F482182

General Info

Members Datasets Scaffolds Average Seq Length
819 369 789 167

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0439840|Ga0436360_0439840_162_674
Length 170
Sequence MTLQRTDEDDTLMALDPLDVVERVLSAENLAFDRTDDGDIAFSLTGDWRDYEMWFAWRPDAECLQLCLSMDHKAAAGGARDGAHQLVNLINQRVWLGHFEVWADEGEVVFRHAMALPGAERPSMAQAASMIDAAMEAADRFFPAFNFLIAEGRTAEDAMASCMFETVGQA

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
9 2643221583 Caulobacter sp. Root655 Isolate Unclassified
10 2643221584 Caulobacter sp. Root656 Isolate Unclassified
11 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
12 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
13 2643221640 Caulobacter sp. Root342 Isolate Unclassified
14 2643221642 Caulobacter sp. Root343 Isolate Unclassified
15 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
16 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
17 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
18 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
19 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
20 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
21 2818991435 Caulobacter henricii 536 Isolate Unclassified
22 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
23 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
24 2849560528 Caulobacter zeae 410 Isolate Unclassified
25 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
26 2851153111 Caulobacter radicis 736 Isolate Unclassified
27 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
28 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
29 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
30 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
33 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
119 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
123 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
124 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
174 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
183 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
184 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
185 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
186 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
190 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
191 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
193 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
194 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
199 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
200 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
208 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
209 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
226 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
227 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
228 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
231 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
232 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
233 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
234 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
235 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
236 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
237 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
238 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
239 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
242 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
243 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
244 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
245 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
246 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
247 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
250 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
251 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
252 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
253 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
256 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
257 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
258 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
259 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
260 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
261 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
262 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
263 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
266 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
267 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
270 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
271 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
272 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
273 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
274 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
275 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
276 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
277 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
278 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
279 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
280 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
281 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
282 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
283 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
284 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
285 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
286 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
287 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
303 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
304 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
307 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
308 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
309 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
310 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
318 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
319 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
323 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
327 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
328 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
329 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
330 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
331 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
332 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
333 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
334 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
335 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
336 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
337 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
338 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
339 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
340 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
341 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
342 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
343 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
344 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
345 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
346 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
347 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
348 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
349 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
350 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
351 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
352 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
353 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
354 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
355 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
356 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
357 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
358 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
359 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
360 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
361 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
362 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
363 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
364 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
365 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
366 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
367 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
368 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
369 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.97
Metatranscriptomes 0.37
Isolates 3.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.32
Nodule 0.24
Rhizoplane 3.66
Rhizosphere 69.6
Stem 0
Stem Tuber 0
Unclassified 8.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10026786 3300003215 Bacteria 2034
2 JGI25153J46596_10033714 3300003215 Bacteria 1685
3 rootH1_10009031 3300003316 Bacteria 3697
4 Ga0055537_1001821 3300003773 Bacteria 7720
5 Ga0055536_1005613 3300003781 Bacteria 6079
6 Ga0055536_1005776 3300003781 Bacteria 5962
7 Ga0055536_1005867 3300003781 Bacteria 5893
8 Ga0055528_1007241 3300003790 Bacteria 4926
9 Ga0055530_10001660 3300003791 Bacteria 15828
10 Ga0055530_10007010 3300003791 Bacteria 4855
11 Ga0055540_1031330 3300003792 Bacteria 1223
12 Ga0055531_10000948 3300003794 Bacteria 23325
13 Ga0055531_10001668 3300003794 Bacteria 15997
14 Ga0055531_10002505 3300003794 Bacteria 12241
15 Ga0055531_10016422 3300003794 Bacteria 3194
16 Ga0055531_10065554 3300003794 Bacteria 863
17 Ga0065165_1001299 3300005262 Bacteria 28025
18 Ga0065165_1005120 3300005262 Bacteria 7591
19 Ga0070658_10182987 3300005327 Bacteria 1764
20 Ga0070658_10338648 3300005327 Bacteria 1286
21 Ga0070658_11058063 3300005327 Bacteria 706
22 Ga0070676_11213114 3300005328 Bacteria 574
23 Ga0070670_100000035 3300005331 Bacteria 157570
24 Ga0070670_100015841 3300005331 Bacteria 6469
25 Ga0070670_100203772 3300005331 Bacteria 1719
26 Ga0070670_101331338 3300005331 Bacteria 658
27 Ga0070677_10326022 3300005333 Bacteria 788
28 Ga0068869_100091453 3300005334 Bacteria 2289
29 Ga0068869_101159370 3300005334 Bacteria 678
30 Ga0070666_10058966 3300005335 Bacteria 2596
31 Ga0070666_10060309 3300005335 Bacteria 2567
32 Ga0070680_100008070 3300005336 Bacteria 8041
33 Ga0070680_100052344 3300005336 Bacteria 3332
34 Ga0068868_100069231 3300005338 Bacteria 2812
35 Ga0070660_100428071 3300005339 Bacteria 1096
36 Ga0070689_100345440 3300005340 Bacteria 1247
37 Ga0070691_10006344 3300005341 Bacteria 5404
38 Ga0070692_10215857 3300005345 Bacteria 1131
39 Ga0070668_100002182 3300005347 Bacteria 14344
40 Ga0070668_100003540 3300005347 Bacteria 11519
41 Ga0070668_100003652 3300005347 Bacteria 11349
42 Ga0070668_100007003 3300005347 Bacteria 8356
43 Ga0070668_100011492 3300005347 Bacteria 6592
44 Ga0070669_100021322 3300005353 Bacteria 4630
45 Ga0070671_100007055 3300005355 Bacteria 8998
46 Ga0070671_100060840 3300005355 Bacteria 3144
47 Ga0070671_101058102 3300005355 Bacteria 712
48 Ga0070674_100840396 3300005356 Bacteria 796
49 Ga0070673_100178716 3300005364 Bacteria 1816
50 Ga0070659_100008075 3300005366 Bacteria 7673
51 Ga0070659_100019781 3300005366 Bacteria 5110
52 Ga0070667_100000711 3300005367 Bacteria 32094
53 Ga0070667_100028886 3300005367 Bacteria 4617
54 Ga0070667_100038720 3300005367 Bacteria 3998
55 Ga0070667_100063073 3300005367 Bacteria 3140
56 Ga0070667_100203998 3300005367 Bacteria 1755
57 Ga0070709_10676013 3300005434 Bacteria 801
58 Ga0070678_100685511 3300005456 Bacteria 922
59 Ga0070662_100038594 3300005457 Bacteria 3393
60 Ga0070681_10028637 3300005458 Bacteria 5601
61 Ga0070679_100040692 3300005530 Bacteria 4624
62 Ga0070679_100068678 3300005530 Bacteria 3534
63 Ga0070684_100833253 3300005535 Bacteria 863
64 Ga0068853_100036715 3300005539 Bacteria 4168
65 Ga0068853_100248127 3300005539 Bacteria 1633
66 Ga0068853_100327918 3300005539 Bacteria 1420
67 Ga0068853_100361875 3300005539 Bacteria 1352
68 Ga0068853_101296962 3300005539 Bacteria 704
69 Ga0070672_100726181 3300005543 Bacteria 871
70 Ga0070665_100000433 3300005548 Bacteria 60988
71 Ga0070665_100001010 3300005548 Bacteria 35486
72 Ga0070665_100002102 3300005548 Bacteria 22306
