3300005843 | Bacteria | 1131 |
| 118 | Ga0068862_100000368 | 3300005844 | Bacteria | 48907 |
| 119 | Ga0068862_100003705 | 3300005844 | Bacteria | 13061 |
| 120 | Ga0068862_100040787 | 3300005844 | Bacteria | 3947 |
| 121 | Ga0068862_100536223 | 3300005844 | Bacteria | 1116 |
| 122 | Ga0068862_100572608 | 3300005844 | Bacteria | 1081 |
| 123 | Ga0070717_10033442 | 3300006028 | Bacteria | 4149 |
| 124 | Ga0070717_10130611 | 3300006028 | Bacteria | 2160 |
| 125 | Ga0075368_10001287 | 3300006042 | Bacteria | 7949 |
| 126 | Ga0075363_100145209 | 3300006048 | Bacteria | 1337 |
| 127 | Ga0075364_10000571 | 3300006051 | Bacteria | 18956 |
| 128 | Ga0075362_10060000 | 3300006177 | Bacteria | 1719 |
| 129 | Ga0075362_10139652 | 3300006177 | Bacteria | 1157 |
| 130 | Ga0075367_10002075 | 3300006178 | Bacteria | 8975 |
| 131 | Ga0075369_10017413 | 3300006186 | Bacteria | 2912 |
| 132 | Ga0075366_10045391 | 3300006195 | Bacteria | 2604 |
| 133 | Ga0075366_10055972 | 3300006195 | Bacteria | 2342 |
| 134 | Ga0075366_10487716 | 3300006195 | Bacteria | 761 |
| 135 | Ga0075370_10027781 | 3300006353 | Bacteria | 3142 |
| 136 | Ga0075370_10106302 | 3300006353 | Bacteria | 1627 |
| 137 | Ga0068865_100008084 | 3300006881 | Bacteria | 6494 |
| 138 | Ga0097620_100002125 | 3300006931 | Bacteria | 20174 |
| 139 | Ga0097620_100067286 | 3300006931 | Bacteria | 3617 |
| 140 | Ga0097620_100115648 | 3300006931 | Bacteria | 2747 |
| 141 | Ga0097620_100231602 | 3300006931 | Bacteria | 1936 |
| 142 | Ga0079104_1016114 | 3300006946 | Bacteria | 2194 |
| 143 | Ga0105240_10002229 | 3300009093 | Bacteria | 31523 |
| 144 | Ga0105240_10002462 | 3300009093 | Bacteria | 29759 |
| 145 | Ga0105240_10050501 | 3300009093 | Bacteria | 5242 |
| 146 | Ga0105240_10216262 | 3300009093 | Bacteria | 2236 |
| 147 | Ga0105240_10269047 | 3300009093 | Bacteria | 1963 |
| 148 | Ga0105240_10334737 | 3300009093 | Bacteria | 1721 |
| 149 | Ga0105240_10426048 | 3300009093 | Bacteria | 1490 |
| 150 | Ga0105240_10525981 | 3300009093 | Bacteria | 1312 |
| 151 | Ga0105240_10659693 | 3300009093 | Bacteria | 1146 |
| 152 | Ga0105240_10730752 | 3300009093 | Bacteria | 1078 |
| 153 | Ga0105240_11322185 | 3300009093 | Bacteria | 760 |
| 154 | Ga0105240_11725982 | 3300009093 | Bacteria | 653 |
| 155 | Ga0105245_10828490 | 3300009098 | Bacteria | 964 |
| 156 | Ga0105245_11031481 | 3300009098 | Bacteria | 868 |
| 157 | Ga0105247_10116207 | 3300009101 | Bacteria | 1728 |
| 158 | Ga0105247_10134749 | 3300009101 | Bacteria | 1613 |
| 159 | Ga0105241_10266098 | 3300009174 | Bacteria | 1459 |
| 160 | Ga0105242_10255803 | 3300009176 | Bacteria | 1580 |
| 161 | Ga0105242_10408070 | 3300009176 | Bacteria | 1270 |
| 162 | Ga0105242_10518592 | 3300009176 | Bacteria | 1137 |
| 163 | Ga0105248_10000106 | 3300009177 | Bacteria | 93898 |
| 164 | Ga0105248_10024660 | 3300009177 | Bacteria | 6688 |
| 165 | Ga0105248_10107846 | 3300009177 | Bacteria | 3140 |
| 166 | Ga0105248_10110698 | 3300009177 | Bacteria | 3097 |
| 167 | Ga0105248_10114333 | 3300009177 | Bacteria | 3044 |
| 168 | Ga0105248_10139129 | 3300009177 | Bacteria | 2738 |
| 169 | Ga0105248_10182848 | 3300009177 | Bacteria | 2362 |
| 170 | Ga0105248_10318324 | 3300009177 | Bacteria | 1752 |
| 171 | Ga0105248_10544814 | 3300009177 | Bacteria | 1309 |
| 172 | Ga0105248_10962852 | 3300009177 | Bacteria | 964 |
| 173 | Ga0105248_11215731 | 3300009177 | Bacteria | 852 |
| 174 | Ga0105237_10544955 | 3300009545 | Bacteria | 1167 |
| 175 | Ga0105237_10971857 | 3300009545 | Bacteria | 856 |
| 176 | Ga0105238_10041921 | 3300009551 | Bacteria | 4636 |
| 177 | Ga0105238_10076763 | 3300009551 | Bacteria | 3333 |
| 178 | Ga0105238_10114475 | 3300009551 | Bacteria | 2676 |
| 179 | Ga0105238_10177065 | 3300009551 | Bacteria | 2109 |
| 180 | Ga0105238_10643718 | 3300009551 | Bacteria | 1070 |
| 181 | Ga0105238_10781535 | 3300009551 | Bacteria | 970 |
| 182 | Ga0105238_11198423 | 3300009551 | Bacteria | 784 |
| 183 | Ga0105238_11358182 | 3300009551 | Bacteria | 737 |
| 184 | Ga0105249_10000525 | 3300009553 | Bacteria | 35250 |
| 185 | Ga0105249_10086152 | 3300009553 | Bacteria | 2929 |
| 186 | Ga0105249_10774763 | 3300009553 | Bacteria | 1022 |
| 187 | Ga0105239_10130044 | 3300010375 | Bacteria | 2800 |
| 188 | Ga0105239_10381679 | 3300010375 | Bacteria | 1593 |
| 189 | Ga0105239_10765506 | 3300010375 | Bacteria | 1105 |
| 190 | Ga0105239_11797574 | 3300010375 | Bacteria | 710 |
| 191 | Ga0105246_11112268 | 3300011119 | Bacteria | 722 |
| 192 | Ga0157319_1002288 | 3300012497 | Bacteria | 1086 |
| 193 | Ga0157373_10003275 | 3300013100 | Bacteria | 12233 |
| 194 | Ga0157373_10386818 | 3300013100 | Bacteria | 1001 |
| 195 | Ga0157370_10025476 | 3300013104 | Bacteria | 5856 |
| 196 | Ga0157370_10255378 | 3300013104 | Bacteria | 1621 |
| 197 | Ga0157369_10582660 | 3300013105 | Bacteria | 1155 |
| 198 | Ga0157369_11087671 | 3300013105 | Bacteria | 817 |
| 199 | Ga0157374_12619687 | 3300013296 | Bacteria | 532 |
| 200 | Ga0157378_11409501 | 3300013297 | Bacteria | 740 |
| 201 | Ga0157378_12451267 | 3300013297 | Bacteria | 574 |
| 202 | Ga0163162_10143578 | 3300013306 | Bacteria | 2501 |
| 203 | Ga0163162_10238917 | 3300013306 | Bacteria | 1947 |
| 204 | Ga0163162_10280639 | 3300013306 | Bacteria | 1798 |
| 205 | Ga0163162_10358644 | 3300013306 | Bacteria | 1591 |
| 206 | Ga0163162_11791954 | 3300013306 | Bacteria | 702 |
| 207 | Ga0157372_10145769 | 3300013307 | Bacteria | 2730 |
| 208 | Ga0157372_10522129 | 3300013307 | Bacteria | 1384 |
| 209 | Ga0157375_11001186 | 3300013308 | Bacteria | 975 |
| 210 | Ga0157375_11801825 | 3300013308 | Bacteria | 726 |
| 211 | Ga0163163_10003142 | 3300014325 | Bacteria | 14001 |
| 212 | Ga0163163_10003291 | 3300014325 | Bacteria | 13699 |
| 213 | Ga0163163_10110592 | 3300014325 | Bacteria | 2776 |
| 214 | Ga0163163_10376672 | 3300014325 | Bacteria | 1477 |
| 215 | Ga0163163_10583366 | 3300014325 | Bacteria | 1181 |
| 216 | Ga0163163_12284813 | 3300014325 | Bacteria | 600 |
| 217 | Ga0157380_10206005 | 3300014326 | Bacteria | 1749 |
| 218 | Ga0157380_10670849 | 3300014326 | Bacteria | 1037 |
| 219 | Ga0157377_10133995 | 3300014745 | Bacteria | 1516 |
| 220 | Ga0157377_10929055 | 3300014745 | Bacteria | 653 |
| 221 | Ga0157379_10009657 | 3300014968 | Bacteria | 8397 |
| 222 | Ga0157379_10023061 | 3300014968 | Bacteria | 5518 |
| 223 | Ga0157379_10027619 | 3300014968 | Bacteria | 5053 |
| 224 | Ga0157379_10192977 | 3300014968 | Bacteria | 1841 |
| 225 | Ga0157376_10539196 | 3300014969 | Bacteria | 1153 |
| 226 | Ga0157376_11211660 | 3300014969 | Bacteria | 783 |
| 227 | Ga0182007_10062552 | 3300015262 | Bacteria | 1220 |
| 228 | Ga0213874_10026951 | 3300021377 | Bacteria | 1631 |
| 229 | Ga0213874_10196440 | 3300021377 | Bacteria | 724 |
| 230 | Ga0213876_10000276 | 3300021384 | Bacteria | 47195 |
| 231 | Ga0213875_10069405 | 3300021388 | Bacteria | 1646 |
| 232 | Ga0213875_10251597 | 3300021388 | Bacteria | 833 |
| 233 | Ga0213875_10325914 | 3300021388 | Bacteria | 728 |
| 234 | Ga0213871_10045895 | 3300021441 | Bacteria | 1185 |
| 235 | Ga0209026_1002959 | 3300025250 | Bacteria | 5915 |
| 236 | Ga0209565_1000402 | 3300025263 | Bacteria | 36267 |
| 237 | Ga0209673_1000956 | 3300025273 | Bacteria | 36077 |
| 238 | Ga0209673_1044805 | 3300025273 | Bacteria | 1222 |
| 239 | Ga0209675_1032346 | 3300025291 | Bacteria | 1225 |
| 240 | Ga0209676_1000252 | 3300025292 | Bacteria | 113425 |
| 241 | Ga0209676_1000467 | 3300025292 | Bacteria | 67659 |
| 242 | Ga0209676_1000560 | 3300025292 | Bacteria | 56233 |
| 243 | Ga0209676_1003120 | 3300025292 | Bacteria | 10631 |
| 244 | Ga0209564_1018585 | 3300025295 | Bacteria | 2641 |
| 245 | Ga0209758_1000334 | 3300025297 | Bacteria | 88149 |
| 246 | Ga0209758_1002021 | 3300025297 | Bacteria | 21830 |
| 247 | Ga0209758_1002093 | 3300025297 | Bacteria | 21212 |
| 248 | Ga0209050_1000130 | 3300025298 | Bacteria | 186070 |
| 249 | Ga0209050_1000461 | 3300025298 | Bacteria | 72912 |
| 250 | Ga0209050_1001568 | 3300025298 | Bacteria | 23778 |
| 251 | Ga0209050_1009109 | 3300025298 | Bacteria | 5149 |
| 252 | Ga0209050_1011749 | 3300025298 | Bacteria | 4108 |
| 253 | Ga0209256_1005220 | 3300025299 | Bacteria | 7624 |
| 254 | Ga0209256_1010924 | 3300025299 | Bacteria | 3720 |
| 255 | Ga0209051_1009272 | 3300025303 | Bacteria | 5088 |
| 256 | Ga0209257_1000059 | 3300025304 | Bacteria | 378097 |
| 257 | Ga0209257_1000060 | 3300025304 | Bacteria | 372267 |
| 258 | Ga0209257_1000186 | 3300025304 | Bacteria | 154365 |
| 259 | Ga0209257_1000406 | 3300025304 | Bacteria | 83846 |
| 260 | Ga0209257_1001256 | 3300025304 | Bacteria | 31336 |
| 261 | Ga0209257_1010228 | 3300025304 | Bacteria | 4803 |
| 262 | Ga0207680_10062871 | 3300025903 | Bacteria | 2270 |
| 263 | Ga0207705_10000859 | 3300025909 | Bacteria | 24922 |
| 264 | Ga0207705_10117812 | 3300025909 | Bacteria | 1968 |
| 265 | Ga0207705_10204376 | 3300025909 | Bacteria | 1497 |
| 266 | Ga0207654_10337347 | 3300025911 | Bacteria | 1035 |
| 267 | Ga0207707_10052652 | 3300025912 | Bacteria | 3543 |
| 268 | Ga0207707_10890637 | 3300025912 | Bacteria | 736 |
| 269 | Ga0207695_10001222 | 3300025913 | Bacteria | 44042 |
| 270 | Ga0207695_10005699 | 3300025913 | Bacteria | 16425 |
| 271 | Ga0207695_10016532 | 3300025913 | Bacteria | 8626 |
| 272 | Ga0207695_10019866 | 3300025913 | Bacteria | 7719 |
| 273 | Ga0207695_10023959 | 3300025913 | Bacteria | 6884 |
| 274 | Ga0207695_10145852 | 3300025913 | Bacteria | 2311 |
| 275 | Ga0207695_10219787 | 3300025913 | Bacteria | 1807 |
| 276 | Ga0207695_10454851 | 3300025913 | Bacteria | 1163 |
| 277 | Ga0207695_10459193 | 3300025913 | Bacteria | 1157 |
| 278 | Ga0207671_11146150 | 3300025914 | Bacteria | 610 |
| 279 | Ga0207660_10005314 | 3300025917 | Bacteria | 8373 |
| 280 | Ga0207660_10481794 | 3300025917 | Bacteria | 1005 |
| 281 | Ga0207657_10027665 | 3300025919 | Bacteria | 5189 |
| 282 | Ga0207657_10103236 | 3300025919 | Bacteria | 2363 |
| 283 | Ga0207652_10039756 | 3300025921 | Bacteria | 3992 |
| 284 | Ga0207652_10040277 | 3300025921 | Bacteria | 3967 |
| 285 | Ga0207681_10058651 | 3300025923 | Bacteria | 2636 |
| 286 | Ga0207681_10275273 | 3300025923 | Bacteria | 1323 |
| 287 | Ga0207694_10044000 | 3300025924 | Bacteria | 3447 |
| 288 | Ga0207694_10123458 | 3300025924 | Bacteria | 2069 |
| 289 | Ga0207694_10193276 | 3300025924 | Bacteria | 1654 |
| 290 | Ga0207694_10218439 | 3300025924 | Bacteria | 1554 |
| 291 | Ga0207694_10360980 | 3300025924 | Bacteria | 1204 |
| 292 | Ga0207650_10000327 | 3300025925 | Bacteria | 46298 |
| 293 | Ga0207650_10029430 | 3300025925 | Bacteria | 3949 |
| 294 | Ga0207650_10139751 | 3300025925 | Bacteria | 1903 |
| 295 | Ga0207650_10174134 | 3300025925 | Bacteria | 1712 |
| 296 | Ga0207650_10200024 | 3300025925 | Bacteria | 1600 |
| 297 | Ga0207700_11313437 | 3300025928 | Bacteria | 644 |
| 298 | Ga0207644_10008067 | 3300025931 | Bacteria | 6891 |
| 299 | Ga0207644_10113844 | 3300025931 | Bacteria | 2049 |
| 300 | Ga0207690_10000159 | 3300025932 | Bacteria | 52852 |
| 301 | Ga0207690_10014486 | 3300025932 | Bacteria | 4762 |
| 302 | Ga0207690_10077040 | 3300025932 | Bacteria | 2317 |
| 303 | Ga0207706_10193522 | 3300025933 | Bacteria | 1784 |
| 304 | Ga0207706_10281543 | 3300025933 | Bacteria | 1450 |
| 305 | Ga0207686_10084875 | 3300025934 | Bacteria | 2076 |
| 306 | Ga0207686_10191571 | 3300025934 | Bacteria | 1458 |
| 307 | Ga0207704_10011221 | 3300025938 | Bacteria | 4405 |
| 308 | Ga0207691_10740987 | 3300025940 | Bacteria | 828 |
| 309 | Ga0207711_10000098 | 3300025941 | Bacteria | 92296 |
| 310 | Ga0207711_10007949 | 3300025941 | Bacteria | 8872 |
| 311 | Ga0207711_10047091 | 3300025941 | Bacteria | 3686 |
| 312 | Ga0207711_10060134 | 3300025941 | Bacteria | 3273 |
| 313 | Ga0207711_10067455 | 3300025941 | Bacteria | 3097 |
| 314 | Ga0207711_10077333 | 3300025941 | Bacteria | 2900 |
| 315 | Ga0207711_10511688 | 3300025941 | Bacteria | 1119 |
| 316 | Ga0207679_10043649 | 3300025945 | Bacteria | 3230 |
| 317 | Ga0207667_10004660 | 3300025949 | Bacteria | 16802 |
| 318 | Ga0207667_10032201 | 3300025949 | Bacteria | 5652 |
| 319 | Ga0207667_10080415 | 3300025949 | Bacteria | 3376 |
| 320 | Ga0207667_10203744 | 3300025949 | Bacteria | 2029 |
| 321 | Ga0207667_11305497 | 3300025949 | Bacteria | 702 |
| 322 | Ga0207667_11403068 | 3300025949 | Bacteria | 672 |
| 323 | Ga0207651_10125994 | 3300025960 | Bacteria | 1951 |
| 324 | Ga0207712_10001643 | 3300025961 | Bacteria | 15061 |
| 325 | Ga0207712_10271478 | 3300025961 | Bacteria | 1380 |
| 326 | Ga0207668_10000025 | 3300025972 | Bacteria | 131733 |
| 327 | Ga0207668_10000035 | 3300025972 | Bacteria | 119182 |