73 Ga0070665_100032211 3300005548 Bacteria 5276
74 Ga0070665_100154207 3300005548 Bacteria 2299
75 Ga0070665_100624307 3300005548 Bacteria 1091
76 Ga0070665_101341945 3300005548 Bacteria 725
77 Ga0068855_100030575 3300005563 Bacteria 6438
78 Ga0068855_100044548 3300005563 Bacteria 5250
79 Ga0068855_100048970 3300005563 Bacteria 4986
80 Ga0068855_100136357 3300005563 Bacteria 2800
81 Ga0068855_100209393 3300005563 Bacteria 2192
82 Ga0068855_100499687 3300005563 Bacteria 1322
83 Ga0068855_100633725 3300005563 Bacteria 1150
84 Ga0068855_101479207 3300005563 Bacteria 698
85 Ga0068855_101624985 3300005563 Bacteria 661
86 Ga0070664_100184765 3300005564 Bacteria 1855
87 Ga0070664_100204087 3300005564 Bacteria 1765
88 Ga0070664_101028008 3300005564 Bacteria 775
89 Ga0068857_100180497 3300005577 Bacteria 1921
90 Ga0068857_100707406 3300005577 Bacteria 957
91 Ga0068854_100149457 3300005578 Bacteria 1800
92 Ga0068856_100161846 3300005614 Bacteria 2248
93 Ga0068856_100702250 3300005614 Bacteria 1032
94 Ga0068852_100612675 3300005616 Bacteria 1094
95 Ga0068859_100002125 3300005617 Bacteria 20174
96 Ga0068859_100067285 3300005617 Bacteria 3617
97 Ga0068859_100115644 3300005617 Bacteria 2747
98 Ga0068859_100231589 3300005617 Bacteria 1936
99 Ga0068864_100000102 3300005618 Bacteria 82743
100 Ga0068864_100000165 3300005618 Bacteria 60874
101 Ga0068864_100008059 3300005618 Bacteria 8688
102 Ga0068864_100027772 3300005618 Bacteria 4782
103 Ga0068870_10067776 3300005840 Bacteria 1937
104 Ga0068863_100000128 3300005841 Bacteria 79841
105 Ga0068863_100002006 3300005841 Bacteria 20201
106 Ga0068863_100009403 3300005841 Bacteria 9543
107 Ga0068863_100037082 3300005841 Bacteria 4642
108 Ga0068863_100095785 3300005841 Bacteria 2817
109 Ga0068863_100599018 3300005841 Bacteria 1091
110 Ga0068858_100000117 3300005842 Bacteria 83778
111 Ga0068858_100015866 3300005842 Bacteria 7081
112 Ga0068858_100143483 3300005842 Bacteria 2242
113 Ga0068860_100000100 3300005843 Bacteria 144580
114 Ga0068860_100000157 3300005843 Bacteria 110717
115 Ga0068860_100012420 3300005843 Bacteria 8389
116 Ga0068860_100033952 3300005843 Bacteria 4894
117 Ga0068860_100574747 3300005843 Bacteria 1131
118 Ga0068862_100000368 3300005844 Bacteria 48907
119 Ga0068862_100003705 3300005844 Bacteria 13061
120 Ga0068862_100040787 3300005844 Bacteria 3947
121 Ga0068862_100536223 3300005844 Bacteria 1116
122 Ga0068862_100572608 3300005844 Bacteria 1081
123 Ga0070717_10033442 3300006028 Bacteria 4149
124 Ga0070717_10130611 3300006028 Bacteria 2160
125 Ga0075368_10001287 3300006042 Bacteria 7949
126 Ga0075363_100145209 3300006048 Bacteria 1337
127 Ga0075364_10000571 3300006051 Bacteria 18956
128 Ga0075362_10060000 3300006177 Bacteria 1719
129 Ga0075362_10139652 3300006177 Bacteria 1157
130 Ga0075367_10002075 3300006178 Bacteria 8975
131 Ga0075369_10017413 3300006186 Bacteria 2912
132 Ga0075366_10045391 3300006195 Bacteria 2604
133 Ga0075366_10055972 3300006195 Bacteria 2342
134 Ga0075366_10487716 3300006195 Bacteria 761
135 Ga0075370_10027781 3300006353 Bacteria 3142
136 Ga0075370_10106302 3300006353 Bacteria 1627
137 Ga0068865_100008084 3300006881 Bacteria 6494
138 Ga0097620_100002125 3300006931 Bacteria 20174
139 Ga0097620_100067286 3300006931 Bacteria 3617
140 Ga0097620_100115648 3300006931 Bacteria 2747
141 Ga0097620_100231602 3300006931 Bacteria 1936
142 Ga0079104_1016114 3300006946 Bacteria 2194
143 Ga0105240_10002229 3300009093 Bacteria 31523
144 Ga0105240_10002462 3300009093 Bacteria 29759
145 Ga0105240_10050501 3300009093 Bacteria 5242
146 Ga0105240_10216262 3300009093 Bacteria 2236
147 Ga0105240_10269047 3300009093 Bacteria 1963
148 Ga0105240_10334737 3300009093 Bacteria 1721
149 Ga0105240_10426048 3300009093 Bacteria 1490
150 Ga0105240_10525981 3300009093 Bacteria 1312
151 Ga0105240_10659693 3300009093 Bacteria 1146
152 Ga0105240_10730752 3300009093 Bacteria 1078
153 Ga0105240_11322185 3300009093 Bacteria 760
154 Ga0105240_11725982 3300009093 Bacteria 653
155 Ga0105245_10828490 3300009098 Bacteria 964
156 Ga0105245_11031481 3300009098 Bacteria 868
157 Ga0105247_10116207 3300009101 Bacteria 1728
158 Ga0105247_10134749 3300009101 Bacteria 1613
159 Ga0105241_10266098 3300009174 Bacteria 1459
160 Ga0105242_10255803 3300009176 Bacteria 1580
161 Ga0105242_10408070 3300009176 Bacteria 1270
162 Ga0105242_10518592 3300009176 Bacteria 1137
163 Ga0105248_10000106 3300009177 Bacteria 93898
164 Ga0105248_10024660 3300009177 Bacteria 6688
165 Ga0105248_10107846 3300009177 Bacteria 3140
166 Ga0105248_10110698 3300009177 Bacteria 3097
167 Ga0105248_10114333 3300009177 Bacteria 3044
168 Ga0105248_10139129 3300009177 Bacteria 2738
169 Ga0105248_10182848 3300009177 Bacteria 2362
170 Ga0105248_10318324 3300009177 Bacteria 1752
171 Ga0105248_10544814 3300009177 Bacteria 1309
172 Ga0105248_10962852 3300009177 Bacteria 964
173 Ga0105248_11215731 3300009177 Bacteria 852
174 Ga0105237_10544955 3300009545 Bacteria 1167
175 Ga0105237_10971857 3300009545 Bacteria 856
176 Ga0105238_10041921 3300009551 Bacteria 4636
177 Ga0105238_10076763 3300009551 Bacteria 3333
178 Ga0105238_10114475 3300009551 Bacteria 2676
179 Ga0105238_10177065 3300009551 Bacteria 2109
180 Ga0105238_10643718 3300009551 Bacteria 1070
181 Ga0105238_10781535 3300009551 Bacteria 970
182 Ga0105238_11198423 3300009551 Bacteria 784
183 Ga0105238_11358182 3300009551 Bacteria 737
184 Ga0105249_10000525 3300009553 Bacteria 35250
185 Ga0105249_10086152 3300009553 Bacteria 2929
186 Ga0105249_10774763 3300009553 Bacteria 1022
187 Ga0105239_10130044 3300010375 Bacteria 2800
188 Ga0105239_10381679 3300010375 Bacteria 1593
189 Ga0105239_10765506 3300010375 Bacteria 1105
190 Ga0105239_11797574 3300010375 Bacteria 710
191 Ga0105246_11112268 3300011119 Bacteria 722
192 Ga0157319_1002288 3300012497 Bacteria 1086
193 Ga0157373_10003275 3300013100 Bacteria 12233
194 Ga0157373_10386818 3300013100 Bacteria 1001
195 Ga0157370_10025476 3300013104 Bacteria 5856
196 Ga0157370_10255378 3300013104 Bacteria 1621
197 Ga0157369_10582660 3300013105 Bacteria 1155
198 Ga0157369_11087671 3300013105 Bacteria 817
199 Ga0157374_12619687 3300013296 Bacteria 532
200 Ga0157378_11409501 3300013297 Bacteria 740
201 Ga0157378_12451267 3300013297 Bacteria 574
202 Ga0163162_10143578 3300013306 Bacteria 2501
203 Ga0163162_10238917 3300013306 Bacteria 1947
204 Ga0163162_10280639 3300013306 Bacteria 1798
205 Ga0163162_10358644 3300013306 Bacteria 1591
206 Ga0163162_11791954 3300013306 Bacteria 702
207 Ga0157372_10145769 3300013307 Bacteria 2730
208 Ga0157372_10522129 3300013307 Bacteria 1384
209 Ga0157375_11001186 3300013308 Bacteria 975
210 Ga0157375_11801825 3300013308 Bacteria 726
211 Ga0163163_10003142 3300014325 Bacteria 14001
212 Ga0163163_10003291 3300014325 Bacteria 13699
213 Ga0163163_10110592 3300014325 Bacteria 2776
214 Ga0163163_10376672 3300014325 Bacteria 1477
215 Ga0163163_10583366 3300014325 Bacteria 1181
216 Ga0163163_12284813 3300014325 Bacteria 600
217 Ga0157380_10206005 3300014326 Bacteria 1749
218 Ga0157380_10670849 3300014326 Bacteria 1037
219 Ga0157377_10133995 3300014745 Bacteria 1516
220 Ga0157377_10929055 3300014745 Bacteria 653
221 Ga0157379_10009657 3300014968 Bacteria 8397
222 Ga0157379_10023061 3300014968 Bacteria 5518
223 Ga0157379_10027619 3300014968 Bacteria 5053
224 Ga0157379_10192977 3300014968 Bacteria 1841
225 Ga0157376_10539196 3300014969 Bacteria 1153
226 Ga0157376_11211660 3300014969 Bacteria 783
227 Ga0182007_10062552 3300015262 Bacteria 1220
228 Ga0213874_10026951 3300021377 Bacteria 1631
229 Ga0213874_10196440 3300021377 Bacteria 724
230 Ga0213876_10000276 3300021384 Bacteria 47195
231 Ga0213875_10069405 3300021388 Bacteria 1646
232 Ga0213875_10251597 3300021388 Bacteria 833
233 Ga0213875_10325914 3300021388 Bacteria 728
234 Ga0213871_10045895 3300021441 Bacteria 1185
235 Ga0209026_1002959 3300025250 Bacteria 5915
236 Ga0209565_1000402 3300025263 Bacteria 36267
237 Ga0209673_1000956 3300025273 Bacteria 36077
238 Ga0209673_1044805 3300025273 Bacteria 1222
239 Ga0209675_1032346 3300025291 Bacteria 1225
240 Ga0209676_1000252 3300025292 Bacteria 113425
241 Ga0209676_1000467 3300025292 Bacteria 67659
242 Ga0209676_1000560 3300025292 Bacteria 56233
243 Ga0209676_1003120 3300025292 Bacteria 10631
244 Ga0209564_1018585 3300025295 Bacteria 2641
245 Ga0209758_1000334 3300025297 Bacteria 88149
246 Ga0209758_1002021 3300025297 Bacteria 21830
247 Ga0209758_1002093 3300025297 Bacteria 21212
248 Ga0209050_1000130 3300025298 Bacteria 186070
249 Ga0209050_1000461 3300025298 Bacteria 72912
250 Ga0209050_1001568 3300025298 Bacteria 23778
251 Ga0209050_1009109 3300025298 Bacteria 5149
252 Ga0209050_1011749 3300025298 Bacteria 4108
253 Ga0209256_1005220 3300025299 Bacteria 7624
254 Ga0209256_1010924 3300025299 Bacteria 3720
255 Ga0209051_1009272 3300025303 Bacteria 5088
256 Ga0209257_1000059 3300025304 Bacteria 378097
257 Ga0209257_1000060 3300025304 Bacteria 372267
258 Ga0209257_1000186 3300025304 Bacteria 154365
259 Ga0209257_1000406 3300025304 Bacteria 83846
260 Ga0209257_1001256 3300025304 Bacteria 31336
261 Ga0209257_1010228 3300025304 Bacteria 4803
262 Ga0207680_10062871 3300025903 Bacteria 2270
263 Ga0207705_10000859 3300025909 Bacteria 24922
264 Ga0207705_10117812 3300025909 Bacteria 1968
265 Ga0207705_10204376 3300025909 Bacteria 1497
266 Ga0207654_10337347 3300025911 Bacteria 1035
267 Ga0207707_10052652 3300025912 Bacteria 3543
268 Ga0207707_10890637 3300025912 Bacteria 736
269 Ga0207695_10001222 3300025913 Bacteria 44042
270 Ga0207695_10005699 3300025913 Bacteria 16425
271 Ga0207695_10016532 3300025913 Bacteria 8626
272 Ga0207695_10019866 3300025913 Bacteria 7719
273 Ga0207695_10023959 3300025913 Bacteria 6884
274 Ga0207695_10145852 3300025913 Bacteria 2311
275 Ga0207695_10219787 3300025913 Bacteria 1807
276 Ga0207695_10454851 3300025913 Bacteria 1163
277 Ga0207695_10459193 3300025913 Bacteria 1157
278 Ga0207671_11146150 3300025914 Bacteria 610
279 Ga0207660_10005314 3300025917 Bacteria 8373
280 Ga0207660_10481794 3300025917 Bacteria 1005
281 Ga0207657_10027665 3300025919 Bacteria 5189
282 Ga0207657_10103236 3300025919 Bacteria 2363
283 Ga0207652_10039756 3300025921 Bacteria 3992
284 Ga0207652_10040277 3300025921 Bacteria 3967
285 Ga0207681_10058651 3300025923 Bacteria 2636
286 Ga0207681_10275273 3300025923 Bacteria 1323
287 Ga0207694_10044000 3300025924 Bacteria 3447
288 Ga0207694_10123458 3300025924 Bacteria 2069
289 Ga0207694_10193276 3300025924 Bacteria 1654
290 Ga0207694_10218439 3300025924 Bacteria 1554
291 Ga0207694_10360980 3300025924 Bacteria 1204
292 Ga0207650_10000327 3300025925 Bacteria 46298
293 Ga0207650_10029430 3300025925 Bacteria 3949
294 Ga0207650_10139751 3300025925 Bacteria 1903
295 Ga0207650_10174134 3300025925 Bacteria 1712
296 Ga0207650_10200024 3300025925 Bacteria 1600
297 Ga0207700_11313437 3300025928 Bacteria 644
298 Ga0207644_10008067 3300025931 Bacteria 6891
299 Ga0207644_10113844 3300025931 Bacteria 2049
300 Ga0207690_10000159 3300025932 Bacteria 52852
301 Ga0207690_10014486 3300025932 Bacteria 4762
302 Ga0207690_10077040 3300025932 Bacteria 2317
303 Ga0207706_10193522 3300025933 Bacteria 1784
304 Ga0207706_10281543 3300025933 Bacteria 1450
305 Ga0207686_10084875 3300025934 Bacteria 2076
306 Ga0207686_10191571 3300025934 Bacteria 1458
307 Ga0207704_10011221 3300025938 Bacteria 4405
308 Ga0207691_10740987 3300025940 Bacteria 828
309 Ga0207711_10000098 3300025941 Bacteria 92296
310 Ga0207711_10007949 3300025941 Bacteria 8872
311 Ga0207711_10047091 3300025941 Bacteria 3686
312 Ga0207711_10060134 3300025941 Bacteria 3273
313 Ga0207711_10067455 3300025941 Bacteria 3097
314 Ga0207711_10077333 3300025941 Bacteria 2900
315 Ga0207711_10511688 3300025941 Bacteria 1119
316 Ga0207679_10043649 3300025945 Bacteria 3230
317 Ga0207667_10004660 3300025949 Bacteria 16802
318 Ga0207667_10032201 3300025949 Bacteria 5652
319 Ga0207667_10080415 3300025949 Bacteria 3376
320 Ga0207667_10203744 3300025949 Bacteria 2029
321 Ga0207667_11305497 3300025949 Bacteria 702
322 Ga0207667_11403068 3300025949 Bacteria 672
323 Ga0207651_10125994 3300025960 Bacteria 1951
324 Ga0207712_10001643 3300025961 Bacteria 15061
325 Ga0207712_10271478 3300025961 Bacteria 1380
326 Ga0207668_10000025 3300025972 Bacteria 131733