| 328 | Ga0207668_10001450 | 3300025972 | Bacteria | 13923 |
| 329 | Ga0207668_10001848 | 3300025972 | Bacteria | 12357 |
| 330 | Ga0207668_10009511 | 3300025972 | Bacteria | 5833 |
| 331 | Ga0207668_10033907 | 3300025972 | Bacteria | 3385 |
| 332 | Ga0207668_10065020 | 3300025972 | Bacteria | 2580 |
| 333 | Ga0207640_10092228 | 3300025981 | Bacteria | 2101 |
| 334 | Ga0207658_10000300 | 3300025986 | Bacteria | 51413 |
| 335 | Ga0207658_10012188 | 3300025986 | Bacteria | 5866 |
| 336 | Ga0207658_10017296 | 3300025986 | Bacteria | 4967 |
| 337 | Ga0207658_10027675 | 3300025986 | Bacteria | 3986 |
| 338 | Ga0207677_10045134 | 3300026023 | Bacteria | 2942 |
| 339 | Ga0207677_10740962 | 3300026023 | Bacteria | 875 |
| 340 | Ga0207703_10002585 | 3300026035 | Bacteria | 15635 |
| 341 | Ga0207703_10004356 | 3300026035 | Bacteria | 11636 |
| 342 | Ga0207703_10159117 | 3300026035 | Bacteria | 1977 |
| 343 | Ga0207703_10528394 | 3300026035 | Bacteria | 1110 |
| 344 | Ga0207639_10014145 | 3300026041 | Bacteria | 5603 |
| 345 | Ga0207639_10027056 | 3300026041 | Bacteria | 4174 |
| 346 | Ga0207639_10174365 | 3300026041 | Bacteria | 1824 |
| 347 | Ga0207639_10301901 | 3300026041 | Bacteria | 1416 |
| 348 | Ga0207639_10488057 | 3300026041 | Bacteria | 1124 |
| 349 | Ga0207678_10567848 | 3300026067 | Bacteria | 993 |
| 350 | Ga0207702_10892307 | 3300026078 | Bacteria | 881 |
| 351 | Ga0207702_11784625 | 3300026078 | Bacteria | 607 |
| 352 | Ga0207641_10000005 | 3300026088 | Bacteria | 470841 |
| 353 | Ga0207641_10000777 | 3300026088 | Bacteria | 34097 |
| 354 | Ga0207641_10000994 | 3300026088 | Bacteria | 29003 |
| 355 | Ga0207641_10047447 | 3300026088 | Bacteria | 3622 |
| 356 | Ga0207641_10243404 | 3300026088 | Bacteria | 1677 |
| 357 | Ga0207641_10284968 | 3300026088 | Bacteria | 1555 |
| 358 | Ga0207641_10416041 | 3300026088 | Bacteria | 1293 |
| 359 | Ga0207648_10206864 | 3300026089 | Bacteria | 1741 |
| 360 | Ga0207648_11125127 | 3300026089 | Bacteria | 737 |
| 361 | Ga0207676_10000066 | 3300026095 | Bacteria | 105425 |
| 362 | Ga0207676_10000145 | 3300026095 | Bacteria | 61785 |
| 363 | Ga0207676_10006892 | 3300026095 | Bacteria | 8051 |
| 364 | Ga0207676_10088804 | 3300026095 | Bacteria | 2531 |
| 365 | Ga0207674_10277098 | 3300026116 | Bacteria | 1625 |
| 366 | Ga0207674_10354915 | 3300026116 | Bacteria | 1417 |
| 367 | Ga0207675_100086350 | 3300026118 | Bacteria | 2946 |
| 368 | Ga0207675_100566011 | 3300026118 | Bacteria | 1137 |
| 369 | Ga0207675_100585934 | 3300026118 | Bacteria | 1117 |
| 370 | Ga0207683_11043367 | 3300026121 | Bacteria | 759 |
| 371 | Ga0207698_10384166 | 3300026142 | Bacteria | 1337 |
| 372 | Ga0207698_10424664 | 3300026142 | Bacteria | 1276 |
| 373 | Ga0209281_1034369 | 3300027111 | Bacteria | 886 |
| 374 | Ga0209968_1057566 | 3300027526 | Bacteria | 682 |
| 375 | Ga0209999_1006580 | 3300027543 | Bacteria | 2087 |
| 376 | Ga0209983_1002147 | 3300027665 | Bacteria | 4348 |
| 377 | Ga0209813_10012213 | 3300027866 | Bacteria | 2264 |
| 378 | Ga0209974_10363604 | 3300027876 | Bacteria | 563 |
| 379 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 380 | Ga0268266_10000814 | 3300028379 | Bacteria | 41101 |
| 381 | Ga0268266_10002311 | 3300028379 | Bacteria | 20672 |
| 382 | Ga0268266_10015863 | 3300028379 | Bacteria | 6447 |
| 383 | Ga0268266_10086133 | 3300028379 | Bacteria | 2746 |
| 384 | Ga0268266_10464906 | 3300028379 | Bacteria | 1204 |
| 385 | Ga0268265_10002522 | 3300028380 | Bacteria | 13705 |
| 386 | Ga0268265_10010073 | 3300028380 | Bacteria | 6380 |
| 387 | Ga0268265_10078212 | 3300028380 | Bacteria | 2601 |
| 388 | Ga0268265_10096513 | 3300028380 | Bacteria | 2376 |
| 389 | Ga0268265_10842456 | 3300028380 | Bacteria | 897 |
| 390 | Ga0268265_11048387 | 3300028380 | Bacteria | 807 |
| 391 | Ga0268264_10000002 | 3300028381 | Bacteria | 1153045 |
| 392 | Ga0268264_10000211 | 3300028381 | Bacteria | 117108 |
| 393 | Ga0268264_10250574 | 3300028381 | Bacteria | 1645 |
| 394 | Ga0265326_10022728 | 3300028558 | Bacteria | 1795 |
| 395 | Ga0265319_1077553 | 3300028563 | Bacteria | 1058 |
| 396 | Ga0265334_10010373 | 3300028573 | Bacteria | 3936 |
| 397 | Ga0265334_10046570 | 3300028573 | Bacteria | 1676 |
| 398 | Ga0265318_10112381 | 3300028577 | Bacteria | 1001 |
| 399 | Ga0307517_10003214 | 3300028786 | Bacteria | 25648 |
| 400 | Ga0307517_10114040 | 3300028786 | Bacteria | 2036 |
| 401 | Ga0307517_10176060 | 3300028786 | Bacteria | 1393 |
| 402 | Ga0307515_10016786 | 3300028794 | Bacteria | 13388 |
| 403 | Ga0307515_10498621 | 3300028794 | Bacteria | 828 |
| 404 | Ga0265338_10007642 | 3300028800 | Bacteria | 13336 |
| 405 | Ga0265338_10069826 | 3300028800 | Bacteria | 3016 |
| 406 | Ga0265338_10097782 | 3300028800 | Bacteria | 2403 |
| 407 | Ga0265338_10165419 | 3300028800 | Bacteria | 1703 |
| 408 | Ga0265338_10234014 | 3300028800 | Bacteria | 1365 |
| 409 | Ga0265338_10447921 | 3300028800 | Bacteria | 914 |
| 410 | Ga0265324_10103409 | 3300029957 | Bacteria | 968 |
| 411 | Ga0307511_10048715 | 3300030521 | Bacteria | 3443 |
| 412 | Ga0265760_10075254 | 3300031090 | Bacteria | 1040 |
| 413 | Ga0265330_10216422 | 3300031235 | Bacteria | 809 |
| 414 | Ga0265320_10173992 | 3300031240 | Bacteria | 967 |
| 415 | Ga0265320_10228339 | 3300031240 | Bacteria | 828 |
| 416 | Ga0265320_10448505 | 3300031240 | Bacteria | 570 |
| 417 | Ga0265340_10028890 | 3300031247 | Bacteria | 2787 |
| 418 | Ga0265327_10000454 | 3300031251 | Bacteria | 73503 |
| 419 | Ga0265327_10001513 | 3300031251 | Bacteria | 28744 |
| 420 | Ga0265327_10002802 | 3300031251 | Bacteria | 17599 |
| 421 | Ga0265327_10109117 | 3300031251 | Bacteria | 1325 |
| 422 | Ga0307513_10000053 | 3300031456 | Bacteria | 149356 |
| 423 | Ga0307513_10000790 | 3300031456 | Bacteria | 45976 |
| 424 | Ga0307513_10004139 | 3300031456 | Bacteria | 19425 |
| 425 | Ga0307513_10364128 | 3300031456 | Bacteria | 1190 |
| 426 | Ga0307513_10501814 | 3300031456 | Bacteria | 930 |
| 427 | Ga0307513_10509514 | 3300031456 | Bacteria | 920 |
| 428 | Ga0307408_100794359 | 3300031548 | Bacteria | 858 |
| 429 | Ga0307514_10358057 | 3300031649 | Bacteria | 773 |
| 430 | Ga0265314_10042221 | 3300031711 | Bacteria | 3256 |
| 431 | Ga0265314_10118869 | 3300031711 | Bacteria | 1667 |
| 432 | Ga0265314_10234529 | 3300031711 | Bacteria | 1062 |
| 433 | Ga0265342_10510319 | 3300031712 | Bacteria | 613 |
| 434 | Ga0307516_10000019 | 3300031730 | Bacteria | 196679 |
| 435 | Ga0307413_11896830 | 3300031824 | Bacteria | 535 |
| 436 | Ga0307406_10008222 | 3300031901 | Bacteria | 5815 |
| 437 | Ga0307406_10959787 | 3300031901 | Bacteria | 731 |
| 438 | Ga0307412_10006570 | 3300031911 | Bacteria | 6585 |
| 439 | Ga0307412_10549258 | 3300031911 | Bacteria | 970 |
| 440 | Ga0307412_11439022 | 3300031911 | Bacteria | 625 |
| 441 | Ga0307414_10056617 | 3300032004 | Bacteria | 2751 |
| 442 | Ga0307414_10264532 | 3300032004 | Bacteria | 1437 |
| 443 | Ga0307414_10377663 | 3300032004 | Bacteria | 1224 |
| 444 | Ga0307414_10396544 | 3300032004 | Bacteria | 1197 |
| 445 | Ga0307411_10202201 | 3300032005 | Bacteria | 1527 |
| 446 | Ga0307411_10927407 | 3300032005 | Bacteria | 775 |
| 447 | Ga0307510_10032424 | 3300033180 | Bacteria | 5886 |
| 448 | Ga0307510_10090503 | 3300033180 | Bacteria | 2906 |
| 449 | Ga0307510_10291518 | 3300033180 | Bacteria | 1097 |
| 450 | Ga0307510_10372633 | 3300033180 | Bacteria | 874 |
| 451 | Ga0307510_10441553 | 3300033180 | Bacteria | 742 |
| 452 | Ga0373934_0308535 | 3300035086 | Bacteria | 657 |
| 453 | Ga0373936_0003687 | 3300035113 | Bacteria | 5750 |
| 454 | Ga0373943_0040693 | 3300035170 | Bacteria | 2245 |
| 455 | Ga0373943_0273108 | 3300035170 | Bacteria | 954 |
| 456 | Ga0373927_0003786 | 3300035695 | Bacteria | 10732 |
| 457 | Ga0373933_0397796 | 3300035724 | Bacteria | 898 |
| 458 | Ga0373933_0596593 | 3300035724 | Bacteria | 725 |
| 459 | Ga0373947_0044772 | 3300035725 | Bacteria | 2647 |
| 460 | Ga0373937_0165947 | 3300036401 | Bacteria | 2071 |
| 461 | Ga0373937_0403589 | 3300036401 | Bacteria | 1297 |
| 462 | Ga0373937_0588225 | 3300036401 | Bacteria | 1057 |
| 463 | Ga0373937_1115188 | 3300036401 | Bacteria | 738 |
| 464 | Ga0373937_1350595 | 3300036401 | Bacteria | 661 |
| 465 | Ga0373925_0004623 | 3300037068 | Bacteria | 10393 |
| 466 | Ga0373925_0169409 | 3300037068 | Bacteria | 1724 |
| 467 | Ga0395899_0000373 | 3300037312 | Bacteria | 53717 |
| 468 | Ga0395899_0145085 | 3300037312 | Bacteria | 1686 |
| 469 | Ga0395899_0145401 | 3300037312 | Bacteria | 1684 |
| 470 | Ga0395899_0356435 | 3300037312 | Bacteria | 977 |
| 471 | Ga0395900_0000052 | 3300037418 | Bacteria | 223910 |
| 472 | Ga0395900_0041082 | 3300037418 | Bacteria | 4769 |
| 473 | Ga0395900_0136998 | 3300037418 | Bacteria | 2508 |
| 474 | Ga0395900_0844447 | 3300037418 | Bacteria | 841 |
| 475 | Ga0395898_0013380 | 3300037466 | Bacteria | 8450 |
| 476 | Ga0395898_0129364 | 3300037466 | Bacteria | 2419 |
| 477 | Ga0395898_0485355 | 3300037466 | Bacteria | 1175 |
| 478 | Ga0395898_0529023 | 3300037466 | Bacteria | 1120 |
| 479 | Ga0395905_0068111 | 3300037471 | Bacteria | 3334 |
| 480 | Ga0395905_0081001 | 3300037471 | Bacteria | 3042 |
| 481 | Ga0395905_0085608 | 3300037471 | Bacteria | 2953 |
| 482 | Ga0395905_0102722 | 3300037471 | Bacteria | 2684 |
| 483 | Ga0395905_0267554 | 3300037471 | Bacteria | 1595 |
| 484 | Ga0395905_0370997 | 3300037471 | Bacteria | 1324 |
| 485 | Ga0436364_0868872 | 3300037853 | Bacteria | 4328 |
| 486 | Ga0436364_0877114 | 3300037853 | Bacteria | 3622 |
| 487 | Ga0436364_1032895 | 3300037853 | Bacteria | 2501 |
| 488 | Ga0436364_1504159 | 3300037853 | Bacteria | 1593 |
| 489 | Ga0395901_0000001 | 3300038443 | Bacteria | 800383 |
| 490 | Ga0395901_0104718 | 3300038443 | Bacteria | 2969 |
| 491 | Ga0395901_0121355 | 3300038443 | Bacteria | 2747 |
| 492 | Ga0395901_0153468 | 3300038443 | Bacteria | 2419 |
| 493 | Ga0395901_0475891 | 3300038443 | Bacteria | 1275 |
| 494 | Ga0395901_0487686 | 3300038443 | Bacteria | 1256 |
| 495 | Ga0395901_0533798 | 3300038443 | Bacteria | 1190 |
| 496 | Ga0436365_0608786 | 3300039437 | Bacteria | 20013 |
| 497 | Ga0436365_1252750 | 3300039437 | Bacteria | 3895 |
| 498 | Ga0436365_1365943 | 3300039437 | Bacteria | 4989 |
| 499 | Ga0436360_0439840 | 3300039438 | Bacteria | 5562 |
| 500 | Ga0436360_0606916 | 3300039438 | Bacteria | 884 |
| 501 | Ga0436361_0315073 | 3300039447 | Bacteria | 579 |
| 502 | Ga0436361_0870135 | 3300039447 | Bacteria | 604 |
| 503 | Ga0436361_1100879 | 3300039447 | Bacteria | 23663 |
| 504 | Ga0436363_0535485 | 3300039450 | Bacteria | 1549 |
| 505 | Ga0436363_0783676 | 3300039450 | Bacteria | 996 |
| 506 | Ga0436363_1290520 | 3300039450 | Bacteria | 4834 |
| 507 | Ga0436362_0542815 | 3300039453 | Bacteria | 946 |
| 508 | Ga0436362_0836285 | 3300039453 | Bacteria | 1185 |
| 509 | Ga0451791_1365756 | 3300041451 | Bacteria | 561 |
| 510 | Ga0451800_0223665 | 3300041459 | Bacteria | 583 |
| 511 | Ga0451853_1586036 | 3300041512 | Bacteria | 1368 |
| 512 | Ga0439445_0023404 | 3300042004 | Bacteria | 1564 |
| 513 | Ga0439446_0008299 | 3300042156 | Bacteria | 2754 |
| 514 | Ga0439446_0075290 | 3300042156 | Bacteria | 1038 |
| 515 | Ga0439435_0009519 | 3300042436 | Bacteria | 2281 |
| 516 | Ga0466972_0406248 | 3300044658 | Bacteria | 638 |
| 517 | Ga0466965_0174766 | 3300044683 | Bacteria | 1131 |
| 518 | Ga0466966_0134742 | 3300044684 | Bacteria | 1511 |
| 519 | Ga0466964_0028853 | 3300044706 | Bacteria | 2188 |
| 520 | Ga0453684_0267837 | 3300044712 | Bacteria | 1954 |
| 521 | Ga0466968_0148231 | 3300044735 | Bacteria | 1077 |
| 522 | Ga0466970_0106425 | 3300044765 | Bacteria | 1530 |
| 523 | Ga0466957_0125077 | 3300044842 | Bacteria | 1642 |
| 524 | Ga0466958_0733459 | 3300045836 | Bacteria | 644 |
| 525 | Ga0495627_000767 | 3300046453 | Bacteria | 23863 |
| 526 | Ga0495629_0106991 | 3300046459 | Bacteria | 1951 |
| 527 | Ga0495629_0841068 | 3300046459 | Bacteria | 604 |
| 528 | Ga0495638_0000935 | 3300046460 | Bacteria | 29593 |
| 529 | Ga0495638_0001119 | 3300046460 | Bacteria | 26080 |
| 530 | Ga0495638_0025082 | 3300046460 | Bacteria | 3879 |
| 531 | Ga0495638_0223734 | 3300046460 | Bacteria | 1050 |
| 532 | Ga0495651_0292422 | 3300046462 | Bacteria | 1096 |
| 533 | Ga0495650_0000403 | 3300046471 | Bacteria | 71792 |
| 534 | Ga0495650_0016563 | 3300046471 | Bacteria | 3729 |
| 535 | Ga0495650_0047502 | 3300046471 | Bacteria | 1795 |
| 536 | Ga0495650_0187715 | 3300046471 | Bacteria | 724 |
| 537 | Ga0495585_0152341 | 3300046492 | Bacteria | 1205 |
| 538 | Ga0495594_0303595 | 3300046499 | Bacteria | 909 |
| 539 | Ga0495583_0000005 | 3300046506 | Bacteria | 636894 |
| 540 | Ga0495583_0047129 | 3300046506 | Bacteria | 1984 |