327 Ga0207668_10000035 3300025972 Bacteria 119182
328 Ga0207668_10001450 3300025972 Bacteria 13923
329 Ga0207668_10001848 3300025972 Bacteria 12357
330 Ga0207668_10009511 3300025972 Bacteria 5833
331 Ga0207668_10033907 3300025972 Bacteria 3385
332 Ga0207668_10065020 3300025972 Bacteria 2580
333 Ga0207640_10092228 3300025981 Bacteria 2101
334 Ga0207658_10000300 3300025986 Bacteria 51413
335 Ga0207658_10012188 3300025986 Bacteria 5866
336 Ga0207658_10017296 3300025986 Bacteria 4967
337 Ga0207658_10027675 3300025986 Bacteria 3986
338 Ga0207677_10045134 3300026023 Bacteria 2942
339 Ga0207677_10740962 3300026023 Bacteria 875
340 Ga0207703_10002585 3300026035 Bacteria 15635
341 Ga0207703_10004356 3300026035 Bacteria 11636
342 Ga0207703_10159117 3300026035 Bacteria 1977
343 Ga0207703_10528394 3300026035 Bacteria 1110
344 Ga0207639_10014145 3300026041 Bacteria 5603
345 Ga0207639_10027056 3300026041 Bacteria 4174
346 Ga0207639_10174365 3300026041 Bacteria 1824
347 Ga0207639_10301901 3300026041 Bacteria 1416
348 Ga0207639_10488057 3300026041 Bacteria 1124
349 Ga0207678_10567848 3300026067 Bacteria 993
350 Ga0207702_10892307 3300026078 Bacteria 881
351 Ga0207702_11784625 3300026078 Bacteria 607
352 Ga0207641_10000005 3300026088 Bacteria 470841
353 Ga0207641_10000777 3300026088 Bacteria 34097
354 Ga0207641_10000994 3300026088 Bacteria 29003
355 Ga0207641_10047447 3300026088 Bacteria 3622
356 Ga0207641_10243404 3300026088 Bacteria 1677
357 Ga0207641_10284968 3300026088 Bacteria 1555
358 Ga0207641_10416041 3300026088 Bacteria 1293
359 Ga0207648_10206864 3300026089 Bacteria 1741
360 Ga0207648_11125127 3300026089 Bacteria 737
361 Ga0207676_10000066 3300026095 Bacteria 105425
362 Ga0207676_10000145 3300026095 Bacteria 61785
363 Ga0207676_10006892 3300026095 Bacteria 8051
364 Ga0207676_10088804 3300026095 Bacteria 2531
365 Ga0207674_10277098 3300026116 Bacteria 1625
366 Ga0207674_10354915 3300026116 Bacteria 1417
367 Ga0207675_100086350 3300026118 Bacteria 2946
368 Ga0207675_100566011 3300026118 Bacteria 1137
369 Ga0207675_100585934 3300026118 Bacteria 1117
370 Ga0207683_11043367 3300026121 Bacteria 759
371 Ga0207698_10384166 3300026142 Bacteria 1337
372 Ga0207698_10424664 3300026142 Bacteria 1276
373 Ga0209281_1034369 3300027111 Bacteria 886
374 Ga0209968_1057566 3300027526 Bacteria 682
375 Ga0209999_1006580 3300027543 Bacteria 2087
376 Ga0209983_1002147 3300027665 Bacteria 4348
377 Ga0209813_10012213 3300027866 Bacteria 2264
378 Ga0209974_10363604 3300027876 Bacteria 563
379 Ga0268266_10000003 3300028379 Bacteria 1701703
380 Ga0268266_10000814 3300028379 Bacteria 41101
381 Ga0268266_10002311 3300028379 Bacteria 20672
382 Ga0268266_10015863 3300028379 Bacteria 6447
383 Ga0268266_10086133 3300028379 Bacteria 2746
384 Ga0268266_10464906 3300028379 Bacteria 1204
385 Ga0268265_10002522 3300028380 Bacteria 13705
386 Ga0268265_10010073 3300028380 Bacteria 6380
387 Ga0268265_10078212 3300028380 Bacteria 2601
388 Ga0268265_10096513 3300028380 Bacteria 2376
389 Ga0268265_10842456 3300028380 Bacteria 897
390 Ga0268265_11048387 3300028380 Bacteria 807
391 Ga0268264_10000002 3300028381 Bacteria 1153045
392 Ga0268264_10000211 3300028381 Bacteria 117108
393 Ga0268264_10250574 3300028381 Bacteria 1645
394 Ga0265326_10022728 3300028558 Bacteria 1795
395 Ga0265319_1077553 3300028563 Bacteria 1058
396 Ga0265334_10010373 3300028573 Bacteria 3936
397 Ga0265334_10046570 3300028573 Bacteria 1676
398 Ga0265318_10112381 3300028577 Bacteria 1001
399 Ga0307517_10003214 3300028786 Bacteria 25648
400 Ga0307517_10114040 3300028786 Bacteria 2036
401 Ga0307517_10176060 3300028786 Bacteria 1393
402 Ga0307515_10016786 3300028794 Bacteria 13388
403 Ga0307515_10498621 3300028794 Bacteria 828
404 Ga0265338_10007642 3300028800 Bacteria 13336
405 Ga0265338_10069826 3300028800 Bacteria 3016
406 Ga0265338_10097782 3300028800 Bacteria 2403
407 Ga0265338_10165419 3300028800 Bacteria 1703
408 Ga0265338_10234014 3300028800 Bacteria 1365
409 Ga0265338_10447921 3300028800 Bacteria 914
410 Ga0265324_10103409 3300029957 Bacteria 968
411 Ga0307511_10048715 3300030521 Bacteria 3443
412 Ga0265760_10075254 3300031090 Bacteria 1040
413 Ga0265330_10216422 3300031235 Bacteria 809
414 Ga0265320_10173992 3300031240 Bacteria 967
415 Ga0265320_10228339 3300031240 Bacteria 828
416 Ga0265320_10448505 3300031240 Bacteria 570
417 Ga0265340_10028890 3300031247 Bacteria 2787
418 Ga0265327_10000454 3300031251 Bacteria 73503
419 Ga0265327_10001513 3300031251 Bacteria 28744
420 Ga0265327_10002802 3300031251 Bacteria 17599
421 Ga0265327_10109117 3300031251 Bacteria 1325
422 Ga0307513_10000053 3300031456 Bacteria 149356
423 Ga0307513_10000790 3300031456 Bacteria 45976
424 Ga0307513_10004139 3300031456 Bacteria 19425
425 Ga0307513_10364128 3300031456 Bacteria 1190
426 Ga0307513_10501814 3300031456 Bacteria 930
427 Ga0307513_10509514 3300031456 Bacteria 920
428 Ga0307408_100794359 3300031548 Bacteria 858
429 Ga0307514_10358057 3300031649 Bacteria 773
430 Ga0265314_10042221 3300031711 Bacteria 3256
431 Ga0265314_10118869 3300031711 Bacteria 1667
432 Ga0265314_10234529 3300031711 Bacteria 1062
433 Ga0265342_10510319 3300031712 Bacteria 613
434 Ga0307516_10000019 3300031730 Bacteria 196679
435 Ga0307413_11896830 3300031824 Bacteria 535
436 Ga0307406_10008222 3300031901 Bacteria 5815
437 Ga0307406_10959787 3300031901 Bacteria 731
438 Ga0307412_10006570 3300031911 Bacteria 6585
439 Ga0307412_10549258 3300031911 Bacteria 970
440 Ga0307412_11439022 3300031911 Bacteria 625
441 Ga0307414_10056617 3300032004 Bacteria 2751
442 Ga0307414_10264532 3300032004 Bacteria 1437
443 Ga0307414_10377663 3300032004 Bacteria 1224
444 Ga0307414_10396544 3300032004 Bacteria 1197
445 Ga0307411_10202201 3300032005 Bacteria 1527
446 Ga0307411_10927407 3300032005 Bacteria 775
447 Ga0307510_10032424 3300033180 Bacteria 5886
448 Ga0307510_10090503 3300033180 Bacteria 2906
449 Ga0307510_10291518 3300033180 Bacteria 1097
450 Ga0307510_10372633 3300033180 Bacteria 874
451 Ga0307510_10441553 3300033180 Bacteria 742
452 Ga0373934_0308535 3300035086 Bacteria 657
453 Ga0373936_0003687 3300035113 Bacteria 5750
454 Ga0373943_0040693 3300035170 Bacteria 2245
455 Ga0373943_0273108 3300035170 Bacteria 954
456 Ga0373927_0003786 3300035695 Bacteria 10732
457 Ga0373933_0397796 3300035724 Bacteria 898
458 Ga0373933_0596593 3300035724 Bacteria 725
459 Ga0373947_0044772 3300035725 Bacteria 2647
460 Ga0373937_0165947 3300036401 Bacteria 2071
461 Ga0373937_0403589 3300036401 Bacteria 1297
462 Ga0373937_0588225 3300036401 Bacteria 1057
463 Ga0373937_1115188 3300036401 Bacteria 738
464 Ga0373937_1350595 3300036401 Bacteria 661
465 Ga0373925_0004623 3300037068 Bacteria 10393
466 Ga0373925_0169409 3300037068 Bacteria 1724
467 Ga0395899_0000373 3300037312 Bacteria 53717
468 Ga0395899_0145085 3300037312 Bacteria 1686
469 Ga0395899_0145401 3300037312 Bacteria 1684
470 Ga0395899_0356435 3300037312 Bacteria 977
471 Ga0395900_0000052 3300037418 Bacteria 223910
472 Ga0395900_0041082 3300037418 Bacteria 4769
473 Ga0395900_0136998 3300037418 Bacteria 2508
474 Ga0395900_0844447 3300037418 Bacteria 841
475 Ga0395898_0013380 3300037466 Bacteria 8450
476 Ga0395898_0129364 3300037466 Bacteria 2419
477 Ga0395898_0485355 3300037466 Bacteria 1175
478 Ga0395898_0529023 3300037466 Bacteria 1120
479 Ga0395905_0068111 3300037471 Bacteria 3334
480 Ga0395905_0081001 3300037471 Bacteria 3042
481 Ga0395905_0085608 3300037471 Bacteria 2953
482 Ga0395905_0102722 3300037471 Bacteria 2684
483 Ga0395905_0267554 3300037471 Bacteria 1595
484 Ga0395905_0370997 3300037471 Bacteria 1324
485 Ga0436364_0868872 3300037853 Bacteria 4328
486 Ga0436364_0877114 3300037853 Bacteria 3622
487 Ga0436364_1032895 3300037853 Bacteria 2501
488 Ga0436364_1504159 3300037853 Bacteria 1593
489 Ga0395901_0000001 3300038443 Bacteria 800383
490 Ga0395901_0104718 3300038443 Bacteria 2969
491 Ga0395901_0121355 3300038443 Bacteria 2747
492 Ga0395901_0153468 3300038443 Bacteria 2419
493 Ga0395901_0475891 3300038443 Bacteria 1275
494 Ga0395901_0487686 3300038443 Bacteria 1256
495 Ga0395901_0533798 3300038443 Bacteria 1190
496 Ga0436365_0608786 3300039437 Bacteria 20013
497 Ga0436365_1252750 3300039437 Bacteria 3895
498 Ga0436365_1365943 3300039437 Bacteria 4989
499 Ga0436360_0439840 3300039438 Bacteria 5562
500 Ga0436360_0606916 3300039438 Bacteria 884
501 Ga0436361_0315073 3300039447 Bacteria 579
502 Ga0436361_0870135 3300039447 Bacteria 604
503 Ga0436361_1100879 3300039447 Bacteria 23663
504 Ga0436363_0535485 3300039450 Bacteria 1549
505 Ga0436363_0783676 3300039450 Bacteria 996
506 Ga0436363_1290520 3300039450 Bacteria 4834
507 Ga0436362_0542815 3300039453 Bacteria 946
508 Ga0436362_0836285 3300039453 Bacteria 1185
509 Ga0451791_1365756 3300041451 Bacteria 561
510 Ga0451800_0223665 3300041459 Bacteria 583
511 Ga0451853_1586036 3300041512 Bacteria 1368
512 Ga0439445_0023404 3300042004 Bacteria 1564
513 Ga0439446_0008299 3300042156 Bacteria 2754
514 Ga0439446_0075290 3300042156 Bacteria 1038
515 Ga0439435_0009519 3300042436 Bacteria 2281
516 Ga0466972_0406248 3300044658 Bacteria 638
517 Ga0466965_0174766 3300044683 Bacteria 1131
518 Ga0466966_0134742 3300044684 Bacteria 1511
519 Ga0466964_0028853 3300044706 Bacteria 2188
520 Ga0453684_0267837 3300044712 Bacteria 1954
521 Ga0466968_0148231 3300044735 Bacteria 1077
522 Ga0466970_0106425 3300044765 Bacteria 1530
523 Ga0466957_0125077 3300044842 Bacteria 1642
524 Ga0466958_0733459 3300045836 Bacteria 644
525 Ga0495627_000767 3300046453 Bacteria 23863
526 Ga0495629_0106991 3300046459 Bacteria 1951
527 Ga0495629_0841068 3300046459 Bacteria 604
528 Ga0495638_0000935 3300046460 Bacteria 29593
529 Ga0495638_0001119 3300046460 Bacteria 26080
530 Ga0495638_0025082 3300046460 Bacteria 3879
531 Ga0495638_0223734 3300046460 Bacteria 1050
532 Ga0495651_0292422 3300046462 Bacteria 1096
533 Ga0495650_0000403 3300046471 Bacteria 71792
534 Ga0495650_0016563 3300046471 Bacteria 3729
535 Ga0495650_0047502 3300046471 Bacteria 1795
536 Ga0495650_0187715 3300046471 Bacteria 724
537 Ga0495585_0152341 3300046492 Bacteria 1205
538 Ga0495594_0303595 3300046499 Bacteria 909
539 Ga0495583_0000005 3300046506 Bacteria 636894
540 Ga0495583_0047129 3300046506 Bacteria 1984
541 Ga0495606_0003858 3300046507 Bacteria 15477
542 Ga0495610_0002475 3300046512 Bacteria 15486
543 Ga0495610_0009314 3300046512 Bacteria 6221
544 Ga0495610_0011679 3300046512 Bacteria 5344
545 Ga0495616_0000172 3300046513 Bacteria 54960
546 Ga0495620_0035870 3300046515 Bacteria 2225
547 Ga0495628_0186214 3300046516 Bacteria 1569
548 Ga0495631_0011080 3300046518 Bacteria 4448
549 Ga0495632_0015448 3300046519 Bacteria 4279
550 Ga0495632_0034675 3300046519 Bacteria 2580
551 Ga0495637_0056020 3300046520 Bacteria 1633
552 Ga0495637_0128566 3300046520 Bacteria 969
553 Ga0495643_0028980 3300046522 Bacteria 3099
554 Ga0495643_0204435 3300046522 Bacteria 946
555 Ga0495648_0024553 3300046524 Bacteria 4102
556 Ga0495648_0046545 3300046524 Bacteria 2688
557 Ga0495648_0221235 3300046524 Bacteria 933
558 Ga0495648_0306086 3300046524 Bacteria 742
559 Ga0495663_0036119 3300046525 Bacteria 1486
560 Ga0495663_0109467 3300046525 Bacteria 917
561 Ga0495663_0271062 3300046525 Bacteria 606
562 Ga0495654_0000708 3300046530 Bacteria 26141
563 Ga0495621_0016728 3300046539 Bacteria 2359
564 Ga0495621_0388434 3300046539 Bacteria 590
565 Ga0495597_0005464 3300046542 Bacteria 6722
566 Ga0495597_0218989 3300046542 Bacteria 756
567 Ga0495645_0340706 3300046543 Bacteria 968
568 Ga0495645_0625191 3300046543 Bacteria 660
569 Ga0495622_0001326 3300046557 Bacteria 12674
570 Ga0495668_0000100 3300046616 Bacteria 137684
571 Ga0495668_0009341 3300046616 Bacteria 6029
572 Ga0495668_0012089 3300046616 Bacteria 5135
573 Ga0495668_0013600 3300046616 Bacteria 4794
574 Ga0495668_0033240 3300046616 Bacteria 2898
575 Ga0495668_0073617 3300046616 Bacteria 1876
576 Ga0495668_0186150 3300046616 Bacteria 1137
577 Ga0495668_0252643 3300046616 Bacteria 965
578 Ga0495668_0265881 3300046616 Bacteria 939
579 Ga0495668_0337844 3300046616 Bacteria 826
580 Ga0495668_0480913 3300046616 Bacteria 684
581 Ga0495611_0029789 3300046648 Bacteria 2395
582 Ga0495625_0003383 3300046660 Bacteria 15983
583 Ga0495625_0003474 3300046660 Bacteria 15651
584 Ga0495625_0014000 3300046660 Bacteria 6424
585 Ga0495625_0021720 3300046660 Bacteria 4934
586 Ga0495625_0028606 3300046660 Bacteria 4178
587 Ga0495625_0054628 3300046660 Bacteria 2851
588 Ga0495625_0067348 3300046660 Bacteria 2520
589 Ga0495625_0165443 3300046660 Bacteria 1479
590 Ga0495659_0060458 3300046664 Bacteria 1398
591 Ga0495588_0309552 3300046674 Bacteria 831
592 Ga0495657_0240670 3300046675 Bacteria 1092
593 Ga0495669_0000012 3300046684 Bacteria 157373
594 Ga0495669_0000250 3300046684 Bacteria 31432
595 Ga0495669_0068563 3300046684 Bacteria 1614
596 Ga0495669_0137478 3300046684 Bacteria 1152
597 Ga0495613_0001323 3300046689 Bacteria 18949
598 Ga0495613_0542434 3300046689 Bacteria 779
599 Ga0495670_0397799 3300046691 Bacteria 744
600 Ga0495671_0090907 3300046692 Bacteria 1494
601 Ga0495589_0164422 3300046794 Bacteria 1056
602 Ga0495660_0066897 3300046810 Bacteria 1915
603 Ga0495581_0178470 3300047315 Bacteria 1242
604 Ga0495636_0134788 3300047318 Bacteria 1100
605 Ga0495672_0001210 3300047320 Bacteria 26025
606 Ga0495672_0064064 3300047320 Bacteria 2106
607 Ga0495672_0449282 3300047320 Bacteria 581
608 Ga0495687_046127 3300047443 Bacteria 1883
609 Ga0495687_128384 3300047443 Bacteria 902
610 Ga0495677_0020987 3300047445 Bacteria 2368
611 Ga0495677_0085371 3300047445 Bacteria 1186
612 Ga0495677_0141666 3300047445 Bacteria 923
613 Ga0495679_021303 3300047446 Bacteria 2241
614 Ga0495679_084936 3300047446 Bacteria 894
615 Ga0495673_0000025 3300047469 Bacteria 512352
616 Ga0495673_0001381 3300047469 Bacteria 19535
617 Ga0495673_0002003 3300047469 Bacteria 14993
618 Ga0495681_0024801 3300047470 Bacteria 3148
619 Ga0495681_0071203 3300047470 Bacteria 1575
620 Ga0495681_0090815 3300047470 Bacteria 1349
621 Ga0495686_0001965 3300047472 Bacteria 20419
622 Ga0495686_0006019 3300047472 Bacteria 9422
623 Ga0495686_0014178 3300047472 Bacteria 5495
624 Ga0495686_0044404 3300047472 Bacteria 2814
625 Ga0495686_0163401 3300047472 Bacteria 1299
626 Ga0495686_0195760 3300047472 Bacteria 1162
627 Ga0495593_0031446 3300047673 Bacteria 2899
628 Ga0496100_0493575 3300048903 Bacteria 943
629 Ga0496101_0085705 3300048904 Bacteria 2335
630 Ga0496101_0149595 3300048904 Bacteria 1785
631 Ga0496102_0019470 3300048905 Bacteria 5978
632 Ga0496102_0025859 3300048905 Bacteria 5229
633 Ga0496102_0334882 3300048905 Bacteria 1425
634 Ga0496103_0055559 3300048906 Bacteria 2456
635 Ga0496103_0768427 3300048906 Bacteria 609
636 Ga0496105_0240272 3300048908 Bacteria 1470
637 Ga0496106_0003982 3300048909 Bacteria 11040
638 Ga0496106_0650243 3300048909 Bacteria 842
639 Ga0496107_0000063 3300048910 Bacteria 52938
640 Ga0496107_0556322 3300048910 Bacteria 849
641 Ga0496107_0673039 3300048910 Bacteria 762
642 Ga0496108_0188933 3300048911 Bacteria 1785
643 Ga0496109_0014318 3300048912 Bacteria 6901
644 Ga0496110_0376878 3300048913 Bacteria 1293
645 Ga0496111_0308281 3300048914 Bacteria 1173
646 Ga0496112_0020241 3300048915 Bacteria 6302
647 Ga0496112_0339013 3300048915 Bacteria 1447
648 Ga0496112_0429194 3300048915 Bacteria 1260
649 Ga0496114_1147501 3300048917 Bacteria 662
650 Ga0496115_0004287 3300048918 Bacteria 10327
651 Ga0496115_0006353 3300048918 Bacteria 8656
652 Ga0496115_0008707 3300048918 Bacteria 7519
653 Ga0496115_0265905 3300048918 Bacteria 1410
654 Ga0496115_0736979 3300048918 Bacteria 772
655 Ga0496115_1061987 3300048918 Bacteria 616
656 Ga0496117_0014984 3300048920 Bacteria 6642
657 Ga0496118_0025848 3300048921 Bacteria 5021
658 Ga0496119_0004972 3300048922 Bacteria 12987
659 Ga0496121_0000059 3300048924 Bacteria 278177
660 Ga0496121_0017039 3300048924 Bacteria 7454
661 Ga0496124_0013512 3300048927 Bacteria 7966
662 Ga0496125_0067909 3300048928 Bacteria 2807
663 Ga0496125_0089362 3300048928 Bacteria 2317
664 Ga0496126_0074075 3300048929 Bacteria 3024
665 Ga0495678_010136 3300049459 Bacteria 4596
666 Ga0495678_150844 3300049459 Bacteria 751
667 Ga0501033_0015367 3300049570 Bacteria 5808
668 Ga0501033_0151808 3300049570 Bacteria 1671
669 Ga0501034_0002424 3300049571 Bacteria 22556
670 Ga0501034_0080391 3300049571 Bacteria 3263
671 Ga0501034_0328804 3300049571 Bacteria 1460
672 Ga0501036_0988846 3300049572 Bacteria 689
673 Ga0501036_1461884 3300049572 Bacteria 553
674 Ga0501037_0409239 3300049573 Bacteria 929
675 Ga0501038_0171942 3300049574 Bacteria 1753
676 Ga0501047_0002933 3300049581 Bacteria 16195
677 Ga0501047_0048528 3300049581 Bacteria 4100
678 Ga0501047_0174495 3300049581 Bacteria 2018
679 Ga0501048_0110380 3300049582 Bacteria 1942
680 Ga0501070_0124566 3300049586 Bacteria 2130
681 Ga0501070_0602056 3300049586 Bacteria 876
682 Ga0501238_003567 3300049671 Bacteria 1915
683 Ga0501257_049735 3300049686 Bacteria 1044
684 Ga0501035_0088936 3300049822 Bacteria 2721
685 Ga0501035_0269121 3300049822 Bacteria 1443
686 Ga0501035_0474790 3300049822 Bacteria 1032
687 Ga0501035_1019650 3300049822 Bacteria 650
688 Ga0501035_1139545 3300049822 Bacteria 608
689 Ga0501044_0000280 3300049823 Bacteria 64928
690 Ga0501044_0002607 3300049823 Bacteria 20483
691 Ga0501044_0207144 3300049823 Bacteria 1917
692 Ga0501044_0293953 3300049823 Bacteria 1555
693 Ga0501044_0337787 3300049823 Bacteria 1428
694 nmdc:mga03683_440233_c1 3300050489 Bacteria 626
695 nmdc:mga03683_46670_c1 3300050489 Bacteria 1796
696 nmdc:mga03683_55387_c1 3300050489 Bacteria 1665
697 nmdc:mga00v17_165_c2 3300050491 Bacteria 34234
698 nmdc:mga0k408_191397_c1 3300050493 Bacteria 1221
699 nmdc:mga0k408_39482_c1 3300050493 Bacteria 2712
700 nmdc:mga0k408_515827_c1 3300050493 Bacteria 708
701 nmdc:mga06z11_55314_c1 3300050494 Bacteria 2049
702 nmdc:mga04h51_14332_c1 3300050495 Bacteria 2264
703 nmdc:mga07m45_171659_c1 3300050496 Bacteria 1260
704 nmdc:mga07m45_74732_c1 3300050496 Bacteria 1931
705 nmdc:mga0sz30_2184_c1 3300050516 Bacteria 6995
706 Ga0500635_0000048 3300053080 Bacteria 80957
707 Ga0500578_0000913 3300053086 Bacteria 33199
708 Ga0500643_000316 3300053087 Bacteria 39239
709 Ga0500643_003880 3300053087 Bacteria 6955
710 Ga0500643_004744 3300053087 Bacteria 6035
711 Ga0500643_017750 3300053087 Bacteria 2376
712 Ga0500643_020132 3300053087 Bacteria 2187
713 Ga0500643_073400 3300053087 Bacteria 947
714 Ga0500644_0000287 3300053088 Bacteria 27540
715 Ga0500644_0008320 3300053088 Bacteria 2735
716 Ga0500644_0009395 3300053088 Bacteria 2614
717 Ga0500646_0029525 3300053090 Bacteria 1502
718 Ga0500647_0017276 3300053091 Bacteria 3325
719 Ga0500647_0113181 3300053091 Bacteria 1289
720 Ga0500583_0159765 3300053092 Bacteria 1122
721 Ga0500583_0223218 3300053092 Bacteria 934
722 Ga0500651_0017968 3300053093 Bacteria 4373
723 Ga0500651_0222198 3300053093 Bacteria 1107
724 Ga0500651_0421470 3300053093 Bacteria 747
725 Ga0500641_0000367 3300053096 Bacteria 16747
726 Ga0500641_0004872 3300053096 Bacteria 4750
727 Ga0500641_0011946 3300053096 Bacteria 3162
728 Ga0500554_022618 3300053102 Bacteria 1758
729 Ga0500555_015082 3300053103 Bacteria 2229
730 Ga0500555_018530 3300053103 Bacteria 2006
731 Ga0500555_042005 3300053103 Bacteria 1271
732 Ga0500556_0001952 3300053104 Bacteria 7280
733 Ga0500556_0002100 3300053104 Bacteria 6808
734 Ga0500556_0053471 3300053104 Bacteria 1468
735 Ga0500562_000754 3300053108 Bacteria 7869
736 Ga0500562_005608 3300053108 Bacteria 3157
737 Ga0500562_014884 3300053108 Bacteria 1993
738 Ga0500569_002374 3300053109 Bacteria 3696
739 Ga0500572_000189 3300053111 Bacteria 21822
740 Ga0500593_193496 3300053117 Bacteria 742
741 Ga0500594_0003639 3300053118 Bacteria 3398
742 Ga0500595_004073 3300053119 Bacteria 6642
743 Ga0500595_022624 3300053119 Bacteria 2222
744 Ga0500595_075689 3300053119 Bacteria 992
745 Ga0500608_000246 3300053122 Bacteria 21323
746 Ga0500608_014541 3300053122 Bacteria 3516
747 Ga0500608_160147 3300053122 Bacteria 976
748 Ga0500614_005576 3300053123 Bacteria 2640
749 Ga0500614_234343 3300053123 Bacteria 570
750 Ga0500618_000319 3300053125 Bacteria 35375
751 Ga0500642_0042281 3300053130 Bacteria 1975
752 Ga0500655_021376 3300053133 Bacteria 1213
753 Ga0500658_0005593 3300053134 Bacteria 4680
754 Ga0500658_0095970 3300053134 Bacteria 1288
755 Ga0500559_0000010 3300053136 Bacteria 165569
756 Ga0500559_0000153 3300053136 Bacteria 54641
757 Ga0500559_0013632 3300053136 Bacteria 3440
758 Ga0500559_0018372 3300053136 Bacteria 2955
759 Ga0500559_0199476 3300053136 Bacteria 943
760 Ga0500564_000369 3300053138 Bacteria 12797
761 Ga0500564_089445 3300053138 Bacteria 1372
762 Ga0500577_0001350 3300053142 Bacteria 6266
763 Ga0500590_014524 3300053148 Bacteria 4060
764 Ga0500616_0012826 3300053153 Bacteria 4890
765 Ga0500616_0017769 3300053153 Bacteria 4030
766 Ga0500616_0034015 3300053153 Bacteria 2779
767 Ga0500616_0161756 3300053153 Bacteria 1026
768 Ga0500616_0304272 3300053153 Bacteria 661
769 Ga0500619_005761 3300053154 Bacteria 2794
770 Ga0500622_0002994 3300053156 Bacteria 11709
771 Ga0500622_0004398 3300053156 Bacteria 8876
772 Ga0500622_0017251 3300053156 Bacteria 3844
773 Ga0500622_0074609 3300053156 Bacteria 1708
774 Ga0500622_0207383 3300053156 Bacteria 887
775 Ga0500624_054838 3300053157 Bacteria 749
776 Ga0500627_0053289 3300053158 Bacteria 1767
777 Ga0500639_139786 3300053163 Bacteria 1134
778 Ga0500636_0036516 3300053177 Bacteria 2908
779 Ga0500636_0067140 3300053177 Bacteria 2084
780 Ga0500637_0023865 3300053178 Bacteria 3348
781 Ga0500576_034342 3300053725 Bacteria 2298
782 Ga0500645_001079 3300053730 Bacteria 15058
783 Ga0500645_001315 3300053730 Bacteria 12887
784 Ga0500645_005711 3300053730 Bacteria 4534
785 Ga0500645_086685 3300053730 Bacteria 890
786 Ga0500596_003146 3300053735 Bacteria 3171
787 Ga0500601_015595 3300053737 Bacteria 864
788 Ga0587072_045009 3300059643 Bacteria 868
789 Ga0587072_071344 3300059643 Bacteria 734

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014969 Ga0157376_11211660 Ga0157376_112116601 146
2 3300039447 Ga0436361_0315073 Ga0436361_0315073_117_566 149
3 3300049572 Ga0501036_1461884 Ga0501036_1461884_11_460 149
4 3300046519 Ga0495632_0034675 Ga0495632_0034675_11_463 150
5 3300028800 Ga0265338_10069826 Ga0265338_100698264 151
6 3300039453 Ga0436362_0836285 Ga0436362_0836285_340_852 154
7 3300047320 Ga0495672_0449282 Ga0495672_0449282_98_568 156
8 3300049586 Ga0501070_0124566 Ga0501070_0124566_171_692 163
9 iso_pu_bacteria 2643221574 2643883067 163
10 iso_pu_bacteria 2643221598 2643998419 163
11 iso_pu_bacteria 2643221663 2644353884 163
12 iso_pu_bacteria 2643221699 2644552775 163
13 iso_pu_bacteria 2791355048 2792461672 163
14 iso_pu_bacteria 2843744320 2843746131 163
15 iso_pu_bacteria 2849560528 2849561615 163
16 iso_pu_bacteria 2849573788 2849574494 163
17 iso_pu_bacteria 2851153111 2851153880 163
18 iso_pu_bacteria 2898329390 2898330491 163
19 iso_pu_bacteria 2510917020 2511121749 164
20 iso_pu_bacteria 2582581279 2585149008 164
21 iso_pu_bacteria 2582581280 2585151630 164
22 iso_pu_bacteria 2582581293 2585195496 164
23 iso_pu_bacteria 2585428106 2587915380 164
24 iso_pu_bacteria 2643221545 2643749208 164
25 iso_pu_bacteria 2643221552 2643781326 164
26 iso_pu_bacteria 2643221583 2643922905 164
27 iso_pu_bacteria 2643221584 2643927093 164
28 iso_pu_bacteria 2643221640 2644223935 164
29 iso_pu_bacteria 2643221642 2644232921 164
30 iso_pu_bacteria 2643221691 2644509017 164
31 iso_pu_bacteria 2818991435 2819536312 164
32 iso_pu_bacteria 2818991454 2819644567 164
33 iso_pu_bacteria 2857504554 2857508019 164
34 iso_pu_bacteria 2884960567 2884963112 164
35 iso_pu_bacteria 2928531327 2928534823 164
36 3300005327 Ga0070658_10182987 Ga0070658_101829873 165
37 3300005548 Ga0070665_100154207 Ga0070665_1001542072 165
38 3300005563 Ga0068855_100633725 Ga0068855_1006337252 165
39 3300009545 Ga0105237_10971857 Ga0105237_109718572 165
40 3300013105 Ga0157369_11087671 Ga0157369_110876711 165
41 3300014745 Ga0157377_10929055 Ga0157377_109290551 165
42 3300025909 Ga0207705_10117812 Ga0207705_101178123 165
43 3300025913 Ga0207695_10145852 Ga0207695_101458524 165
44 3300028379 Ga0268266_10086133 Ga0268266_100861332 165
45 3300037312 Ga0395899_0145085 Ga0395899_0145085_406_906 165
46 3300037418 Ga0395900_0041082 Ga0395900_0041082_2878_3378 165
47 3300037471 Ga0395905_0068111 Ga0395905_0068111_671_1171 165
48 3300037471 Ga0395905_0081001 Ga0395905_0081001_1656_2156 165