| 541 | Ga0495606_0003858 | 3300046507 | Bacteria | 15477 |
| 542 | Ga0495610_0002475 | 3300046512 | Bacteria | 15486 |
| 543 | Ga0495610_0009314 | 3300046512 | Bacteria | 6221 |
| 544 | Ga0495610_0011679 | 3300046512 | Bacteria | 5344 |
| 545 | Ga0495616_0000172 | 3300046513 | Bacteria | 54960 |
| 546 | Ga0495620_0035870 | 3300046515 | Bacteria | 2225 |
| 547 | Ga0495628_0186214 | 3300046516 | Bacteria | 1569 |
| 548 | Ga0495631_0011080 | 3300046518 | Bacteria | 4448 |
| 549 | Ga0495632_0015448 | 3300046519 | Bacteria | 4279 |
| 550 | Ga0495632_0034675 | 3300046519 | Bacteria | 2580 |
| 551 | Ga0495637_0056020 | 3300046520 | Bacteria | 1633 |
| 552 | Ga0495637_0128566 | 3300046520 | Bacteria | 969 |
| 553 | Ga0495643_0028980 | 3300046522 | Bacteria | 3099 |
| 554 | Ga0495643_0204435 | 3300046522 | Bacteria | 946 |
| 555 | Ga0495648_0024553 | 3300046524 | Bacteria | 4102 |
| 556 | Ga0495648_0046545 | 3300046524 | Bacteria | 2688 |
| 557 | Ga0495648_0221235 | 3300046524 | Bacteria | 933 |
| 558 | Ga0495648_0306086 | 3300046524 | Bacteria | 742 |
| 559 | Ga0495663_0036119 | 3300046525 | Bacteria | 1486 |
| 560 | Ga0495663_0109467 | 3300046525 | Bacteria | 917 |
| 561 | Ga0495663_0271062 | 3300046525 | Bacteria | 606 |
| 562 | Ga0495654_0000708 | 3300046530 | Bacteria | 26141 |
| 563 | Ga0495621_0016728 | 3300046539 | Bacteria | 2359 |
| 564 | Ga0495621_0388434 | 3300046539 | Bacteria | 590 |
| 565 | Ga0495597_0005464 | 3300046542 | Bacteria | 6722 |
| 566 | Ga0495597_0218989 | 3300046542 | Bacteria | 756 |
| 567 | Ga0495645_0340706 | 3300046543 | Bacteria | 968 |
| 568 | Ga0495645_0625191 | 3300046543 | Bacteria | 660 |
| 569 | Ga0495622_0001326 | 3300046557 | Bacteria | 12674 |
| 570 | Ga0495668_0000100 | 3300046616 | Bacteria | 137684 |
| 571 | Ga0495668_0009341 | 3300046616 | Bacteria | 6029 |
| 572 | Ga0495668_0012089 | 3300046616 | Bacteria | 5135 |
| 573 | Ga0495668_0013600 | 3300046616 | Bacteria | 4794 |
| 574 | Ga0495668_0033240 | 3300046616 | Bacteria | 2898 |
| 575 | Ga0495668_0073617 | 3300046616 | Bacteria | 1876 |
| 576 | Ga0495668_0186150 | 3300046616 | Bacteria | 1137 |
| 577 | Ga0495668_0252643 | 3300046616 | Bacteria | 965 |
| 578 | Ga0495668_0265881 | 3300046616 | Bacteria | 939 |
| 579 | Ga0495668_0337844 | 3300046616 | Bacteria | 826 |
| 580 | Ga0495668_0480913 | 3300046616 | Bacteria | 684 |
| 581 | Ga0495611_0029789 | 3300046648 | Bacteria | 2395 |
| 582 | Ga0495625_0003383 | 3300046660 | Bacteria | 15983 |
| 583 | Ga0495625_0003474 | 3300046660 | Bacteria | 15651 |
| 584 | Ga0495625_0014000 | 3300046660 | Bacteria | 6424 |
| 585 | Ga0495625_0021720 | 3300046660 | Bacteria | 4934 |
| 586 | Ga0495625_0028606 | 3300046660 | Bacteria | 4178 |
| 587 | Ga0495625_0054628 | 3300046660 | Bacteria | 2851 |
| 588 | Ga0495625_0067348 | 3300046660 | Bacteria | 2520 |
| 589 | Ga0495625_0165443 | 3300046660 | Bacteria | 1479 |
| 590 | Ga0495659_0060458 | 3300046664 | Bacteria | 1398 |
| 591 | Ga0495588_0309552 | 3300046674 | Bacteria | 831 |
| 592 | Ga0495657_0240670 | 3300046675 | Bacteria | 1092 |
| 593 | Ga0495669_0000012 | 3300046684 | Bacteria | 157373 |
| 594 | Ga0495669_0000250 | 3300046684 | Bacteria | 31432 |
| 595 | Ga0495669_0068563 | 3300046684 | Bacteria | 1614 |
| 596 | Ga0495669_0137478 | 3300046684 | Bacteria | 1152 |
| 597 | Ga0495613_0001323 | 3300046689 | Bacteria | 18949 |
| 598 | Ga0495613_0542434 | 3300046689 | Bacteria | 779 |
| 599 | Ga0495670_0397799 | 3300046691 | Bacteria | 744 |
| 600 | Ga0495671_0090907 | 3300046692 | Bacteria | 1494 |
| 601 | Ga0495589_0164422 | 3300046794 | Bacteria | 1056 |
| 602 | Ga0495660_0066897 | 3300046810 | Bacteria | 1915 |
| 603 | Ga0495581_0178470 | 3300047315 | Bacteria | 1242 |
| 604 | Ga0495636_0134788 | 3300047318 | Bacteria | 1100 |
| 605 | Ga0495672_0001210 | 3300047320 | Bacteria | 26025 |
| 606 | Ga0495672_0064064 | 3300047320 | Bacteria | 2106 |
| 607 | Ga0495672_0449282 | 3300047320 | Bacteria | 581 |
| 608 | Ga0495687_046127 | 3300047443 | Bacteria | 1883 |
| 609 | Ga0495687_128384 | 3300047443 | Bacteria | 902 |
| 610 | Ga0495677_0020987 | 3300047445 | Bacteria | 2368 |
| 611 | Ga0495677_0085371 | 3300047445 | Bacteria | 1186 |
| 612 | Ga0495677_0141666 | 3300047445 | Bacteria | 923 |
| 613 | Ga0495679_021303 | 3300047446 | Bacteria | 2241 |
| 614 | Ga0495679_084936 | 3300047446 | Bacteria | 894 |
| 615 | Ga0495673_0000025 | 3300047469 | Bacteria | 512352 |
| 616 | Ga0495673_0001381 | 3300047469 | Bacteria | 19535 |
| 617 | Ga0495673_0002003 | 3300047469 | Bacteria | 14993 |
| 618 | Ga0495681_0024801 | 3300047470 | Bacteria | 3148 |
| 619 | Ga0495681_0071203 | 3300047470 | Bacteria | 1575 |
| 620 | Ga0495681_0090815 | 3300047470 | Bacteria | 1349 |
| 621 | Ga0495686_0001965 | 3300047472 | Bacteria | 20419 |
| 622 | Ga0495686_0006019 | 3300047472 | Bacteria | 9422 |
| 623 | Ga0495686_0014178 | 3300047472 | Bacteria | 5495 |
| 624 | Ga0495686_0044404 | 3300047472 | Bacteria | 2814 |
| 625 | Ga0495686_0163401 | 3300047472 | Bacteria | 1299 |
| 626 | Ga0495686_0195760 | 3300047472 | Bacteria | 1162 |
| 627 | Ga0495593_0031446 | 3300047673 | Bacteria | 2899 |
| 628 | Ga0496100_0493575 | 3300048903 | Bacteria | 943 |
| 629 | Ga0496101_0085705 | 3300048904 | Bacteria | 2335 |
| 630 | Ga0496101_0149595 | 3300048904 | Bacteria | 1785 |
| 631 | Ga0496102_0019470 | 3300048905 | Bacteria | 5978 |
| 632 | Ga0496102_0025859 | 3300048905 | Bacteria | 5229 |
| 633 | Ga0496102_0334882 | 3300048905 | Bacteria | 1425 |
| 634 | Ga0496103_0055559 | 3300048906 | Bacteria | 2456 |
| 635 | Ga0496103_0768427 | 3300048906 | Bacteria | 609 |
| 636 | Ga0496105_0240272 | 3300048908 | Bacteria | 1470 |
| 637 | Ga0496106_0003982 | 3300048909 | Bacteria | 11040 |
| 638 | Ga0496106_0650243 | 3300048909 | Bacteria | 842 |
| 639 | Ga0496107_0000063 | 3300048910 | Bacteria | 52938 |
| 640 | Ga0496107_0556322 | 3300048910 | Bacteria | 849 |
| 641 | Ga0496107_0673039 | 3300048910 | Bacteria | 762 |
| 642 | Ga0496108_0188933 | 3300048911 | Bacteria | 1785 |
| 643 | Ga0496109_0014318 | 3300048912 | Bacteria | 6901 |
| 644 | Ga0496110_0376878 | 3300048913 | Bacteria | 1293 |
| 645 | Ga0496111_0308281 | 3300048914 | Bacteria | 1173 |
| 646 | Ga0496112_0020241 | 3300048915 | Bacteria | 6302 |
| 647 | Ga0496112_0339013 | 3300048915 | Bacteria | 1447 |
| 648 | Ga0496112_0429194 | 3300048915 | Bacteria | 1260 |
| 649 | Ga0496114_1147501 | 3300048917 | Bacteria | 662 |
| 650 | Ga0496115_0004287 | 3300048918 | Bacteria | 10327 |
| 651 | Ga0496115_0006353 | 3300048918 | Bacteria | 8656 |
| 652 | Ga0496115_0008707 | 3300048918 | Bacteria | 7519 |
| 653 | Ga0496115_0265905 | 3300048918 | Bacteria | 1410 |
| 654 | Ga0496115_0736979 | 3300048918 | Bacteria | 772 |
| 655 | Ga0496115_1061987 | 3300048918 | Bacteria | 616 |
| 656 | Ga0496117_0014984 | 3300048920 | Bacteria | 6642 |
| 657 | Ga0496118_0025848 | 3300048921 | Bacteria | 5021 |
| 658 | Ga0496119_0004972 | 3300048922 | Bacteria | 12987 |
| 659 | Ga0496121_0000059 | 3300048924 | Bacteria | 278177 |
| 660 | Ga0496121_0017039 | 3300048924 | Bacteria | 7454 |
| 661 | Ga0496124_0013512 | 3300048927 | Bacteria | 7966 |
| 662 | Ga0496125_0067909 | 3300048928 | Bacteria | 2807 |
| 663 | Ga0496125_0089362 | 3300048928 | Bacteria | 2317 |
| 664 | Ga0496126_0074075 | 3300048929 | Bacteria | 3024 |
| 665 | Ga0495678_010136 | 3300049459 | Bacteria | 4596 |
| 666 | Ga0495678_150844 | 3300049459 | Bacteria | 751 |
| 667 | Ga0501033_0015367 | 3300049570 | Bacteria | 5808 |
| 668 | Ga0501033_0151808 | 3300049570 | Bacteria | 1671 |
| 669 | Ga0501034_0002424 | 3300049571 | Bacteria | 22556 |
| 670 | Ga0501034_0080391 | 3300049571 | Bacteria | 3263 |
| 671 | Ga0501034_0328804 | 3300049571 | Bacteria | 1460 |
| 672 | Ga0501036_0988846 | 3300049572 | Bacteria | 689 |
| 673 | Ga0501036_1461884 | 3300049572 | Bacteria | 553 |
| 674 | Ga0501037_0409239 | 3300049573 | Bacteria | 929 |
| 675 | Ga0501038_0171942 | 3300049574 | Bacteria | 1753 |
| 676 | Ga0501047_0002933 | 3300049581 | Bacteria | 16195 |
| 677 | Ga0501047_0048528 | 3300049581 | Bacteria | 4100 |
| 678 | Ga0501047_0174495 | 3300049581 | Bacteria | 2018 |
| 679 | Ga0501048_0110380 | 3300049582 | Bacteria | 1942 |
| 680 | Ga0501070_0124566 | 3300049586 | Bacteria | 2130 |
| 681 | Ga0501070_0602056 | 3300049586 | Bacteria | 876 |
| 682 | Ga0501238_003567 | 3300049671 | Bacteria | 1915 |
| 683 | Ga0501257_049735 | 3300049686 | Bacteria | 1044 |
| 684 | Ga0501035_0088936 | 3300049822 | Bacteria | 2721 |
| 685 | Ga0501035_0269121 | 3300049822 | Bacteria | 1443 |
| 686 | Ga0501035_0474790 | 3300049822 | Bacteria | 1032 |
| 687 | Ga0501035_1019650 | 3300049822 | Bacteria | 650 |
| 688 | Ga0501035_1139545 | 3300049822 | Bacteria | 608 |
| 689 | Ga0501044_0000280 | 3300049823 | Bacteria | 64928 |
| 690 | Ga0501044_0002607 | 3300049823 | Bacteria | 20483 |
| 691 | Ga0501044_0207144 | 3300049823 | Bacteria | 1917 |
| 692 | Ga0501044_0293953 | 3300049823 | Bacteria | 1555 |
| 693 | Ga0501044_0337787 | 3300049823 | Bacteria | 1428 |
| 694 | nmdc:mga03683_440233_c1 | 3300050489 | Bacteria | 626 |
| 695 | nmdc:mga03683_46670_c1 | 3300050489 | Bacteria | 1796 |
| 696 | nmdc:mga03683_55387_c1 | 3300050489 | Bacteria | 1665 |
| 697 | nmdc:mga00v17_165_c2 | 3300050491 | Bacteria | 34234 |
| 698 | nmdc:mga0k408_191397_c1 | 3300050493 | Bacteria | 1221 |
| 699 | nmdc:mga0k408_39482_c1 | 3300050493 | Bacteria | 2712 |
| 700 | nmdc:mga0k408_515827_c1 | 3300050493 | Bacteria | 708 |
| 701 | nmdc:mga06z11_55314_c1 | 3300050494 | Bacteria | 2049 |
| 702 | nmdc:mga04h51_14332_c1 | 3300050495 | Bacteria | 2264 |
| 703 | nmdc:mga07m45_171659_c1 | 3300050496 | Bacteria | 1260 |
| 704 | nmdc:mga07m45_74732_c1 | 3300050496 | Bacteria | 1931 |
| 705 | nmdc:mga0sz30_2184_c1 | 3300050516 | Bacteria | 6995 |
| 706 | Ga0500635_0000048 | 3300053080 | Bacteria | 80957 |
| 707 | Ga0500578_0000913 | 3300053086 | Bacteria | 33199 |
| 708 | Ga0500643_000316 | 3300053087 | Bacteria | 39239 |
| 709 | Ga0500643_003880 | 3300053087 | Bacteria | 6955 |
| 710 | Ga0500643_004744 | 3300053087 | Bacteria | 6035 |
| 711 | Ga0500643_017750 | 3300053087 | Bacteria | 2376 |
| 712 | Ga0500643_020132 | 3300053087 | Bacteria | 2187 |
| 713 | Ga0500643_073400 | 3300053087 | Bacteria | 947 |
| 714 | Ga0500644_0000287 | 3300053088 | Bacteria | 27540 |
| 715 | Ga0500644_0008320 | 3300053088 | Bacteria | 2735 |
| 716 | Ga0500644_0009395 | 3300053088 | Bacteria | 2614 |
| 717 | Ga0500646_0029525 | 3300053090 | Bacteria | 1502 |
| 718 | Ga0500647_0017276 | 3300053091 | Bacteria | 3325 |
| 719 | Ga0500647_0113181 | 3300053091 | Bacteria | 1289 |
| 720 | Ga0500583_0159765 | 3300053092 | Bacteria | 1122 |
| 721 | Ga0500583_0223218 | 3300053092 | Bacteria | 934 |
| 722 | Ga0500651_0017968 | 3300053093 | Bacteria | 4373 |
| 723 | Ga0500651_0222198 | 3300053093 | Bacteria | 1107 |
| 724 | Ga0500651_0421470 | 3300053093 | Bacteria | 747 |
| 725 | Ga0500641_0000367 | 3300053096 | Bacteria | 16747 |
| 726 | Ga0500641_0004872 | 3300053096 | Bacteria | 4750 |
| 727 | Ga0500641_0011946 | 3300053096 | Bacteria | 3162 |
| 728 | Ga0500554_022618 | 3300053102 | Bacteria | 1758 |
| 729 | Ga0500555_015082 | 3300053103 | Bacteria | 2229 |
| 730 | Ga0500555_018530 | 3300053103 | Bacteria | 2006 |
| 731 | Ga0500555_042005 | 3300053103 | Bacteria | 1271 |
| 732 | Ga0500556_0001952 | 3300053104 | Bacteria | 7280 |
| 733 | Ga0500556_0002100 | 3300053104 | Bacteria | 6808 |
| 734 | Ga0500556_0053471 | 3300053104 | Bacteria | 1468 |
| 735 | Ga0500562_000754 | 3300053108 | Bacteria | 7869 |
| 736 | Ga0500562_005608 | 3300053108 | Bacteria | 3157 |
| 737 | Ga0500562_014884 | 3300053108 | Bacteria | 1993 |
| 738 | Ga0500569_002374 | 3300053109 | Bacteria | 3696 |
| 739 | Ga0500572_000189 | 3300053111 | Bacteria | 21822 |
| 740 | Ga0500593_193496 | 3300053117 | Bacteria | 742 |
| 741 | Ga0500594_0003639 | 3300053118 | Bacteria | 3398 |
| 742 | Ga0500595_004073 | 3300053119 | Bacteria | 6642 |
| 743 | Ga0500595_022624 | 3300053119 | Bacteria | 2222 |
| 744 | Ga0500595_075689 | 3300053119 | Bacteria | 992 |
| 745 | Ga0500608_000246 | 3300053122 | Bacteria | 21323 |
| 746 | Ga0500608_014541 | 3300053122 | Bacteria | 3516 |
| 747 | Ga0500608_160147 | 3300053122 | Bacteria | 976 |
| 748 | Ga0500614_005576 | 3300053123 | Bacteria | 2640 |
| 749 | Ga0500614_234343 | 3300053123 | Bacteria | 570 |
| 750 | Ga0500618_000319 | 3300053125 | Bacteria | 35375 |
| 751 | Ga0500642_0042281 | 3300053130 | Bacteria | 1975 |
| 752 | Ga0500655_021376 | 3300053133 | Bacteria | 1213 |
| 753 | Ga0500658_0005593 | 3300053134 | Bacteria | 4680 |
| 754 | Ga0500658_0095970 | 3300053134 | Bacteria | 1288 |