49 3300037471 Ga0395905_0085608 Ga0395905_0085608_163_663 165
50 3300037471 Ga0395905_0267554 Ga0395905_0267554_196_696 165
51 3300038443 Ga0395901_0104718 Ga0395901_0104718_949_1449 165
52 3300039447 Ga0436361_0870135 Ga0436361_0870135_26_526 165
53 3300039453 Ga0436362_0542815 Ga0436362_0542815_382_882 165
54 3300044658 Ga0466972_0406248 Ga0466972_0406248_69_569 165
55 3300044683 Ga0466965_0174766 Ga0466965_0174766_120_620 165
56 3300044765 Ga0466970_0106425 Ga0466970_0106425_15_515 165
57 3300044842 Ga0466957_0125077 Ga0466957_0125077_754_1254 165
58 3300045836 Ga0466958_0733459 Ga0466958_0733459_63_563 165
59 3300048915 Ga0496112_0429194 Ga0496112_0429194_708_1208 165
60 3300053087 Ga0500643_004744 Ga0500643_004744_3366_3866 165
61 3300003215 JGI25153J46596_10033714 JGI25153J46596_100337142 166
62 3300003781 Ga0055536_1005613 Ga0055536_10056136 166
63 3300003791 Ga0055530_10001660 Ga0055530_1000166010 166
64 3300003794 Ga0055531_10000948 Ga0055531_1000094810 166
65 3300003794 Ga0055531_10016422 Ga0055531_100164223 166
66 3300005262 Ga0065165_1005120 Ga0065165_10051206 166
67 3300005327 Ga0070658_10338648 Ga0070658_103386482 166
68 3300005327 Ga0070658_11058063 Ga0070658_110580631 166
69 3300005331 Ga0070670_100000035 Ga0070670_100000035118 166
70 3300005331 Ga0070670_100015841 Ga0070670_1000158414 166
71 3300005331 Ga0070670_100203772 Ga0070670_1002037723 166
72 3300005331 Ga0070670_101331338 Ga0070670_1013313381 166
73 3300005334 Ga0068869_100091453 Ga0068869_1000914532 166
74 3300005334 Ga0068869_101159370 Ga0068869_1011593701 166
75 3300005335 Ga0070666_10058966 Ga0070666_100589663 166
76 3300005336 Ga0070680_100008070 Ga0070680_1000080704 166
77 3300005336 Ga0070680_100052344 Ga0070680_1000523444 166
78 3300005338 Ga0068868_100069231 Ga0068868_1000692313 166
79 3300005339 Ga0070660_100428071 Ga0070660_1004280711 166
80 3300005340 Ga0070689_100345440 Ga0070689_1003454402 166
81 3300005341 Ga0070691_10006344 Ga0070691_100063446 166
82 3300005345 Ga0070692_10215857 Ga0070692_102158571 166
83 3300005347 Ga0070668_100002182 Ga0070668_10000218215 166
84 3300005347 Ga0070668_100003540 Ga0070668_1000035404 166
85 3300005347 Ga0070668_100003652 Ga0070668_1000036521 166
86 3300005347 Ga0070668_100007003 Ga0070668_1000070033 166
87 3300005347 Ga0070668_100011492 Ga0070668_1000114923 166
88 3300005353 Ga0070669_100021322 Ga0070669_1000213225 166
89 3300005355 Ga0070671_100007055 Ga0070671_1000070554 166
90 3300005355 Ga0070671_100060840 Ga0070671_1000608403 166
91 3300005364 Ga0070673_100178716 Ga0070673_1001787162 166
92 3300005366 Ga0070659_100008075 Ga0070659_1000080756 166
93 3300005367 Ga0070667_100000711 Ga0070667_10000071118 166
94 3300005367 Ga0070667_100028886 Ga0070667_1000288865 166
95 3300005367 Ga0070667_100038720 Ga0070667_1000387202 166
96 3300005367 Ga0070667_100063073 Ga0070667_1000630733 166
97 3300005367 Ga0070667_100203998 Ga0070667_1002039983 166
98 3300005457 Ga0070662_100038594 Ga0070662_1000385943 166
99 3300005458 Ga0070681_10028637 Ga0070681_100286374 166
100 3300005530 Ga0070679_100040692 Ga0070679_1000406924 166
101 3300005530 Ga0070679_100068678 Ga0070679_1000686783 166
102 3300005539 Ga0068853_100327918 Ga0068853_1003279183 166
103 3300005539 Ga0068853_100361875 Ga0068853_1003618752 166
104 3300005539 Ga0068853_101296962 Ga0068853_1012969621 166
105 3300005543 Ga0070672_100726181 Ga0070672_1007261812 166
106 3300005548 Ga0070665_100000433 Ga0070665_10000043342 166
107 3300005548 Ga0070665_100001010 Ga0070665_10000101042 166
108 3300005548 Ga0070665_100002102 Ga0070665_10000210219 166
109 3300005548 Ga0070665_100032211 Ga0070665_1000322118 166
110 3300005563 Ga0068855_100030575 Ga0068855_1000305755 166
111 3300005563 Ga0068855_100044548 Ga0068855_1000445485 166
112 3300005563 Ga0068855_100048970 Ga0068855_1000489703 166
113 3300005563 Ga0068855_100209393 Ga0068855_1002093932 166
114 3300005564 Ga0070664_100204087 Ga0070664_1002040873 166
115 3300005577 Ga0068857_100180497 Ga0068857_1001804973 166
116 3300005577 Ga0068857_100707406 Ga0068857_1007074062 166
117 3300005578 Ga0068854_100149457 Ga0068854_1001494573 166
118 3300005614 Ga0068856_100161846 Ga0068856_1001618463 166
119 3300005616 Ga0068852_100612675 Ga0068852_1006126752 166
120 3300005617 Ga0068859_100002125 Ga0068859_1000021259 166
121 3300005617 Ga0068859_100067285 Ga0068859_1000672852 166
122 3300005617 Ga0068859_100231589 Ga0068859_1002315893 166
123 3300005618 Ga0068864_100000102 Ga0068864_10000010264 166
124 3300005618 Ga0068864_100000165 Ga0068864_10000016528 166
125 3300005618 Ga0068864_100008059 Ga0068864_1000080597 166
126 3300005618 Ga0068864_100027772 Ga0068864_1000277722 166
127 3300005841 Ga0068863_100000128 Ga0068863_10000012823 166
128 3300005841 Ga0068863_100002006 Ga0068863_10000200624 166
129 3300005841 Ga0068863_100009403 Ga0068863_1000094036 166
130 3300005841 Ga0068863_100037082 Ga0068863_1000370823 166
131 3300005841 Ga0068863_100095785 Ga0068863_1000957853 166
132 3300005841 Ga0068863_100599018 Ga0068863_1005990181 166
133 3300005842 Ga0068858_100000117 Ga0068858_1000001176 166
134 3300005842 Ga0068858_100015866 Ga0068858_1000158664 166
135 3300005842 Ga0068858_100143483 Ga0068858_1001434833 166
136 3300005843 Ga0068860_100000100 Ga0068860_10000010091 166
137 3300005843 Ga0068860_100000157 Ga0068860_100000157104 166
138 3300005843 Ga0068860_100012420 Ga0068860_1000124209 166
139 3300005843 Ga0068860_100033952 Ga0068860_1000339524 166
140 3300005844 Ga0068862_100000368 Ga0068862_10000036811 166
141 3300005844 Ga0068862_100003705 Ga0068862_1000037056 166
142 3300005844 Ga0068862_100040787 Ga0068862_1000407875 166
143 3300005844 Ga0068862_100572608 Ga0068862_1005726082 166
144 3300006028 Ga0070717_10033442 Ga0070717_100334424 166
145 3300006028 Ga0070717_10130611 Ga0070717_101306111 166
146 3300006042 Ga0075368_10001287 Ga0075368_100012872 166
147 3300006048 Ga0075363_100145209 Ga0075363_1001452092 166
148 3300006051 Ga0075364_10000571 Ga0075364_1000057113 166
149 3300006177 Ga0075362_10139652 Ga0075362_101396521 166
150 3300006178 Ga0075367_10002075 Ga0075367_100020757 166
151 3300006195 Ga0075366_10055972 Ga0075366_100559724 166
152 3300006353 Ga0075370_10106302 Ga0075370_101063023 166
153 3300006881 Ga0068865_100008084 Ga0068865_1000080847 166
154 3300006931 Ga0097620_100002125 Ga0097620_10000212518 166
155 3300006931 Ga0097620_100067286 Ga0097620_1000672862 166
156 3300006931 Ga0097620_100231602 Ga0097620_1002316022 166
157 3300006946 Ga0079104_1016114 Ga0079104_10161143 166
158 3300009093 Ga0105240_10002462 Ga0105240_100024626 166
159 3300009093 Ga0105240_10050501 Ga0105240_100505011 166
160 3300009093 Ga0105240_10269047 Ga0105240_102690473 166
161 3300009093 Ga0105240_10334737 Ga0105240_103347373 166
162 3300009093 Ga0105240_10426048 Ga0105240_104260482 166
163 3300009093 Ga0105240_10659693 Ga0105240_106596932 166
164 3300009093 Ga0105240_10730752 Ga0105240_107307522 166
165 3300009093 Ga0105240_11322185 Ga0105240_113221851 166
166 3300009093 Ga0105240_11725982 Ga0105240_117259822 166
167 3300009098 Ga0105245_11031481 Ga0105245_110314811 166
168 3300009101 Ga0105247_10116207 Ga0105247_101162072 166
169 3300009101 Ga0105247_10134749 Ga0105247_101347493 166
170 3300009174 Ga0105241_10266098 Ga0105241_102660982 166
171 3300009176 Ga0105242_10255803 Ga0105242_102558031 166
172 3300009176 Ga0105242_10518592 Ga0105242_105185922 166
173 3300009177 Ga0105248_10000106 Ga0105248_1000010688 166
174 3300009177 Ga0105248_10024660 Ga0105248_100246608 166
175 3300009177 Ga0105248_10107846 Ga0105248_101078465 166
176 3300009177 Ga0105248_10110698 Ga0105248_101106981 166
177 3300009177 Ga0105248_10114333 Ga0105248_101143334 166
178 3300009177 Ga0105248_10139129 Ga0105248_101391294 166
179 3300009177 Ga0105248_10182848 Ga0105248_101828482 166
180 3300009177 Ga0105248_10318324 Ga0105248_103183242 166
181 3300009177 Ga0105248_10544814 Ga0105248_105448142 166
182 3300009177 Ga0105248_11215731 Ga0105248_112157311 166
183 3300009545 Ga0105237_10544955 Ga0105237_105449552 166
184 3300009551 Ga0105238_10041921 Ga0105238_100419214 166
185 3300009551 Ga0105238_10076763 Ga0105238_100767634 166
186 3300009551 Ga0105238_10177065 Ga0105238_101770651 166
187 3300009551 Ga0105238_10781535 Ga0105238_107815351 166
188 3300009551 Ga0105238_11358182 Ga0105238_113581821 166
189 3300009553 Ga0105249_10000525 Ga0105249_1000052510 166
190 3300009553 Ga0105249_10086152 Ga0105249_100861523 166
191 3300009553 Ga0105249_10774763 Ga0105249_107747631 166
192 3300010375 Ga0105239_10130044 Ga0105239_101300442 166
193 3300010375 Ga0105239_10381679 Ga0105239_103816792 166
194 3300010375 Ga0105239_10765506 Ga0105239_107655062 166
195 3300010375 Ga0105239_11797574 Ga0105239_117975741 166
196 3300011119 Ga0105246_11112268 Ga0105246_111122681 166
197 3300013100 Ga0157373_10386818 Ga0157373_103868182 166
198 3300013104 Ga0157370_10025476 Ga0157370_100254766 166
199 3300013104 Ga0157370_10255378 Ga0157370_102553783 166
200 3300013297 Ga0157378_12451267 Ga0157378_124512671 166
201 3300013306 Ga0163162_10143578 Ga0163162_101435782 166
202 3300013306 Ga0163162_10238917 Ga0163162_102389172 166
203 3300013306 Ga0163162_10280639 Ga0163162_102806393 166
204 3300013306 Ga0163162_10358644 Ga0163162_103586443 166
205 3300013307 Ga0157372_10145769 Ga0157372_101457694 166
206 3300013307 Ga0157372_10522129 Ga0157372_105221292 166
207 3300013308 Ga0157375_11801825 Ga0157375_118018251 166
208 3300014325 Ga0163163_10003142 Ga0163163_1000314211 166
209 3300014325 Ga0163163_10003291 Ga0163163_100032915 166
210 3300014325 Ga0163163_10110592 Ga0163163_101105922 166
211 3300014325 Ga0163163_10376672 Ga0163163_103766722 166
212 3300014325 Ga0163163_12284813 Ga0163163_122848131 166
213 3300014326 Ga0157380_10206005 Ga0157380_102060052 166
214 3300014326 Ga0157380_10670849 Ga0157380_106708492 166
215 3300014745 Ga0157377_10133995 Ga0157377_101339952 166
216 3300014968 Ga0157379_10009657 Ga0157379_100096574 166
217 3300014968 Ga0157379_10023061 Ga0157379_100230613 166
218 3300014968 Ga0157379_10027619 Ga0157379_100276197 166
219 3300014968 Ga0157379_10192977 Ga0157379_101929773 166
220 3300014969 Ga0157376_10539196 Ga0157376_105391962 166
221 3300015262 Ga0182007_10062552 Ga0182007_100625522 166
222 3300021388 Ga0213875_10325914 Ga0213875_103259141 166
223 3300025250 Ga0209026_1002959 Ga0209026_10029595 166
224 3300025292 Ga0209676_1000252 Ga0209676_100025289 166
225 3300025292 Ga0209676_1003120 Ga0209676_10031208 166
226 3300025297 Ga0209758_1000334 Ga0209758_10003348 166
227 3300025298 Ga0209050_1000130 Ga0209050_100013077 166
228 3300025298 Ga0209050_1009109 Ga0209050_10091094 166
229 3300025304 Ga0209257_1000059 Ga0209257_1000059272 166
230 3300025304 Ga0209257_1000060 Ga0209257_1000060251 166
231 3300025304 Ga0209257_1000406 Ga0209257_100040674 166
232 3300025909 Ga0207705_10000859 Ga0207705_1000085915 166
233 3300025911 Ga0207654_10337347 Ga0207654_103373472 166
234 3300025912 Ga0207707_10052652 Ga0207707_100526525 166
235 3300025912 Ga0207707_10890637 Ga0207707_108906371 166
236 3300025913 Ga0207695_10001222 Ga0207695_1000122238 166
237 3300025913 Ga0207695_10005699 Ga0207695_100056994 166
238 3300025913 Ga0207695_10016532 Ga0207695_100165329 166
239 3300025913 Ga0207695_10019866 Ga0207695_100198664 166
240 3300025913 Ga0207695_10454851 Ga0207695_104548511 166
241 3300025913 Ga0207695_10459193 Ga0207695_104591932 166
242 3300025914 Ga0207671_11146150 Ga0207671_111461501 166
243 3300025917 Ga0207660_10005314 Ga0207660_100053146 166
244 3300025917 Ga0207660_10481794 Ga0207660_104817942 166
245 3300025919 Ga0207657_10027665 Ga0207657_100276656 166
246 3300025919 Ga0207657_10103236 Ga0207657_101032362 166
247 3300025921 Ga0207652_10039756 Ga0207652_100397563 166
248 3300025921 Ga0207652_10040277 Ga0207652_100402774 166
249 3300025923 Ga0207681_10058651 Ga0207681_100586512 166
250 3300025923 Ga0207681_10275273 Ga0207681_102752732 166
251 3300025924 Ga0207694_10044000 Ga0207694_100440004 166
252 3300025924 Ga0207694_10123458 Ga0207694_101234583 166
253 3300025924 Ga0207694_10218439 Ga0207694_102184391 166
254 3300025924 Ga0207694_10360980 Ga0207694_103609801 166
255 3300025925 Ga0207650_10000327 Ga0207650_100003271 166