| 755 | Ga0500559_0000010 | 3300053136 | Bacteria | 165569 |
| 756 | Ga0500559_0000153 | 3300053136 | Bacteria | 54641 |
| 757 | Ga0500559_0013632 | 3300053136 | Bacteria | 3440 |
| 758 | Ga0500559_0018372 | 3300053136 | Bacteria | 2955 |
| 759 | Ga0500559_0199476 | 3300053136 | Bacteria | 943 |
| 760 | Ga0500564_000369 | 3300053138 | Bacteria | 12797 |
| 761 | Ga0500564_089445 | 3300053138 | Bacteria | 1372 |
| 762 | Ga0500577_0001350 | 3300053142 | Bacteria | 6266 |
| 763 | Ga0500590_014524 | 3300053148 | Bacteria | 4060 |
| 764 | Ga0500616_0012826 | 3300053153 | Bacteria | 4890 |
| 765 | Ga0500616_0017769 | 3300053153 | Bacteria | 4030 |
| 766 | Ga0500616_0034015 | 3300053153 | Bacteria | 2779 |
| 767 | Ga0500616_0161756 | 3300053153 | Bacteria | 1026 |
| 768 | Ga0500616_0304272 | 3300053153 | Bacteria | 661 |
| 769 | Ga0500619_005761 | 3300053154 | Bacteria | 2794 |
| 770 | Ga0500622_0002994 | 3300053156 | Bacteria | 11709 |
| 771 | Ga0500622_0004398 | 3300053156 | Bacteria | 8876 |
| 772 | Ga0500622_0017251 | 3300053156 | Bacteria | 3844 |
| 773 | Ga0500622_0074609 | 3300053156 | Bacteria | 1708 |
| 774 | Ga0500622_0207383 | 3300053156 | Bacteria | 887 |
| 775 | Ga0500624_054838 | 3300053157 | Bacteria | 749 |
| 776 | Ga0500627_0053289 | 3300053158 | Bacteria | 1767 |
| 777 | Ga0500639_139786 | 3300053163 | Bacteria | 1134 |
| 778 | Ga0500636_0036516 | 3300053177 | Bacteria | 2908 |
| 779 | Ga0500636_0067140 | 3300053177 | Bacteria | 2084 |
| 780 | Ga0500637_0023865 | 3300053178 | Bacteria | 3348 |
| 781 | Ga0500576_034342 | 3300053725 | Bacteria | 2298 |
| 782 | Ga0500645_001079 | 3300053730 | Bacteria | 15058 |
| 783 | Ga0500645_001315 | 3300053730 | Bacteria | 12887 |
| 784 | Ga0500645_005711 | 3300053730 | Bacteria | 4534 |
| 785 | Ga0500645_086685 | 3300053730 | Bacteria | 890 |
| 786 | Ga0500596_003146 | 3300053735 | Bacteria | 3171 |
| 787 | Ga0500601_015595 | 3300053737 | Bacteria | 864 |
| 788 | Ga0587072_045009 | 3300059643 | Bacteria | 868 |
| 789 | Ga0587072_071344 | 3300059643 | Bacteria | 734 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014969 | Ga0157376_11211660 | Ga0157376_112116601 | 146 |
| 2 | 3300039447 | Ga0436361_0315073 | Ga0436361_0315073_117_566 | 149 |
| 3 | 3300049572 | Ga0501036_1461884 | Ga0501036_1461884_11_460 | 149 |
| 4 | 3300046519 | Ga0495632_0034675 | Ga0495632_0034675_11_463 | 150 |
| 5 | 3300028800 | Ga0265338_10069826 | Ga0265338_100698264 | 151 |
| 6 | 3300039453 | Ga0436362_0836285 | Ga0436362_0836285_340_852 | 154 |
| 7 | 3300047320 | Ga0495672_0449282 | Ga0495672_0449282_98_568 | 156 |
| 8 | 3300049586 | Ga0501070_0124566 | Ga0501070_0124566_171_692 | 163 |
| 9 | iso_pu_bacteria | 2643221574 | 2643883067 | 163 |
| 10 | iso_pu_bacteria | 2643221598 | 2643998419 | 163 |
| 11 | iso_pu_bacteria | 2643221663 | 2644353884 | 163 |
| 12 | iso_pu_bacteria | 2643221699 | 2644552775 | 163 |
| 13 | iso_pu_bacteria | 2791355048 | 2792461672 | 163 |
| 14 | iso_pu_bacteria | 2843744320 | 2843746131 | 163 |
| 15 | iso_pu_bacteria | 2849560528 | 2849561615 | 163 |
| 16 | iso_pu_bacteria | 2849573788 | 2849574494 | 163 |
| 17 | iso_pu_bacteria | 2851153111 | 2851153880 | 163 |
| 18 | iso_pu_bacteria | 2898329390 | 2898330491 | 163 |
| 19 | iso_pu_bacteria | 2510917020 | 2511121749 | 164 |
| 20 | iso_pu_bacteria | 2582581279 | 2585149008 | 164 |
| 21 | iso_pu_bacteria | 2582581280 | 2585151630 | 164 |
| 22 | iso_pu_bacteria | 2582581293 | 2585195496 | 164 |
| 23 | iso_pu_bacteria | 2585428106 | 2587915380 | 164 |
| 24 | iso_pu_bacteria | 2643221545 | 2643749208 | 164 |
| 25 | iso_pu_bacteria | 2643221552 | 2643781326 | 164 |
| 26 | iso_pu_bacteria | 2643221583 | 2643922905 | 164 |
| 27 | iso_pu_bacteria | 2643221584 | 2643927093 | 164 |
| 28 | iso_pu_bacteria | 2643221640 | 2644223935 | 164 |
| 29 | iso_pu_bacteria | 2643221642 | 2644232921 | 164 |
| 30 | iso_pu_bacteria | 2643221691 | 2644509017 | 164 |
| 31 | iso_pu_bacteria | 2818991435 | 2819536312 | 164 |
| 32 | iso_pu_bacteria | 2818991454 | 2819644567 | 164 |
| 33 | iso_pu_bacteria | 2857504554 | 2857508019 | 164 |
| 34 | iso_pu_bacteria | 2884960567 | 2884963112 | 164 |
| 35 | iso_pu_bacteria | 2928531327 | 2928534823 | 164 |
| 36 | 3300005327 | Ga0070658_10182987 | Ga0070658_101829873 | 165 |
| 37 | 3300005548 | Ga0070665_100154207 | Ga0070665_1001542072 | 165 |
| 38 | 3300005563 | Ga0068855_100633725 | Ga0068855_1006337252 | 165 |
| 39 | 3300009545 | Ga0105237_10971857 | Ga0105237_109718572 | 165 |
| 40 | 3300013105 | Ga0157369_11087671 | Ga0157369_110876711 | 165 |
| 41 | 3300014745 | Ga0157377_10929055 | Ga0157377_109290551 | 165 |
| 42 | 3300025909 | Ga0207705_10117812 | Ga0207705_101178123 | 165 |
| 43 | 3300025913 | Ga0207695_10145852 | Ga0207695_101458524 | 165 |
| 44 | 3300028379 | Ga0268266_10086133 | Ga0268266_100861332 | 165 |
| 45 | 3300037312 | Ga0395899_0145085 | Ga0395899_0145085_406_906 | 165 |
| 46 | 3300037418 | Ga0395900_0041082 | Ga0395900_0041082_2878_3378 | 165 |
| 47 | 3300037471 | Ga0395905_0068111 | Ga0395905_0068111_671_1171 | 165 |
| 48 | 3300037471 | Ga0395905_0081001 | Ga0395905_0081001_1656_2156 | 165 |
| 49 | 3300037471 | Ga0395905_0085608 | Ga0395905_0085608_163_663 | 165 |
| 50 | 3300037471 | Ga0395905_0267554 | Ga0395905_0267554_196_696 | 165 |
| 51 | 3300038443 | Ga0395901_0104718 | Ga0395901_0104718_949_1449 | 165 |
| 52 | 3300039447 | Ga0436361_0870135 | Ga0436361_0870135_26_526 | 165 |
| 53 | 3300039453 | Ga0436362_0542815 | Ga0436362_0542815_382_882 | 165 |
| 54 | 3300044658 | Ga0466972_0406248 | Ga0466972_0406248_69_569 | 165 |
| 55 | 3300044683 | Ga0466965_0174766 | Ga0466965_0174766_120_620 | 165 |
| 56 | 3300044765 | Ga0466970_0106425 | Ga0466970_0106425_15_515 | 165 |
| 57 | 3300044842 | Ga0466957_0125077 | Ga0466957_0125077_754_1254 | 165 |
| 58 | 3300045836 | Ga0466958_0733459 | Ga0466958_0733459_63_563 | 165 |
| 59 | 3300048915 | Ga0496112_0429194 | Ga0496112_0429194_708_1208 | 165 |
| 60 | 3300053087 | Ga0500643_004744 | Ga0500643_004744_3366_3866 | 165 |
| 61 | 3300003215 | JGI25153J46596_10033714 | JGI25153J46596_100337142 | 166 |
| 62 | 3300003781 | Ga0055536_1005613 | Ga0055536_10056136 | 166 |
| 63 | 3300003791 | Ga0055530_10001660 | Ga0055530_1000166010 | 166 |
| 64 | 3300003794 | Ga0055531_10000948 | Ga0055531_1000094810 | 166 |
| 65 | 3300003794 | Ga0055531_10016422 | Ga0055531_100164223 | 166 |
| 66 | 3300005262 | Ga0065165_1005120 | Ga0065165_10051206 | 166 |
| 67 | 3300005327 | Ga0070658_10338648 | Ga0070658_103386482 | 166 |
| 68 | 3300005327 | Ga0070658_11058063 | Ga0070658_110580631 | 166 |
| 69 | 3300005331 | Ga0070670_100000035 | Ga0070670_100000035118 | 166 |
| 70 | 3300005331 | Ga0070670_100015841 | Ga0070670_1000158414 | 166 |
| 71 | 3300005331 | Ga0070670_100203772 | Ga0070670_1002037723 | 166 |
| 72 | 3300005331 | Ga0070670_101331338 | Ga0070670_1013313381 | 166 |
| 73 | 3300005334 | Ga0068869_100091453 | Ga0068869_1000914532 | 166 |
| 74 | 3300005334 | Ga0068869_101159370 | Ga0068869_1011593701 | 166 |
| 75 | 3300005335 | Ga0070666_10058966 | Ga0070666_100589663 | 166 |
| 76 | 3300005336 | Ga0070680_100008070 | Ga0070680_1000080704 | 166 |
| 77 | 3300005336 | Ga0070680_100052344 | Ga0070680_1000523444 | 166 |
| 78 | 3300005338 | Ga0068868_100069231 | Ga0068868_1000692313 | 166 |
| 79 | 3300005339 | Ga0070660_100428071 | Ga0070660_1004280711 | 166 |
| 80 | 3300005340 | Ga0070689_100345440 | Ga0070689_1003454402 | 166 |
| 81 | 3300005341 | Ga0070691_10006344 | Ga0070691_100063446 | 166 |
| 82 | 3300005345 | Ga0070692_10215857 | Ga0070692_102158571 | 166 |
| 83 | 3300005347 | Ga0070668_100002182 | Ga0070668_10000218215 | 166 |
| 84 | 3300005347 | Ga0070668_100003540 | Ga0070668_1000035404 | 166 |
| 85 | 3300005347 | Ga0070668_100003652 | Ga0070668_1000036521 | 166 |
| 86 | 3300005347 | Ga0070668_100007003 | Ga0070668_1000070033 | 166 |
| 87 | 3300005347 | Ga0070668_100011492 | Ga0070668_1000114923 | 166 |
| 88 | 3300005353 | Ga0070669_100021322 | Ga0070669_1000213225 | 166 |
| 89 | 3300005355 | Ga0070671_100007055 | Ga0070671_1000070554 | 166 |
| 90 | 3300005355 | Ga0070671_100060840 | Ga0070671_1000608403 | 166 |
| 91 | 3300005364 | Ga0070673_100178716 | Ga0070673_1001787162 | 166 |
| 92 | 3300005366 | Ga0070659_100008075 | Ga0070659_1000080756 | 166 |
| 93 | 3300005367 | Ga0070667_100000711 | Ga0070667_10000071118 | 166 |
| 94 | 3300005367 | Ga0070667_100028886 | Ga0070667_1000288865 | 166 |
| 95 | 3300005367 | Ga0070667_100038720 | Ga0070667_1000387202 | 166 |
| 96 | 3300005367 | Ga0070667_100063073 | Ga0070667_1000630733 | 166 |
| 97 | 3300005367 | Ga0070667_100203998 | Ga0070667_1002039983 | 166 |
| 98 | 3300005457 | Ga0070662_100038594 | Ga0070662_1000385943 | 166 |
| 99 | 3300005458 | Ga0070681_10028637 | Ga0070681_100286374 | 166 |
| 100 | 3300005530 | Ga0070679_100040692 | Ga0070679_1000406924 | 166 |
| 101 | 3300005530 | Ga0070679_100068678 | Ga0070679_1000686783 | 166 |
| 102 | 3300005539 | Ga0068853_100327918 | Ga0068853_1003279183 | 166 |
| 103 | 3300005539 | Ga0068853_100361875 | Ga0068853_1003618752 | 166 |
| 104 | 3300005539 | Ga0068853_101296962 | Ga0068853_1012969621 | 166 |
| 105 | 3300005543 | Ga0070672_100726181 | Ga0070672_1007261812 | 166 |
| 106 | 3300005548 | Ga0070665_100000433 | Ga0070665_10000043342 | 166 |
| 107 | 3300005548 | Ga0070665_100001010 | Ga0070665_10000101042 | 166 |
| 108 | 3300005548 | Ga0070665_100002102 | Ga0070665_10000210219 | 166 |
| 109 | 3300005548 | Ga0070665_100032211 | Ga0070665_1000322118 | 166 |
| 110 | 3300005563 | Ga0068855_100030575 | Ga0068855_1000305755 | 166 |
| 111 | 3300005563 | Ga0068855_100044548 | Ga0068855_1000445485 | 166 |
| 112 | 3300005563 | Ga0068855_100048970 | Ga0068855_1000489703 | 166 |
| 113 | 3300005563 | Ga0068855_100209393 | Ga0068855_1002093932 | 166 |
| 114 | 3300005564 | Ga0070664_100204087 | Ga0070664_1002040873 | 166 |
| 115 | 3300005577 | Ga0068857_100180497 | Ga0068857_1001804973 | 166 |
| 116 | 3300005577 | Ga0068857_100707406 | Ga0068857_1007074062 | 166 |
| 117 | 3300005578 | Ga0068854_100149457 | Ga0068854_1001494573 | 166 |
| 118 | 3300005614 | Ga0068856_100161846 | Ga0068856_1001618463 | 166 |
| 119 | 3300005616 | Ga0068852_100612675 | Ga0068852_1006126752 | 166 |
| 120 | 3300005617 | Ga0068859_100002125 | Ga0068859_1000021259 | 166 |
| 121 | 3300005617 | Ga0068859_100067285 | Ga0068859_1000672852 | 166 |
| 122 | 3300005617 | Ga0068859_100231589 | Ga0068859_1002315893 | 166 |
| 123 | 3300005618 | Ga0068864_100000102 | Ga0068864_10000010264 | 166 |
| 124 | 3300005618 | Ga0068864_100000165 | Ga0068864_10000016528 | 166 |
| 125 | 3300005618 | Ga0068864_100008059 | Ga0068864_1000080597 | 166 |
| 126 | 3300005618 | Ga0068864_100027772 | Ga0068864_1000277722 | 166 |
| 127 | 3300005841 | Ga0068863_100000128 | Ga0068863_10000012823 | 166 |
| 128 | 3300005841 | Ga0068863_100002006 | Ga0068863_10000200624 | 166 |
| 129 | 3300005841 | Ga0068863_100009403 | Ga0068863_1000094036 | 166 |
| 130 | 3300005841 | Ga0068863_100037082 | Ga0068863_1000370823 | 166 |
| 131 | 3300005841 | Ga0068863_100095785 | Ga0068863_1000957853 | 166 |
| 132 | 3300005841 | Ga0068863_100599018 | Ga0068863_1005990181 | 166 |
| 133 | 3300005842 | Ga0068858_100000117 | Ga0068858_1000001176 | 166 |
| 134 | 3300005842 | Ga0068858_100015866 | Ga0068858_1000158664 | 166 |
| 135 | 3300005842 | Ga0068858_100143483 | Ga0068858_1001434833 | 166 |
| 136 | 3300005843 | Ga0068860_100000100 | Ga0068860_10000010091 | 166 |
| 137 | 3300005843 | Ga0068860_100000157 | Ga0068860_100000157104 | 166 |
| 138 | 3300005843 | Ga0068860_100012420 | Ga0068860_1000124209 | 166 |
| 139 | 3300005843 | Ga0068860_100033952 | Ga0068860_1000339524 | 166 |
| 140 | 3300005844 | Ga0068862_100000368 | Ga0068862_10000036811 | 166 |
| 141 | 3300005844 | Ga0068862_100003705 | Ga0068862_1000037056 | 166 |
| 142 | 3300005844 | Ga0068862_100040787 | Ga0068862_1000407875 | 166 |
| 143 | 3300005844 | Ga0068862_100572608 | Ga0068862_1005726082 | 166 |
| 144 | 3300006028 | Ga0070717_10033442 | Ga0070717_100334424 | 166 |
| 145 | 3300006028 | Ga0070717_10130611 | Ga0070717_101306111 | 166 |
| 146 | 3300006042 | Ga0075368_10001287 | Ga0075368_100012872 | 166 |
| 147 | 3300006048 | Ga0075363_100145209 | Ga0075363_1001452092 | 166 |
| 148 | 3300006051 | Ga0075364_10000571 | Ga0075364_1000057113 | 166 |
| 149 | 3300006177 | Ga0075362_10139652 | Ga0075362_101396521 | 166 |
| 150 | 3300006178 | Ga0075367_10002075 | Ga0075367_100020757 | 166 |
| 151 | 3300006195 | Ga0075366_10055972 | Ga0075366_100559724 | 166 |
| 152 | 3300006353 | Ga0075370_10106302 | Ga0075370_101063023 | 166 |
| 153 | 3300006881 | Ga0068865_100008084 | Ga0068865_1000080847 | 166 |
| 154 | 3300006931 | Ga0097620_100002125 | Ga0097620_10000212518 | 166 |
| 155 | 3300006931 | Ga0097620_100067286 | Ga0097620_1000672862 | 166 |
| 156 | 3300006931 | Ga0097620_100231602 | Ga0097620_1002316022 | 166 |
| 157 | 3300006946 | Ga0079104_1016114 | Ga0079104_10161143 | 166 |
| 158 | 3300009093 | Ga0105240_10002462 | Ga0105240_100024626 | 166 |
| 159 | 3300009093 | Ga0105240_10050501 | Ga0105240_100505011 | 166 |
| 160 | 3300009093 | Ga0105240_10269047 | Ga0105240_102690473 | 166 |
| 161 | 3300009093 | Ga0105240_10334737 | Ga0105240_103347373 | 166 |
| 162 | 3300009093 | Ga0105240_10426048 | Ga0105240_104260482 | 166 |
| 163 | 3300009093 | Ga0105240_10659693 | Ga0105240_106596932 | 166 |
| 164 | 3300009093 | Ga0105240_10730752 | Ga0105240_107307522 | 166 |
| 165 | 3300009093 | Ga0105240_11322185 | Ga0105240_113221851 | 166 |
| 166 | 3300009093 | Ga0105240_11725982 | Ga0105240_117259822 | 166 |
| 167 | 3300009098 | Ga0105245_11031481 | Ga0105245_110314811 | 166 |
| 168 | 3300009101 | Ga0105247_10116207 | Ga0105247_101162072 | 166 |
| 169 | 3300009101 | Ga0105247_10134749 | Ga0105247_101347493 | 166 |
| 170 | 3300009174 | Ga0105241_10266098 | Ga0105241_102660982 | 166 |
| 171 | 3300009176 | Ga0105242_10255803 | Ga0105242_102558031 | 166 |
| 172 | 3300009176 | Ga0105242_10518592 | Ga0105242_105185922 | 166 |
| 173 | 3300009177 | Ga0105248_10000106 | Ga0105248_1000010688 | 166 |
| 174 | 3300009177 | Ga0105248_10024660 | Ga0105248_100246608 | 166 |
| 175 | 3300009177 | Ga0105248_10107846 | Ga0105248_101078465 | 166 |
| 176 | 3300009177 | Ga0105248_10110698 | Ga0105248_101106981 | 166 |
| 177 | 3300009177 | Ga0105248_10114333 | Ga0105248_101143334 | 166 |
| 178 | 3300009177 | Ga0105248_10139129 | Ga0105248_101391294 | 166 |
| 179 | 3300009177 | Ga0105248_10182848 | Ga0105248_101828482 | 166 |
| 180 | 3300009177 | Ga0105248_10318324 | Ga0105248_103183242 | 166 |
| 181 | 3300009177 | Ga0105248_10544814 | Ga0105248_105448142 | 166 |
| 182 | 3300009177 | Ga0105248_11215731 | Ga0105248_112157311 | 166 |
| 183 | 3300009545 | Ga0105237_10544955 | Ga0105237_105449552 | 166 |
| 184 | 3300009551 | Ga0105238_10041921 | Ga0105238_100419214 | 166 |
| 185 | 3300009551 | Ga0105238_10076763 | Ga0105238_100767634 | 166 |
| 186 | 3300009551 | Ga0105238_10177065 | Ga0105238_101770651 | 166 |
| 187 | 3300009551 | Ga0105238_10781535 | Ga0105238_107815351 | 166 |
| 188 | 3300009551 | Ga0105238_11358182 | Ga0105238_113581821 | 166 |
| 189 | 3300009553 | Ga0105249_10000525 | Ga0105249_1000052510 | 166 |
| 190 | 3300009553 | Ga0105249_10086152 | Ga0105249_100861523 | 166 |
| 191 | 3300009553 | Ga0105249_10774763 | Ga0105249_107747631 | 166 |
| 192 | 3300010375 | Ga0105239_10130044 | Ga0105239_101300442 | 166 |
| 193 | 3300010375 | Ga0105239_10381679 | Ga0105239_103816792 | 166 |
| 194 | 3300010375 | Ga0105239_10765506 | Ga0105239_107655062 | 166 |
| 195 | 3300010375 | Ga0105239_11797574 | Ga0105239_117975741 | 166 |
| 196 | 3300011119 | Ga0105246_11112268 | Ga0105246_111122681 | 166 |
| 197 | 3300013100 | Ga0157373_10386818 | Ga0157373_103868182 | 166 |
| 198 | 3300013104 | Ga0157370_10025476 | Ga0157370_100254766 | 166 |
| 199 | 3300013104 | Ga0157370_10255378 | Ga0157370_102553783 | 166 |
| 200 | 3300013297 | Ga0157378_12451267 | Ga0157378_124512671 | 166 |
| 201 | 3300013306 | Ga0163162_10143578 | Ga0163162_101435782 | 166 |
| 202 | 3300013306 | Ga0163162_10238917 | Ga0163162_102389172 | 166 |
| 203 | 3300013306 | Ga0163162_10280639 | Ga0163162_102806393 | 166 |
| 204 | 3300013306 | Ga0163162_10358644 | Ga0163162_103586443 | 166 |
| 205 | 3300013307 | Ga0157372_10145769 | Ga0157372_101457694 | 166 |
| 206 | 3300013307 | Ga0157372_10522129 | Ga0157372_105221292 | 166 |
| 207 | 3300013308 | Ga0157375_11801825 | Ga0157375_118018251 | 166 |
| 208 | 3300014325 | Ga0163163_10003142 | Ga0163163_1000314211 | 166 |
| 209 | 3300014325 | Ga0163163_10003291 | Ga0163163_100032915 | 166 |
| 210 | 3300014325 | Ga0163163_10110592 | Ga0163163_101105922 | 166 |
| 211 | 3300014325 | Ga0163163_10376672 | Ga0163163_103766722 | 166 |
| 212 | 3300014325 | Ga0163163_12284813 | Ga0163163_122848131 | 166 |
| 213 | 3300014326 | Ga0157380_10206005 | Ga0157380_102060052 | 166 |
| 214 | 3300014326 | Ga0157380_10670849 | Ga0157380_106708492 | 166 |
| 215 | 3300014745 | Ga0157377_10133995 | Ga0157377_101339952 | 166 |
| 216 | 3300014968 | Ga0157379_10009657 | Ga0157379_100096574 | 166 |
| 217 | 3300014968 | Ga0157379_10023061 | Ga0157379_100230613 | 166 |
| 218 | 3300014968 | Ga0157379_10027619 | Ga0157379_100276197 | 166 |
| 219 | 3300014968 | Ga0157379_10192977 | Ga0157379_101929773 | 166 |
| 220 | 3300014969 | Ga0157376_10539196 | Ga0157376_105391962 | 166 |
| 221 | 3300015262 | Ga0182007_10062552 | Ga0182007_100625522 | 166 |
| 222 | 3300021388 | Ga0213875_10325914 | Ga0213875_103259141 | 166 |
| 223 | 3300025250 | Ga0209026_1002959 | Ga0209026_10029595 | 166 |
| 224 | 3300025292 | Ga0209676_1000252 | Ga0209676_100025289 | 166 |
| 225 | 3300025292 | Ga0209676_1003120 | Ga0209676_10031208 | 166 |
| 226 | 3300025297 | Ga0209758_1000334 | Ga0209758_10003348 | 166 |
| 227 | 3300025298 | Ga0209050_1000130 | Ga0209050_100013077 | 166 |
| 228 | 3300025298 | Ga0209050_1009109 | Ga0209050_10091094 | 166 |
| 229 | 3300025304 | Ga0209257_1000059 | Ga0209257_1000059272 | 166 |
| 230 | 3300025304 | Ga0209257_1000060 | Ga0209257_1000060251 | 166 |
| 231 | 3300025304 | Ga0209257_1000406 | Ga0209257_100040674 | 166 |
| 232 | 3300025909 | Ga0207705_10000859 | Ga0207705_1000085915 | 166 |
| 233 | 3300025911 | Ga0207654_10337347 | Ga0207654_103373472 | 166 |
| 234 | 3300025912 | Ga0207707_10052652 | Ga0207707_100526525 | 166 |
| 235 | 3300025912 | Ga0207707_10890637 | Ga0207707_108906371 | 166 |
| 236 | 3300025913 | Ga0207695_10001222 | Ga0207695_1000122238 | 166 |
| 237 | 3300025913 | Ga0207695_10005699 | Ga0207695_100056994 | 166 |
| 238 | 3300025913 | Ga0207695_10016532 | Ga0207695_100165329 | 166 |
| 239 | 3300025913 | Ga0207695_10019866 | Ga0207695_100198664 | 166 |
| 240 | 3300025913 | Ga0207695_10454851 | Ga0207695_104548511 | 166 |
| 241 | 3300025913 | Ga0207695_10459193 | Ga0207695_104591932 | 166 |
| 242 | 3300025914 | Ga0207671_11146150 | Ga0207671_111461501 | 166 |
| 243 | 3300025917 | Ga0207660_10005314 | Ga0207660_100053146 | 166 |
| 244 | 3300025917 | Ga0207660_10481794 | Ga0207660_104817942 | 166 |
| 245 | 3300025919 | Ga0207657_10027665 | Ga0207657_100276656 | 166 |
| 246 | 3300025919 | Ga0207657_10103236 | Ga0207657_101032362 | 166 |
| 247 | 3300025921 | Ga0207652_10039756 | Ga0207652_100397563 | 166 |
| 248 | 3300025921 | Ga0207652_10040277 | Ga0207652_100402774 | 166 |
| 249 | 3300025923 | Ga0207681_10058651 | Ga0207681_100586512 | 166 |
| 250 | 3300025923 | Ga0207681_10275273 | Ga0207681_102752732 | 166 |
| 251 | 3300025924 | Ga0207694_10044000 | Ga0207694_100440004 | 166 |
| 252 | 3300025924 | Ga0207694_10123458 | Ga0207694_101234583 | 166 |
| 253 | 3300025924 | Ga0207694_10218439 | Ga0207694_102184391 | 166 |
| 254 | 3300025924 | Ga0207694_10360980 | Ga0207694_103609801 | 166 |
| 255 | 3300025925 | Ga0207650_10000327 | Ga0207650_100003271 | 166 |
| 256 | 3300025925 | Ga0207650_10029430 | Ga0207650_100294304 | 166 |
| 257 | 3300025925 | Ga0207650_10139751 | Ga0207650_101397511 | 166 |
| 258 | 3300025925 | Ga0207650_10174134 | Ga0207650_101741343 | 166 |
| 259 | 3300025925 | Ga0207650_10200024 | Ga0207650_102000243 | 166 |
| 260 | 3300025931 | Ga0207644_10008067 | Ga0207644_100080677 | 166 |
| 261 | 3300025931 | Ga0207644_10113844 | Ga0207644_101138443 | 166 |
| 262 | 3300025932 | Ga0207690_10000159 | Ga0207690_1000015939 | 166 |
| 263 | 3300025932 | Ga0207690_10014486 | Ga0207690_100144865 | 166 |
| 264 | 3300025933 | Ga0207706_10193522 | Ga0207706_101935222 | 166 |
| 265 | 3300025933 | Ga0207706_10281543 | Ga0207706_102815432 | 166 |
| 266 | 3300025934 | Ga0207686_10191571 | Ga0207686_101915712 | 166 |
| 267 | 3300025938 | Ga0207704_10011221 | Ga0207704_100112215 | 166 |
| 268 | 3300025940 | Ga0207691_10740987 | Ga0207691_107409871 | 166 |
| 269 | 3300025941 | Ga0207711_10000098 | Ga0207711_100000984 | 166 |
| 270 | 3300025941 | Ga0207711_10007949 | Ga0207711_100079492 | 166 |
| 271 | 3300025941 | Ga0207711_10047091 | Ga0207711_100470914 | 166 |
| 272 | 3300025941 | Ga0207711_10060134 | Ga0207711_100601342 | 166 |
| 273 | 3300025941 | Ga0207711_10067455 | Ga0207711_100674551 | 166 |
| 274 | 3300025941 | Ga0207711_10077333 | Ga0207711_100773331 | 166 |
| 275 | 3300025949 | Ga0207667_10004660 | Ga0207667_1000466015 | 166 |
| 276 | 3300025949 | Ga0207667_10032201 | Ga0207667_100322013 | 166 |
| 277 | 3300025949 | Ga0207667_10080415 | Ga0207667_100804153 | 166 |
| 278 | 3300025960 | Ga0207651_10125994 | Ga0207651_101259943 | 166 |
| 279 | 3300025961 | Ga0207712_10001643 | Ga0207712_100016437 | 166 |
| 280 | 3300025961 | Ga0207712_10271478 | Ga0207712_102714782 | 166 |
| 281 | 3300025972 | Ga0207668_10000025 | Ga0207668_1000002541 | 166 |
| 282 | 3300025972 | Ga0207668_10000035 | Ga0207668_10000035135 | 166 |
| 283 | 3300025972 | Ga0207668_10001450 | Ga0207668_1000145015 | 166 |
| 284 | 3300025972 | Ga0207668_10001848 | Ga0207668_100018486 | 166 |
| 285 | 3300025972 | Ga0207668_10009511 | Ga0207668_100095116 | 166 |
| 286 | 3300025972 | Ga0207668_10033907 | Ga0207668_100339074 | 166 |
| 287 | 3300025981 | Ga0207640_10092228 | Ga0207640_100922282 | 166 |
| 288 | 3300025986 | Ga0207658_10000300 | Ga0207658_1000030049 | 166 |
| 289 | 3300025986 | Ga0207658_10012188 | Ga0207658_100121885 | 166 |
| 290 | 3300025986 | Ga0207658_10017296 | Ga0207658_100172963 | 166 |
| 291 | 3300025986 | Ga0207658_10027675 | Ga0207658_100276754 | 166 |
| 292 | 3300026023 | Ga0207677_10045134 | Ga0207677_100451343 | 166 |
| 293 | 3300026035 | Ga0207703_10002585 | Ga0207703_1000258511 | 166 |
| 294 | 3300026035 | Ga0207703_10004356 | Ga0207703_100043567 | 166 |
| 295 | 3300026035 | Ga0207703_10159117 | Ga0207703_101591172 | 166 |
| 296 | 3300026035 | Ga0207703_10528394 | Ga0207703_105283941 | 166 |
| 297 | 3300026041 | Ga0207639_10014145 | Ga0207639_100141451 | 166 |
| 298 | 3300026041 | Ga0207639_10301901 | Ga0207639_103019013 | 166 |
| 299 | 3300026041 | Ga0207639_10488057 | Ga0207639_104880571 | 166 |
| 300 | 3300026067 | Ga0207678_10567848 | Ga0207678_105678482 | 166 |
| 301 | 3300026088 | Ga0207641_10000005 | Ga0207641_10000005405 | 166 |
| 302 | 3300026088 | Ga0207641_10000777 | Ga0207641_1000077713 | 166 |
| 303 | 3300026088 | Ga0207641_10000994 | Ga0207641_1000099418 | 166 |
| 304 | 3300026088 | Ga0207641_10047447 | Ga0207641_100474474 | 166 |
| 305 | 3300026088 | Ga0207641_10243404 | Ga0207641_102434042 | 166 |
| 306 | 3300026088 | Ga0207641_10284968 | Ga0207641_102849682 | 166 |
| 307 | 3300026088 | Ga0207641_10416041 | Ga0207641_104160412 | 166 |
| 308 | 3300026089 | Ga0207648_10206864 | Ga0207648_102068642 | 166 |
| 309 | 3300026089 | Ga0207648_11125127 | Ga0207648_111251271 | 166 |
| 310 | 3300026095 | Ga0207676_10000066 | Ga0207676_1000006692 | 166 |
| 311 | 3300026095 | Ga0207676_10000145 | Ga0207676_100001456 | 166 |
| 312 | 3300026095 | Ga0207676_10006892 | Ga0207676_100068923 | 166 |
| 313 | 3300026095 | Ga0207676_10088804 | Ga0207676_100888044 | 166 |
| 314 | 3300026116 | Ga0207674_10354915 | Ga0207674_103549153 | 166 |
| 315 | 3300026118 | Ga0207675_100086350 | Ga0207675_1000863504 | 166 |
| 316 | 3300026118 | Ga0207675_100566011 | Ga0207675_1005660112 | 166 |
| 317 | 3300026118 | Ga0207675_100585934 | Ga0207675_1005859343 | 166 |
| 318 | 3300026121 | Ga0207683_11043367 | Ga0207683_110433671 | 166 |
| 319 | 3300026142 | Ga0207698_10384166 | Ga0207698_103841663 | 166 |
| 320 | 3300026142 | Ga0207698_10424664 | Ga0207698_104246642 | 166 |
| 321 | 3300027111 | Ga0209281_1034369 | Ga0209281_10343692 | 166 |
| 322 | 3300027526 | Ga0209968_1057566 | Ga0209968_10575661 | 166 |
| 323 | 3300027543 | Ga0209999_1006580 | Ga0209999_10065802 | 166 |
| 324 | 3300027665 | Ga0209983_1002147 | Ga0209983_10021473 | 166 |
| 325 | 3300027866 | Ga0209813_10012213 | Ga0209813_100122132 | 166 |
| 326 | 3300027876 | Ga0209974_10363604 | Ga0209974_103636041 | 166 |
| 327 | 3300028379 | Ga0268266_10000003 | Ga0268266_10000003565 | 166 |
| 328 | 3300028379 | Ga0268266_10000814 | Ga0268266_100008146 | 166 |
| 329 | 3300028379 | Ga0268266_10002311 | Ga0268266_100023114 | 166 |
| 330 | 3300028379 | Ga0268266_10015863 | Ga0268266_100158639 | 166 |
| 331 | 3300028379 | Ga0268266_10464906 | Ga0268266_104649062 | 166 |
| 332 | 3300028380 | Ga0268265_10002522 | Ga0268265_1000252213 | 166 |
| 333 | 3300028380 | Ga0268265_10010073 | Ga0268265_100100734 | 166 |