256 3300025925 Ga0207650_10029430 Ga0207650_100294304 166
257 3300025925 Ga0207650_10139751 Ga0207650_101397511 166
258 3300025925 Ga0207650_10174134 Ga0207650_101741343 166
259 3300025925 Ga0207650_10200024 Ga0207650_102000243 166
260 3300025931 Ga0207644_10008067 Ga0207644_100080677 166
261 3300025931 Ga0207644_10113844 Ga0207644_101138443 166
262 3300025932 Ga0207690_10000159 Ga0207690_1000015939 166
263 3300025932 Ga0207690_10014486 Ga0207690_100144865 166
264 3300025933 Ga0207706_10193522 Ga0207706_101935222 166
265 3300025933 Ga0207706_10281543 Ga0207706_102815432 166
266 3300025934 Ga0207686_10191571 Ga0207686_101915712 166
267 3300025938 Ga0207704_10011221 Ga0207704_100112215 166
268 3300025940 Ga0207691_10740987 Ga0207691_107409871 166
269 3300025941 Ga0207711_10000098 Ga0207711_100000984 166
270 3300025941 Ga0207711_10007949 Ga0207711_100079492 166
271 3300025941 Ga0207711_10047091 Ga0207711_100470914 166
272 3300025941 Ga0207711_10060134 Ga0207711_100601342 166
273 3300025941 Ga0207711_10067455 Ga0207711_100674551 166
274 3300025941 Ga0207711_10077333 Ga0207711_100773331 166
275 3300025949 Ga0207667_10004660 Ga0207667_1000466015 166
276 3300025949 Ga0207667_10032201 Ga0207667_100322013 166
277 3300025949 Ga0207667_10080415 Ga0207667_100804153 166
278 3300025960 Ga0207651_10125994 Ga0207651_101259943 166
279 3300025961 Ga0207712_10001643 Ga0207712_100016437 166
280 3300025961 Ga0207712_10271478 Ga0207712_102714782 166
281 3300025972 Ga0207668_10000025 Ga0207668_1000002541 166
282 3300025972 Ga0207668_10000035 Ga0207668_10000035135 166
283 3300025972 Ga0207668_10001450 Ga0207668_1000145015 166
284 3300025972 Ga0207668_10001848 Ga0207668_100018486 166
285 3300025972 Ga0207668_10009511 Ga0207668_100095116 166
286 3300025972 Ga0207668_10033907 Ga0207668_100339074 166
287 3300025981 Ga0207640_10092228 Ga0207640_100922282 166
288 3300025986 Ga0207658_10000300 Ga0207658_1000030049 166
289 3300025986 Ga0207658_10012188 Ga0207658_100121885 166
290 3300025986 Ga0207658_10017296 Ga0207658_100172963 166
291 3300025986 Ga0207658_10027675 Ga0207658_100276754 166
292 3300026023 Ga0207677_10045134 Ga0207677_100451343 166
293 3300026035 Ga0207703_10002585 Ga0207703_1000258511 166
294 3300026035 Ga0207703_10004356 Ga0207703_100043567 166
295 3300026035 Ga0207703_10159117 Ga0207703_101591172 166
296 3300026035 Ga0207703_10528394 Ga0207703_105283941 166
297 3300026041 Ga0207639_10014145 Ga0207639_100141451 166
298 3300026041 Ga0207639_10301901 Ga0207639_103019013 166
299 3300026041 Ga0207639_10488057 Ga0207639_104880571 166
300 3300026067 Ga0207678_10567848 Ga0207678_105678482 166
301 3300026088 Ga0207641_10000005 Ga0207641_10000005405 166
302 3300026088 Ga0207641_10000777 Ga0207641_1000077713 166
303 3300026088 Ga0207641_10000994 Ga0207641_1000099418 166
304 3300026088 Ga0207641_10047447 Ga0207641_100474474 166
305 3300026088 Ga0207641_10243404 Ga0207641_102434042 166
306 3300026088 Ga0207641_10284968 Ga0207641_102849682 166
307 3300026088 Ga0207641_10416041 Ga0207641_104160412 166
308 3300026089 Ga0207648_10206864 Ga0207648_102068642 166
309 3300026089 Ga0207648_11125127 Ga0207648_111251271 166
310 3300026095 Ga0207676_10000066 Ga0207676_1000006692 166
311 3300026095 Ga0207676_10000145 Ga0207676_100001456 166
312 3300026095 Ga0207676_10006892 Ga0207676_100068923 166
313 3300026095 Ga0207676_10088804 Ga0207676_100888044 166
314 3300026116 Ga0207674_10354915 Ga0207674_103549153 166
315 3300026118 Ga0207675_100086350 Ga0207675_1000863504 166
316 3300026118 Ga0207675_100566011 Ga0207675_1005660112 166
317 3300026118 Ga0207675_100585934 Ga0207675_1005859343 166
318 3300026121 Ga0207683_11043367 Ga0207683_110433671 166
319 3300026142 Ga0207698_10384166 Ga0207698_103841663 166
320 3300026142 Ga0207698_10424664 Ga0207698_104246642 166
321 3300027111 Ga0209281_1034369 Ga0209281_10343692 166
322 3300027526 Ga0209968_1057566 Ga0209968_10575661 166
323 3300027543 Ga0209999_1006580 Ga0209999_10065802 166
324 3300027665 Ga0209983_1002147 Ga0209983_10021473 166
325 3300027866 Ga0209813_10012213 Ga0209813_100122132 166
326 3300027876 Ga0209974_10363604 Ga0209974_103636041 166
327 3300028379 Ga0268266_10000003 Ga0268266_10000003565 166
328 3300028379 Ga0268266_10000814 Ga0268266_100008146 166
329 3300028379 Ga0268266_10002311 Ga0268266_100023114 166
330 3300028379 Ga0268266_10015863 Ga0268266_100158639 166
331 3300028379 Ga0268266_10464906 Ga0268266_104649062 166
332 3300028380 Ga0268265_10002522 Ga0268265_1000252213 166
333 3300028380 Ga0268265_10010073 Ga0268265_100100734 166
334 3300028380 Ga0268265_10096513 Ga0268265_100965132 166
335 3300028380 Ga0268265_10842456 Ga0268265_108424562 166
336 3300028380 Ga0268265_11048387 Ga0268265_110483871 166
337 3300028381 Ga0268264_10000002 Ga0268264_10000002747 166
338 3300028381 Ga0268264_10000211 Ga0268264_1000021149 166
339 3300028786 Ga0307517_10003214 Ga0307517_1000321419 166
340 3300028786 Ga0307517_10114040 Ga0307517_101140402 166
341 3300030521 Ga0307511_10048715 Ga0307511_100487154 166
342 3300031251 Ga0265327_10002802 Ga0265327_1000280214 166
343 3300031456 Ga0307513_10000053 Ga0307513_1000005361 166
344 3300031456 Ga0307513_10000790 Ga0307513_1000079023 166
345 3300031456 Ga0307513_10004139 Ga0307513_100041397 166
346 3300031456 Ga0307513_10501814 Ga0307513_105018142 166
347 3300031456 Ga0307513_10509514 Ga0307513_105095142 166
348 3300031548 Ga0307408_100794359 Ga0307408_1007943591 166
349 3300031730 Ga0307516_10000019 Ga0307516_10000019154 166
350 3300031824 Ga0307413_11896830 Ga0307413_118968301 166
351 3300031901 Ga0307406_10008222 Ga0307406_100082227 166
352 3300031901 Ga0307406_10959787 Ga0307406_109597872 166
353 3300031911 Ga0307412_10006570 Ga0307412_100065704 166
354 3300031911 Ga0307412_10549258 Ga0307412_105492582 166
355 3300031911 Ga0307412_11439022 Ga0307412_114390221 166
356 3300032004 Ga0307414_10056617 Ga0307414_100566172 166
357 3300032004 Ga0307414_10377663 Ga0307414_103776632 166
358 3300032004 Ga0307414_10396544 Ga0307414_103965442 166
359 3300032005 Ga0307411_10202201 Ga0307411_102022013 166
360 3300033180 Ga0307510_10032424 Ga0307510_100324247 166
361 3300033180 Ga0307510_10090503 Ga0307510_100905034 166
362 3300033180 Ga0307510_10372633 Ga0307510_103726332 166
363 3300033180 Ga0307510_10441553 Ga0307510_104415531 166
364 3300035113 Ga0373936_0003687 Ga0373936_0003687_4797_5300 166
365 3300035170 Ga0373943_0040693 Ga0373943_0040693_234_737 166
366 3300035170 Ga0373943_0273108 Ga0373943_0273108_203_706 166
367 3300035695 Ga0373927_0003786 Ga0373927_0003786_9503_10006 166
368 3300035725 Ga0373947_0044772 Ga0373947_0044772_164_667 166
369 3300036401 Ga0373937_1115188 Ga0373937_1115188_58_561 166
370 3300037068 Ga0373925_0004623 Ga0373925_0004623_9164_9667 166
371 3300037068 Ga0373925_0169409 Ga0373925_0169409_138_641 166
372 3300037312 Ga0395899_0000373 Ga0395899_0000373_28106_28609 166
373 3300037312 Ga0395899_0356435 Ga0395899_0356435_174_680 166
374 3300037418 Ga0395900_0000052 Ga0395900_0000052_97494_97997 166
375 3300037418 Ga0395900_0844447 Ga0395900_0844447_178_681 166
376 3300037466 Ga0395898_0013380 Ga0395898_0013380_439_942 166
377 3300037466 Ga0395898_0485355 Ga0395898_0485355_536_1039 166
378 3300037466 Ga0395898_0529023 Ga0395898_0529023_178_681 166
379 3300037471 Ga0395905_0102722 Ga0395905_0102722_476_979 166
380 3300037471 Ga0395905_0370997 Ga0395905_0370997_383_886 166
381 3300037853 Ga0436364_1032895 Ga0436364_1032895_1924_2427 166
382 3300038443 Ga0395901_0000001 Ga0395901_0000001_690012_690515 166
383 3300038443 Ga0395901_0475891 Ga0395901_0475891_298_801 166
384 3300038443 Ga0395901_0487686 Ga0395901_0487686_301_804 166
385 3300038443 Ga0395901_0533798 Ga0395901_0533798_30_533 166
386 3300039437 Ga0436365_1365943 Ga0436365_1365943_510_1013 166
387 3300042156 Ga0439446_0075290 Ga0439446_0075290_420_923 166
388 3300044684 Ga0466966_0134742 Ga0466966_0134742_886_1389 166
389 3300044706 Ga0466964_0028853 Ga0466964_0028853_389_892 166
390 3300044712 Ga0453684_0267837 Ga0453684_0267837_190_693 166
391 3300044735 Ga0466968_0148231 Ga0466968_0148231_140_643 166
392 3300046459 Ga0495629_0106991 Ga0495629_0106991_761_1264 166
393 3300046459 Ga0495629_0841068 Ga0495629_0841068_18_521 166
394 3300046471 Ga0495650_0016563 Ga0495650_0016563_1732_2235 166
395 3300046499 Ga0495594_0303595 Ga0495594_0303595_100_603 166
396 3300046506 Ga0495583_0047129 Ga0495583_0047129_912_1415 166
397 3300046515 Ga0495620_0035870 Ga0495620_0035870_1131_1634 166
398 3300046516 Ga0495628_0186214 Ga0495628_0186214_533_1039 166
399 3300046520 Ga0495637_0128566 Ga0495637_0128566_358_861 166
400 3300046522 Ga0495643_0028980 Ga0495643_0028980_540_1043 166
401 3300046525 Ga0495663_0109467 Ga0495663_0109467_251_754 166
402 3300046525 Ga0495663_0271062 Ga0495663_0271062_10_513 166
403 3300046542 Ga0495597_0005464 Ga0495597_0005464_1470_1973 166
404 3300046543 Ga0495645_0340706 Ga0495645_0340706_237_743 166
405 3300046557 Ga0495622_0001326 Ga0495622_0001326_1179_1682 166
406 3300046616 Ga0495668_0013600 Ga0495668_0013600_4024_4527 166
407 3300046616 Ga0495668_0073617 Ga0495668_0073617_202_705 166
408 3300046616 Ga0495668_0186150 Ga0495668_0186150_309_812 166
409 3300046616 Ga0495668_0252643 Ga0495668_0252643_41_544 166
410 3300046616 Ga0495668_0265881 Ga0495668_0265881_94_597 166
411 3300046616 Ga0495668_0337844 Ga0495668_0337844_74_577 166
412 3300046616 Ga0495668_0480913 Ga0495668_0480913_21_524 166
413 3300046648 Ga0495611_0029789 Ga0495611_0029789_573_1076 166
414 3300046660 Ga0495625_0067348 Ga0495625_0067348_401_904 166
415 3300046660 Ga0495625_0165443 Ga0495625_0165443_516_1019 166
416 3300046674 Ga0495588_0309552 Ga0495588_0309552_117_620 166
417 3300046675 Ga0495657_0240670 Ga0495657_0240670_530_1033 166
418 3300046684 Ga0495669_0000012 Ga0495669_0000012_61203_61706 166
419 3300046684 Ga0495669_0000250 Ga0495669_0000250_2834_3337 166
420 3300046684 Ga0495669_0068563 Ga0495669_0068563_398_901 166
421 3300046684 Ga0495669_0137478 Ga0495669_0137478_90_593 166
422 3300046689 Ga0495613_0542434 Ga0495613_0542434_72_575 166
423 3300046691 Ga0495670_0397799 Ga0495670_0397799_92_595 166
424 3300047315 Ga0495581_0178470 Ga0495581_0178470_583_1086 166
425 3300047318 Ga0495636_0134788 Ga0495636_0134788_509_1012 166
426 3300047320 Ga0495672_0064064 Ga0495672_0064064_552_1055 166
427 3300047443 Ga0495687_046127 Ga0495687_046127_265_768 166
428 3300047445 Ga0495677_0020987 Ga0495677_0020987_1353_1856 166
429 3300047445 Ga0495677_0085371 Ga0495677_0085371_244_747 166
430 3300047445 Ga0495677_0141666 Ga0495677_0141666_332_835 166
431 3300047470 Ga0495681_0090815 Ga0495681_0090815_399_902 166
432 3300047472 Ga0495686_0006019 Ga0495686_0006019_85_588 166
433 3300047673 Ga0495593_0031446 Ga0495593_0031446_763_1266 166
434 3300048903 Ga0496100_0493575 Ga0496100_0493575_274_780 166
435 3300048904 Ga0496101_0085705 Ga0496101_0085705_617_1120 166
436 3300048905 Ga0496102_0019470 Ga0496102_0019470_2442_2945 166
437 3300048905 Ga0496102_0025859 Ga0496102_0025859_4139_4642 166
438 3300048905 Ga0496102_0334882 Ga0496102_0334882_221_724 166
439 3300048906 Ga0496103_0055559 Ga0496103_0055559_1367_1870 166
440 3300048906 Ga0496103_0768427 Ga0496103_0768427_94_597 166
441 3300048908 Ga0496105_0240272 Ga0496105_0240272_26_529 166
442 3300048910 Ga0496107_0556322 Ga0496107_0556322_200_703 166
443 3300048910 Ga0496107_0673039 Ga0496107_0673039_53_556 166
444 3300048911 Ga0496108_0188933 Ga0496108_0188933_1100_1603 166
445 3300048912 Ga0496109_0014318 Ga0496109_0014318_5116_5619 166
446 3300048913 Ga0496110_0376878 Ga0496110_0376878_674_1177 166
447 3300048914 Ga0496111_0308281 Ga0496111_0308281_45_548 166
448 3300048915 Ga0496112_0020241 Ga0496112_0020241_5237_5740 166
449 3300048915 Ga0496112_0339013 Ga0496112_0339013_702_1205 166
450 3300048917 Ga0496114_1147501 Ga0496114_1147501_71_574 166
451 3300048918 Ga0496115_0004287 Ga0496115_0004287_6325_6828 166
452 3300048918 Ga0496115_0006353 Ga0496115_0006353_6041_6544 166
453 3300048918 Ga0496115_0265905 Ga0496115_0265905_501_1004 166
454 3300048920 Ga0496117_0014984 Ga0496117_0014984_5365_5868 166
455 3300048921 Ga0496118_0025848 Ga0496118_0025848_1867_2370 166
456 3300048922 Ga0496119_0004972 Ga0496119_0004972_10711_11214 166