| 334 | 3300028380 | Ga0268265_10096513 | Ga0268265_100965132 | 166 |
| 335 | 3300028380 | Ga0268265_10842456 | Ga0268265_108424562 | 166 |
| 336 | 3300028380 | Ga0268265_11048387 | Ga0268265_110483871 | 166 |
| 337 | 3300028381 | Ga0268264_10000002 | Ga0268264_10000002747 | 166 |
| 338 | 3300028381 | Ga0268264_10000211 | Ga0268264_1000021149 | 166 |
| 339 | 3300028786 | Ga0307517_10003214 | Ga0307517_1000321419 | 166 |
| 340 | 3300028786 | Ga0307517_10114040 | Ga0307517_101140402 | 166 |
| 341 | 3300030521 | Ga0307511_10048715 | Ga0307511_100487154 | 166 |
| 342 | 3300031251 | Ga0265327_10002802 | Ga0265327_1000280214 | 166 |
| 343 | 3300031456 | Ga0307513_10000053 | Ga0307513_1000005361 | 166 |
| 344 | 3300031456 | Ga0307513_10000790 | Ga0307513_1000079023 | 166 |
| 345 | 3300031456 | Ga0307513_10004139 | Ga0307513_100041397 | 166 |
| 346 | 3300031456 | Ga0307513_10501814 | Ga0307513_105018142 | 166 |
| 347 | 3300031456 | Ga0307513_10509514 | Ga0307513_105095142 | 166 |
| 348 | 3300031548 | Ga0307408_100794359 | Ga0307408_1007943591 | 166 |
| 349 | 3300031730 | Ga0307516_10000019 | Ga0307516_10000019154 | 166 |
| 350 | 3300031824 | Ga0307413_11896830 | Ga0307413_118968301 | 166 |
| 351 | 3300031901 | Ga0307406_10008222 | Ga0307406_100082227 | 166 |
| 352 | 3300031901 | Ga0307406_10959787 | Ga0307406_109597872 | 166 |
| 353 | 3300031911 | Ga0307412_10006570 | Ga0307412_100065704 | 166 |
| 354 | 3300031911 | Ga0307412_10549258 | Ga0307412_105492582 | 166 |
| 355 | 3300031911 | Ga0307412_11439022 | Ga0307412_114390221 | 166 |
| 356 | 3300032004 | Ga0307414_10056617 | Ga0307414_100566172 | 166 |
| 357 | 3300032004 | Ga0307414_10377663 | Ga0307414_103776632 | 166 |
| 358 | 3300032004 | Ga0307414_10396544 | Ga0307414_103965442 | 166 |
| 359 | 3300032005 | Ga0307411_10202201 | Ga0307411_102022013 | 166 |
| 360 | 3300033180 | Ga0307510_10032424 | Ga0307510_100324247 | 166 |
| 361 | 3300033180 | Ga0307510_10090503 | Ga0307510_100905034 | 166 |
| 362 | 3300033180 | Ga0307510_10372633 | Ga0307510_103726332 | 166 |
| 363 | 3300033180 | Ga0307510_10441553 | Ga0307510_104415531 | 166 |
| 364 | 3300035113 | Ga0373936_0003687 | Ga0373936_0003687_4797_5300 | 166 |
| 365 | 3300035170 | Ga0373943_0040693 | Ga0373943_0040693_234_737 | 166 |
| 366 | 3300035170 | Ga0373943_0273108 | Ga0373943_0273108_203_706 | 166 |
| 367 | 3300035695 | Ga0373927_0003786 | Ga0373927_0003786_9503_10006 | 166 |
| 368 | 3300035725 | Ga0373947_0044772 | Ga0373947_0044772_164_667 | 166 |
| 369 | 3300036401 | Ga0373937_1115188 | Ga0373937_1115188_58_561 | 166 |
| 370 | 3300037068 | Ga0373925_0004623 | Ga0373925_0004623_9164_9667 | 166 |
| 371 | 3300037068 | Ga0373925_0169409 | Ga0373925_0169409_138_641 | 166 |
| 372 | 3300037312 | Ga0395899_0000373 | Ga0395899_0000373_28106_28609 | 166 |
| 373 | 3300037312 | Ga0395899_0356435 | Ga0395899_0356435_174_680 | 166 |
| 374 | 3300037418 | Ga0395900_0000052 | Ga0395900_0000052_97494_97997 | 166 |
| 375 | 3300037418 | Ga0395900_0844447 | Ga0395900_0844447_178_681 | 166 |
| 376 | 3300037466 | Ga0395898_0013380 | Ga0395898_0013380_439_942 | 166 |
| 377 | 3300037466 | Ga0395898_0485355 | Ga0395898_0485355_536_1039 | 166 |
| 378 | 3300037466 | Ga0395898_0529023 | Ga0395898_0529023_178_681 | 166 |
| 379 | 3300037471 | Ga0395905_0102722 | Ga0395905_0102722_476_979 | 166 |
| 380 | 3300037471 | Ga0395905_0370997 | Ga0395905_0370997_383_886 | 166 |
| 381 | 3300037853 | Ga0436364_1032895 | Ga0436364_1032895_1924_2427 | 166 |
| 382 | 3300038443 | Ga0395901_0000001 | Ga0395901_0000001_690012_690515 | 166 |
| 383 | 3300038443 | Ga0395901_0475891 | Ga0395901_0475891_298_801 | 166 |
| 384 | 3300038443 | Ga0395901_0487686 | Ga0395901_0487686_301_804 | 166 |
| 385 | 3300038443 | Ga0395901_0533798 | Ga0395901_0533798_30_533 | 166 |
| 386 | 3300039437 | Ga0436365_1365943 | Ga0436365_1365943_510_1013 | 166 |
| 387 | 3300042156 | Ga0439446_0075290 | Ga0439446_0075290_420_923 | 166 |
| 388 | 3300044684 | Ga0466966_0134742 | Ga0466966_0134742_886_1389 | 166 |
| 389 | 3300044706 | Ga0466964_0028853 | Ga0466964_0028853_389_892 | 166 |
| 390 | 3300044712 | Ga0453684_0267837 | Ga0453684_0267837_190_693 | 166 |
| 391 | 3300044735 | Ga0466968_0148231 | Ga0466968_0148231_140_643 | 166 |
| 392 | 3300046459 | Ga0495629_0106991 | Ga0495629_0106991_761_1264 | 166 |
| 393 | 3300046459 | Ga0495629_0841068 | Ga0495629_0841068_18_521 | 166 |
| 394 | 3300046471 | Ga0495650_0016563 | Ga0495650_0016563_1732_2235 | 166 |
| 395 | 3300046499 | Ga0495594_0303595 | Ga0495594_0303595_100_603 | 166 |
| 396 | 3300046506 | Ga0495583_0047129 | Ga0495583_0047129_912_1415 | 166 |
| 397 | 3300046515 | Ga0495620_0035870 | Ga0495620_0035870_1131_1634 | 166 |
| 398 | 3300046516 | Ga0495628_0186214 | Ga0495628_0186214_533_1039 | 166 |
| 399 | 3300046520 | Ga0495637_0128566 | Ga0495637_0128566_358_861 | 166 |
| 400 | 3300046522 | Ga0495643_0028980 | Ga0495643_0028980_540_1043 | 166 |
| 401 | 3300046525 | Ga0495663_0109467 | Ga0495663_0109467_251_754 | 166 |
| 402 | 3300046525 | Ga0495663_0271062 | Ga0495663_0271062_10_513 | 166 |
| 403 | 3300046542 | Ga0495597_0005464 | Ga0495597_0005464_1470_1973 | 166 |
| 404 | 3300046543 | Ga0495645_0340706 | Ga0495645_0340706_237_743 | 166 |
| 405 | 3300046557 | Ga0495622_0001326 | Ga0495622_0001326_1179_1682 | 166 |
| 406 | 3300046616 | Ga0495668_0013600 | Ga0495668_0013600_4024_4527 | 166 |
| 407 | 3300046616 | Ga0495668_0073617 | Ga0495668_0073617_202_705 | 166 |
| 408 | 3300046616 | Ga0495668_0186150 | Ga0495668_0186150_309_812 | 166 |
| 409 | 3300046616 | Ga0495668_0252643 | Ga0495668_0252643_41_544 | 166 |
| 410 | 3300046616 | Ga0495668_0265881 | Ga0495668_0265881_94_597 | 166 |
| 411 | 3300046616 | Ga0495668_0337844 | Ga0495668_0337844_74_577 | 166 |
| 412 | 3300046616 | Ga0495668_0480913 | Ga0495668_0480913_21_524 | 166 |
| 413 | 3300046648 | Ga0495611_0029789 | Ga0495611_0029789_573_1076 | 166 |
| 414 | 3300046660 | Ga0495625_0067348 | Ga0495625_0067348_401_904 | 166 |
| 415 | 3300046660 | Ga0495625_0165443 | Ga0495625_0165443_516_1019 | 166 |
| 416 | 3300046674 | Ga0495588_0309552 | Ga0495588_0309552_117_620 | 166 |
| 417 | 3300046675 | Ga0495657_0240670 | Ga0495657_0240670_530_1033 | 166 |
| 418 | 3300046684 | Ga0495669_0000012 | Ga0495669_0000012_61203_61706 | 166 |
| 419 | 3300046684 | Ga0495669_0000250 | Ga0495669_0000250_2834_3337 | 166 |
| 420 | 3300046684 | Ga0495669_0068563 | Ga0495669_0068563_398_901 | 166 |
| 421 | 3300046684 | Ga0495669_0137478 | Ga0495669_0137478_90_593 | 166 |
| 422 | 3300046689 | Ga0495613_0542434 | Ga0495613_0542434_72_575 | 166 |
| 423 | 3300046691 | Ga0495670_0397799 | Ga0495670_0397799_92_595 | 166 |
| 424 | 3300047315 | Ga0495581_0178470 | Ga0495581_0178470_583_1086 | 166 |
| 425 | 3300047318 | Ga0495636_0134788 | Ga0495636_0134788_509_1012 | 166 |
| 426 | 3300047320 | Ga0495672_0064064 | Ga0495672_0064064_552_1055 | 166 |
| 427 | 3300047443 | Ga0495687_046127 | Ga0495687_046127_265_768 | 166 |
| 428 | 3300047445 | Ga0495677_0020987 | Ga0495677_0020987_1353_1856 | 166 |
| 429 | 3300047445 | Ga0495677_0085371 | Ga0495677_0085371_244_747 | 166 |
| 430 | 3300047445 | Ga0495677_0141666 | Ga0495677_0141666_332_835 | 166 |
| 431 | 3300047470 | Ga0495681_0090815 | Ga0495681_0090815_399_902 | 166 |
| 432 | 3300047472 | Ga0495686_0006019 | Ga0495686_0006019_85_588 | 166 |
| 433 | 3300047673 | Ga0495593_0031446 | Ga0495593_0031446_763_1266 | 166 |
| 434 | 3300048903 | Ga0496100_0493575 | Ga0496100_0493575_274_780 | 166 |
| 435 | 3300048904 | Ga0496101_0085705 | Ga0496101_0085705_617_1120 | 166 |
| 436 | 3300048905 | Ga0496102_0019470 | Ga0496102_0019470_2442_2945 | 166 |
| 437 | 3300048905 | Ga0496102_0025859 | Ga0496102_0025859_4139_4642 | 166 |
| 438 | 3300048905 | Ga0496102_0334882 | Ga0496102_0334882_221_724 | 166 |
| 439 | 3300048906 | Ga0496103_0055559 | Ga0496103_0055559_1367_1870 | 166 |
| 440 | 3300048906 | Ga0496103_0768427 | Ga0496103_0768427_94_597 | 166 |
| 441 | 3300048908 | Ga0496105_0240272 | Ga0496105_0240272_26_529 | 166 |
| 442 | 3300048910 | Ga0496107_0556322 | Ga0496107_0556322_200_703 | 166 |
| 443 | 3300048910 | Ga0496107_0673039 | Ga0496107_0673039_53_556 | 166 |
| 444 | 3300048911 | Ga0496108_0188933 | Ga0496108_0188933_1100_1603 | 166 |
| 445 | 3300048912 | Ga0496109_0014318 | Ga0496109_0014318_5116_5619 | 166 |
| 446 | 3300048913 | Ga0496110_0376878 | Ga0496110_0376878_674_1177 | 166 |
| 447 | 3300048914 | Ga0496111_0308281 | Ga0496111_0308281_45_548 | 166 |
| 448 | 3300048915 | Ga0496112_0020241 | Ga0496112_0020241_5237_5740 | 166 |
| 449 | 3300048915 | Ga0496112_0339013 | Ga0496112_0339013_702_1205 | 166 |
| 450 | 3300048917 | Ga0496114_1147501 | Ga0496114_1147501_71_574 | 166 |
| 451 | 3300048918 | Ga0496115_0004287 | Ga0496115_0004287_6325_6828 | 166 |
| 452 | 3300048918 | Ga0496115_0006353 | Ga0496115_0006353_6041_6544 | 166 |
| 453 | 3300048918 | Ga0496115_0265905 | Ga0496115_0265905_501_1004 | 166 |
| 454 | 3300048920 | Ga0496117_0014984 | Ga0496117_0014984_5365_5868 | 166 |
| 455 | 3300048921 | Ga0496118_0025848 | Ga0496118_0025848_1867_2370 | 166 |
| 456 | 3300048922 | Ga0496119_0004972 | Ga0496119_0004972_10711_11214 | 166 |
| 457 | 3300048924 | Ga0496121_0000059 | Ga0496121_0000059_138549_139052 | 166 |
| 458 | 3300048928 | Ga0496125_0067909 | Ga0496125_0067909_588_1091 | 166 |
| 459 | 3300049570 | Ga0501033_0151808 | Ga0501033_0151808_550_1053 | 166 |
| 460 | 3300049571 | Ga0501034_0080391 | Ga0501034_0080391_434_937 | 166 |
| 461 | 3300049571 | Ga0501034_0328804 | Ga0501034_0328804_123_626 | 166 |
| 462 | 3300049581 | Ga0501047_0002933 | Ga0501047_0002933_5115_5618 | 166 |
| 463 | 3300049581 | Ga0501047_0048528 | Ga0501047_0048528_557_1060 | 166 |
| 464 | 3300049581 | Ga0501047_0174495 | Ga0501047_0174495_817_1320 | 166 |
| 465 | 3300049582 | Ga0501048_0110380 | Ga0501048_0110380_483_986 | 166 |
| 466 | 3300049586 | Ga0501070_0602056 | Ga0501070_0602056_287_790 | 166 |
| 467 | 3300049686 | Ga0501257_049735 | Ga0501257_049735_375_878 | 166 |
| 468 | 3300049822 | Ga0501035_0088936 | Ga0501035_0088936_544_1047 | 166 |
| 469 | 3300049822 | Ga0501035_0269121 | Ga0501035_0269121_634_1137 | 166 |
| 470 | 3300049822 | Ga0501035_0474790 | Ga0501035_0474790_76_579 | 166 |
| 471 | 3300049822 | Ga0501035_1019650 | Ga0501035_1019650_40_543 | 166 |
| 472 | 3300049822 | Ga0501035_1139545 | Ga0501035_1139545_21_527 | 166 |
| 473 | 3300049823 | Ga0501044_0002607 | Ga0501044_0002607_13524_14027 | 166 |
| 474 | 3300049823 | Ga0501044_0207144 | Ga0501044_0207144_641_1144 | 166 |
| 475 | 3300049823 | Ga0501044_0337787 | Ga0501044_0337787_340_843 | 166 |
| 476 | 3300050489 | nmdc:mga03683_440233_c1 | nmdc:mga03683_440233_c1_74_577 | 166 |
| 477 | 3300050489 | nmdc:mga03683_55387_c1 | nmdc:mga03683_55387_c1_573_1076 | 166 |
| 478 | 3300050491 | nmdc:mga00v17_165_c2 | nmdc:mga00v17_165_c2_4530_5033 | 166 |
| 479 | 3300050493 | nmdc:mga0k408_39482_c1 | nmdc:mga0k408_39482_c1_828_1331 | 166 |
| 480 | 3300050494 | nmdc:mga06z11_55314_c1 | nmdc:mga06z11_55314_c1_756_1259 | 166 |
| 481 | 3300050495 | nmdc:mga04h51_14332_c1 | nmdc:mga04h51_14332_c1_1004_1507 | 166 |
| 482 | 3300050496 | nmdc:mga07m45_74732_c1 | nmdc:mga07m45_74732_c1_1346_1849 | 166 |
| 483 | 3300053080 | Ga0500635_0000048 | Ga0500635_0000048_14622_15125 | 166 |
| 484 | 3300053087 | Ga0500643_003880 | Ga0500643_003880_1460_1963 | 166 |
| 485 | 3300053087 | Ga0500643_020132 | Ga0500643_020132_1214_1717 | 166 |
| 486 | 3300053088 | Ga0500644_0008320 | Ga0500644_0008320_739_1242 | 166 |
| 487 | 3300053090 | Ga0500646_0029525 | Ga0500646_0029525_886_1389 | 166 |
| 488 | 3300053091 | Ga0500647_0113181 | Ga0500647_0113181_59_562 | 166 |
| 489 | 3300053092 | Ga0500583_0159765 | Ga0500583_0159765_511_1014 | 166 |
| 490 | 3300053093 | Ga0500651_0017968 | Ga0500651_0017968_2832_3335 | 166 |
| 491 | 3300053093 | Ga0500651_0222198 | Ga0500651_0222198_593_1096 | 166 |
| 492 | 3300053096 | Ga0500641_0004872 | Ga0500641_0004872_2174_2677 | 166 |
| 493 | 3300053096 | Ga0500641_0011946 | Ga0500641_0011946_2598_3101 | 166 |
| 494 | 3300053103 | Ga0500555_018530 | Ga0500555_018530_1209_1712 | 166 |
| 495 | 3300053103 | Ga0500555_042005 | Ga0500555_042005_730_1233 | 166 |
| 496 | 3300053108 | Ga0500562_000754 | Ga0500562_000754_21_524 | 166 |
| 497 | 3300053108 | Ga0500562_005608 | Ga0500562_005608_2574_3077 | 166 |
| 498 | 3300053109 | Ga0500569_002374 | Ga0500569_002374_518_1021 | 166 |
| 499 | 3300053119 | Ga0500595_004073 | Ga0500595_004073_4426_4929 | 166 |
| 500 | 3300053119 | Ga0500595_075689 | Ga0500595_075689_84_587 | 166 |
| 501 | 3300053122 | Ga0500608_000246 | Ga0500608_000246_4829_5332 | 166 |
| 502 | 3300053122 | Ga0500608_160147 | Ga0500608_160147_362_865 | 166 |
| 503 | 3300053123 | Ga0500614_005576 | Ga0500614_005576_1267_1770 | 166 |
| 504 | 3300053130 | Ga0500642_0042281 | Ga0500642_0042281_1379_1882 | 166 |
| 505 | 3300053134 | Ga0500658_0095970 | Ga0500658_0095970_645_1148 | 166 |
| 506 | 3300053136 | Ga0500559_0199476 | Ga0500559_0199476_346_849 | 166 |
| 507 | 3300053138 | Ga0500564_089445 | Ga0500564_089445_500_1003 | 166 |
| 508 | 3300053148 | Ga0500590_014524 | Ga0500590_014524_2054_2557 | 166 |
| 509 | 3300053154 | Ga0500619_005761 | Ga0500619_005761_1642_2145 | 166 |
| 510 | 3300053156 | Ga0500622_0002994 | Ga0500622_0002994_10307_10810 | 166 |
| 511 | 3300053157 | Ga0500624_054838 | Ga0500624_054838_192_695 | 166 |
| 512 | 3300053163 | Ga0500639_139786 | Ga0500639_139786_510_1013 | 166 |
| 513 | 3300053177 | Ga0500636_0036516 | Ga0500636_0036516_463_966 | 166 |
| 514 | 3300053177 | Ga0500636_0067140 | Ga0500636_0067140_587_1090 | 166 |
| 515 | 3300053178 | Ga0500637_0023865 | Ga0500637_0023865_756_1259 | 166 |
| 516 | 3300053725 | Ga0500576_034342 | Ga0500576_034342_1067_1570 | 166 |
| 517 | 3300053730 | Ga0500645_005711 | Ga0500645_005711_2710_3213 | 166 |
| 518 | 3300053735 | Ga0500596_003146 | Ga0500596_003146_1774_2277 | 166 |
| 519 | 3300053737 | Ga0500601_015595 | Ga0500601_015595_50_553 | 166 |
| 520 | 3300059643 | Ga0587072_045009 | Ga0587072_045009_75_578 | 166 |
| 521 | 3300059643 | Ga0587072_071344 | Ga0587072_071344_102_605 | 166 |
| 522 | iso_pu_bacteria | 2643221614 | 2644086714 | 166 |
| 523 | iso_pu_bacteria | 2643221661 | 2644341668 | 166 |
| 524 | iso_pu_bacteria | 2643221666 | 2644367955 | 166 |
| 525 | 3300005355 | Ga0070671_101058102 | Ga0070671_1010581021 | 167 |
| 526 | 3300014325 | Ga0163163_10583366 | Ga0163163_105833661 | 167 |
| 527 | 3300021377 | Ga0213874_10026951 | Ga0213874_100269513 | 167 |
| 528 | 3300021384 | Ga0213876_10000276 | Ga0213876_1000027635 | 167 |
| 529 | 3300025299 | Ga0209256_1010924 | Ga0209256_10109244 | 167 |
| 530 | 3300028558 | Ga0265326_10022728 | Ga0265326_100227282 | 167 |
| 531 | 3300028563 | Ga0265319_1077553 | Ga0265319_10775532 | 167 |
| 532 | 3300028573 | Ga0265334_10010373 | Ga0265334_100103734 | 167 |
| 533 | 3300028577 | Ga0265318_10112381 | Ga0265318_101123812 | 167 |
| 534 | 3300028800 | Ga0265338_10007642 | Ga0265338_100076424 | 167 |
| 535 | 3300028800 | Ga0265338_10165419 | Ga0265338_101654193 | 167 |
| 536 | 3300031090 | Ga0265760_10075254 | Ga0265760_100752541 | 167 |
| 537 | 3300031240 | Ga0265320_10173992 | Ga0265320_101739922 | 167 |
| 538 | 3300031247 | Ga0265340_10028890 | Ga0265340_100288902 | 167 |
| 539 | 3300031251 | Ga0265327_10109117 | Ga0265327_101091173 | 167 |
| 540 | 3300031711 | Ga0265314_10042221 | Ga0265314_100422214 | 167 |
| 541 | 3300031711 | Ga0265314_10234529 | Ga0265314_102345292 | 167 |
| 542 | 3300031712 | Ga0265342_10510319 | Ga0265342_105103191 | 167 |
| 543 | 3300035086 | Ga0373934_0308535 | Ga0373934_0308535_121_627 | 167 |
| 544 | 3300035724 | Ga0373933_0397796 | Ga0373933_0397796_377_883 | 167 |
| 545 | 3300035724 | Ga0373933_0596593 | Ga0373933_0596593_99_605 | 167 |
| 546 | 3300036401 | Ga0373937_0403589 | Ga0373937_0403589_265_771 | 167 |
| 547 | 3300036401 | Ga0373937_0588225 | Ga0373937_0588225_348_854 | 167 |
| 548 | 3300039437 | Ga0436365_0608786 | Ga0436365_0608786_18271_18777 | 167 |
| 549 | 3300039450 | Ga0436363_0783676 | Ga0436363_0783676_169_672 | 167 |
| 550 | 3300039450 | Ga0436363_1290520 | Ga0436363_1290520_3459_3965 | 167 |
| 551 | 3300047470 | Ga0495681_0071203 | Ga0495681_0071203_204_707 | 167 |
| 552 | 3300048918 | Ga0496115_1061987 | Ga0496115_1061987_87_590 | 167 |
| 553 | 3300053117 | Ga0500593_193496 | Ga0500593_193496_14_520 | 167 |
| 554 | 3300053153 | Ga0500616_0304272 | Ga0500616_0304272_56_562 | 167 |
| 555 | 3300003215 | JGI25153J46596_10026786 | JGI25153J46596_100267862 | 168 |
| 556 | 3300003316 | rootH1_10009031 | rootH1_100090312 | 168 |
| 557 | 3300003773 | Ga0055537_1001821 | Ga0055537_10018214 | 168 |
| 558 | 3300003781 | Ga0055536_1005776 | Ga0055536_10057767 | 168 |
| 559 | 3300003781 | Ga0055536_1005867 | Ga0055536_10058677 | 168 |
| 560 | 3300003790 | Ga0055528_1007241 | Ga0055528_10072416 | 168 |
| 561 | 3300003791 | Ga0055530_10007010 | Ga0055530_100070106 | 168 |
| 562 | 3300003792 | Ga0055540_1031330 | Ga0055540_10313302 | 168 |
| 563 | 3300003794 | Ga0055531_10001668 | Ga0055531_100016687 | 168 |
| 564 | 3300003794 | Ga0055531_10002505 | Ga0055531_100025056 | 168 |
| 565 | 3300003794 | Ga0055531_10065554 | Ga0055531_100655542 | 168 |
| 566 | 3300005262 | Ga0065165_1001299 | Ga0065165_10012993 | 168 |
| 567 | 3300005328 | Ga0070676_11213114 | Ga0070676_112131141 | 168 |
| 568 | 3300005333 | Ga0070677_10326022 | Ga0070677_103260221 | 168 |
| 569 | 3300005335 | Ga0070666_10060309 | Ga0070666_100603091 | 168 |
| 570 | 3300005356 | Ga0070674_100840396 | Ga0070674_1008403961 | 168 |
| 571 | 3300005366 | Ga0070659_100019781 | Ga0070659_1000197817 | 168 |
| 572 | 3300005434 | Ga0070709_10676013 | Ga0070709_106760131 | 168 |
| 573 | 3300005456 | Ga0070678_100685511 | Ga0070678_1006855111 | 168 |
| 574 | 3300005535 | Ga0070684_100833253 | Ga0070684_1008332531 | 168 |
| 575 | 3300005539 | Ga0068853_100036715 | Ga0068853_1000367153 | 168 |
| 576 | 3300005539 | Ga0068853_100248127 | Ga0068853_1002481272 | 168 |
| 577 | 3300005548 | Ga0070665_100624307 | Ga0070665_1006243072 | 168 |
| 578 | 3300005548 | Ga0070665_101341945 | Ga0070665_1013419451 | 168 |
| 579 | 3300005563 | Ga0068855_100136357 | Ga0068855_1001363573 | 168 |
| 580 | 3300005563 | Ga0068855_100499687 | Ga0068855_1004996872 | 168 |
| 581 | 3300005563 | Ga0068855_101479207 | Ga0068855_1014792072 | 168 |
| 582 | 3300005563 | Ga0068855_101624985 | Ga0068855_1016249851 | 168 |
| 583 | 3300005564 | Ga0070664_100184765 | Ga0070664_1001847652 | 168 |
| 584 | 3300005564 | Ga0070664_101028008 | Ga0070664_1010280081 | 168 |
| 585 | 3300005614 | Ga0068856_100702250 | Ga0068856_1007022501 | 168 |
| 586 | 3300005617 | Ga0068859_100115644 | Ga0068859_1001156442 | 168 |
| 587 | 3300005840 | Ga0068870_10067776 | Ga0068870_100677762 | 168 |
| 588 | 3300005843 | Ga0068860_100574747 | Ga0068860_1005747471 | 168 |
| 589 | 3300005844 | Ga0068862_100536223 | Ga0068862_1005362232 | 168 |
| 590 | 3300006177 | Ga0075362_10060000 | Ga0075362_100600001 | 168 |
| 591 | 3300006186 | Ga0075369_10017413 | Ga0075369_100174133 | 168 |
| 592 | 3300006195 | Ga0075366_10045391 | Ga0075366_100453912 | 168 |
| 593 | 3300006195 | Ga0075366_10487716 | Ga0075366_104877161 | 168 |
| 594 | 3300006353 | Ga0075370_10027781 | Ga0075370_100277814 | 168 |
| 595 | 3300006931 | Ga0097620_100115648 | Ga0097620_1001156482 | 168 |
| 596 | 3300009093 | Ga0105240_10002229 | Ga0105240_1000222913 | 168 |
| 597 | 3300009093 | Ga0105240_10216262 | Ga0105240_102162623 | 168 |
| 598 | 3300009093 | Ga0105240_10525981 | Ga0105240_105259812 | 168 |
| 599 | 3300009098 | Ga0105245_10828490 | Ga0105245_108284902 | 168 |
| 600 | 3300009176 | Ga0105242_10408070 | Ga0105242_104080703 | 168 |
| 601 | 3300009177 | Ga0105248_10962852 | Ga0105248_109628522 | 168 |
| 602 | 3300009551 | Ga0105238_10114475 | Ga0105238_101144753 | 168 |
| 603 | 3300009551 | Ga0105238_10643718 | Ga0105238_106437182 | 168 |
| 604 | 3300009551 | Ga0105238_11198423 | Ga0105238_111984232 | 168 |
| 605 | 3300012497 | Ga0157319_1002288 | Ga0157319_10022881 | 168 |
| 606 | 3300013100 | Ga0157373_10003275 | Ga0157373_100032758 | 168 |
| 607 | 3300013105 | Ga0157369_10582660 | Ga0157369_105826602 | 168 |
| 608 | 3300013296 | Ga0157374_12619687 | Ga0157374_126196871 | 168 |
| 609 | 3300013297 | Ga0157378_11409501 | Ga0157378_114095012 | 168 |
| 610 | 3300013306 | Ga0163162_11791954 | Ga0163162_117919541 | 168 |
| 611 | 3300013308 | Ga0157375_11001186 | Ga0157375_110011862 | 168 |
| 612 | 3300021377 | Ga0213874_10196440 | Ga0213874_101964401 | 168 |
| 613 | 3300021388 | Ga0213875_10069405 | Ga0213875_100694052 | 168 |
| 614 | 3300021388 | Ga0213875_10251597 | Ga0213875_102515971 | 168 |
| 615 | 3300021441 | Ga0213871_10045895 | Ga0213871_100458951 | 168 |
| 616 | 3300025263 | Ga0209565_1000402 | Ga0209565_100040236 | 168 |
| 617 | 3300025273 | Ga0209673_1000956 | Ga0209673_100095637 | 168 |
| 618 | 3300025273 | Ga0209673_1044805 | Ga0209673_10448052 | 168 |
| 619 | 3300025291 | Ga0209675_1032346 | Ga0209675_10323462 | 168 |
| 620 | 3300025292 | Ga0209676_1000467 | Ga0209676_100046713 | 168 |
| 621 | 3300025292 | Ga0209676_1000560 | Ga0209676_100056013 | 168 |
| 622 | 3300025295 | Ga0209564_1018585 | Ga0209564_10185852 | 168 |
| 623 | 3300025297 | Ga0209758_1002021 | Ga0209758_100202115 | 168 |
| 624 | 3300025297 | Ga0209758_1002093 | Ga0209758_100209315 | 168 |
| 625 | 3300025298 | Ga0209050_1000461 | Ga0209050_100046158 | 168 |
| 626 | 3300025298 | Ga0209050_1001568 | Ga0209050_100156813 | 168 |
| 627 | 3300025298 | Ga0209050_1011749 | Ga0209050_10117494 | 168 |
| 628 | 3300025299 | Ga0209256_1005220 | Ga0209256_10052205 | 168 |
| 629 | 3300025303 | Ga0209051_1009272 | Ga0209051_10092724 | 168 |
| 630 | 3300025304 | Ga0209257_1000186 | Ga0209257_1000186143 | 168 |
| 631 | 3300025304 | Ga0209257_1001256 | Ga0209257_100125620 | 168 |
| 632 | 3300025304 | Ga0209257_1010228 | Ga0209257_10102282 | 168 |
| 633 | 3300025903 | Ga0207680_10062871 | Ga0207680_100628714 | 168 |
| 634 | 3300025909 | Ga0207705_10204376 | Ga0207705_102043761 | 168 |
| 635 | 3300025913 | Ga0207695_10023959 | Ga0207695_100239599 | 168 |
| 636 | 3300025913 | Ga0207695_10219787 | Ga0207695_102197873 | 168 |
| 637 | 3300025924 | Ga0207694_10193276 | Ga0207694_101932763 | 168 |
| 638 | 3300025928 | Ga0207700_11313437 | Ga0207700_113134371 | 168 |
| 639 | 3300025932 | Ga0207690_10077040 | Ga0207690_100770401 | 168 |
| 640 | 3300025934 | Ga0207686_10084875 | Ga0207686_100848752 | 168 |
| 641 | 3300025941 | Ga0207711_10511688 | Ga0207711_105116882 | 168 |
| 642 | 3300025945 | Ga0207679_10043649 | Ga0207679_100436492 | 168 |
| 643 | 3300025949 | Ga0207667_10203744 | Ga0207667_102037442 | 168 |
| 644 | 3300025949 | Ga0207667_11305497 | Ga0207667_113054971 | 168 |
| 645 | 3300025949 | Ga0207667_11403068 | Ga0207667_114030681 | 168 |
| 646 | 3300025972 | Ga0207668_10065020 | Ga0207668_100650203 | 168 |
| 647 | 3300026023 | Ga0207677_10740962 | Ga0207677_107409622 | 168 |
| 648 | 3300026041 | Ga0207639_10027056 | Ga0207639_100270564 | 168 |
| 649 | 3300026041 | Ga0207639_10174365 | Ga0207639_101743651 | 168 |
| 650 | 3300026078 | Ga0207702_10892307 | Ga0207702_108923072 | 168 |
| 651 | 3300026078 | Ga0207702_11784625 | Ga0207702_117846251 | 168 |
| 652 | 3300026116 | Ga0207674_10277098 | Ga0207674_102770983 | 168 |
| 653 | 3300028380 | Ga0268265_10078212 | Ga0268265_100782123 | 168 |
| 654 | 3300028381 | Ga0268264_10250574 | Ga0268264_102505742 | 168 |
| 655 | 3300028573 | Ga0265334_10046570 | Ga0265334_100465702 | 168 |
| 656 | 3300028786 | Ga0307517_10176060 | Ga0307517_101760601 | 168 |
| 657 | 3300028794 | Ga0307515_10016786 | Ga0307515_100167864 | 168 |
| 658 | 3300028794 | Ga0307515_10498621 | Ga0307515_104986211 | 168 |
| 659 | 3300028800 | Ga0265338_10097782 | Ga0265338_100977822 | 168 |
| 660 | 3300028800 | Ga0265338_10234014 | Ga0265338_102340142 | 168 |
| 661 | 3300028800 | Ga0265338_10447921 | Ga0265338_104479211 | 168 |
| 662 | 3300029957 | Ga0265324_10103409 | Ga0265324_101034092 | 168 |
| 663 | 3300031235 | Ga0265330_10216422 | Ga0265330_102164222 | 168 |
| 664 | 3300031240 | Ga0265320_10228339 | Ga0265320_102283391 | 168 |
| 665 | 3300031240 | Ga0265320_10448505 | Ga0265320_104485051 | 168 |
| 666 | 3300031251 | Ga0265327_10000454 | Ga0265327_1000045430 | 168 |
| 667 | 3300031251 | Ga0265327_10001513 | Ga0265327_100015135 | 168 |
| 668 | 3300031456 | Ga0307513_10364128 | Ga0307513_103641282 | 168 |
| 669 | 3300031649 | Ga0307514_10358057 | Ga0307514_103580571 | 168 |
| 670 | 3300031711 | Ga0265314_10118869 | Ga0265314_101188692 | 168 |
| 671 | 3300032004 | Ga0307414_10264532 | Ga0307414_102645321 | 168 |
| 672 | 3300032005 | Ga0307411_10927407 | Ga0307411_109274072 | 168 |
| 673 | 3300033180 | Ga0307510_10291518 | Ga0307510_102915182 | 168 |
| 674 | 3300036401 | Ga0373937_0165947 | Ga0373937_0165947_1270_1779 | 168 |
| 675 | 3300036401 | Ga0373937_1350595 | Ga0373937_1350595_122_631 | 168 |
| 676 | 3300037312 | Ga0395899_0145401 | Ga0395899_0145401_775_1284 | 168 |
| 677 | 3300037418 | Ga0395900_0136998 | Ga0395900_0136998_1815_2324 | 168 |
| 678 | 3300037466 | Ga0395898_0129364 | Ga0395898_0129364_1859_2368 | 168 |
| 679 | 3300037853 | Ga0436364_0868872 | Ga0436364_0868872_1477_1986 | 168 |
| 680 | 3300037853 | Ga0436364_0877114 | Ga0436364_0877114_2190_2699 | 168 |