457 3300048924 Ga0496121_0000059 Ga0496121_0000059_138549_139052 166
458 3300048928 Ga0496125_0067909 Ga0496125_0067909_588_1091 166
459 3300049570 Ga0501033_0151808 Ga0501033_0151808_550_1053 166
460 3300049571 Ga0501034_0080391 Ga0501034_0080391_434_937 166
461 3300049571 Ga0501034_0328804 Ga0501034_0328804_123_626 166
462 3300049581 Ga0501047_0002933 Ga0501047_0002933_5115_5618 166
463 3300049581 Ga0501047_0048528 Ga0501047_0048528_557_1060 166
464 3300049581 Ga0501047_0174495 Ga0501047_0174495_817_1320 166
465 3300049582 Ga0501048_0110380 Ga0501048_0110380_483_986 166
466 3300049586 Ga0501070_0602056 Ga0501070_0602056_287_790 166
467 3300049686 Ga0501257_049735 Ga0501257_049735_375_878 166
468 3300049822 Ga0501035_0088936 Ga0501035_0088936_544_1047 166
469 3300049822 Ga0501035_0269121 Ga0501035_0269121_634_1137 166
470 3300049822 Ga0501035_0474790 Ga0501035_0474790_76_579 166
471 3300049822 Ga0501035_1019650 Ga0501035_1019650_40_543 166
472 3300049822 Ga0501035_1139545 Ga0501035_1139545_21_527 166
473 3300049823 Ga0501044_0002607 Ga0501044_0002607_13524_14027 166
474 3300049823 Ga0501044_0207144 Ga0501044_0207144_641_1144 166
475 3300049823 Ga0501044_0337787 Ga0501044_0337787_340_843 166
476 3300050489 nmdc:mga03683_440233_c1 nmdc:mga03683_440233_c1_74_577 166
477 3300050489 nmdc:mga03683_55387_c1 nmdc:mga03683_55387_c1_573_1076 166
478 3300050491 nmdc:mga00v17_165_c2 nmdc:mga00v17_165_c2_4530_5033 166
479 3300050493 nmdc:mga0k408_39482_c1 nmdc:mga0k408_39482_c1_828_1331 166
480 3300050494 nmdc:mga06z11_55314_c1 nmdc:mga06z11_55314_c1_756_1259 166
481 3300050495 nmdc:mga04h51_14332_c1 nmdc:mga04h51_14332_c1_1004_1507 166
482 3300050496 nmdc:mga07m45_74732_c1 nmdc:mga07m45_74732_c1_1346_1849 166
483 3300053080 Ga0500635_0000048 Ga0500635_0000048_14622_15125 166
484 3300053087 Ga0500643_003880 Ga0500643_003880_1460_1963 166
485 3300053087 Ga0500643_020132 Ga0500643_020132_1214_1717 166
486 3300053088 Ga0500644_0008320 Ga0500644_0008320_739_1242 166
487 3300053090 Ga0500646_0029525 Ga0500646_0029525_886_1389 166
488 3300053091 Ga0500647_0113181 Ga0500647_0113181_59_562 166
489 3300053092 Ga0500583_0159765 Ga0500583_0159765_511_1014 166
490 3300053093 Ga0500651_0017968 Ga0500651_0017968_2832_3335 166
491 3300053093 Ga0500651_0222198 Ga0500651_0222198_593_1096 166
492 3300053096 Ga0500641_0004872 Ga0500641_0004872_2174_2677 166
493 3300053096 Ga0500641_0011946 Ga0500641_0011946_2598_3101 166
494 3300053103 Ga0500555_018530 Ga0500555_018530_1209_1712 166
495 3300053103 Ga0500555_042005 Ga0500555_042005_730_1233 166
496 3300053108 Ga0500562_000754 Ga0500562_000754_21_524 166
497 3300053108 Ga0500562_005608 Ga0500562_005608_2574_3077 166
498 3300053109 Ga0500569_002374 Ga0500569_002374_518_1021 166
499 3300053119 Ga0500595_004073 Ga0500595_004073_4426_4929 166
500 3300053119 Ga0500595_075689 Ga0500595_075689_84_587 166
501 3300053122 Ga0500608_000246 Ga0500608_000246_4829_5332 166
502 3300053122 Ga0500608_160147 Ga0500608_160147_362_865 166
503 3300053123 Ga0500614_005576 Ga0500614_005576_1267_1770 166
504 3300053130 Ga0500642_0042281 Ga0500642_0042281_1379_1882 166
505 3300053134 Ga0500658_0095970 Ga0500658_0095970_645_1148 166
506 3300053136 Ga0500559_0199476 Ga0500559_0199476_346_849 166
507 3300053138 Ga0500564_089445 Ga0500564_089445_500_1003 166
508 3300053148 Ga0500590_014524 Ga0500590_014524_2054_2557 166
509 3300053154 Ga0500619_005761 Ga0500619_005761_1642_2145 166
510 3300053156 Ga0500622_0002994 Ga0500622_0002994_10307_10810 166
511 3300053157 Ga0500624_054838 Ga0500624_054838_192_695 166
512 3300053163 Ga0500639_139786 Ga0500639_139786_510_1013 166
513 3300053177 Ga0500636_0036516 Ga0500636_0036516_463_966 166
514 3300053177 Ga0500636_0067140 Ga0500636_0067140_587_1090 166
515 3300053178 Ga0500637_0023865 Ga0500637_0023865_756_1259 166
516 3300053725 Ga0500576_034342 Ga0500576_034342_1067_1570 166
517 3300053730 Ga0500645_005711 Ga0500645_005711_2710_3213 166
518 3300053735 Ga0500596_003146 Ga0500596_003146_1774_2277 166
519 3300053737 Ga0500601_015595 Ga0500601_015595_50_553 166
520 3300059643 Ga0587072_045009 Ga0587072_045009_75_578 166
521 3300059643 Ga0587072_071344 Ga0587072_071344_102_605 166
522 iso_pu_bacteria 2643221614 2644086714 166
523 iso_pu_bacteria 2643221661 2644341668 166
524 iso_pu_bacteria 2643221666 2644367955 166
525 3300005355 Ga0070671_101058102 Ga0070671_1010581021 167
526 3300014325 Ga0163163_10583366 Ga0163163_105833661 167
527 3300021377 Ga0213874_10026951 Ga0213874_100269513 167
528 3300021384 Ga0213876_10000276 Ga0213876_1000027635 167
529 3300025299 Ga0209256_1010924 Ga0209256_10109244 167
530 3300028558 Ga0265326_10022728 Ga0265326_100227282 167
531 3300028563 Ga0265319_1077553 Ga0265319_10775532 167
532 3300028573 Ga0265334_10010373 Ga0265334_100103734 167
533 3300028577 Ga0265318_10112381 Ga0265318_101123812 167
534 3300028800 Ga0265338_10007642 Ga0265338_100076424 167
535 3300028800 Ga0265338_10165419 Ga0265338_101654193 167
536 3300031090 Ga0265760_10075254 Ga0265760_100752541 167
537 3300031240 Ga0265320_10173992 Ga0265320_101739922 167
538 3300031247 Ga0265340_10028890 Ga0265340_100288902 167
539 3300031251 Ga0265327_10109117 Ga0265327_101091173 167
540 3300031711 Ga0265314_10042221 Ga0265314_100422214 167
541 3300031711 Ga0265314_10234529 Ga0265314_102345292 167
542 3300031712 Ga0265342_10510319 Ga0265342_105103191 167
543 3300035086 Ga0373934_0308535 Ga0373934_0308535_121_627 167
544 3300035724 Ga0373933_0397796 Ga0373933_0397796_377_883 167
545 3300035724 Ga0373933_0596593 Ga0373933_0596593_99_605 167
546 3300036401 Ga0373937_0403589 Ga0373937_0403589_265_771 167
547 3300036401 Ga0373937_0588225 Ga0373937_0588225_348_854 167
548 3300039437 Ga0436365_0608786 Ga0436365_0608786_18271_18777 167
549 3300039450 Ga0436363_0783676 Ga0436363_0783676_169_672 167
550 3300039450 Ga0436363_1290520 Ga0436363_1290520_3459_3965 167
551 3300047470 Ga0495681_0071203 Ga0495681_0071203_204_707 167
552 3300048918 Ga0496115_1061987 Ga0496115_1061987_87_590 167
553 3300053117 Ga0500593_193496 Ga0500593_193496_14_520 167
554 3300053153 Ga0500616_0304272 Ga0500616_0304272_56_562 167
555 3300003215 JGI25153J46596_10026786 JGI25153J46596_100267862 168
556 3300003316 rootH1_10009031 rootH1_100090312 168
557 3300003773 Ga0055537_1001821 Ga0055537_10018214 168
558 3300003781 Ga0055536_1005776 Ga0055536_10057767 168
559 3300003781 Ga0055536_1005867 Ga0055536_10058677 168
560 3300003790 Ga0055528_1007241 Ga0055528_10072416 168
561 3300003791 Ga0055530_10007010 Ga0055530_100070106 168
562 3300003792 Ga0055540_1031330 Ga0055540_10313302 168
563 3300003794 Ga0055531_10001668 Ga0055531_100016687 168
564 3300003794 Ga0055531_10002505 Ga0055531_100025056 168
565 3300003794 Ga0055531_10065554 Ga0055531_100655542 168
566 3300005262 Ga0065165_1001299 Ga0065165_10012993 168
567 3300005328 Ga0070676_11213114 Ga0070676_112131141 168
568 3300005333 Ga0070677_10326022 Ga0070677_103260221 168
569 3300005335 Ga0070666_10060309 Ga0070666_100603091 168
570 3300005356 Ga0070674_100840396 Ga0070674_1008403961 168
571 3300005366 Ga0070659_100019781 Ga0070659_1000197817 168
572 3300005434 Ga0070709_10676013 Ga0070709_106760131 168
573 3300005456 Ga0070678_100685511 Ga0070678_1006855111 168
574 3300005535 Ga0070684_100833253 Ga0070684_1008332531 168
575 3300005539 Ga0068853_100036715 Ga0068853_1000367153 168
576 3300005539 Ga0068853_100248127 Ga0068853_1002481272 168
577 3300005548 Ga0070665_100624307 Ga0070665_1006243072 168
578 3300005548 Ga0070665_101341945 Ga0070665_1013419451 168
579 3300005563 Ga0068855_100136357 Ga0068855_1001363573 168
580 3300005563 Ga0068855_100499687 Ga0068855_1004996872 168
581 3300005563 Ga0068855_101479207 Ga0068855_1014792072 168
582 3300005563 Ga0068855_101624985 Ga0068855_1016249851 168
583 3300005564 Ga0070664_100184765 Ga0070664_1001847652 168
584 3300005564 Ga0070664_101028008 Ga0070664_1010280081 168
585 3300005614 Ga0068856_100702250 Ga0068856_1007022501 168
586 3300005617 Ga0068859_100115644 Ga0068859_1001156442 168
587 3300005840 Ga0068870_10067776 Ga0068870_100677762 168
588 3300005843 Ga0068860_100574747 Ga0068860_1005747471 168
589 3300005844 Ga0068862_100536223 Ga0068862_1005362232 168
590 3300006177 Ga0075362_10060000 Ga0075362_100600001 168
591 3300006186 Ga0075369_10017413 Ga0075369_100174133 168
592 3300006195 Ga0075366_10045391 Ga0075366_100453912 168
593 3300006195 Ga0075366_10487716 Ga0075366_104877161 168
594 3300006353 Ga0075370_10027781 Ga0075370_100277814 168
595 3300006931 Ga0097620_100115648 Ga0097620_1001156482 168
596 3300009093 Ga0105240_10002229 Ga0105240_1000222913 168
597 3300009093 Ga0105240_10216262 Ga0105240_102162623 168
598 3300009093 Ga0105240_10525981 Ga0105240_105259812 168
599 3300009098 Ga0105245_10828490 Ga0105245_108284902 168
600 3300009176 Ga0105242_10408070 Ga0105242_104080703 168
601 3300009177 Ga0105248_10962852 Ga0105248_109628522 168
602 3300009551 Ga0105238_10114475 Ga0105238_101144753 168
603 3300009551 Ga0105238_10643718 Ga0105238_106437182 168
604 3300009551 Ga0105238_11198423 Ga0105238_111984232 168
605 3300012497 Ga0157319_1002288 Ga0157319_10022881 168
606 3300013100 Ga0157373_10003275 Ga0157373_100032758 168
607 3300013105 Ga0157369_10582660 Ga0157369_105826602 168
608 3300013296 Ga0157374_12619687 Ga0157374_126196871 168
609 3300013297 Ga0157378_11409501 Ga0157378_114095012 168
610 3300013306 Ga0163162_11791954 Ga0163162_117919541 168
611 3300013308 Ga0157375_11001186 Ga0157375_110011862 168
612 3300021377 Ga0213874_10196440 Ga0213874_101964401 168
613 3300021388 Ga0213875_10069405 Ga0213875_100694052 168
614 3300021388 Ga0213875_10251597 Ga0213875_102515971 168
615 3300021441 Ga0213871_10045895 Ga0213871_100458951 168
616 3300025263 Ga0209565_1000402 Ga0209565_100040236 168
617 3300025273 Ga0209673_1000956 Ga0209673_100095637 168
618 3300025273 Ga0209673_1044805 Ga0209673_10448052 168
619 3300025291 Ga0209675_1032346 Ga0209675_10323462 168
620 3300025292 Ga0209676_1000467 Ga0209676_100046713 168
621 3300025292 Ga0209676_1000560 Ga0209676_100056013 168
622 3300025295 Ga0209564_1018585 Ga0209564_10185852 168
623 3300025297 Ga0209758_1002021 Ga0209758_100202115 168
624 3300025297 Ga0209758_1002093 Ga0209758_100209315 168
625 3300025298 Ga0209050_1000461 Ga0209050_100046158 168
626 3300025298 Ga0209050_1001568 Ga0209050_100156813 168
627 3300025298 Ga0209050_1011749 Ga0209050_10117494 168
628 3300025299 Ga0209256_1005220 Ga0209256_10052205 168
629 3300025303 Ga0209051_1009272 Ga0209051_10092724 168
630 3300025304 Ga0209257_1000186 Ga0209257_1000186143 168
631 3300025304 Ga0209257_1001256 Ga0209257_100125620 168
632 3300025304 Ga0209257_1010228 Ga0209257_10102282 168
633 3300025903 Ga0207680_10062871 Ga0207680_100628714 168
634 3300025909 Ga0207705_10204376 Ga0207705_102043761 168
635 3300025913 Ga0207695_10023959 Ga0207695_100239599 168
636 3300025913 Ga0207695_10219787 Ga0207695_102197873 168
637 3300025924 Ga0207694_10193276 Ga0207694_101932763 168
638 3300025928 Ga0207700_11313437 Ga0207700_113134371 168
639 3300025932 Ga0207690_10077040 Ga0207690_100770401 168
640 3300025934 Ga0207686_10084875 Ga0207686_100848752 168
641 3300025941 Ga0207711_10511688 Ga0207711_105116882 168
642 3300025945 Ga0207679_10043649 Ga0207679_100436492 168
643 3300025949 Ga0207667_10203744 Ga0207667_102037442 168
644 3300025949 Ga0207667_11305497 Ga0207667_113054971 168
645 3300025949 Ga0207667_11403068 Ga0207667_114030681 168
646 3300025972 Ga0207668_10065020 Ga0207668_100650203 168
647 3300026023 Ga0207677_10740962 Ga0207677_107409622 168
648 3300026041 Ga0207639_10027056 Ga0207639_100270564 168
649 3300026041 Ga0207639_10174365 Ga0207639_101743651 168
650 3300026078 Ga0207702_10892307 Ga0207702_108923072 168
651 3300026078 Ga0207702_11784625 Ga0207702_117846251 168
652 3300026116 Ga0207674_10277098 Ga0207674_102770983 168
653 3300028380 Ga0268265_10078212 Ga0268265_100782123 168
654 3300028381 Ga0268264_10250574 Ga0268264_102505742 168
655 3300028573 Ga0265334_10046570 Ga0265334_100465702 168
656 3300028786 Ga0307517_10176060 Ga0307517_101760601 168
657 3300028794 Ga0307515_10016786 Ga0307515_100167864 168
658 3300028794 Ga0307515_10498621 Ga0307515_104986211 168
659 3300028800 Ga0265338_10097782 Ga0265338_100977822 168
660 3300028800 Ga0265338_10234014 Ga0265338_102340142 168
661 3300028800 Ga0265338_10447921 Ga0265338_104479211 168
662 3300029957 Ga0265324_10103409 Ga0265324_101034092 168
663 3300031235 Ga0265330_10216422 Ga0265330_102164222 168
664 3300031240 Ga0265320_10228339 Ga0265320_102283391 168
665 3300031240 Ga0265320_10448505 Ga0265320_104485051 168
666 3300031251 Ga0265327_10000454 Ga0265327_1000045430 168
667 3300031251 Ga0265327_10001513 Ga0265327_100015135 168
668 3300031456 Ga0307513_10364128 Ga0307513_103641282 168
669 3300031649 Ga0307514_10358057 Ga0307514_103580571 168
670 3300031711 Ga0265314_10118869 Ga0265314_101188692 168
671 3300032004 Ga0307414_10264532 Ga0307414_102645321 168
672 3300032005 Ga0307411_10927407 Ga0307411_109274072 168
673 3300033180 Ga0307510_10291518 Ga0307510_102915182 168
674 3300036401 Ga0373937_0165947 Ga0373937_0165947_1270_1779 168
675 3300036401 Ga0373937_1350595 Ga0373937_1350595_122_631 168
676 3300037312 Ga0395899_0145401 Ga0395899_0145401_775_1284 168
677 3300037418 Ga0395900_0136998 Ga0395900_0136998_1815_2324 168
678 3300037466 Ga0395898_0129364 Ga0395898_0129364_1859_2368 168
679 3300037853 Ga0436364_0868872 Ga0436364_0868872_1477_1986 168
680 3300037853 Ga0436364_0877114 Ga0436364_0877114_2190_2699 168
681 3300037853 Ga0436364_1504159 Ga0436364_1504159_201_710 168
682 3300038443 Ga0395901_0121355 Ga0395901_0121355_559_1068 168
683 3300038443 Ga0395901_0153468 Ga0395901_0153468_112_621 168
684 3300039437 Ga0436365_1252750 Ga0436365_1252750_788_1309 168
685 3300039438 Ga0436360_0439840 Ga0436360_0439840_162_674 168
686 3300039438 Ga0436360_0606916 Ga0436360_0606916_214_723 168
687 3300039447 Ga0436361_1100879 Ga0436361_1100879_20281_20790 168
688 3300039450 Ga0436363_0535485 Ga0436363_0535485_648_1157 168
689 3300041451 Ga0451791_1365756 Ga0451791_1365756_21_530 168
690 3300041459 Ga0451800_0223665 Ga0451800_0223665_55_561 168
691 3300041512 Ga0451853_1586036 Ga0451853_1586036_98_604 168
692 3300042004 Ga0439445_0023404 Ga0439445_0023404_266_772 168
693 3300042156 Ga0439446_0008299 Ga0439446_0008299_1151_1657 168
694 3300042436 Ga0439435_0009519 Ga0439435_0009519_1546_2052 168
695 3300046453 Ga0495627_000767 Ga0495627_000767_17624_18130 168
696 3300046460 Ga0495638_0000935 Ga0495638_0000935_6195_6701 168
697 3300046460 Ga0495638_0001119 Ga0495638_0001119_8630_9136 168
698 3300046460 Ga0495638_0025082 Ga0495638_0025082_3117_3623 168
699 3300046460 Ga0495638_0223734 Ga0495638_0223734_142_648 168
700 3300046462 Ga0495651_0292422 Ga0495651_0292422_242_751 168
701 3300046471 Ga0495650_0000403 Ga0495650_0000403_58142_58648 168
702 3300046471 Ga0495650_0047502 Ga0495650_0047502_1028_1534 168
703 3300046471 Ga0495650_0187715 Ga0495650_0187715_113_619 168
704 3300046492 Ga0495585_0152341 Ga0495585_0152341_433_939 168
705 3300046506 Ga0495583_0000005 Ga0495583_0000005_133313_133819 168
706 3300046507 Ga0495606_0003858 Ga0495606_0003858_9214_9720 168
707 3300046512 Ga0495610_0002475 Ga0495610_0002475_11799_12305 168
708 3300046512 Ga0495610_0009314 Ga0495610_0009314_3732_4238 168
709 3300046512 Ga0495610_0011679 Ga0495610_0011679_3766_4272 168
710 3300046513 Ga0495616_0000172 Ga0495616_0000172_21098_21604 168
711 3300046518 Ga0495631_0011080 Ga0495631_0011080_1166_1672 168
712 3300046519 Ga0495632_0015448 Ga0495632_0015448_52_558 168
713 3300046520 Ga0495637_0056020 Ga0495637_0056020_546_1052 168
714 3300046522 Ga0495643_0204435 Ga0495643_0204435_306_812 168
715 3300046524 Ga0495648_0024553 Ga0495648_0024553_2087_2593 168
716 3300046524 Ga0495648_0046545 Ga0495648_0046545_1909_2415 168
717 3300046524 Ga0495648_0221235 Ga0495648_0221235_70_576 168
718 3300046524 Ga0495648_0306086 Ga0495648_0306086_196_702 168
719 3300046525 Ga0495663_0036119 Ga0495663_0036119_347_853 168
720 3300046530 Ga0495654_0000708 Ga0495654_0000708_13133_13639 168
721 3300046539 Ga0495621_0016728 Ga0495621_0016728_701_1210 168
722 3300046539 Ga0495621_0388434 Ga0495621_0388434_20_568 168
723 3300046542 Ga0495597_0218989 Ga0495597_0218989_188_694 168
724 3300046543 Ga0495645_0625191 Ga0495645_0625191_86_595 168
725 3300046616 Ga0495668_0000100 Ga0495668_0000100_125124_125630 168
726 3300046616 Ga0495668_0009341 Ga0495668_0009341_3458_3964 168
727 3300046616 Ga0495668_0012089 Ga0495668_0012089_1131_1637 168
728 3300046616 Ga0495668_0033240 Ga0495668_0033240_1971_2477 168
729 3300046660 Ga0495625_0003383 Ga0495625_0003383_9529_10035 168
730 3300046660 Ga0495625_0003474 Ga0495625_0003474_5976_6482 168
731 3300046660 Ga0495625_0014000 Ga0495625_0014000_4037_4543 168
732 3300046660 Ga0495625_0021720 Ga0495625_0021720_3023_3529 168
733 3300046660 Ga0495625_0028606 Ga0495625_0028606_788_1294 168
734 3300046660 Ga0495625_0054628 Ga0495625_0054628_739_1245 168
735 3300046664 Ga0495659_0060458 Ga0495659_0060458_839_1345 168
736 3300046689 Ga0495613_0001323 Ga0495613_0001323_1624_2133 168
737 3300046692 Ga0495671_0090907 Ga0495671_0090907_487_993 168
738 3300046794 Ga0495589_0164422 Ga0495589_0164422_394_900 168
739 3300046810 Ga0495660_0066897 Ga0495660_0066897_1287_1793 168
740 3300047320 Ga0495672_0001210 Ga0495672_0001210_19844_20350 168
741 3300047443 Ga0495687_128384 Ga0495687_128384_76_582 168
742 3300047446 Ga0495679_021303 Ga0495679_021303_1677_2183 168
743 3300047446 Ga0495679_084936 Ga0495679_084936_307_813 168
744 3300047469 Ga0495673_0000025 Ga0495673_0000025_228692_229198 168
745 3300047469 Ga0495673_0001381 Ga0495673_0001381_3897_4403 168
746 3300047469 Ga0495673_0002003 Ga0495673_0002003_5491_5997 168
747 3300047470 Ga0495681_0024801 Ga0495681_0024801_719_1225 168
748 3300047472 Ga0495686_0001965 Ga0495686_0001965_2840_3346 168
749 3300047472 Ga0495686_0014178 Ga0495686_0014178_2331_2837 168
750 3300047472 Ga0495686_0044404 Ga0495686_0044404_2292_2798 168
751 3300047472 Ga0495686_0163401 Ga0495686_0163401_708_1214 168
752 3300047472 Ga0495686_0195760 Ga0495686_0195760_623_1129 168
753 3300048904 Ga0496101_0149595 Ga0496101_0149595_1115_1621 168
754 3300048909 Ga0496106_0003982 Ga0496106_0003982_1371_1877 168
755 3300048909 Ga0496106_0650243 Ga0496106_0650243_17_526 168
756 3300048910 Ga0496107_0000063 Ga0496107_0000063_12358_12864 168
757 3300048918 Ga0496115_0008707 Ga0496115_0008707_5639_6145 168
758 3300048918 Ga0496115_0736979 Ga0496115_0736979_86_592 168
759 3300048924 Ga0496121_0017039 Ga0496121_0017039_70_576 168
760 3300048927 Ga0496124_0013512 Ga0496124_0013512_3787_4293 168
761 3300048928 Ga0496125_0089362 Ga0496125_0089362_858_1364 168
762 3300048929 Ga0496126_0074075 Ga0496126_0074075_334_840 168
763 3300049459 Ga0495678_010136 Ga0495678_010136_1064_1570 168
764 3300049459 Ga0495678_150844 Ga0495678_150844_83_589 168
765 3300049570 Ga0501033_0015367 Ga0501033_0015367_3184_3693 168
766 3300049571 Ga0501034_0002424 Ga0501034_0002424_5754_6263 168
767 3300049572 Ga0501036_0988846 Ga0501036_0988846_21_530 168
768 3300049573 Ga0501037_0409239 Ga0501037_0409239_119_628 168
769 3300049574 Ga0501038_0171942 Ga0501038_0171942_488_997 168
770 3300049671 Ga0501238_003567 Ga0501238_003567_795_1301 168
771 3300049823 Ga0501044_0000280 Ga0501044_0000280_56488_56997 168
772 3300049823 Ga0501044_0293953 Ga0501044_0293953_169_678 168
773 3300050489 nmdc:mga03683_46670_c1 nmdc:mga03683_46670_c1_1169_1675 168
774 3300050493 nmdc:mga0k408_191397_c1 nmdc:mga0k408_191397_c1_536_1042 168
775 3300050493 nmdc:mga0k408_515827_c1 nmdc:mga0k408_515827_c1_96_602 168
776 3300050496 nmdc:mga07m45_171659_c1 nmdc:mga07m45_171659_c1_449_955 168
777 3300050516 nmdc:mga0sz30_2184_c1 nmdc:mga0sz30_2184_c1_5066_5572 168
778 3300053086 Ga0500578_0000913 Ga0500578_0000913_12872_13378 168
779 3300053087 Ga0500643_000316 Ga0500643_000316_23621_24130 168
780 3300053087 Ga0500643_017750 Ga0500643_017750_430_936 168
781 3300053087 Ga0500643_073400 Ga0500643_073400_304_810 168
782 3300053088 Ga0500644_0000287 Ga0500644_0000287_25449_25955 168
783 3300053088 Ga0500644_0009395 Ga0500644_0009395_1582_2088 168
784 3300053091 Ga0500647_0017276 Ga0500647_0017276_2324_2833 168
785 3300053092 Ga0500583_0223218 Ga0500583_0223218_292_798 168
786 3300053093 Ga0500651_0421470 Ga0500651_0421470_63_569 168
787 3300053096 Ga0500641_0000367 Ga0500641_0000367_10251_10760 168
788 3300053102 Ga0500554_022618 Ga0500554_022618_35_541 168
789 3300053103 Ga0500555_015082 Ga0500555_015082_1138_1647 168
790 3300053104 Ga0500556_0001952 Ga0500556_0001952_5684_6190 168
791 3300053104 Ga0500556_0002100 Ga0500556_0002100_4201_4710 168
792 3300053104 Ga0500556_0053471 Ga0500556_0053471_918_1427 168
793 3300053108 Ga0500562_014884 Ga0500562_014884_633_1142 168
794 3300053111 Ga0500572_000189 Ga0500572_000189_11653_12162 168
795 3300053118 Ga0500594_0003639 Ga0500594_0003639_1036_1542 168
796 3300053119 Ga0500595_022624 Ga0500595_022624_1210_1719 168
797 3300053122 Ga0500608_014541 Ga0500608_014541_1035_1541 168
798 3300053123 Ga0500614_234343 Ga0500614_234343_40_546 168
799 3300053125 Ga0500618_000319 Ga0500618_000319_22902_23408 168
800 3300053133 Ga0500655_021376 Ga0500655_021376_386_895 168
801 3300053134 Ga0500658_0005593 Ga0500658_0005593_3115_3621 168
802 3300053136 Ga0500559_0000010 Ga0500559_0000010_103236_103745 168
803 3300053136 Ga0500559_0000153 Ga0500559_0000153_12843_13349 168
804 3300053136 Ga0500559_0013632 Ga0500559_0013632_2029_2535 168
805 3300053136 Ga0500559_0018372 Ga0500559_0018372_2027_2533 168
806 3300053138 Ga0500564_000369 Ga0500564_000369_2037_2543 168
807 3300053142 Ga0500577_0001350 Ga0500577_0001350_1793_2299 168
808 3300053153 Ga0500616_0012826 Ga0500616_0012826_2324_2833 168
809 3300053153 Ga0500616_0017769 Ga0500616_0017769_2073_2582 168
810 3300053153 Ga0500616_0034015 Ga0500616_0034015_1227_1736 168
811 3300053153 Ga0500616_0161756 Ga0500616_0161756_116_622 168
812 3300053156 Ga0500622_0004398 Ga0500622_0004398_5573_6079 168
813 3300053156 Ga0500622_0017251 Ga0500622_0017251_1421_1930 168
814 3300053156 Ga0500622_0074609 Ga0500622_0074609_326_832 168
815 3300053156 Ga0500622_0207383 Ga0500622_0207383_362_868 168
816 3300053158 Ga0500627_0053289 Ga0500627_0053289_811_1317 168
817 3300053730 Ga0500645_001079 Ga0500645_001079_3029_3538 168
818 3300053730 Ga0500645_001315 Ga0500645_001315_9696_10205 168
819 3300053730 Ga0500645_086685 Ga0500645_086685_153_662 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10722

YbjN

Putative bacterial sensory transduction regulator

17

147

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7fz5-assembly1.cif.gz_A crystal structure of human fabp4 in complex with rac-(2r)-1-[[3-(3-cyclopropyl-1,2,4-oxadiazol-5-yl)-4,5,6,7-tetrahydro-1-benzothiophen-2-yl]carbamoyl]pyrrolidine-2-carboxylic acid 0.7706 29 67
7fwq-assembly1.cif.gz_A crystal structure of human fabp4 binding site mutated to that of fabp3 in complex with 6-chloro-4-(2-chlorophenoxy)-2-methylquinoline-3-carboxylic acid, i.e. smiles c1(ccc2c(c1)c(c(c(n2)c)c(=o)o)oc1c(cccc1)cl)cl with ic50=0.048 microm 0.736 29 67
6vu7-assembly1.cif.gz_D crystal structure of ybjn, a putative transcription regulator from e. coli 0.7306 17 137
4h5b-assembly1.cif.gz_A crystal structure of dr_1245 from deinococcus radiodurans 0.7047 17 151
1n5b-assembly3.cif.gz_B crystal structure of the yersinia enterocolitica molecular chaperone syce 0.7018 18 138
ID Description Score Start End Superfamily
af_I6Y4U0_54_180_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8231 19 136 3.30.420.40
af_I6Y4U0_54_180_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7645 19 136 3.30.420.40
af_A4I6G8_183_310_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.758 16 135 3.30.1460.10
af_Q2FXG1_205_373_3.40.50.10990 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.7458 40 68 3.40.50.10990
1k3eA02 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.7329 40 140 3.30.1460.10
ID Description Score Start End GO Terms
AF-A0A257X5W7-F1-model_v4 YbjN domain-containing protein 0.9605 1 138
AF-A0A257X5W7-F1-model_v4 YbjN domain-containing protein 0.9537 1 138
AF-A0A5E7YW60-F1-model_v4 deleted 0.9425 13 168
AF-A0A0J6CHT9-F1-model_v4 Sensory transduction regulator 0.938 18 151
AF-A0A838MP11-F1-model_v4 YbjN domain-containing protein 0.9355 13 161

Feature Viewer

pLDDT pTM Quality
89.25 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map