| 681 | 3300037853 | Ga0436364_1504159 | Ga0436364_1504159_201_710 | 168 |
| 682 | 3300038443 | Ga0395901_0121355 | Ga0395901_0121355_559_1068 | 168 |
| 683 | 3300038443 | Ga0395901_0153468 | Ga0395901_0153468_112_621 | 168 |
| 684 | 3300039437 | Ga0436365_1252750 | Ga0436365_1252750_788_1309 | 168 |
| 685 | 3300039438 | Ga0436360_0439840 | Ga0436360_0439840_162_674 | 168 |
| 686 | 3300039438 | Ga0436360_0606916 | Ga0436360_0606916_214_723 | 168 |
| 687 | 3300039447 | Ga0436361_1100879 | Ga0436361_1100879_20281_20790 | 168 |
| 688 | 3300039450 | Ga0436363_0535485 | Ga0436363_0535485_648_1157 | 168 |
| 689 | 3300041451 | Ga0451791_1365756 | Ga0451791_1365756_21_530 | 168 |
| 690 | 3300041459 | Ga0451800_0223665 | Ga0451800_0223665_55_561 | 168 |
| 691 | 3300041512 | Ga0451853_1586036 | Ga0451853_1586036_98_604 | 168 |
| 692 | 3300042004 | Ga0439445_0023404 | Ga0439445_0023404_266_772 | 168 |
| 693 | 3300042156 | Ga0439446_0008299 | Ga0439446_0008299_1151_1657 | 168 |
| 694 | 3300042436 | Ga0439435_0009519 | Ga0439435_0009519_1546_2052 | 168 |
| 695 | 3300046453 | Ga0495627_000767 | Ga0495627_000767_17624_18130 | 168 |
| 696 | 3300046460 | Ga0495638_0000935 | Ga0495638_0000935_6195_6701 | 168 |
| 697 | 3300046460 | Ga0495638_0001119 | Ga0495638_0001119_8630_9136 | 168 |
| 698 | 3300046460 | Ga0495638_0025082 | Ga0495638_0025082_3117_3623 | 168 |
| 699 | 3300046460 | Ga0495638_0223734 | Ga0495638_0223734_142_648 | 168 |
| 700 | 3300046462 | Ga0495651_0292422 | Ga0495651_0292422_242_751 | 168 |
| 701 | 3300046471 | Ga0495650_0000403 | Ga0495650_0000403_58142_58648 | 168 |
| 702 | 3300046471 | Ga0495650_0047502 | Ga0495650_0047502_1028_1534 | 168 |
| 703 | 3300046471 | Ga0495650_0187715 | Ga0495650_0187715_113_619 | 168 |
| 704 | 3300046492 | Ga0495585_0152341 | Ga0495585_0152341_433_939 | 168 |
| 705 | 3300046506 | Ga0495583_0000005 | Ga0495583_0000005_133313_133819 | 168 |
| 706 | 3300046507 | Ga0495606_0003858 | Ga0495606_0003858_9214_9720 | 168 |
| 707 | 3300046512 | Ga0495610_0002475 | Ga0495610_0002475_11799_12305 | 168 |
| 708 | 3300046512 | Ga0495610_0009314 | Ga0495610_0009314_3732_4238 | 168 |
| 709 | 3300046512 | Ga0495610_0011679 | Ga0495610_0011679_3766_4272 | 168 |
| 710 | 3300046513 | Ga0495616_0000172 | Ga0495616_0000172_21098_21604 | 168 |
| 711 | 3300046518 | Ga0495631_0011080 | Ga0495631_0011080_1166_1672 | 168 |
| 712 | 3300046519 | Ga0495632_0015448 | Ga0495632_0015448_52_558 | 168 |
| 713 | 3300046520 | Ga0495637_0056020 | Ga0495637_0056020_546_1052 | 168 |
| 714 | 3300046522 | Ga0495643_0204435 | Ga0495643_0204435_306_812 | 168 |
| 715 | 3300046524 | Ga0495648_0024553 | Ga0495648_0024553_2087_2593 | 168 |
| 716 | 3300046524 | Ga0495648_0046545 | Ga0495648_0046545_1909_2415 | 168 |
| 717 | 3300046524 | Ga0495648_0221235 | Ga0495648_0221235_70_576 | 168 |
| 718 | 3300046524 | Ga0495648_0306086 | Ga0495648_0306086_196_702 | 168 |
| 719 | 3300046525 | Ga0495663_0036119 | Ga0495663_0036119_347_853 | 168 |
| 720 | 3300046530 | Ga0495654_0000708 | Ga0495654_0000708_13133_13639 | 168 |
| 721 | 3300046539 | Ga0495621_0016728 | Ga0495621_0016728_701_1210 | 168 |
| 722 | 3300046539 | Ga0495621_0388434 | Ga0495621_0388434_20_568 | 168 |
| 723 | 3300046542 | Ga0495597_0218989 | Ga0495597_0218989_188_694 | 168 |
| 724 | 3300046543 | Ga0495645_0625191 | Ga0495645_0625191_86_595 | 168 |
| 725 | 3300046616 | Ga0495668_0000100 | Ga0495668_0000100_125124_125630 | 168 |
| 726 | 3300046616 | Ga0495668_0009341 | Ga0495668_0009341_3458_3964 | 168 |
| 727 | 3300046616 | Ga0495668_0012089 | Ga0495668_0012089_1131_1637 | 168 |
| 728 | 3300046616 | Ga0495668_0033240 | Ga0495668_0033240_1971_2477 | 168 |
| 729 | 3300046660 | Ga0495625_0003383 | Ga0495625_0003383_9529_10035 | 168 |
| 730 | 3300046660 | Ga0495625_0003474 | Ga0495625_0003474_5976_6482 | 168 |
| 731 | 3300046660 | Ga0495625_0014000 | Ga0495625_0014000_4037_4543 | 168 |
| 732 | 3300046660 | Ga0495625_0021720 | Ga0495625_0021720_3023_3529 | 168 |
| 733 | 3300046660 | Ga0495625_0028606 | Ga0495625_0028606_788_1294 | 168 |
| 734 | 3300046660 | Ga0495625_0054628 | Ga0495625_0054628_739_1245 | 168 |
| 735 | 3300046664 | Ga0495659_0060458 | Ga0495659_0060458_839_1345 | 168 |
| 736 | 3300046689 | Ga0495613_0001323 | Ga0495613_0001323_1624_2133 | 168 |
| 737 | 3300046692 | Ga0495671_0090907 | Ga0495671_0090907_487_993 | 168 |
| 738 | 3300046794 | Ga0495589_0164422 | Ga0495589_0164422_394_900 | 168 |
| 739 | 3300046810 | Ga0495660_0066897 | Ga0495660_0066897_1287_1793 | 168 |
| 740 | 3300047320 | Ga0495672_0001210 | Ga0495672_0001210_19844_20350 | 168 |
| 741 | 3300047443 | Ga0495687_128384 | Ga0495687_128384_76_582 | 168 |
| 742 | 3300047446 | Ga0495679_021303 | Ga0495679_021303_1677_2183 | 168 |
| 743 | 3300047446 | Ga0495679_084936 | Ga0495679_084936_307_813 | 168 |
| 744 | 3300047469 | Ga0495673_0000025 | Ga0495673_0000025_228692_229198 | 168 |
| 745 | 3300047469 | Ga0495673_0001381 | Ga0495673_0001381_3897_4403 | 168 |
| 746 | 3300047469 | Ga0495673_0002003 | Ga0495673_0002003_5491_5997 | 168 |
| 747 | 3300047470 | Ga0495681_0024801 | Ga0495681_0024801_719_1225 | 168 |
| 748 | 3300047472 | Ga0495686_0001965 | Ga0495686_0001965_2840_3346 | 168 |
| 749 | 3300047472 | Ga0495686_0014178 | Ga0495686_0014178_2331_2837 | 168 |
| 750 | 3300047472 | Ga0495686_0044404 | Ga0495686_0044404_2292_2798 | 168 |
| 751 | 3300047472 | Ga0495686_0163401 | Ga0495686_0163401_708_1214 | 168 |
| 752 | 3300047472 | Ga0495686_0195760 | Ga0495686_0195760_623_1129 | 168 |
| 753 | 3300048904 | Ga0496101_0149595 | Ga0496101_0149595_1115_1621 | 168 |
| 754 | 3300048909 | Ga0496106_0003982 | Ga0496106_0003982_1371_1877 | 168 |
| 755 | 3300048909 | Ga0496106_0650243 | Ga0496106_0650243_17_526 | 168 |
| 756 | 3300048910 | Ga0496107_0000063 | Ga0496107_0000063_12358_12864 | 168 |
| 757 | 3300048918 | Ga0496115_0008707 | Ga0496115_0008707_5639_6145 | 168 |
| 758 | 3300048918 | Ga0496115_0736979 | Ga0496115_0736979_86_592 | 168 |
| 759 | 3300048924 | Ga0496121_0017039 | Ga0496121_0017039_70_576 | 168 |
| 760 | 3300048927 | Ga0496124_0013512 | Ga0496124_0013512_3787_4293 | 168 |
| 761 | 3300048928 | Ga0496125_0089362 | Ga0496125_0089362_858_1364 | 168 |
| 762 | 3300048929 | Ga0496126_0074075 | Ga0496126_0074075_334_840 | 168 |
| 763 | 3300049459 | Ga0495678_010136 | Ga0495678_010136_1064_1570 | 168 |
| 764 | 3300049459 | Ga0495678_150844 | Ga0495678_150844_83_589 | 168 |
| 765 | 3300049570 | Ga0501033_0015367 | Ga0501033_0015367_3184_3693 | 168 |
| 766 | 3300049571 | Ga0501034_0002424 | Ga0501034_0002424_5754_6263 | 168 |
| 767 | 3300049572 | Ga0501036_0988846 | Ga0501036_0988846_21_530 | 168 |
| 768 | 3300049573 | Ga0501037_0409239 | Ga0501037_0409239_119_628 | 168 |
| 769 | 3300049574 | Ga0501038_0171942 | Ga0501038_0171942_488_997 | 168 |
| 770 | 3300049671 | Ga0501238_003567 | Ga0501238_003567_795_1301 | 168 |
| 771 | 3300049823 | Ga0501044_0000280 | Ga0501044_0000280_56488_56997 | 168 |
| 772 | 3300049823 | Ga0501044_0293953 | Ga0501044_0293953_169_678 | 168 |
| 773 | 3300050489 | nmdc:mga03683_46670_c1 | nmdc:mga03683_46670_c1_1169_1675 | 168 |
| 774 | 3300050493 | nmdc:mga0k408_191397_c1 | nmdc:mga0k408_191397_c1_536_1042 | 168 |
| 775 | 3300050493 | nmdc:mga0k408_515827_c1 | nmdc:mga0k408_515827_c1_96_602 | 168 |
| 776 | 3300050496 | nmdc:mga07m45_171659_c1 | nmdc:mga07m45_171659_c1_449_955 | 168 |
| 777 | 3300050516 | nmdc:mga0sz30_2184_c1 | nmdc:mga0sz30_2184_c1_5066_5572 | 168 |
| 778 | 3300053086 | Ga0500578_0000913 | Ga0500578_0000913_12872_13378 | 168 |
| 779 | 3300053087 | Ga0500643_000316 | Ga0500643_000316_23621_24130 | 168 |
| 780 | 3300053087 | Ga0500643_017750 | Ga0500643_017750_430_936 | 168 |
| 781 | 3300053087 | Ga0500643_073400 | Ga0500643_073400_304_810 | 168 |
| 782 | 3300053088 | Ga0500644_0000287 | Ga0500644_0000287_25449_25955 | 168 |
| 783 | 3300053088 | Ga0500644_0009395 | Ga0500644_0009395_1582_2088 | 168 |
| 784 | 3300053091 | Ga0500647_0017276 | Ga0500647_0017276_2324_2833 | 168 |
| 785 | 3300053092 | Ga0500583_0223218 | Ga0500583_0223218_292_798 | 168 |
| 786 | 3300053093 | Ga0500651_0421470 | Ga0500651_0421470_63_569 | 168 |
| 787 | 3300053096 | Ga0500641_0000367 | Ga0500641_0000367_10251_10760 | 168 |
| 788 | 3300053102 | Ga0500554_022618 | Ga0500554_022618_35_541 | 168 |
| 789 | 3300053103 | Ga0500555_015082 | Ga0500555_015082_1138_1647 | 168 |
| 790 | 3300053104 | Ga0500556_0001952 | Ga0500556_0001952_5684_6190 | 168 |
| 791 | 3300053104 | Ga0500556_0002100 | Ga0500556_0002100_4201_4710 | 168 |
| 792 | 3300053104 | Ga0500556_0053471 | Ga0500556_0053471_918_1427 | 168 |
| 793 | 3300053108 | Ga0500562_014884 | Ga0500562_014884_633_1142 | 168 |
| 794 | 3300053111 | Ga0500572_000189 | Ga0500572_000189_11653_12162 | 168 |
| 795 | 3300053118 | Ga0500594_0003639 | Ga0500594_0003639_1036_1542 | 168 |
| 796 | 3300053119 | Ga0500595_022624 | Ga0500595_022624_1210_1719 | 168 |
| 797 | 3300053122 | Ga0500608_014541 | Ga0500608_014541_1035_1541 | 168 |
| 798 | 3300053123 | Ga0500614_234343 | Ga0500614_234343_40_546 | 168 |
| 799 | 3300053125 | Ga0500618_000319 | Ga0500618_000319_22902_23408 | 168 |
| 800 | 3300053133 | Ga0500655_021376 | Ga0500655_021376_386_895 | 168 |
| 801 | 3300053134 | Ga0500658_0005593 | Ga0500658_0005593_3115_3621 | 168 |
| 802 | 3300053136 | Ga0500559_0000010 | Ga0500559_0000010_103236_103745 | 168 |
| 803 | 3300053136 | Ga0500559_0000153 | Ga0500559_0000153_12843_13349 | 168 |
| 804 | 3300053136 | Ga0500559_0013632 | Ga0500559_0013632_2029_2535 | 168 |
| 805 | 3300053136 | Ga0500559_0018372 | Ga0500559_0018372_2027_2533 | 168 |
| 806 | 3300053138 | Ga0500564_000369 | Ga0500564_000369_2037_2543 | 168 |
| 807 | 3300053142 | Ga0500577_0001350 | Ga0500577_0001350_1793_2299 | 168 |
| 808 | 3300053153 | Ga0500616_0012826 | Ga0500616_0012826_2324_2833 | 168 |
| 809 | 3300053153 | Ga0500616_0017769 | Ga0500616_0017769_2073_2582 | 168 |
| 810 | 3300053153 | Ga0500616_0034015 | Ga0500616_0034015_1227_1736 | 168 |
| 811 | 3300053153 | Ga0500616_0161756 | Ga0500616_0161756_116_622 | 168 |
| 812 | 3300053156 | Ga0500622_0004398 | Ga0500622_0004398_5573_6079 | 168 |
| 813 | 3300053156 | Ga0500622_0017251 | Ga0500622_0017251_1421_1930 | 168 |
| 814 | 3300053156 | Ga0500622_0074609 | Ga0500622_0074609_326_832 | 168 |
| 815 | 3300053156 | Ga0500622_0207383 | Ga0500622_0207383_362_868 | 168 |
| 816 | 3300053158 | Ga0500627_0053289 | Ga0500627_0053289_811_1317 | 168 |
| 817 | 3300053730 | Ga0500645_001079 | Ga0500645_001079_3029_3538 | 168 |
| 818 | 3300053730 | Ga0500645_001315 | Ga0500645_001315_9696_10205 | 168 |
| 819 | 3300053730 | Ga0500645_086685 | Ga0500645_086685_153_662 | 168 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7fz5-assembly1.cif.gz_A | crystal structure of human fabp4 in complex with rac-(2r)-1-[[3-(3-cyclopropyl-1,2,4-oxadiazol-5-yl)-4,5,6,7-tetrahydro-1-benzothiophen-2-yl]carbamoyl]pyrrolidine-2-carboxylic acid | 0.7706 | 29 | 67 |
| 7fwq-assembly1.cif.gz_A | crystal structure of human fabp4 binding site mutated to that of fabp3 in complex with 6-chloro-4-(2-chlorophenoxy)-2-methylquinoline-3-carboxylic acid, i.e. smiles c1(ccc2c(c1)c(c(c(n2)c)c(=o)o)oc1c(cccc1)cl)cl with ic50=0.048 microm | 0.736 | 29 | 67 |
| 6vu7-assembly1.cif.gz_D | crystal structure of ybjn, a putative transcription regulator from e. coli | 0.7306 | 17 | 137 |
| 4h5b-assembly1.cif.gz_A | crystal structure of dr_1245 from deinococcus radiodurans | 0.7047 | 17 | 151 |
| 1n5b-assembly3.cif.gz_B | crystal structure of the yersinia enterocolitica molecular chaperone syce | 0.7018 | 18 | 138 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y4U0_54_180_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8231 | 19 | 136 | 3.30.420.40 |
| af_I6Y4U0_54_180_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.7645 | 19 | 136 | 3.30.420.40 |
| af_A4I6G8_183_310_3.30.1460.10 | Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; | 0.758 | 16 | 135 | 3.30.1460.10 |
| af_Q2FXG1_205_373_3.40.50.10990 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II | 0.7458 | 40 | 68 | 3.40.50.10990 |
| 1k3eA02 | Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; | 0.7329 | 40 | 140 | 3.30.1460.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257X5W7-F1-model_v4 | YbjN domain-containing protein | 0.9605 | 1 | 138 |
|
| AF-A0A257X5W7-F1-model_v4 | YbjN domain-containing protein | 0.9537 | 1 | 138 |
|
| AF-A0A5E7YW60-F1-model_v4 | deleted | 0.9425 | 13 | 168 |
|
| AF-A0A0J6CHT9-F1-model_v4 | Sensory transduction regulator | 0.938 | 18 | 151 |
|
| AF-A0A838MP11-F1-model_v4 | YbjN domain-containing protein | 0.9355 | 13 | 161 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar