F482122

General Info

Members Datasets Scaffolds Average Seq Length
818 307 818 495

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100019780|Ga0068868_1000197802
Length 506
Sequence MLAKNLTEALTFDDVLLIPAYSEVVPAQVSTQTQLTRDITLNTPLLSSAMDTVTESRMAIAMAQQGGIGIVHRNLTIEAQAGEIDKVKRSESGMIVDPVTIGPDQQIADALEVMRRYKISGVPVTKGTKLVGILTNRDLRFETRVDVPVGDVMTKENLITVAVGTTLEEAELILHKHRVEKLLVVDDQYNLKGLITVKDIQKKLKYPSASKDEKGRLRVGGAIGATGDFLERAEELVNARVDVLAIDSAHGHSSRVLEAVREVKKRFPGVGVLAGNVATYEGAQALMDAGADAIKVGIGPGSICTTRMVTGAGMPQITAIAESARAAQERGIPVIADGGIKYSGEVTKAIAAGASSVMIGSLFAGVDESPGETILYQGRSFKSYRGMGSLTAMSQGSGERYFQSAEDLAKEIDTEGVVQRERNGQNRLAKFVPEGIEGRVPYRGPLEAMVYQLVGGLRSGMGYLGCGTIAELQQKAQFVRISNAGLRESHVHDVIITREAPNYHVE

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
113 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
166 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
171 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
172 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
173 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
178 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
179 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
180 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
183 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
184 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
185 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
190 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
191 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
222 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
234 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
262 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
279 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
280 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
281 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
282 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
283 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
284 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
285 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
286 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
287 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
292 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
303 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
304 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 1.47
Rhizosphere 95.11
Stem 0
Stem Tuber 0
Unclassified 2.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10093704 3300005293 Bacteria 4593
2 Ga0070658_10057258 3300005327 Bacteria 3170
3 Ga0070676_10009362 3300005328 Bacteria 5294
4 Ga0070676_10051548 3300005328 Bacteria 2417
5 Ga0070683_100000002 3300005329 Bacteria 427530
6 Ga0070683_100007932 3300005329 Bacteria 9004
7 Ga0070683_100078429 3300005329 Bacteria 3090
8 Ga0070683_100099042 3300005329 Bacteria 2744
9 Ga0070670_100001949 3300005331 Bacteria 16915
10 Ga0070666_10017503 3300005335 Bacteria 4594
11 Ga0070666_10041327 3300005335 Bacteria 3081
12 Ga0070666_10103624 3300005335 Bacteria 1963
13 Ga0070680_100026699 3300005336 Bacteria 4618
14 Ga0070680_100032224 3300005336 Bacteria 4217
15 Ga0070682_100064443 3300005337 Bacteria 2326
16 Ga0068868_100001660 3300005338 Bacteria 15197
17 Ga0068868_100015752 3300005338 Bacteria 5600
18 Ga0068868_100019780 3300005338 Bacteria 5050
19 Ga0068868_100021745 3300005338 Bacteria 4833
20 Ga0068868_100066500 3300005338 Bacteria 2866
21 Ga0068868_100067628 3300005338 Bacteria 2844
22 Ga0070660_100007894 3300005339 Bacteria 7425
23 Ga0070660_100115767 3300005339 Bacteria 2137
24 Ga0070687_100054056 3300005343 Bacteria 2091
25 Ga0070661_100008885 3300005344 Bacteria 6954
26 Ga0070661_100019563 3300005344 Bacteria 4826
27 Ga0070661_100025646 3300005344 Bacteria 4238
28 Ga0070661_100054741 3300005344 Bacteria 2922
29 Ga0070668_100011535 3300005347 Bacteria 6579
30 Ga0070675_100003550 3300005354 Bacteria 11840
31 Ga0070675_100020001 3300005354 Bacteria 5341
32 Ga0070675_100020069 3300005354 Bacteria 5331
33 Ga0070675_100055347 3300005354 Bacteria 3265
34 Ga0070675_100114608 3300005354 Bacteria 2284
35 Ga0070671_100000378 3300005355 Bacteria 30628
36 Ga0070671_100015148 3300005355 Bacteria 6228
37 Ga0070671_100042917 3300005355 Bacteria 3761
38 Ga0070674_100012266 3300005356 Bacteria 5259
39 Ga0070673_100007515 3300005364 Bacteria 7198
40 Ga0070673_100098684 3300005364 Bacteria 2401
41 Ga0070688_100038813 3300005365 Bacteria 2911
42 Ga0070659_100016010 3300005366 Bacteria 5625
43 Ga0070667_100004263 3300005367 Bacteria 12077
44 Ga0070667_100015915 3300005367 Bacteria 6223
45 Ga0070667_100019425 3300005367 Bacteria 5638
46 Ga0070703_10009229 3300005406 Bacteria 2783
47 Ga0070709_10000423 3300005434 Bacteria 25611
48 Ga0070714_100000096 3300005435 Bacteria 74616
49 Ga0070714_100001908 3300005435 Bacteria 15192
50 Ga0070714_100102955 3300005435 Bacteria 2518
51 Ga0070713_100000364 3300005436 Bacteria 29177
52 Ga0070713_100008685 3300005436 Bacteria 7225
53 Ga0070713_100011727 3300005436 Bacteria 6397
54 Ga0070713_100103287 3300005436 Bacteria 2473
55 Ga0070701_10007710 3300005438 Bacteria 4618
56 Ga0070711_100103524 3300005439 Bacteria 2075
57 Ga0070705_100047339 3300005440 Bacteria 2485
58 Ga0070705_100049561 3300005440 Bacteria 2439
59 Ga0070694_100012714 3300005444 Bacteria 5241
60 Ga0070708_100000805 3300005445 Bacteria 23638
61 Ga0070708_100003971 3300005445 Bacteria 11607
62 Ga0070708_100007485 3300005445 Bacteria 8742
63 Ga0070708_100012412 3300005445 Bacteria 6955
64 Ga0070663_100010931 3300005455 Bacteria 5673
65 Ga0070663_100062398 3300005455 Bacteria 2687
66 Ga0070662_100006651 3300005457 Bacteria 7465
67 Ga0070662_100053402 3300005457 Bacteria 2925
68 Ga0070662_100056115 3300005457 Bacteria 2859
69 Ga0070681_10006468 3300005458 Bacteria 11407
70 Ga0070681_10073881 3300005458 Bacteria 3371
71 Ga0070681_10092236 3300005458 Bacteria 2978
72 Ga0070681_10157601 3300005458 Bacteria 2194
73 Ga0068867_100007704 3300005459 Bacteria 7619
74 Ga0068867_100022763 3300005459 Bacteria 4482
75 Ga0070685_10019908 3300005466 Bacteria 3627
76 Ga0070706_100000278 3300005467 Bacteria 62365
77 Ga0070706_100021666 3300005467 Bacteria 5918
78 Ga0070706_100245321 3300005467 Bacteria 1672
79 Ga0070707_100000221 3300005468 Bacteria 57035
80 Ga0070698_100023905 3300005471 Bacteria 6380
81 Ga0070699_100015903 3300005518 Bacteria 6461
82 Ga0070699_100018350 3300005518 Bacteria 6011
83 Ga0070679_100003386 3300005530 Bacteria 14614
84 Ga0070679_100009883 3300005530 Bacteria 9026
85 Ga0070679_100047135 3300005530 Bacteria 4297
86 Ga0070679_100068323 3300005530 Bacteria 3545
87 Ga0070684_100000007 3300005535 Bacteria 217174
88 Ga0070684_100039558 3300005535 Bacteria 4057
89 Ga0070684_100044069 3300005535 Bacteria 3857
90 Ga0070684_100099199 3300005535 Bacteria 2599
91 Ga0070697_100000993 3300005536 Bacteria 21455
92 Ga0070697_100001847 3300005536 Bacteria 16183
93 Ga0070697_100033249 3300005536 Bacteria 4152
94 Ga0068853_100014788 3300005539 Bacteria 6405
95 Ga0068853_100022773 3300005539 Bacteria 5236
96 Ga0070672_100101299 3300005543 Bacteria 2336
97 Ga0070686_100032737 3300005544 Bacteria 3189
98 Ga0070695_100010421 3300005545 Bacteria 5550
99 Ga0070696_100002464 3300005546 Bacteria 12271
100 Ga0070696_100006664 3300005546 Bacteria 7714
101 Ga0070693_100000037 3300005547 Bacteria 50504
102 Ga0070665_100028376 3300005548 Bacteria 5638
103 Ga0068855_100000642 3300005563 Bacteria 42759
104 Ga0068855_100002278 3300005563 Bacteria 23709
105 Ga0068855_100013554 3300005563 Bacteria 9834
106 Ga0068855_100022851 3300005563 Bacteria 7496
107 Ga0068855_100085072 3300005563 Bacteria 3660
108 Ga0068855_100158826 3300005563 Bacteria 2567
109 Ga0068855_100235951 3300005563 Bacteria 2045
110 Ga0070664_100001989 3300005564 Bacteria 16388
111 Ga0070664_100104305 3300005564 Bacteria 2469
112 Ga0070664_100204667 3300005564 Bacteria 1762
113 Ga0068857_100001478 3300005577 Bacteria 18698
114 Ga0068857_100009230 3300005577 Bacteria 8556
115 Ga0068857_100040887 3300005577 Bacteria 4110
116 Ga0068857_100134234 3300005577 Bacteria 2234
117 Ga0068854_100029876 3300005578 Bacteria 3776
118 Ga0068856_100003152 3300005614 Bacteria 16815
119 Ga0068856_100014834 3300005614 Bacteria 7521
120 Ga0068856_100014853 3300005614 Bacteria 7515
121 Ga0068856_100016878 3300005614 Bacteria 7076
122 Ga0068856_100042132 3300005614 Bacteria 4491
123 Ga0068856_100043286 3300005614 Bacteria 4430
124 Ga0068852_100000415 3300005616 Bacteria 28473
125 Ga0068852_100073456 3300005616 Bacteria 3009
126 Ga0068852_100081737 3300005616 Bacteria 2869
127 Ga0068852_100206405 3300005616 Bacteria 1862
128 Ga0068859_100006813 3300005617 Bacteria 11608
129 Ga0068859_100010766 3300005617 Bacteria 9204
130 Ga0068859_100033639 3300005617 Bacteria 5148
131 Ga0068859_100077042 3300005617 Bacteria 3375
132 Ga0068859_100100435 3300005617 Bacteria 2949
133 Ga0068859_100120349 3300005617 Bacteria 2692
134 Ga0068864_100001669 3300005618 Bacteria 18274
135 Ga0068864_100003645 3300005618 Bacteria 12734
136 Ga0068864_100004251 3300005618 Bacteria 11784
137 Ga0068864_100135900 3300005618 Bacteria 2214
138 Ga0068866_10021754 3300005718 Bacteria 2958
139 Ga0068866_10038702 3300005718 Bacteria 2350
140 Ga0068851_10006846 3300005834 Bacteria 5219
141 Ga0068851_10008567 3300005834 Bacteria 4731
142 Ga0068851_10015529 3300005834 Bacteria 3629
143 Ga0068863_100004389 3300005841 Bacteria 13905
144 Ga0068863_100030408 3300005841 Bacteria 5157
145 Ga0068863_100064567 3300005841 Bacteria 3462
146 Ga0068863_100067932 3300005841 Bacteria 3372
147 Ga0068863_100138445 3300005841 Bacteria 2326
148 Ga0068858_100003482 3300005842 Bacteria 15606
149 Ga0068858_100004396 3300005842 Bacteria 13831
150 Ga0068858_100007847 3300005842 Bacteria 10295
151 Ga0068858_100014966 3300005842 Bacteria 7300
152 Ga0068858_100026791 3300005842 Bacteria 5355
153 Ga0068858_100031600 3300005842 Bacteria 4918
154 Ga0068858_100083674 3300005842 Bacteria 2967
155 Ga0068860_100002369 3300005843 Bacteria 19794
156 Ga0068860_100011406 3300005843 Bacteria 8756
157 Ga0068860_100023431 3300005843 Bacteria 5966
158 Ga0068860_100049370 3300005843 Bacteria 4008
159 Ga0068860_100072062 3300005843 Bacteria 3283
160 Ga0081455_10000246 3300005937 Bacteria 70584
161 Ga0081455_10013820 3300005937 Bacteria 7944
162 Ga0081455_10047850 3300005937 Bacteria 3699
163 Ga0081538_10000663 3300005981 Bacteria 38027
164 Ga0081538_10001749 3300005981 Bacteria 22060
165 Ga0081538_10006844 3300005981 Bacteria 9935
166 Ga0081540_1005801 3300005983 Bacteria 9136
167 Ga0081540_1016962 3300005983 Bacteria 4529
168 Ga0070717_10002621 3300006028 Bacteria 12687
169 Ga0070717_10045959 3300006028 Bacteria 3571
170 Ga0070717_10193400 3300006028 Bacteria 1778
171 Ga0075365_10021836 3300006038 Bacteria 3999
172 Ga0075364_10005747 3300006051 Bacteria 7234
173 Ga0070712_100002672 3300006175 Bacteria 11005
174 Ga0070712_100010032 3300006175 Bacteria 5971
175 Ga0070712_100137108 3300006175 Bacteria 1862
176 Ga0075367_10009184 3300006178 Bacteria 5157
177 Ga0075366_10001249 3300006195 Bacteria 12628
178 Ga0097621_100004652 3300006237 Bacteria 9582
179 Ga0097621_100015449 3300006237 Bacteria 5743
180 Ga0097621_100020172 3300006237 Bacteria 5134
181 Ga0097621_100024268 3300006237 Bacteria 4733
182 Ga0097621_100031066 3300006237 Bacteria 4235
183 Ga0097621_100036253 3300006237 Bacteria 3945
184 Ga0097621_100052500 3300006237 Bacteria 3321
185 Ga0097621_100111216 3300006237 Bacteria 2315
186 Ga0068871_100014111 3300006358 Bacteria 5943
187 Ga0068871_100026889 3300006358 Bacteria 4494
188 Ga0068871_100030778 3300006358 Bacteria 4230
189 Ga0068871_100039111 3300006358 Bacteria 3793
190 Ga0068871_100058314 3300006358 Bacteria 3143
191 Ga0068871_100078857 3300006358 Bacteria 2723
192 Ga0075428_100003081 3300006844 Bacteria 18188
193 Ga0075428_100132027 3300006844 Bacteria 2716
194 Ga0075428_100357777 3300006844 Bacteria 1566
195 Ga0075431_100005846 3300006847 Bacteria 12173
196 Ga0075431_100109414 3300006847 Bacteria 2852
197 Ga0075433_10015741 3300006852 Bacteria 6214
198 Ga0075433_10082186 3300006852 Bacteria 2841
199 Ga0075433_10089230 3300006852 Bacteria 2725
200 Ga0075433_10209197 3300006852 Bacteria 1734
201 Ga0075434_100003909 3300006871 Bacteria 13339
202 Ga0075434_100005331 3300006871 Bacteria 11701
203 Ga0075434_100008203 3300006871 Bacteria 9690
204 Ga0075434_100033223 3300006871 Bacteria 5091
205 Ga0075429_100024549 3300006880 Bacteria 5230
206 Ga0068865_100007218 3300006881 Bacteria 6826
207 Ga0068865_100011388 3300006881 Bacteria 5563
208 Ga0068865_100019789 3300006881 Bacteria 4359
209 Ga0068865_100020714 3300006881 Bacteria 4268
210 Ga0097620_100006814 3300006931 Bacteria 11608
211 Ga0097620_100010766 3300006931 Bacteria 9204
212 Ga0097620_100033641 3300006931 Bacteria 5148
213 Ga0097620_100077030 3300006931 Bacteria 3375
214 Ga0097620_100100428 3300006931 Bacteria 2949
215 Ga0097620_100120348 3300006931 Bacteria 2692
216 Ga0075435_100009419 3300007076 Bacteria 7069
217 Ga0099795_10031829 3300007788 Bacteria 1820
218 Ga0105240_10000734 3300009093 Bacteria 59913
219 Ga0105240_10001326 3300009093 Bacteria 42653
220 Ga0105240_10001395 3300009093 Bacteria 41517
221 Ga0105240_10025014 3300009093 Bacteria 7860
222 Ga0105240_10030445 3300009093 Bacteria 7015
223 Ga0105240_10032052 3300009093 Bacteria 6806
224 Ga0105240_10081283 3300009093 Bacteria 3982
225 Ga0105240_10098075 3300009093 Bacteria 3570
226 Ga0111539_10004140 3300009094 Bacteria 19023
227 Ga0111539_10009382 3300009094 Bacteria 12354
228 Ga0111539_10012378 3300009094 Bacteria 10697
229 Ga0111539_10029920 3300009094 Bacteria 6624
230 Ga0111539_10035040 3300009094 Bacteria 6078
231 Ga0111539_10219191 3300009094 Bacteria 2216
232 Ga0105245_10007394 3300009098 Bacteria 9618
233 Ga0105245_10028226 3300009098 Bacteria 4947
234 Ga0105245_10029145 3300009098 Bacteria 4874
235 Ga0105245_10036728 3300009098 Bacteria 4353
236 Ga0105245_10055244 3300009098 Bacteria 3566
237 Ga0105245_10073069 3300009098 Bacteria 3117
238 Ga0105245_10126779 3300009098 Bacteria 2390
239 Ga0114129_10000777 3300009147 Bacteria 40773
240 Ga0114129_10008706 3300009147 Bacteria 14466
241 Ga0114129_10058156 3300009147 Bacteria 5408
242 Ga0114129_10147701 3300009147 Bacteria 3219
243 Ga0114129_10225080 3300009147 Bacteria 2529
244 Ga0114129_10501756 3300009147 Bacteria 1585
245 Ga0105243_10019881 3300009148 Bacteria 5093
246 Ga0105241_10032077 3300009174 Bacteria 3935
247 Ga0105241_10043258 3300009174 Bacteria 3411
248 Ga0105241_10049056 3300009174 Bacteria 3214
249 Ga0105242_10056943 3300009176 Bacteria 3199
250 Ga0105248_10000094 3300009177 Bacteria 98558
251 Ga0105248_10000806 3300009177 Bacteria 35108
252 Ga0105248_10001021 3300009177 Bacteria 30968
253 Ga0105248_10003639 3300009177 Bacteria 17111
254 Ga0105248_10013851 3300009177 Bacteria 8872
255 Ga0105248_10020967 3300009177 Bacteria 7244
256 Ga0105248_10056649 3300009177 Bacteria 4397
257 Ga0105248_10064389 3300009177 Bacteria 4116
258 Ga0105248_10138686 3300009177 Bacteria 2743
259 Ga0105248_10261284 3300009177 Bacteria 1949
260 Ga0105237_10022562 3300009545 Bacteria 6457
261 Ga0105237_10031468 3300009545 Bacteria 5380
262 Ga0105237_10076730 3300009545 Bacteria 3332
263 Ga0105237_10231164 3300009545 Bacteria 1850
264 Ga0105238_10000635 3300009551 Bacteria 37013
265 Ga0105238_10017459 3300009551 Bacteria 7293
266 Ga0105238_10060106 3300009551 Bacteria 3806
267 Ga0105238_10064670 3300009551 Bacteria 3657
268 Ga0105238_10067857 3300009551 Bacteria 3567
269 Ga0105249_10032997 3300009553 Bacteria 4686
270 Ga0105249_10055655 3300009553 Bacteria 3620
271 Ga0105239_10002713 3300010375 Bacteria 22271
272 Ga0105239_10029098 3300010375 Bacteria 6073
273 Ga0105239_10030580 3300010375 Bacteria 5922
274 Ga0105239_10069943 3300010375 Bacteria 3855
275 Ga0105239_10105811 3300010375 Bacteria 3116
276 Ga0105246_10016520 3300011119 Bacteria 4674
277 Ga0157370_10000137 3300013104 Bacteria 88336
278 Ga0157370_10058522 3300013104 Bacteria 3663
279 Ga0157370_10179396 3300013104 Bacteria 1968
280 Ga0157369_10001369 3300013105 Bacteria 30048
281 Ga0157369_10001777 3300013105 Bacteria 26103
282 Ga0157369_10023951 3300013105 Bacteria 6793
283 Ga0157369_10097222 3300013105 Bacteria 3141
284 Ga0157374_10000659 3300013296 Bacteria 30341
285 Ga0157374_10007218 3300013296 Bacteria 9465
286 Ga0157374_10011444 3300013296 Bacteria 7682
287 Ga0157374_10014732 3300013296 Bacteria 6848
288 Ga0157374_10015360 3300013296 Bacteria 6714
289 Ga0157374_10021536 3300013296 Bacteria 5738
290 Ga0157374_10041913 3300013296 Bacteria 4221
291 Ga0157374_10112524 3300013296 Bacteria 2619
292 Ga0157378_10000217 3300013297 Bacteria 55710
293 Ga0157378_10000368 3300013297 Bacteria 44566
294 Ga0157378_10009309 3300013297 Bacteria 8557
295 Ga0157378_10105385 3300013297 Bacteria 2578
296 Ga0157378_10142141 3300013297 Bacteria 2229
297 Ga0163162_10003509 3300013306 Bacteria 14999
298 Ga0163162_10010248 3300013306 Bacteria 9105
299 Ga0163162_10013499 3300013306 Bacteria 7974
300 Ga0163162_10044186 3300013306 Bacteria 4462
301 Ga0163162_10050679 3300013306 Bacteria 4163
302 Ga0163162_10194436 3300013306 Bacteria 2157
303 Ga0163162_10253473 3300013306 Bacteria 1892
304 Ga0163162_10328964 3300013306 Bacteria 1661
305 Ga0157372_10000134 3300013307 Bacteria 81431
306 Ga0157372_10000424 3300013307 Bacteria 46469
307 Ga0157372_10005022 3300013307 Bacteria 14053
308 Ga0157372_10022198 3300013307 Bacteria 6866
309 Ga0157372_10109955 3300013307 Bacteria 3157
310 Ga0157372_10249923 3300013307 Bacteria 2058
311 Ga0157375_10001430 3300013308 Bacteria 20541
312 Ga0157375_10051835 3300013308 Bacteria 4032
313 Ga0157375_10060584 3300013308 Bacteria 3754
314 Ga0157375_10122408 3300013308 Bacteria 2713
315 Ga0157375_10129329 3300013308 Bacteria 2643
316 Ga0157375_10287886 3300013308 Bacteria 1806
317 Ga0163163_10000729 3300014325 Bacteria 27951
318 Ga0163163_10007573 3300014325 Bacteria 9591
319 Ga0163163_10026318 3300014325 Bacteria 5559
320 Ga0163163_10051412 3300014325 Bacteria 4064
321 Ga0163163_10075764 3300014325 Bacteria 3358
322 Ga0163163_10205888 3300014325 Bacteria 2016
323 Ga0157380_10023314 3300014326 Bacteria 4668
324 Ga0157377_10039805 3300014745 Bacteria 2601
325 Ga0157379_10022635 3300014968 Bacteria 5568
326 Ga0157379_10045112 3300014968 Bacteria 3935
327 Ga0157376_10021045 3300014969 Bacteria 5060
328 Ga0157376_10032863 3300014969 Bacteria 4170
329 Ga0157376_10036571 3300014969 Bacteria 3979
330 Ga0157376_10066786 3300014969 Bacteria 3041
331 Ga0157376_10067881 3300014969 Bacteria 3017
332 Ga0157376_10094775 3300014969 Bacteria 2594
333 Ga0182007_10005535 3300015262 Bacteria 5530
334 Ga0163161_10018153 3300017792 Bacteria 4931
335 Ga0213872_10001564 3300021361 Bacteria 14608
336 Ga0213872_10034060 3300021361 Bacteria 2332
337 Ga0213876_10036843 3300021384 Bacteria 2580
338 Ga0213875_10000004 3300021388 Bacteria 703388
339 Ga0213875_10000313 3300021388 Bacteria 46302
340 Ga0213875_10010292 3300021388 Bacteria 4686
341 Ga0213875_10010911 3300021388 Bacteria 4539
342 Ga0213871_10003941 3300021441 Bacteria 2918
343 Ga0224569_100108 3300022732 Bacteria 5748
344 Ga0228598_1001374 3300024227 Bacteria 5347
345 Ga0207656_10008171 3300025321 Bacteria 3841
346 Ga0207692_10027104 3300025898 Bacteria 2695
347 Ga0207642_10034805 3300025899 Bacteria 2145
348 Ga0207680_10008418 3300025903 Bacteria 5063
349 Ga0207680_10017582 3300025903 Bacteria 3781
350 Ga0207680_10041434 3300025903 Bacteria 2686
351 Ga0207699_10000209 3300025906 Bacteria 34945
352 Ga0207699_10126074 3300025906 Bacteria 1662
353 Ga0207643_10032617 3300025908 Bacteria 2910
354 Ga0207684_10011624 3300025910 Bacteria 7688
355 Ga0207684_10027366 3300025910 Bacteria 4859
356 Ga0207684_10029639 3300025910 Bacteria 4659
357 Ga0207684_10040107 3300025910 Bacteria 3969
358 Ga0207684_10055510 3300025910 Bacteria 3360
359 Ga0207654_10056884 3300025911 Bacteria 2271
360 Ga0207654_10082870 3300025911 Bacteria 1935
361 Ga0207707_10021854 3300025912 Bacteria 5592
362 Ga0207707_10037500 3300025912 Bacteria 4236
363 Ga0207695_10000379 3300025913 Bacteria 101331
364 Ga0207695_10003457 3300025913 Bacteria 22260
365 Ga0207695_10017528 3300025913 Bacteria 8330
366 Ga0207695_10025208 3300025913 Bacteria 6664
367 Ga0207695_10026384 3300025913 Bacteria 6484
368 Ga0207695_10027004 3300025913 Bacteria 6397
369 Ga0207695_10030031 3300025913 Bacteria 5992
370 Ga0207695_10052463 3300025913 Bacteria 4272
371 Ga0207695_10134305 3300025913 Bacteria 2429
372 Ga0207695_10275964 3300025913 Bacteria 1575
373 Ga0207671_10143354 3300025914 Bacteria 1842
374 Ga0207671_10190968 3300025914 Bacteria 1597
375 Ga0207693_10000026 3300025915 Bacteria 122717
376 Ga0207693_10062889 3300025915 Bacteria 2908
377 Ga0207693_10085307 3300025915 Bacteria 2474
378 Ga0207693_10120672 3300025915 Bacteria 2059
379 Ga0207663_10030366 3300025916 Bacteria 3188
380 Ga0207663_10050554 3300025916 Bacteria 2584
381 Ga0207663_10116911 3300025916 Bacteria 1819
382 Ga0207662_10013090 3300025918 Bacteria 4634
383 Ga0207657_10002375 3300025919 Bacteria 20365
384 Ga0207657_10168175 3300025919 Bacteria 1777
385 Ga0207652_10016109 3300025921 Bacteria 6097
386 Ga0207652_10019567 3300025921 Bacteria 5569
387 Ga0207652_10185568 3300025921 Bacteria 1870
388 Ga0207652_10285851 3300025921 Bacteria 1488
389 Ga0207646_10000037 3300025922 Bacteria 196362
390 Ga0207646_10015090 3300025922 Bacteria 7310
391 Ga0207646_10026227 3300025922 Bacteria 5320
392 Ga0207646_10116923 3300025922 Bacteria 2395
393 Ga0207646_10126089 3300025922 Bacteria 2302
394 Ga0207694_10000580 3300025924 Bacteria 33080
395 Ga0207694_10021413 3300025924 Bacteria 4899
396 Ga0207694_10032572 3300025924 Bacteria 3990
397 Ga0207694_10096202 3300025924 Bacteria 2342
398 Ga0207694_10097298 3300025924 Bacteria 2329
399 Ga0207694_10117124 3300025924 Bacteria 2124
400 Ga0207650_10020427 3300025925 Bacteria 4671
401 Ga0207659_10000323 3300025926 Bacteria 28799
402 Ga0207687_10006068 3300025927 Bacteria 7996
403 Ga0207687_10030888 3300025927 Bacteria 3616
404 Ga0207687_10036583 3300025927 Bacteria 3344
405 Ga0207687_10096892 3300025927 Bacteria 2163
406 Ga0207700_10000306 3300025928 Bacteria 28993
407 Ga0207700_10032295 3300025928 Bacteria 3732
408 Ga0207700_10098503 3300025928 Bacteria 2326
409 Ga0207664_10000087 3300025929 Bacteria 88607
410 Ga0207664_10012309 3300025929 Bacteria 6111
411 Ga0207664_10041011 3300025929 Bacteria 3604
412 Ga0207664_10127559 3300025929 Bacteria 2138
413 Ga0207644_10000680 3300025931 Bacteria 21467
414 Ga0207644_10022432 3300025931 Bacteria 4314
415 Ga0207644_10029090 3300025931 Bacteria 3830
416 Ga0207690_10054616 3300025932 Bacteria 2686
417 Ga0207706_10011869 3300025933 Bacteria 7931
418 Ga0207706_10060961 3300025933 Bacteria 3322
419 Ga0207670_10028880 3300025936 Bacteria 3527
420 Ga0207665_10007676 3300025939 Bacteria 7121
421 Ga0207665_10017617 3300025939 Bacteria 4694
422 Ga0207665_10038334 3300025939 Bacteria 3191
423 Ga0207665_10137176 3300025939 Bacteria 1742
424 Ga0207691_10002288 3300025940 Bacteria 18746
425 Ga0207691_10002504 3300025940 Bacteria 17973
426 Ga0207691_10005514 3300025940 Bacteria 12227
427 Ga0207711_10000086 3300025941 Bacteria 99422
428 Ga0207711_10000700 3300025941 Bacteria 33079
429 Ga0207711_10001388 3300025941 Bacteria 22791
430 Ga0207711_10010324 3300025941 Bacteria 7758
431 Ga0207711_10031160 3300025941 Bacteria 4500
432 Ga0207711_10046036 3300025941 Bacteria 3727
433 Ga0207711_10066709 3300025941 Bacteria 3112
434 Ga0207711_10122552 3300025941 Bacteria 2322
435 Ga0207689_10021270 3300025942 Bacteria 5454
436 Ga0207661_10000003 3300025944 Bacteria 611941
437 Ga0207661_10033901 3300025944 Bacteria 3966
438 Ga0207661_10146655 3300025944 Bacteria 2037
439 Ga0207679_10015286 3300025945 Bacteria 5067
440 Ga0207679_10049078 3300025945 Bacteria 3077
441 Ga0207679_10079496 3300025945 Bacteria 2501
442 Ga0207679_10136949 3300025945 Bacteria 1973
443 Ga0207667_10002416 3300025949 Bacteria 23398
444 Ga0207667_10004201 3300025949 Bacteria 17682
445 Ga0207667_10019621 3300025949 Bacteria 7540
446 Ga0207667_10042670 3300025949 Bacteria 4820
447 Ga0207667_10109697 3300025949 Bacteria 2846
448 Ga0207667_10117717 3300025949 Bacteria 2738
449 Ga0207667_10162015 3300025949 Bacteria 2300
450 Ga0207651_10018593 3300025960 Bacteria 4141
451 Ga0207640_10009549 3300025981 Bacteria 5435
452 Ga0207640_10068528 3300025981 Bacteria 2378
453 Ga0207658_10013308 3300025986 Bacteria 5618
454 Ga0207658_10027029 3300025986 Bacteria 4029
455 Ga0207677_10008947 3300026023 Bacteria 5617
456 Ga0207677_10084994 3300026023 Bacteria 2282
457 Ga0207703_10001176 3300026035 Bacteria 24683
458 Ga0207703_10042274 3300026035 Bacteria 3655
459 Ga0207703_10152881 3300026035 Bacteria 2014
460 Ga0207639_10002985 3300026041 Bacteria 11391
461 Ga0207639_10012613 3300026041 Bacteria 5890
462 Ga0207702_10016913 3300026078 Bacteria 6036
463 Ga0207702_10033923 3300026078 Bacteria 4265
464 Ga0207702_10045554 3300026078 Bacteria 3689
465 Ga0207702_10060335 3300026078 Bacteria 3233
466 Ga0207702_10076439 3300026078 Bacteria 2895
467 Ga0207702_10113976 3300026078 Bacteria 2409
468 Ga0207641_10008247 3300026088 Bacteria 8611
469 Ga0207641_10024896 3300026088 Bacteria 4934
470 Ga0207641_10039613 3300026088 Bacteria 3942
471 Ga0207641_10131929 3300026088 Bacteria 2244
472 Ga0207641_10223320 3300026088 Bacteria 1748
473 Ga0207641_10243380 3300026088 Bacteria 1677
474 Ga0207648_10051935 3300026089 Bacteria 3584
475 Ga0207676_10001580 3300026095 Bacteria 16746
476 Ga0207676_10007865 3300026095 Bacteria 7582
477 Ga0207676_10023619 3300026095 Bacteria 4539
478 Ga0207676_10120621 3300026095 Bacteria 2211
479 Ga0207674_10045779 3300026116 Bacteria 4497
480 Ga0207683_10031448 3300026121 Bacteria 4607
481 Ga0207683_10199904 3300026121 Bacteria 1816
482 Ga0207698_10000039 3300026142 Bacteria 101073
483 Ga0207698_10146550 3300026142 Bacteria 2043
484 Ga0209179_1000419 3300027512 Bacteria 4230
485 Ga0209588_1008548 3300027671 Bacteria 3039
486 Ga0207428_10000328 3300027907 Bacteria 61709
487 Ga0207428_10014125 3300027907 Bacteria 6952
488 Ga0207428_10017744 3300027907 Bacteria 6103
489 Ga0207428_10049822 3300027907 Bacteria 3354
490 Ga0207428_10126900 3300027907 Bacteria 1953
491 Ga0265354_1001157 3300028016 Bacteria 4025
492 Ga0265356_1000458 3300028017 Bacteria 7408
493 Ga0268266_10007530 3300028379 Bacteria 9809
494 Ga0268266_10018388 3300028379 Bacteria 5956
495 Ga0268266_10019116 3300028379 Bacteria 5834
496 Ga0268266_10032090 3300028379 Bacteria 4461
497 Ga0268265_10036808 3300028380 Bacteria 3587
498 Ga0268264_10002388 3300028381 Bacteria 16546
499 Ga0268264_10003579 3300028381 Bacteria 13380
500 Ga0268264_10009249 3300028381 Bacteria 8158
501 Ga0268264_10047817 3300028381 Bacteria 3557
502 Ga0268264_10183319 3300028381 Bacteria 1903
503 Ga0265319_1000426 3300028563 Bacteria 30400
504 Ga0265318_10000466 3300028577 Bacteria 30068
505 Ga0265318_10002124 3300028577 Bacteria 10787
506 Ga0265323_10001872 3300028653 Bacteria 9946
507 Ga0265336_10002446 3300028666 Bacteria 7654
508 Ga0265336_10003601 3300028666 Bacteria 6050
509 Ga0265338_10007828 3300028800 Bacteria 13133
510 Ga0265338_10045724 3300028800 Bacteria 4021
511 Ga0265338_10132983 3300028800 Bacteria 1961
512 Ga0265762_1003998 3300030760 Bacteria 2643
513 Ga0265760_10000014 3300031090 Bacteria 93274
514 Ga0265330_10000107 3300031235 Bacteria 69658
515 Ga0265330_10006445 3300031235 Bacteria 5801
516 Ga0265332_10006044 3300031238 Bacteria 5530
517 Ga0265332_10022224 3300031238 Bacteria 2800
518 Ga0265328_10000456 3300031239 Bacteria 19024
519 Ga0265328_10003578 3300031239 Bacteria 6851
520 Ga0265320_10000126 3300031240 Bacteria 66933
521 Ga0265320_10006467 3300031240 Bacteria 7386
522 Ga0265320_10040964 3300031240 Bacteria 2306
523 Ga0265325_10000066 3300031241 Bacteria 73035
524 Ga0265325_10000701 3300031241 Bacteria 24270
525 Ga0265325_10001419 3300031241 Bacteria 16872
526 Ga0265325_10005096 3300031241 Bacteria 8175
527 Ga0265325_10010234 3300031241 Bacteria 5442
528 Ga0265325_10010895 3300031241 Bacteria 5238
529 Ga0265329_10000274 3300031242 Bacteria 27297
530 Ga0265340_10001016 3300031247 Bacteria 15986
531 Ga0265340_10001113 3300031247 Bacteria 15346
532 Ga0265340_10006158 3300031247 Bacteria 6616
533 Ga0265340_10007209 3300031247 Bacteria 6053
534 Ga0265340_10039049 3300031247 Bacteria 2346
535 Ga0265339_10000029 3300031249 Bacteria 139089
536 Ga0265339_10000555 3300031249 Bacteria 29182
537 Ga0265339_10000921 3300031249 Bacteria 22618
538 Ga0265339_10001016 3300031249 Bacteria 21354
539 Ga0265339_10003294 3300031249 Bacteria 11307
540 Ga0265339_10036200 3300031249 Bacteria 2764
541 Ga0265331_10000025 3300031250 Bacteria 229346
542 Ga0265331_10009321 3300031250 Bacteria 5518
543 Ga0265331_10019068 3300031250 Bacteria 3546
544 Ga0265316_10000447 3300031344 Bacteria 46965
545 Ga0265316_10000784 3300031344 Bacteria 35048
546 Ga0265316_10003190 3300031344 Bacteria 16676
547 Ga0265316_10008523 3300031344 Bacteria 9504
548 Ga0265316_10010718 3300031344 Bacteria 8328
549 Ga0265316_10012698 3300031344 Bacteria 7537
550 Ga0265316_10052881 3300031344 Bacteria 3184
551 Ga0265316_10101414 3300031344 Bacteria 2187
552 Ga0265313_10001112 3300031595 Bacteria 25726
553 Ga0265313_10001195 3300031595 Bacteria 24872
554 Ga0265313_10001537 3300031595 Bacteria 21459
555 Ga0265313_10012844 3300031595 Bacteria 5082
556 Ga0265313_10023461 3300031595 Bacteria 3322
557 Ga0265314_10000195 3300031711 Bacteria 90391
558 Ga0265314_10001212 3300031711 Bacteria 29629
559 Ga0265314_10001907 3300031711 Bacteria 22286
560 Ga0265314_10029621 3300031711 Bacteria 4064
561 Ga0265314_10081880 3300031711 Bacteria 2125
562 Ga0265342_10000078 3300031712 Bacteria 105279
563 Ga0265342_10000307 3300031712 Bacteria 55504
564 Ga0265342_10000362 3300031712 Bacteria 50260
565 Ga0265342_10001748 3300031712 Bacteria 19819
566 Ga0265342_10008829 3300031712 Bacteria 7186
567 Ga0265342_10032177 3300031712 Bacteria 3236
568 Ga0265342_10040530 3300031712 Bacteria 2824
569 Ga0265342_10081202 3300031712 Bacteria 1873
570 Ga0265342_10089954 3300031712 Bacteria 1761
571 Ga0307510_10027922 3300033180 Bacteria 6455
572 Ga0373926_0018032 3300035083 Bacteria 2426
573 Ga0373936_0005113 3300035113 Bacteria 4938
574 Ga0373956_0027979 3300035119 Bacteria 2451
575 Ga0373943_0000594 3300035170 Bacteria 15714
576 Ga0373935_0002647 3300035692 Bacteria 10291
577 Ga0373927_0000747 3300035695 Bacteria 24845
578 Ga0373927_0000934 3300035695 Bacteria 22198
579 Ga0373927_0013916 3300035695 Bacteria 5337
580 Ga0373927_0020079 3300035695 Bacteria 4382
581 Ga0373927_0095626 3300035695 Bacteria 1931
582 Ga0373933_0000129 3300035724 Bacteria 47946
583 Ga0373933_0029156 3300035724 Bacteria 3189
584 Ga0373933_0039134 3300035724 Bacteria 2789
585 Ga0373947_0000971 3300035725 Bacteria 17501
586 Ga0373947_0007329 3300035725 Bacteria 6387
587 Ga0373947_0020980 3300035725 Bacteria 3779
588 Ga0373947_0037861 3300035725 Bacteria 2863
589 Ga0373937_0000015 3300036401 Bacteria 148228
590 Ga0373937_0010379 3300036401 Bacteria 8133
591 Ga0373937_0063269 3300036401 Bacteria 3403
592 Ga0373937_0083455 3300036401 Bacteria 2956
593 Ga0373937_0110752 3300036401 Bacteria 2553
594 Ga0373937_0166954 3300036401 Bacteria 2064
595 Ga0373925_0015527 3300037068 Bacteria 5509
596 Ga0373925_0019549 3300037068 Bacteria 4927
597 Ga0373925_0028771 3300037068 Bacteria 4073
598 Ga0373925_0118237 3300037068 Bacteria 2055
599 Ga0395905_0057134 3300037471 Bacteria 3650
600 Ga0436364_0177309 3300037853 Bacteria 4598
601 Ga0436364_0288437 3300037853 Bacteria 7086
602 Ga0436364_0748068 3300037853 Bacteria 528910
603 Ga0436364_0880534 3300037853 Bacteria 127762
604 Ga0436364_0895125 3300037853 Bacteria 1982
605 Ga0436364_1448794 3300037853 Bacteria 5505
606 Ga0436364_1499157 3300037853 Bacteria 5197
607 Ga0436364_1535143 3300037853 Bacteria 15848
608 Ga0436365_0343849 3300039437 Bacteria 5409
609 Ga0436365_0612444 3300039437 Bacteria 5369
610 Ga0436365_1466946 3300039437 Bacteria 2639
611 Ga0436360_1307109 3300039438 Bacteria 36883
612 Ga0436360_1314441 3300039438 Bacteria 19937
613 Ga0436361_0350897 3300039447 Bacteria 18933
614 Ga0436361_0379682 3300039447 Bacteria 5824
615 Ga0436361_0464047 3300039447 Bacteria 78853
616 Ga0436363_0100069 3300039450 Bacteria 1900
617 Ga0451577_0044266 3300042876 Bacteria 3985
618 Ga0453683_0042654 3300044673 Bacteria 2848
619 Ga0466963_0117463 3300044694 Bacteria 1828
620 Ga0453684_0000397 3300044712 Bacteria 179262
621 Ga0451576_0013704 3300045051 Bacteria 9056
622 Ga0451576_0100191 3300045051 Bacteria 3013
623 Ga0466967_0135452 3300045976 Bacteria 2290
624 Ga0495592_0004333 3300046454 Bacteria 10382
625 Ga0495592_0007581 3300046454 Bacteria 8126
626 Ga0495592_0079214 3300046454 Bacteria 2378
627 Ga0495603_0047299 3300046455 Bacteria 2562
628 Ga0495629_0011385 3300046459 Bacteria 6461
629 Ga0495629_0044354 3300046459 Bacteria 3121
630 Ga0495629_0063849 3300046459 Bacteria 2571
631 Ga0495629_0082179 3300046459 Bacteria 2248
632 Ga0495651_0000269 3300046462 Bacteria 40351
633 Ga0495651_0006179 3300046462 Bacteria 9147
634 Ga0495651_0006705 3300046462 Bacteria 8801
635 Ga0495651_0029939 3300046462 Bacteria 4245
636 Ga0495651_0080881 3300046462 Bacteria 2453
637 Ga0495653_0007181 3300046463 Bacteria 9131
638 Ga0495653_0010352 3300046463 Bacteria 7627
639 Ga0495650_0000010 3300046471 Bacteria 645599
640 Ga0495580_0001289 3300046472 Bacteria 22103
641 Ga0495580_0004497 3300046472 Bacteria 11712
642 Ga0495580_0004544 3300046472 Bacteria 11653
643 Ga0495580_0005237 3300046472 Bacteria 10776
644 Ga0495580_0009412 3300046472 Bacteria 7686
645 Ga0495580_0017276 3300046472 Bacteria 5400
646 Ga0495580_0025378 3300046472 Bacteria 4332
647 Ga0495580_0026686 3300046472 Bacteria 4208
648 Ga0495580_0046103 3300046472 Bacteria 3095
649 Ga0495580_0048974 3300046472 Bacteria 2990
650 Ga0495582_0000706 3300046473 Bacteria 18439
651 Ga0495582_0002662 3300046473 Bacteria 9966
652 Ga0495582_0008306 3300046473 Bacteria 5731
653 Ga0495582_0017131 3300046473 Bacteria 3966
654 Ga0495639_0011597 3300046475 Bacteria 3803
655 Ga0495662_0007670 3300046476 Bacteria 5318
656 Ga0495662_0053847 3300046476 Bacteria 1943
657 Ga0495664_0007875 3300046477 Bacteria 5931
658 Ga0495664_0016909 3300046477 Bacteria 4164
659 Ga0495594_0032020 3300046499 Bacteria 2852
660 Ga0495606_0038902 3300046507 Bacteria 3213
661 Ga0495608_0038397 3300046511 Bacteria 3216
662 Ga0495628_0001626 3300046516 Bacteria 20577
663 Ga0495628_0021843 3300046516 Bacteria 5260
664 Ga0495628_0048485 3300046516 Bacteria 3367
665 Ga0495630_0065793 3300046517 Bacteria 2724
666 Ga0495644_0000350 3300046523 Bacteria 20849
667 Ga0495652_0002034 3300046529 Bacteria 21479
668 Ga0495652_0071196 3300046529 Bacteria 2904
669 Ga0495652_0079728 3300046529 Bacteria 2706
670 Ga0495665_0000288 3300046531 Bacteria 25561
671 Ga0495665_0048691 3300046531 Bacteria 2247
672 Ga0495640_0033523 3300046533 Bacteria 3647
673 Ga0495586_0046721 3300046535 Bacteria 2335
674 Ga0495587_0000081 3300046536 Bacteria 74942
675 Ga0495587_0010143 3300046536 Bacteria 6009
676 Ga0495587_0065985 3300046536 Bacteria 2112
677 Ga0495587_0093025 3300046536 Bacteria 1741
678 Ga0495645_0005411 3300046543 Bacteria 8757
679 Ga0495645_0047065 3300046543 Bacteria 3143
680 Ga0495645_0063109 3300046543 Bacteria 2683
681 Ga0495667_0000465 3300046559 Bacteria 25809
682 Ga0495667_0000598 3300046559 Bacteria 22976
683 Ga0495667_0004027 3300046559 Bacteria 9878
684 Ga0495667_0004030 3300046559 Bacteria 9875
685 Ga0495667_0032624 3300046559 Bacteria 3489
686 Ga0495668_0022228 3300046616 Bacteria 3627
687 Ga0495634_0004373 3300046642 Bacteria 11123
688 Ga0495634_0027186 3300046642 Bacteria 3981
689 Ga0495634_0065842 3300046642 Bacteria 2400
690 Ga0495625_0035758 3300046660 Bacteria 3658
691 Ga0495635_0026072 3300046663 Bacteria 4070
692 Ga0495635_0068704 3300046663 Bacteria 2430
693 Ga0495659_0002458 3300046664 Bacteria 5983
694 Ga0495657_0001605 3300046675 Bacteria 19438
695 Ga0495657_0019966 3300046675 Bacteria 4826
696 Ga0495657_0026775 3300046675 Bacteria 4080
697 Ga0495599_0005464 3300046678 Bacteria 7600
698 Ga0495599_0013062 3300046678 Bacteria 5127
699 Ga0495599_0050103 3300046678 Bacteria 2617
700 Ga0495599_0053415 3300046678 Bacteria 2531
701 Ga0495623_0012532 3300046679 Bacteria 5485
702 Ga0495623_0018844 3300046679 Bacteria 4456
703 Ga0495623_0023174 3300046679 Bacteria 4007
704 Ga0495646_0048952 3300046680 Bacteria 2566
705 Ga0495658_0011190 3300046683 Bacteria 4505
706 Ga0495669_0017547 3300046684 Bacteria 3072
707 Ga0495613_0005267 3300046689 Bacteria 9714
708 Ga0495613_0014721 3300046689 Bacteria 5805
709 Ga0495624_0008050 3300046690 Bacteria 7383
710 Ga0495624_0058452 3300046690 Bacteria 2421
711 Ga0495600_0002044 3300046809 Bacteria 11367
712 Ga0495600_0003665 3300046809 Bacteria 9069
713 Ga0495600_0076059 3300046809 Bacteria 2192
714 Ga0495581_0005319 3300047315 Bacteria 7447
715 Ga0495581_0016892 3300047315 Bacteria 4241
716 Ga0495581_0086809 3300047315 Bacteria 1814
717 Ga0495604_0000736 3300047317 Bacteria 27505
718 Ga0495604_0022691 3300047317 Bacteria 5011
719 Ga0495604_0072850 3300047317 Bacteria 2595
720 Ga0495636_0016157 3300047318 Bacteria 2979
721 Ga0495674_0006123 3300047319 Bacteria 11552
722 Ga0495674_0047949 3300047319 Bacteria 3784
723 Ga0495674_0117468 3300047319 Bacteria 2250
724 Ga0495674_0168743 3300047319 Bacteria 1827
725 Ga0495672_0082865 3300047320 Bacteria 1783
726 Ga0495676_0021782 3300047321 Bacteria 5589
727 Ga0495676_0044034 3300047321 Bacteria 3647
728 Ga0495680_0000041 3300047322 Bacteria 99386
729 Ga0495680_0082475 3300047322 Bacteria 2426
730 Ga0495675_0000349 3300047444 Bacteria 32511
731 Ga0495675_0001165 3300047444 Bacteria 15958
732 Ga0495675_0001405 3300047444 Bacteria 14584
733 Ga0495675_0049625 3300047444 Bacteria 2667
734 Ga0495684_0000521 3300047471 Bacteria 31227
735 Ga0495684_0001787 3300047471 Bacteria 17259
736 Ga0495684_0035646 3300047471 Bacteria 3814
737 Ga0495684_0040591 3300047471 Bacteria 3567
738 Ga0495686_0000027 3300047472 Bacteria 382657
739 Ga0495686_0008767 3300047472 Bacteria 7371
740 Ga0495602_0000101 3300048088 Bacteria 81181
741 Ga0495602_0019378 3300048088 Bacteria 6756
742 Ga0495602_0038136 3300048088 Bacteria 4449
743 Ga0495602_0087148 3300048088 Bacteria 2604
744 Ga0495602_0179256 3300048088 Bacteria 1636
745 Ga0495614_0001042 3300048089 Bacteria 11847
746 Ga0496104_0000127 3300048907 Bacteria 70210
747 Ga0496104_0126993 3300048907 Bacteria 2449
748 Ga0496104_0130612 3300048907 Bacteria 2413
749 Ga0496104_0273838 3300048907 Bacteria 1601
750 Ga0496105_0125334 3300048908 Bacteria 2117
751 Ga0496106_0066069 3300048909 Bacteria 2754
752 Ga0496106_0136959 3300048909 Bacteria 1924
753 Ga0496112_0057421 3300048915 Bacteria 3832
754 Ga0496112_0089113 3300048915 Bacteria 3053
755 Ga0496115_0012549 3300048918 Bacteria 6383
756 Ga0496115_0148198 3300048918 Bacteria 1937
757 Ga0496115_0149101 3300048918 Bacteria 1931
758 Ga0496126_0002651 3300048929 Bacteria 23706
759 Ga0496126_0037039 3300048929 Bacteria 4556
760 Ga0501031_0004063 3300049568 Bacteria 9437
761 Ga0501032_0001455 3300049569 Bacteria 18825
762 Ga0501036_0000255 3300049572 Bacteria 36165
763 Ga0501038_0013708 3300049574 Bacteria 7389
764 Ga0501039_0022459 3300049575 Bacteria 4843
765 Ga0501043_0071340 3300049579 Bacteria 2728
766 Ga0501046_0013244 3300049580 Bacteria 6988
767 Ga0501047_0011142 3300049581 Bacteria 8509
768 Ga0501047_0014185 3300049581 Bacteria 7574
769 Ga0501048_0009515 3300049582 Bacteria 7294
770 Ga0501067_0002621 3300049583 Bacteria 9957
771 Ga0501068_0004334 3300049584 Bacteria 7714
772 Ga0501069_0000224 3300049585 Bacteria 25263
773 Ga0501070_0023337 3300049586 Bacteria 5182
774 Ga0501072_0053330 3300049588 Bacteria 3184
775 Ga0501073_0127128 3300049589 Bacteria 1766
776 Ga0501074_0023820 3300049590 Bacteria 4450
777 Ga0501076_0033461 3300049592 Bacteria 4013
778 Ga0501077_0019257 3300049593 Bacteria 4316
779 Ga0501079_0005002 3300049741 Bacteria 9829
780 Ga0501080_0000961 3300049742 Bacteria 23597
781 Ga0501035_0151531 3300049822 Bacteria 2012
782 Ga0501044_0000216 3300049823 Bacteria 73383
783 Ga0501044_0035476 3300049823 Bacteria 5222
784 nmdc:mga0k408_2781_c1 3300050493 Bacteria 9306
785 nmdc:mga06z11_2467_c1 3300050494 Bacteria 7069
786 nmdc:mga05p37_1967_c1 3300050507 Bacteria 23970
787 nmdc:mga05p37_333532_c1 3300050507 Bacteria 1791
788 nmdc:mga09592_38331_c1 3300050508 Bacteria 4023
789 nmdc:mga09592_61815_c1 3300050508 Bacteria 3168
790 nmdc:mga09592_97438_c1 3300050508 Bacteria 2517
791 nmdc:mga0qj67_24639_c1 3300050509 Bacteria 4139
792 nmdc:mga06r32_167709_c1 3300050510 Bacteria 2179
793 nmdc:mga08y16_128789_c1 3300050511 Bacteria 2633
794 nmdc:mga08y16_133358_c1 3300050511 Bacteria 2582
795 nmdc:mga08y16_1357_c1 3300050511 Bacteria 24450
796 nmdc:mga08y16_138199_c1 3300050511 Bacteria 2533
797 nmdc:mga08y16_20326_c1 3300050511 Bacteria 7009
798 nmdc:mga08y16_30012_c1 3300050511 Bacteria 5725
799 nmdc:mga08y16_38313_c1 3300050511 Bacteria 5035
800 nmdc:mga08y16_9411_c1 3300050511 Bacteria 10247
801 nmdc:mga0n895_125489_c1 3300050512 Bacteria 2590
802 nmdc:mga0n895_17754_c1 3300050512 Bacteria 6566
803 nmdc:mga0n895_30674_c1 3300050512 Bacteria 5140
804 nmdc:mga0rr50_30299_c1 3300050513 Bacteria 3829
805 nmdc:mga08x19_2984_c1 3300050514 Bacteria 10168
806 nmdc:mga0a205_172227_c1 3300050515 Bacteria 2060
807 nmdc:mga0a205_18616_c1 3300050515 Bacteria 6533
808 nmdc:mga0a205_18636_c1 3300050515 Bacteria 6530
809 nmdc:mga0a205_28589_c1 3300050515 Bacteria 5331
810 nmdc:mga0a205_83518_c1 3300050515 Bacteria 3085
811 nmdc:mga0a205_91204_c1 3300050515 Bacteria 2944
812 Ga0495601_0006486 3300053077 Bacteria 6844
813 Ga0500651_0000002 3300053093 Bacteria 476609
814 Ga0500595_000014 3300053119 Bacteria 247996
815 Ga0501084_0000854 3300054114 Bacteria 23555
816 Ga0501082_0018177 3300060353 Bacteria 6053
817 Ga0501082_0096290 3300060353 Bacteria 2559
818 Ga0530510_0006805 3300061734 Bacteria 7965

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048908 Ga0496105_0125334 Ga0496105_0125334_10_1359 429
2 3300039447 Ga0436361_0379682 Ga0436361_0379682_25_1479 463
3 3300046472 Ga0495580_0009412 Ga0495580_0009412_127_1635 470
4 3300005440 Ga0070705_100047339 Ga0070705_1000473391 475
5 3300005445 Ga0070708_100012412 Ga0070708_1000124122 476
6 3300006844 Ga0075428_100132027 Ga0075428_1001320271 476
7 3300031344 Ga0265316_10008523 Ga0265316_100085232 477
8 3300005546 Ga0070696_100006664 Ga0070696_1000066648 480
9 3300005842 Ga0068858_100014966 Ga0068858_1000149666 480
10 3300006852 Ga0075433_10015741 Ga0075433_100157414 480
11 3300006871 Ga0075434_100008203 Ga0075434_1000082038 480
12 3300009177 Ga0105248_10003639 Ga0105248_1000363913 480
13 3300014968 Ga0157379_10022635 Ga0157379_100226354 480
14 3300025908 Ga0207643_10032617 Ga0207643_100326172 480
15 3300025916 Ga0207663_10050554 Ga0207663_100505543 480
16 3300025936 Ga0207670_10028880 Ga0207670_100288802 480
17 3300025939 Ga0207665_10038334 Ga0207665_100383343 480
18 3300025941 Ga0207711_10031160 Ga0207711_100311602 480
19 3300026035 Ga0207703_10001176 Ga0207703_100011765 480
20 3300027907 Ga0207428_10049822 Ga0207428_100498224 480
21 3300042876 Ga0451577_0044266 Ga0451577_0044266_1209_2729 480
22 3300045051 Ga0451576_0013704 Ga0451576_0013704_465_1985 480
23 3300046473 Ga0495582_0017131 Ga0495582_0017131_1583_3103 480
24 3300046664 Ga0495659_0002458 Ga0495659_0002458_3775_5301 480
25 3300050511 nmdc:mga08y16_9411_c1 nmdc:mga08y16_9411_c1_1832_3352 480
26 3300050515 nmdc:mga0a205_18636_c1 nmdc:mga0a205_18636_c1_4351_5883 480
27 3300006852 Ga0075433_10089230 Ga0075433_100892302 482
28 3300007076 Ga0075435_100009419 Ga0075435_1000094192 482
29 3300009094 Ga0111539_10009382 Ga0111539_100093826 482
30 3300009094 Ga0111539_10219191 Ga0111539_102191912 482
31 3300009147 Ga0114129_10008706 Ga0114129_1000870610 482
32 3300027907 Ga0207428_10017744 Ga0207428_100177443 482
33 3300035725 Ga0373947_0020980 Ga0373947_0020980_224_1705 482
34 3300036401 Ga0373937_0166954 Ga0373937_0166954_368_1849 482
35 3300050511 nmdc:mga08y16_38313_c1 nmdc:mga08y16_38313_c1_2762_4234 482
36 3300050512 nmdc:mga0n895_125489_c1 nmdc:mga0n895_125489_c1_223_1695 482
37 3300050513 nmdc:mga0rr50_30299_c1 nmdc:mga0rr50_30299_c1_1324_2796 482
38 3300050515 nmdc:mga0a205_28589_c1 nmdc:mga0a205_28589_c1_3784_5256 482
39 3300005406 Ga0070703_10009229 Ga0070703_100092291 483
40 3300005435 Ga0070714_100001908 Ga0070714_10000190813 483
41 3300005436 Ga0070713_100011727 Ga0070713_1000117277 483
42 3300005440 Ga0070705_100049561 Ga0070705_1000495612 483
43 3300005444 Ga0070694_100012714 Ga0070694_1000127142 483
44 3300005445 Ga0070708_100000805 Ga0070708_10000080519 483
45 3300005518 Ga0070699_100015903 Ga0070699_1000159034 483
46 3300005536 Ga0070697_100001847 Ga0070697_1000018475 483
47 3300005536 Ga0070697_100033249 Ga0070697_1000332492 483
48 3300005545 Ga0070695_100010421 Ga0070695_1000104212 483
49 3300005546 Ga0070696_100002464 Ga0070696_1000024647 483
50 3300005547 Ga0070693_100000037 Ga0070693_10000003733 483
51 3300005841 Ga0068863_100138445 Ga0068863_1001384452 483
52 3300005843 Ga0068860_100002369 Ga0068860_10000236910 483
53 3300006028 Ga0070717_10002621 Ga0070717_100026215 483
54 3300006871 Ga0075434_100003909 Ga0075434_1000039092 483
55 3300009094 Ga0111539_10004140 Ga0111539_1000414010 483
56 3300009098 Ga0105245_10126779 Ga0105245_101267792 483
57 3300009177 Ga0105248_10261284 Ga0105248_102612842 483
58 3300009553 Ga0105249_10055655 Ga0105249_100556553 483
59 3300013296 Ga0157374_10041913 Ga0157374_100419132 483
60 3300013297 Ga0157378_10000368 Ga0157378_100003687 483
61 3300013297 Ga0157378_10009309 Ga0157378_1000930910 483
62 3300013306 Ga0163162_10050679 Ga0163162_100506793 483
63 3300013306 Ga0163162_10194436 Ga0163162_101944362 483
64 3300013308 Ga0157375_10122408 Ga0157375_101224082 483
65 3300013308 Ga0157375_10129329 Ga0157375_101293292 483
66 3300014326 Ga0157380_10023314 Ga0157380_100233142 483
67 3300014745 Ga0157377_10039805 Ga0157377_100398052 483
68 3300021384 Ga0213876_10036843 Ga0213876_100368433 483
69 3300025910 Ga0207684_10027366 Ga0207684_100273664 483
70 3300025916 Ga0207663_10030366 Ga0207663_100303662 483
71 3300025921 Ga0207652_10016109 Ga0207652_100161092 483
72 3300025922 Ga0207646_10026227 Ga0207646_100262275 483
73 3300025922 Ga0207646_10126089 Ga0207646_101260891 483
74 3300025928 Ga0207700_10032295 Ga0207700_100322952 483
75 3300025929 Ga0207664_10012309 Ga0207664_100123092 483
76 3300026088 Ga0207641_10243380 Ga0207641_102433801 483
77 3300028016 Ga0265354_1001157 Ga0265354_10011572 483
78 3300028381 Ga0268264_10002388 Ga0268264_100023889 483
79 3300028563 Ga0265319_1000426 Ga0265319_100042632 483
80 3300028577 Ga0265318_10000466 Ga0265318_100004665 483
81 3300028800 Ga0265338_10132983 Ga0265338_101329832 483
82 3300031240 Ga0265320_10000126 Ga0265320_1000012631 483
83 3300031242 Ga0265329_10000274 Ga0265329_1000027435 483
84 3300031247 Ga0265340_10001016 Ga0265340_1000101610 483
85 3300031249 Ga0265339_10001016 Ga0265339_1000101616 483
86 3300031249 Ga0265339_10003294 Ga0265339_100032941 483
87 3300031250 Ga0265331_10000025 Ga0265331_10000025175 483
88 3300031250 Ga0265331_10009321 Ga0265331_100093213 483
89 3300031344 Ga0265316_10000784 Ga0265316_100007842 483
90 3300031595 Ga0265313_10001537 Ga0265313_1000153713 483
91 3300031711 Ga0265314_10001212 Ga0265314_1000121213 483
92 3300031711 Ga0265314_10029621 Ga0265314_100296213 483
93 3300031712 Ga0265342_10000362 Ga0265342_1000036245 483
94 3300031712 Ga0265342_10008829 Ga0265342_100088293 483
95 3300035695 Ga0373927_0000934 Ga0373927_0000934_1403_2866 483
96 3300035695 Ga0373927_0095626 Ga0373927_0095626_418_1881 483
97 3300037853 Ga0436364_0177309 Ga0436364_0177309_2078_3529 483
98 3300037853 Ga0436364_1499157 Ga0436364_1499157_41_1510 483
99 3300046454 Ga0495592_0004333 Ga0495592_0004333_1105_2568 483
100 3300046455 Ga0495603_0047299 Ga0495603_0047299_359_1822 483
101 3300046462 Ga0495651_0000269 Ga0495651_0000269_17213_18676 483
102 3300046462 Ga0495651_0006179 Ga0495651_0006179_261_1724 483
103 3300046462 Ga0495651_0029939 Ga0495651_0029939_723_2186 483
104 3300046463 Ga0495653_0007181 Ga0495653_0007181_2616_4079 483
105 3300046472 Ga0495580_0026686 Ga0495580_0026686_277_1740 483
106 3300046473 Ga0495582_0008306 Ga0495582_0008306_560_2023 483
107 3300046475 Ga0495639_0011597 Ga0495639_0011597_779_2242 483
108 3300046476 Ga0495662_0053847 Ga0495662_0053847_359_1822 483
109 3300046499 Ga0495594_0032020 Ga0495594_0032020_359_1822 483
110 3300046511 Ga0495608_0038397 Ga0495608_0038397_488_1951 483
111 3300046516 Ga0495628_0001626 Ga0495628_0001626_10471_11934 483
112 3300046516 Ga0495628_0021843 Ga0495628_0021843_1541_3004 483
113 3300046516 Ga0495628_0048485 Ga0495628_0048485_605_2074 483
114 3300046517 Ga0495630_0065793 Ga0495630_0065793_44_1507 483
115 3300046529 Ga0495652_0002034 Ga0495652_0002034_13265_14728 483
116 3300046533 Ga0495640_0033523 Ga0495640_0033523_734_2197 483
117 3300046536 Ga0495587_0010143 Ga0495587_0010143_3398_4861 483
118 3300046536 Ga0495587_0065985 Ga0495587_0065985_139_1602 483
119 3300046536 Ga0495587_0093025 Ga0495587_0093025_261_1724 483
120 3300046543 Ga0495645_0047065 Ga0495645_0047065_261_1724 483
121 3300046543 Ga0495645_0063109 Ga0495645_0063109_1198_2661 483
122 3300046559 Ga0495667_0000598 Ga0495667_0000598_15763_17226 483
123 3300046559 Ga0495667_0004027 Ga0495667_0004027_6667_8130 483
124 3300046642 Ga0495634_0065842 Ga0495634_0065842_233_1696 483
125 3300046663 Ga0495635_0026072 Ga0495635_0026072_2196_3659 483
126 3300046675 Ga0495657_0019966 Ga0495657_0019966_1896_3359 483
127 3300046675 Ga0495657_0026775 Ga0495657_0026775_463_1926 483
128 3300046678 Ga0495599_0005464 Ga0495599_0005464_5199_6662 483
129 3300046679 Ga0495623_0012532 Ga0495623_0012532_504_1967 483
130 3300046684 Ga0495669_0017547 Ga0495669_0017547_1025_2485 483
131 3300046690 Ga0495624_0058452 Ga0495624_0058452_879_2342 483
132 3300046809 Ga0495600_0002044 Ga0495600_0002044_5036_6499 483
133 3300046809 Ga0495600_0076059 Ga0495600_0076059_133_1596 483
134 3300047315 Ga0495581_0016892 Ga0495581_0016892_1729_3192 483
135 3300047317 Ga0495604_0000736 Ga0495604_0000736_16640_18103 483
136 3300047317 Ga0495604_0072850 Ga0495604_0072850_886_2349 483
137 3300047319 Ga0495674_0006123 Ga0495674_0006123_2544_4007 483
138 3300047319 Ga0495674_0168743 Ga0495674_0168743_177_1640 483
139 3300047321 Ga0495676_0044034 Ga0495676_0044034_871_2334 483
140 3300047322 Ga0495680_0000041 Ga0495680_0000041_54018_55481 483
141 3300047444 Ga0495675_0000349 Ga0495675_0000349_17890_19353 483
142 3300047471 Ga0495684_0000521 Ga0495684_0000521_10796_12259 483
143 3300047471 Ga0495684_0001787 Ga0495684_0001787_573_2036 483
144 3300048088 Ga0495602_0019378 Ga0495602_0019378_2924_4387 483
145 3300048088 Ga0495602_0038136 Ga0495602_0038136_2623_4086 483
146 3300048909 Ga0496106_0066069 Ga0496106_0066069_331_1806 483
147 3300050493 nmdc:mga0k408_2781_c1 nmdc:mga0k408_2781_c1_7698_9158 483
148 3300050494 nmdc:mga06z11_2467_c1 nmdc:mga06z11_2467_c1_4731_6191 483
149 3300050508 nmdc:mga09592_38331_c1 nmdc:mga09592_38331_c1_525_1985 483
150 3300050511 nmdc:mga08y16_1357_c1 nmdc:mga08y16_1357_c1_16896_18356 483
151 3300050512 nmdc:mga0n895_30674_c1 nmdc:mga0n895_30674_c1_397_1860 483
152 3300053077 Ga0495601_0006486 Ga0495601_0006486_1185_2654 483
153 3300005328 Ga0070676_10051548 Ga0070676_100515482 484
154 3300005329 Ga0070683_100000002 Ga0070683_100000002199 484
155 3300005329 Ga0070683_100078429 Ga0070683_1000784292 484
156 3300005335 Ga0070666_10017503 Ga0070666_100175033 484
157 3300005335 Ga0070666_10041327 Ga0070666_100413272 484
158 3300005338 Ga0068868_100066500 Ga0068868_1000665002 484
159 3300005338 Ga0068868_100067628 Ga0068868_1000676282 484
160 3300005339 Ga0070660_100115767 Ga0070660_1001157672 484
161 3300005343 Ga0070687_100054056 Ga0070687_1000540562 484
162 3300005344 Ga0070661_100054741 Ga0070661_1000547412 484
163 3300005354 Ga0070675_100003550 Ga0070675_1000035502 484
164 3300005354 Ga0070675_100020001 Ga0070675_1000200014 484
165 3300005354 Ga0070675_100055347 Ga0070675_1000553471 484
166 3300005355 Ga0070671_100015148 Ga0070671_1000151482 484
167 3300005356 Ga0070674_100012266 Ga0070674_1000122663 484
168 3300005364 Ga0070673_100098684 Ga0070673_1000986842 484
169 3300005365 Ga0070688_100038813 Ga0070688_1000388133 484
170 3300005366 Ga0070659_100016010 Ga0070659_1000160102 484
171 3300005367 Ga0070667_100004263 Ga0070667_1000042637 484
172 3300005367 Ga0070667_100015915 Ga0070667_1000159156 484
173 3300005436 Ga0070713_100103287 Ga0070713_1001032872 484
174 3300005438 Ga0070701_10007710 Ga0070701_100077102 484
175 3300005445 Ga0070708_100003971 Ga0070708_1000039712 484
176 3300005457 Ga0070662_100056115 Ga0070662_1000561152 484
177 3300005458 Ga0070681_10092236 Ga0070681_100922363 484
178 3300005466 Ga0070685_10019908 Ga0070685_100199081 484
179 3300005467 Ga0070706_100245321 Ga0070706_1002453211 484
180 3300005468 Ga0070707_100000221 Ga0070707_10000022122 484
181 3300005471 Ga0070698_100023905 Ga0070698_1000239052 484
182 3300005518 Ga0070699_100018350 Ga0070699_1000183503 484
183 3300005530 Ga0070679_100009883 Ga0070679_1000098832 484
184 3300005535 Ga0070684_100000007 Ga0070684_100000007199 484
185 3300005539 Ga0068853_100022773 Ga0068853_1000227733 484
186 3300005543 Ga0070672_100101299 Ga0070672_1001012992 484
187 3300005544 Ga0070686_100032737 Ga0070686_1000327373 484
188 3300005548 Ga0070665_100028376 Ga0070665_1000283762 484
189 3300005563 Ga0068855_100002278 Ga0068855_10000227810 484
190 3300005563 Ga0068855_100085072 Ga0068855_1000850724 484
191 3300005564 Ga0070664_100104305 Ga0070664_1001043052 484
192 3300005577 Ga0068857_100009230 Ga0068857_1000092309 484
193 3300005577 Ga0068857_100040887 Ga0068857_1000408875 484
194 3300005614 Ga0068856_100014834 Ga0068856_1000148342 484
195 3300005614 Ga0068856_100014853 Ga0068856_1000148538 484
196 3300005614 Ga0068856_100042132 Ga0068856_1000421323 484
197 3300005614 Ga0068856_100043286 Ga0068856_1000432862 484
198 3300005617 Ga0068859_100033639 Ga0068859_1000336393 484
199 3300005617 Ga0068859_100077042 Ga0068859_1000770422 484
200 3300005617 Ga0068859_100100435 Ga0068859_1001004355 484
201 3300005617 Ga0068859_100120349 Ga0068859_1001203492 484
202 3300005618 Ga0068864_100003645 Ga0068864_1000036452 484
203 3300005618 Ga0068864_100004251 Ga0068864_1000042516 484
204 3300005618 Ga0068864_100135900 Ga0068864_1001359002 484
205 3300005841 Ga0068863_100030408 Ga0068863_1000304083 484
206 3300005841 Ga0068863_100067932 Ga0068863_1000679323 484
207 3300005842 Ga0068858_100003482 Ga0068858_1000034826 484
208 3300005842 Ga0068858_100004396 Ga0068858_10000439610 484
209 3300005842 Ga0068858_100026791 Ga0068858_1000267912 484
210 3300005842 Ga0068858_100031600 Ga0068858_1000316005 484
211 3300005843 Ga0068860_100011406 Ga0068860_1000114069 484
212 3300005843 Ga0068860_100023431 Ga0068860_1000234312 484
213 3300005937 Ga0081455_10000246 Ga0081455_1000024635 484
214 3300005937 Ga0081455_10013820 Ga0081455_100138205 484
215 3300005937 Ga0081455_10047850 Ga0081455_100478502 484
216 3300005981 Ga0081538_10000663 Ga0081538_1000066310 484
217 3300005981 Ga0081538_10001749 Ga0081538_100017498 484
218 3300005981 Ga0081538_10006844 Ga0081538_100068442 484
219 3300005983 Ga0081540_1016962 Ga0081540_10169622 484
220 3300006028 Ga0070717_10045959 Ga0070717_100459591 484
221 3300006028 Ga0070717_10193400 Ga0070717_101934003 484
222 3300006038 Ga0075365_10021836 Ga0075365_100218362 484
223 3300006051 Ga0075364_10005747 Ga0075364_100057472 484
224 3300006175 Ga0070712_100137108 Ga0070712_1001371081 484
225 3300006178 Ga0075367_10009184 Ga0075367_100091842 484
226 3300006195 Ga0075366_10001249 Ga0075366_100012498 484
227 3300006237 Ga0097621_100004652 Ga0097621_1000046525 484
228 3300006237 Ga0097621_100020172 Ga0097621_1000201723 484
229 3300006237 Ga0097621_100024268 Ga0097621_1000242684 484
230 3300006237 Ga0097621_100036253 Ga0097621_1000362533 484
231 3300006237 Ga0097621_100111216 Ga0097621_1001112161 484
232 3300006358 Ga0068871_100014111 Ga0068871_1000141114 484
233 3300006358 Ga0068871_100030778 Ga0068871_1000307783 484
234 3300006358 Ga0068871_100039111 Ga0068871_1000391112 484
235 3300006358 Ga0068871_100078857 Ga0068871_1000788572 484
236 3300006844 Ga0075428_100003081 Ga0075428_1000030818 484
237 3300006844 Ga0075428_100357777 Ga0075428_1003577771 484
238 3300006847 Ga0075431_100005846 Ga0075431_1000058462 484
239 3300006847 Ga0075431_100109414 Ga0075431_1001094142 484
240 3300006852 Ga0075433_10082186 Ga0075433_100821862 484
241 3300006852 Ga0075433_10209197 Ga0075433_102091971 484
242 3300006871 Ga0075434_100033223 Ga0075434_1000332232 484
243 3300006880 Ga0075429_100024549 Ga0075429_1000245492 484
244 3300006881 Ga0068865_100007218 Ga0068865_1000072182 484
245 3300006931 Ga0097620_100033641 Ga0097620_1000336413 484
246 3300006931 Ga0097620_100077030 Ga0097620_1000770303 484
247 3300006931 Ga0097620_100100428 Ga0097620_1001004281 484
248 3300006931 Ga0097620_100120348 Ga0097620_1001203482 484
249 3300007788 Ga0099795_10031829 Ga0099795_100318291 484
250 3300009093 Ga0105240_10000734 Ga0105240_1000073465 484
251 3300009093 Ga0105240_10025014 Ga0105240_100250142 484
252 3300009093 Ga0105240_10030445 Ga0105240_100304453 484
253 3300009093 Ga0105240_10098075 Ga0105240_100980754 484
254 3300009094 Ga0111539_10012378 Ga0111539_100123782 484
255 3300009094 Ga0111539_10029920 Ga0111539_100299206 484
256 3300009094 Ga0111539_10035040 Ga0111539_100350402 484
257 3300009098 Ga0105245_10029145 Ga0105245_100291455 484
258 3300009098 Ga0105245_10036728 Ga0105245_100367284 484
259 3300009147 Ga0114129_10000777 Ga0114129_1000077732 484
260 3300009147 Ga0114129_10058156 Ga0114129_100581562 484
261 3300009147 Ga0114129_10147701 Ga0114129_101477013 484
262 3300009147 Ga0114129_10225080 Ga0114129_102250802 484
263 3300009147 Ga0114129_10501756 Ga0114129_105017561 484
264 3300009174 Ga0105241_10032077 Ga0105241_100320773 484
265 3300009174 Ga0105241_10049056 Ga0105241_100490564 484
266 3300009176 Ga0105242_10056943 Ga0105242_100569434 484
267 3300009177 Ga0105248_10000806 Ga0105248_1000080615 484
268 3300009177 Ga0105248_10056649 Ga0105248_100566492 484
269 3300009177 Ga0105248_10064389 Ga0105248_100643894 484
270 3300009177 Ga0105248_10138686 Ga0105248_101386862 484
271 3300009545 Ga0105237_10031468 Ga0105237_100314684 484
272 3300009545 Ga0105237_10076730 Ga0105237_100767303 484
273 3300009545 Ga0105237_10231164 Ga0105237_102311641 484
274 3300009551 Ga0105238_10017459 Ga0105238_100174594 484
275 3300009551 Ga0105238_10060106 Ga0105238_100601063 484
276 3300009551 Ga0105238_10064670 Ga0105238_100646701 484
277 3300009551 Ga0105238_10067857 Ga0105238_100678573 484
278 3300009553 Ga0105249_10032997 Ga0105249_100329972 484
279 3300010375 Ga0105239_10029098 Ga0105239_100290983 484
280 3300010375 Ga0105239_10030580 Ga0105239_100305805 484
281 3300013296 Ga0157374_10007218 Ga0157374_100072186 484
282 3300013296 Ga0157374_10014732 Ga0157374_100147324 484
283 3300013297 Ga0157378_10105385 Ga0157378_101053853 484
284 3300013297 Ga0157378_10142141 Ga0157378_101421412 484
285 3300013306 Ga0163162_10003509 Ga0163162_100035096 484
286 3300013306 Ga0163162_10013499 Ga0163162_100134992 484
287 3300013306 Ga0163162_10044186 Ga0163162_100441864 484
288 3300013306 Ga0163162_10253473 Ga0163162_102534732 484
289 3300013306 Ga0163162_10328964 Ga0163162_103289641 484
290 3300013308 Ga0157375_10001430 Ga0157375_100014302 484
291 3300013308 Ga0157375_10051835 Ga0157375_100518352 484
292 3300013308 Ga0157375_10060584 Ga0157375_100605842 484
293 3300013308 Ga0157375_10287886 Ga0157375_102878862 484
294 3300014325 Ga0163163_10007573 Ga0163163_100075732 484
295 3300014325 Ga0163163_10026318 Ga0163163_100263183 484
296 3300014325 Ga0163163_10075764 Ga0163163_100757643 484
297 3300014325 Ga0163163_10205888 Ga0163163_102058882 484
298 3300014968 Ga0157379_10045112 Ga0157379_100451121 484
299 3300014969 Ga0157376_10032863 Ga0157376_100328634 484
300 3300014969 Ga0157376_10036571 Ga0157376_100365712 484
301 3300014969 Ga0157376_10094775 Ga0157376_100947751 484
302 3300021388 Ga0213875_10000004 Ga0213875_10000004277 484
303 3300021388 Ga0213875_10000313 Ga0213875_1000031315 484
304 3300021388 Ga0213875_10010292 Ga0213875_100102924 484
305 3300021388 Ga0213875_10010911 Ga0213875_100109111 484
306 3300021441 Ga0213871_10003941 Ga0213871_100039412 484
307 3300025899 Ga0207642_10034805 Ga0207642_100348052 484
308 3300025903 Ga0207680_10017582 Ga0207680_100175822 484
309 3300025903 Ga0207680_10041434 Ga0207680_100414342 484
310 3300025910 Ga0207684_10029639 Ga0207684_100296393 484
311 3300025910 Ga0207684_10040107 Ga0207684_100401072 484
312 3300025911 Ga0207654_10056884 Ga0207654_100568842 484
313 3300025912 Ga0207707_10037500 Ga0207707_100375001 484
314 3300025913 Ga0207695_10017528 Ga0207695_100175286 484
315 3300025913 Ga0207695_10025208 Ga0207695_100252082 484
316 3300025913 Ga0207695_10027004 Ga0207695_100270043 484
317 3300025913 Ga0207695_10030031 Ga0207695_100300314 484
318 3300025913 Ga0207695_10275964 Ga0207695_102759641 484
319 3300025914 Ga0207671_10143354 Ga0207671_101433542 484
320 3300025914 Ga0207671_10190968 Ga0207671_101909682 484
321 3300025915 Ga0207693_10120672 Ga0207693_101206722 484
322 3300025918 Ga0207662_10013090 Ga0207662_100130902 484
323 3300025919 Ga0207657_10002375 Ga0207657_1000237512 484
324 3300025921 Ga0207652_10019567 Ga0207652_100195672 484
325 3300025921 Ga0207652_10285851 Ga0207652_102858511 484
326 3300025922 Ga0207646_10000037 Ga0207646_10000037146 484
327 3300025922 Ga0207646_10015090 Ga0207646_100150904 484
328 3300025924 Ga0207694_10032572 Ga0207694_100325723 484
329 3300025924 Ga0207694_10096202 Ga0207694_100962022 484
330 3300025924 Ga0207694_10097298 Ga0207694_100972981 484
331 3300025924 Ga0207694_10117124 Ga0207694_101171241 484
332 3300025925 Ga0207650_10020427 Ga0207650_100204272 484
333 3300025926 Ga0207659_10000323 Ga0207659_1000032315 484
334 3300025927 Ga0207687_10006068 Ga0207687_100060686 484
335 3300025927 Ga0207687_10030888 Ga0207687_100308884 484
336 3300025931 Ga0207644_10022432 Ga0207644_100224322 484
337 3300025932 Ga0207690_10054616 Ga0207690_100546162 484
338 3300025940 Ga0207691_10002288 Ga0207691_100022882 484
339 3300025940 Ga0207691_10005514 Ga0207691_100055148 484
340 3300025941 Ga0207711_10000700 Ga0207711_1000070021 484
341 3300025941 Ga0207711_10066709 Ga0207711_100667094 484
342 3300025941 Ga0207711_10122552 Ga0207711_101225522 484
343 3300025942 Ga0207689_10021270 Ga0207689_100212702 484
344 3300025944 Ga0207661_10000003 Ga0207661_10000003195 484
345 3300025944 Ga0207661_10033901 Ga0207661_100339013 484
346 3300025945 Ga0207679_10015286 Ga0207679_100152862 484
347 3300025945 Ga0207679_10079496 Ga0207679_100794962 484
348 3300025949 Ga0207667_10002416 Ga0207667_100024166 484
349 3300025949 Ga0207667_10109697 Ga0207667_101096972 484
350 3300025949 Ga0207667_10162015 Ga0207667_101620152 484
351 3300025960 Ga0207651_10018593 Ga0207651_100185932 484
352 3300025986 Ga0207658_10013308 Ga0207658_100133084 484
353 3300025986 Ga0207658_10027029 Ga0207658_100270293 484
354 3300026023 Ga0207677_10084994 Ga0207677_100849942 484
355 3300026035 Ga0207703_10042274 Ga0207703_100422743 484
356 3300026041 Ga0207639_10002985 Ga0207639_100029856 484
357 3300026078 Ga0207702_10016913 Ga0207702_100169132 484
358 3300026078 Ga0207702_10060335 Ga0207702_100603355 484
359 3300026078 Ga0207702_10113976 Ga0207702_101139762 484
360 3300026088 Ga0207641_10008247 Ga0207641_100082472 484
361 3300026088 Ga0207641_10024896 Ga0207641_100248963 484
362 3300026088 Ga0207641_10039613 Ga0207641_100396132 484
363 3300026088 Ga0207641_10131929 Ga0207641_101319293 484
364 3300026088 Ga0207641_10223320 Ga0207641_102233201 484
365 3300026089 Ga0207648_10051935 Ga0207648_100519353 484
366 3300026095 Ga0207676_10001580 Ga0207676_100015805 484
367 3300026095 Ga0207676_10007865 Ga0207676_100078654 484
368 3300026095 Ga0207676_10120621 Ga0207676_101206211 484
369 3300026116 Ga0207674_10045779 Ga0207674_100457792 484
370 3300026121 Ga0207683_10199904 Ga0207683_101999042 484
371 3300026142 Ga0207698_10146550 Ga0207698_101465501 484
372 3300027512 Ga0209179_1000419 Ga0209179_10004192 484
373 3300027671 Ga0209588_1008548 Ga0209588_10085483 484
374 3300027907 Ga0207428_10000328 Ga0207428_1000032824 484
375 3300027907 Ga0207428_10014125 Ga0207428_100141252 484
376 3300027907 Ga0207428_10126900 Ga0207428_101269002 484
377 3300028379 Ga0268266_10018388 Ga0268266_100183884 484
378 3300028379 Ga0268266_10019116 Ga0268266_100191164 484
379 3300028380 Ga0268265_10036808 Ga0268265_100368082 484
380 3300028381 Ga0268264_10003579 Ga0268264_100035795 484
381 3300028381 Ga0268264_10009249 Ga0268264_100092492 484
382 3300028381 Ga0268264_10047817 Ga0268264_100478172 484
383 3300028381 Ga0268264_10183319 Ga0268264_101833192 484
384 3300028653 Ga0265323_10001872 Ga0265323_100018726 484
385 3300031090 Ga0265760_10000014 Ga0265760_1000001429 484
386 3300031241 Ga0265325_10001419 Ga0265325_1000141911 484
387 3300031241 Ga0265325_10005096 Ga0265325_100050964 484
388 3300031344 Ga0265316_10052881 Ga0265316_100528812 484
389 3300031595 Ga0265313_10012844 Ga0265313_100128444 484
390 3300031711 Ga0265314_10001907 Ga0265314_100019076 484
391 3300031712 Ga0265342_10089954 Ga0265342_100899542 484
392 3300035695 Ga0373927_0020079 Ga0373927_0020079_269_1723 484
393 3300035724 Ga0373933_0000129 Ga0373933_0000129_801_2261 484
394 3300035725 Ga0373947_0037861 Ga0373947_0037861_745_2199 484
395 3300036401 Ga0373937_0000015 Ga0373937_0000015_71275_72735 484
396 3300036401 Ga0373937_0010379 Ga0373937_0010379_4204_5688 484
397 3300036401 Ga0373937_0063269 Ga0373937_0063269_1452_2936 484
398 3300036401 Ga0373937_0083455 Ga0373937_0083455_942_2396 484
399 3300037068 Ga0373925_0118237 Ga0373925_0118237_266_1720 484
400 3300037853 Ga0436364_0288437 Ga0436364_0288437_850_2304 484
401 3300037853 Ga0436364_0748068 Ga0436364_0748068_304287_305741 484
402 3300037853 Ga0436364_0880534 Ga0436364_0880534_10070_11524 484
403 3300037853 Ga0436364_0895125 Ga0436364_0895125_216_1685 484
404 3300037853 Ga0436364_1448794 Ga0436364_1448794_3197_4654 484
405 3300037853 Ga0436364_1535143 Ga0436364_1535143_10974_12428 484
406 3300039437 Ga0436365_0343849 Ga0436365_0343849_1887_3341 484
407 3300039437 Ga0436365_0612444 Ga0436365_0612444_2005_3459 484
408 3300039437 Ga0436365_1466946 Ga0436365_1466946_1025_2497 484
409 3300039438 Ga0436360_1307109 Ga0436360_1307109_23220_24674 484
410 3300044673 Ga0453683_0042654 Ga0453683_0042654_1149_2609 484
411 3300044712 Ga0453684_0000397 Ga0453684_0000397_118779_120251 484
412 3300045051 Ga0451576_0100191 Ga0451576_0100191_1291_2751 484
413 3300046454 Ga0495592_0007581 Ga0495592_0007581_4818_6302 484
414 3300046454 Ga0495592_0079214 Ga0495592_0079214_718_2172 484
415 3300046462 Ga0495651_0006705 Ga0495651_0006705_6907_8367 484
416 3300046462 Ga0495651_0080881 Ga0495651_0080881_533_1987 484
417 3300046472 Ga0495580_0004544 Ga0495580_0004544_210_1664 484
418 3300046472 Ga0495580_0017276 Ga0495580_0017276_1587_3041 484
419 3300046472 Ga0495580_0025378 Ga0495580_0025378_2710_4164 484
420 3300046472 Ga0495580_0048974 Ga0495580_0048974_421_1875 484
421 3300046476 Ga0495662_0007670 Ga0495662_0007670_1629_3083 484
422 3300046477 Ga0495664_0007875 Ga0495664_0007875_157_1611 484
423 3300046529 Ga0495652_0071196 Ga0495652_0071196_55_1515 484
424 3300046529 Ga0495652_0079728 Ga0495652_0079728_198_1652 484
425 3300046535 Ga0495586_0046721 Ga0495586_0046721_644_2128 484
426 3300046536 Ga0495587_0000081 Ga0495587_0000081_11382_12842 484
427 3300046559 Ga0495667_0000465 Ga0495667_0000465_10280_11764 484
428 3300046559 Ga0495667_0032624 Ga0495667_0032624_1996_3450 484
429 3300046642 Ga0495634_0027186 Ga0495634_0027186_2210_3664 484
430 3300046675 Ga0495657_0001605 Ga0495657_0001605_9987_11471 484
431 3300046678 Ga0495599_0013062 Ga0495599_0013062_1902_3356 484
432 3300046678 Ga0495599_0053415 Ga0495599_0053415_502_1956 484
433 3300046679 Ga0495623_0023174 Ga0495623_0023174_2482_3936 484
434 3300046689 Ga0495613_0014721 Ga0495613_0014721_1410_2894 484
435 3300047317 Ga0495604_0022691 Ga0495604_0022691_1575_3035 484
436 3300047318 Ga0495636_0016157 Ga0495636_0016157_176_1645 484
437 3300047319 Ga0495674_0047949 Ga0495674_0047949_1038_2492 484
438 3300047322 Ga0495680_0082475 Ga0495680_0082475_875_2329 484
439 3300047444 Ga0495675_0001405 Ga0495675_0001405_11545_13005 484
440 3300047471 Ga0495684_0035646 Ga0495684_0035646_1763_3217 484
441 3300048088 Ga0495602_0000101 Ga0495602_0000101_17067_18527 484
442 3300048088 Ga0495602_0087148 Ga0495602_0087148_770_2224 484
443 3300048088 Ga0495602_0179256 Ga0495602_0179256_132_1586 484
444 3300048915 Ga0496112_0057421 Ga0496112_0057421_2066_3520 484
445 3300049568 Ga0501031_0004063 Ga0501031_0004063_229_1683 484
446 3300049569 Ga0501032_0001455 Ga0501032_0001455_2914_4368 484
447 3300049572 Ga0501036_0000255 Ga0501036_0000255_29060_30514 484
448 3300049574 Ga0501038_0013708 Ga0501038_0013708_598_2052 484
449 3300049575 Ga0501039_0022459 Ga0501039_0022459_251_1705 484
450 3300049579 Ga0501043_0071340 Ga0501043_0071340_924_2378 484
451 3300049580 Ga0501046_0013244 Ga0501046_0013244_3104_4558 484
452 3300049581 Ga0501047_0011142 Ga0501047_0011142_2293_3747 484
453 3300049581 Ga0501047_0014185 Ga0501047_0014185_195_1649 484
454 3300049582 Ga0501048_0009515 Ga0501048_0009515_2968_4422 484
455 3300049583 Ga0501067_0002621 Ga0501067_0002621_3294_4748 484
456 3300049584 Ga0501068_0004334 Ga0501068_0004334_5337_6791 484
457 3300049585 Ga0501069_0000224 Ga0501069_0000224_4064_5518 484
458 3300049586 Ga0501070_0023337 Ga0501070_0023337_2037_3491 484
459 3300049588 Ga0501072_0053330 Ga0501072_0053330_832_2286 484
460 3300049589 Ga0501073_0127128 Ga0501073_0127128_103_1557 484
461 3300049590 Ga0501074_0023820 Ga0501074_0023820_338_1792 484
462 3300049592 Ga0501076_0033461 Ga0501076_0033461_482_1936 484
463 3300049593 Ga0501077_0019257 Ga0501077_0019257_2292_3746 484
464 3300049741 Ga0501079_0005002 Ga0501079_0005002_5210_6664 484
465 3300049742 Ga0501080_0000961 Ga0501080_0000961_9579_11033 484
466 3300049822 Ga0501035_0151531 Ga0501035_0151531_339_1793 484
467 3300049823 Ga0501044_0000216 Ga0501044_0000216_59908_61362 484
468 3300049823 Ga0501044_0035476 Ga0501044_0035476_3294_4748 484
469 3300050507 nmdc:mga05p37_1967_c1 nmdc:mga05p37_1967_c1_486_1997 484
470 3300050507 nmdc:mga05p37_333532_c1 nmdc:mga05p37_333532_c1_143_1654 484
471 3300050508 nmdc:mga09592_61815_c1 nmdc:mga09592_61815_c1_1609_3072 484
472 3300050508 nmdc:mga09592_97438_c1 nmdc:mga09592_97438_c1_632_2143 484
473 3300050509 nmdc:mga0qj67_24639_c1 nmdc:mga0qj67_24639_c1_110_1576 484
474 3300050510 nmdc:mga06r32_167709_c1 nmdc:mga06r32_167709_c1_515_1978 484
475 3300050511 nmdc:mga08y16_128789_c1 nmdc:mga08y16_128789_c1_620_2107 484
476 3300050511 nmdc:mga08y16_133358_c1 nmdc:mga08y16_133358_c1_971_2437 484
477 3300050511 nmdc:mga08y16_138199_c1 nmdc:mga08y16_138199_c1_929_2440 484
478 3300050511 nmdc:mga08y16_20326_c1 nmdc:mga08y16_20326_c1_4884_6347 484
479 3300050511 nmdc:mga08y16_30012_c1 nmdc:mga08y16_30012_c1_2797_4284 484
480 3300050512 nmdc:mga0n895_17754_c1 nmdc:mga0n895_17754_c1_3117_4628 484
481 3300050515 nmdc:mga0a205_172227_c1 nmdc:mga0a205_172227_c1_460_1923 484
482 3300050515 nmdc:mga0a205_18616_c1 nmdc:mga0a205_18616_c1_1286_2797 484
483 3300050515 nmdc:mga0a205_83518_c1 nmdc:mga0a205_83518_c1_97_1560 484
484 3300050515 nmdc:mga0a205_91204_c1 nmdc:mga0a205_91204_c1_1079_2590 484
485 3300054114 Ga0501084_0000854 Ga0501084_0000854_6148_7602 484
486 3300060353 Ga0501082_0018177 Ga0501082_0018177_2139_3593 484
487 3300060353 Ga0501082_0096290 Ga0501082_0096290_678_2141 484
488 3300061734 Ga0530510_0006805 Ga0530510_0006805_6456_7919 484
489 3300025945 Ga0207679_10136949 Ga0207679_101369492 485
490 3300037471 Ga0395905_0057134 Ga0395905_0057134_1820_3331 485
491 3300045976 Ga0466967_0135452 Ga0466967_0135452_58_1566 485
492 3300005293 Ga0065715_10093704 Ga0065715_100937043 486
493 3300005327 Ga0070658_10057258 Ga0070658_100572582 486
494 3300005328 Ga0070676_10009362 Ga0070676_100093622 486
495 3300005329 Ga0070683_100007932 Ga0070683_1000079322 486
496 3300005329 Ga0070683_100099042 Ga0070683_1000990422 486
497 3300005331 Ga0070670_100001949 Ga0070670_1000019496 486
498 3300005335 Ga0070666_10103624 Ga0070666_101036241 486
499 3300005336 Ga0070680_100026699 Ga0070680_1000266993 486
500 3300005336 Ga0070680_100032224 Ga0070680_1000322242 486
501 3300005337 Ga0070682_100064443 Ga0070682_1000644432 486
502 3300005338 Ga0068868_100001660 Ga0068868_1000016602 486
503 3300005338 Ga0068868_100015752 Ga0068868_1000157524 486
504 3300005338 Ga0068868_100019780 Ga0068868_1000197802 486
505 3300005338 Ga0068868_100021745 Ga0068868_1000217452 486
506 3300005339 Ga0070660_100007894 Ga0070660_1000078948 486
507 3300005344 Ga0070661_100008885 Ga0070661_1000088858 486
508 3300005344 Ga0070661_100019563 Ga0070661_1000195633 486
509 3300005344 Ga0070661_100025646 Ga0070661_1000256462 486
510 3300005347 Ga0070668_100011535 Ga0070668_1000115354 486
511 3300005354 Ga0070675_100020069 Ga0070675_1000200692 486
512 3300005354 Ga0070675_100114608 Ga0070675_1001146081 486
513 3300005355 Ga0070671_100000378 Ga0070671_10000037819 486
514 3300005355 Ga0070671_100042917 Ga0070671_1000429173 486
515 3300005364 Ga0070673_100007515 Ga0070673_1000075155 486
516 3300005367 Ga0070667_100019425 Ga0070667_1000194252 486
517 3300005434 Ga0070709_10000423 Ga0070709_1000042315 486
518 3300005435 Ga0070714_100000096 Ga0070714_10000009648 486
519 3300005435 Ga0070714_100102955 Ga0070714_1001029553 486
520 3300005436 Ga0070713_100000364 Ga0070713_1000003649 486
521 3300005436 Ga0070713_100008685 Ga0070713_1000086854 486
522 3300005439 Ga0070711_100103524 Ga0070711_1001035242 486
523 3300005445 Ga0070708_100007485 Ga0070708_1000074852 486
524 3300005455 Ga0070663_100010931 Ga0070663_1000109312 486
525 3300005455 Ga0070663_100062398 Ga0070663_1000623982 486
526 3300005457 Ga0070662_100006651 Ga0070662_1000066515 486
527 3300005457 Ga0070662_100053402 Ga0070662_1000534022 486
528 3300005458 Ga0070681_10006468 Ga0070681_1000646810 486
529 3300005458 Ga0070681_10073881 Ga0070681_100738812 486
530 3300005458 Ga0070681_10157601 Ga0070681_101576011 486
531 3300005459 Ga0068867_100007704 Ga0068867_1000077042 486
532 3300005459 Ga0068867_100022763 Ga0068867_1000227633 486
533 3300005467 Ga0070706_100000278 Ga0070706_10000027833 486
534 3300005467 Ga0070706_100021666 Ga0070706_1000216662 486
535 3300005530 Ga0070679_100003386 Ga0070679_1000033862 486
536 3300005530 Ga0070679_100047135 Ga0070679_1000471351 486
537 3300005530 Ga0070679_100068323 Ga0070679_1000683233 486
538 3300005535 Ga0070684_100039558 Ga0070684_1000395582 486
539 3300005535 Ga0070684_100044069 Ga0070684_1000440693 486
540 3300005535 Ga0070684_100099199 Ga0070684_1000991994 486
541 3300005536 Ga0070697_100000993 Ga0070697_1000009932 486
542 3300005539 Ga0068853_100014788 Ga0068853_1000147882 486
543 3300005563 Ga0068855_100000642 Ga0068855_10000064231 486
544 3300005563 Ga0068855_100013554 Ga0068855_1000135546 486
545 3300005563 Ga0068855_100022851 Ga0068855_1000228513 486
546 3300005563 Ga0068855_100158826 Ga0068855_1001588262 486
547 3300005563 Ga0068855_100235951 Ga0068855_1002359512 486
548 3300005564 Ga0070664_100001989 Ga0070664_10000198911 486
549 3300005564 Ga0070664_100204667 Ga0070664_1002046672 486
550 3300005577 Ga0068857_100001478 Ga0068857_10000147814 486
551 3300005577 Ga0068857_100134234 Ga0068857_1001342342 486
552 3300005578 Ga0068854_100029876 Ga0068854_1000298762 486
553 3300005614 Ga0068856_100003152 Ga0068856_10000315211 486
554 3300005614 Ga0068856_100016878 Ga0068856_1000168784 486
555 3300005616 Ga0068852_100000415 Ga0068852_1000004154 486
556 3300005616 Ga0068852_100073456 Ga0068852_1000734563 486
557 3300005616 Ga0068852_100081737 Ga0068852_1000817374 486
558 3300005616 Ga0068852_100206405 Ga0068852_1002064051 486
559 3300005617 Ga0068859_100006813 Ga0068859_1000068139 486
560 3300005617 Ga0068859_100010766 Ga0068859_1000107668 486
561 3300005618 Ga0068864_100001669 Ga0068864_1000016697 486
562 3300005718 Ga0068866_10021754 Ga0068866_100217543 486
563 3300005718 Ga0068866_10038702 Ga0068866_100387022 486
564 3300005834 Ga0068851_10006846 Ga0068851_100068462 486
565 3300005834 Ga0068851_10008567 Ga0068851_100085673 486
566 3300005834 Ga0068851_10015529 Ga0068851_100155292 486
567 3300005841 Ga0068863_100004389 Ga0068863_1000043892 486
568 3300005841 Ga0068863_100064567 Ga0068863_1000645672 486
569 3300005842 Ga0068858_100007847 Ga0068858_1000078478 486
570 3300005842 Ga0068858_100083674 Ga0068858_1000836742 486
571 3300005843 Ga0068860_100049370 Ga0068860_1000493702 486
572 3300005843 Ga0068860_100072062 Ga0068860_1000720624 486
573 3300005983 Ga0081540_1005801 Ga0081540_10058013 486
574 3300006175 Ga0070712_100002672 Ga0070712_1000026727 486
575 3300006175 Ga0070712_100010032 Ga0070712_1000100325 486
576 3300006237 Ga0097621_100015449 Ga0097621_1000154495 486
577 3300006237 Ga0097621_100031066 Ga0097621_1000310664 486
578 3300006237 Ga0097621_100052500 Ga0097621_1000525002 486
579 3300006358 Ga0068871_100026889 Ga0068871_1000268895 486
580 3300006358 Ga0068871_100058314 Ga0068871_1000583142 486
581 3300006871 Ga0075434_100005331 Ga0075434_1000053319 486
582 3300006881 Ga0068865_100011388 Ga0068865_1000113884 486
583 3300006881 Ga0068865_100019789 Ga0068865_1000197893 486
584 3300006881 Ga0068865_100020714 Ga0068865_1000207142 486
585 3300006931 Ga0097620_100006814 Ga0097620_1000068142 486
586 3300006931 Ga0097620_100010766 Ga0097620_1000107664 486
587 3300009093 Ga0105240_10001326 Ga0105240_1000132623 486
588 3300009093 Ga0105240_10001395 Ga0105240_1000139524 486
589 3300009093 Ga0105240_10032052 Ga0105240_100320527 486
590 3300009093 Ga0105240_10081283 Ga0105240_100812832 486
591 3300009098 Ga0105245_10007394 Ga0105245_100073949 486
592 3300009098 Ga0105245_10028226 Ga0105245_100282266 486
593 3300009098 Ga0105245_10055244 Ga0105245_100552442 486
594 3300009098 Ga0105245_10073069 Ga0105245_100730692 486
595 3300009148 Ga0105243_10019881 Ga0105243_100198815 486
596 3300009174 Ga0105241_10043258 Ga0105241_100432582 486
597 3300009177 Ga0105248_10000094 Ga0105248_1000009453 486
598 3300009177 Ga0105248_10001021 Ga0105248_1000102115 486
599 3300009177 Ga0105248_10013851 Ga0105248_100138514 486
600 3300009177 Ga0105248_10020967 Ga0105248_100209674 486
601 3300009545 Ga0105237_10022562 Ga0105237_100225622 486
602 3300009551 Ga0105238_10000635 Ga0105238_1000063524 486
603 3300010375 Ga0105239_10002713 Ga0105239_100027138 486
604 3300010375 Ga0105239_10069943 Ga0105239_100699432 486
605 3300010375 Ga0105239_10105811 Ga0105239_101058112 486
606 3300011119 Ga0105246_10016520 Ga0105246_100165202 486
607 3300013104 Ga0157370_10000137 Ga0157370_1000013711 486
608 3300013104 Ga0157370_10058522 Ga0157370_100585224 486
609 3300013104 Ga0157370_10179396 Ga0157370_101793962 486
610 3300013105 Ga0157369_10001369 Ga0157369_1000136924 486
611 3300013105 Ga0157369_10001777 Ga0157369_100017774 486
612 3300013105 Ga0157369_10023951 Ga0157369_100239512 486
613 3300013105 Ga0157369_10097222 Ga0157369_100972223 486
614 3300013296 Ga0157374_10000659 Ga0157374_1000065911 486
615 3300013296 Ga0157374_10011444 Ga0157374_100114442 486
616 3300013296 Ga0157374_10015360 Ga0157374_100153602 486
617 3300013296 Ga0157374_10021536 Ga0157374_100215364 486
618 3300013296 Ga0157374_10112524 Ga0157374_101125242 486
619 3300013297 Ga0157378_10000217 Ga0157378_1000021717 486
620 3300013306 Ga0163162_10010248 Ga0163162_100102486 486
621 3300013307 Ga0157372_10000134 Ga0157372_100001347 486
622 3300013307 Ga0157372_10000424 Ga0157372_1000042424 486
623 3300013307 Ga0157372_10005022 Ga0157372_100050227 486
624 3300013307 Ga0157372_10022198 Ga0157372_100221982 486
625 3300013307 Ga0157372_10109955 Ga0157372_101099553 486
626 3300013307 Ga0157372_10249923 Ga0157372_102499232 486
627 3300014325 Ga0163163_10000729 Ga0163163_1000072911 486
628 3300014325 Ga0163163_10051412 Ga0163163_100514125 486
629 3300014969 Ga0157376_10021045 Ga0157376_100210452 486
630 3300014969 Ga0157376_10066786 Ga0157376_100667862 486
631 3300014969 Ga0157376_10067881 Ga0157376_100678813 486
632 3300015262 Ga0182007_10005535 Ga0182007_100055355 486
633 3300017792 Ga0163161_10018153 Ga0163161_100181532 486
634 3300021361 Ga0213872_10001564 Ga0213872_100015646 486
635 3300021361 Ga0213872_10034060 Ga0213872_100340602 486
636 3300022732 Ga0224569_100108 Ga0224569_1001086 486
637 3300024227 Ga0228598_1001374 Ga0228598_10013743 486
638 3300025321 Ga0207656_10008171 Ga0207656_100081712 486
639 3300025898 Ga0207692_10027104 Ga0207692_100271041 486
640 3300025903 Ga0207680_10008418 Ga0207680_100084183 486
641 3300025906 Ga0207699_10000209 Ga0207699_1000020930 486
642 3300025906 Ga0207699_10126074 Ga0207699_101260741 486
643 3300025910 Ga0207684_10011624 Ga0207684_100116247 486
644 3300025910 Ga0207684_10055510 Ga0207684_100555104 486
645 3300025911 Ga0207654_10082870 Ga0207654_100828702 486
646 3300025912 Ga0207707_10021854 Ga0207707_100218546 486
647 3300025913 Ga0207695_10000379 Ga0207695_1000037966 486
648 3300025913 Ga0207695_10003457 Ga0207695_1000345724 486
649 3300025913 Ga0207695_10026384 Ga0207695_100263847 486
650 3300025913 Ga0207695_10052463 Ga0207695_100524633 486
651 3300025913 Ga0207695_10134305 Ga0207695_101343052 486
652 3300025915 Ga0207693_10000026 Ga0207693_1000002657 486
653 3300025915 Ga0207693_10062889 Ga0207693_100628892 486
654 3300025915 Ga0207693_10085307 Ga0207693_100853072 486
655 3300025916 Ga0207663_10116911 Ga0207663_101169112 486
656 3300025919 Ga0207657_10168175 Ga0207657_101681751 486
657 3300025921 Ga0207652_10185568 Ga0207652_101855682 486
658 3300025922 Ga0207646_10116923 Ga0207646_101169233 486
659 3300025924 Ga0207694_10000580 Ga0207694_1000058011 486
660 3300025924 Ga0207694_10021413 Ga0207694_100214132 486
661 3300025927 Ga0207687_10036583 Ga0207687_100365832 486
662 3300025927 Ga0207687_10096892 Ga0207687_100968922 486
663 3300025928 Ga0207700_10000306 Ga0207700_1000030610 486
664 3300025928 Ga0207700_10098503 Ga0207700_100985032 486
665 3300025929 Ga0207664_10000087 Ga0207664_1000008757 486
666 3300025929 Ga0207664_10041011 Ga0207664_100410112 486
667 3300025929 Ga0207664_10127559 Ga0207664_101275592 486
668 3300025931 Ga0207644_10000680 Ga0207644_100006803 486
669 3300025931 Ga0207644_10029090 Ga0207644_100290903 486
670 3300025933 Ga0207706_10011869 Ga0207706_100118694 486
671 3300025933 Ga0207706_10060961 Ga0207706_100609612 486
672 3300025939 Ga0207665_10007676 Ga0207665_100076764 486
673 3300025939 Ga0207665_10017617 Ga0207665_100176172 486
674 3300025939 Ga0207665_10137176 Ga0207665_101371761 486
675 3300025940 Ga0207691_10002504 Ga0207691_1000250413 486
676 3300025941 Ga0207711_10000086 Ga0207711_1000008636 486
677 3300025941 Ga0207711_10001388 Ga0207711_1000138819 486
678 3300025941 Ga0207711_10010324 Ga0207711_100103244 486
679 3300025941 Ga0207711_10046036 Ga0207711_100460364 486
680 3300025944 Ga0207661_10146655 Ga0207661_101466551 486
681 3300025945 Ga0207679_10049078 Ga0207679_100490782 486
682 3300025949 Ga0207667_10004201 Ga0207667_1000420110 486
683 3300025949 Ga0207667_10019621 Ga0207667_100196214 486
684 3300025949 Ga0207667_10042670 Ga0207667_100426704 486
685 3300025949 Ga0207667_10117717 Ga0207667_101177172 486
686 3300025981 Ga0207640_10009549 Ga0207640_100095493 486
687 3300025981 Ga0207640_10068528 Ga0207640_100685281 486
688 3300026023 Ga0207677_10008947 Ga0207677_100089475 486
689 3300026035 Ga0207703_10152881 Ga0207703_101528811 486
690 3300026041 Ga0207639_10012613 Ga0207639_100126132 486
691 3300026078 Ga0207702_10033923 Ga0207702_100339234 486
692 3300026078 Ga0207702_10045554 Ga0207702_100455542 486
693 3300026078 Ga0207702_10076439 Ga0207702_100764392 486
694 3300026095 Ga0207676_10023619 Ga0207676_100236192 486
695 3300026121 Ga0207683_10031448 Ga0207683_100314484 486
696 3300026142 Ga0207698_10000039 Ga0207698_1000003934 486
697 3300028017 Ga0265356_1000458 Ga0265356_10004583 486
698 3300028379 Ga0268266_10007530 Ga0268266_100075306 486
699 3300028379 Ga0268266_10032090 Ga0268266_100320902 486
700 3300028577 Ga0265318_10002124 Ga0265318_1000212414 486
701 3300028666 Ga0265336_10002446 Ga0265336_100024465 486
702 3300028666 Ga0265336_10003601 Ga0265336_100036012 486
703 3300028800 Ga0265338_10007828 Ga0265338_100078288 486
704 3300028800 Ga0265338_10045724 Ga0265338_100457241 486
705 3300030760 Ga0265762_1003998 Ga0265762_10039981 486
706 3300031235 Ga0265330_10000107 Ga0265330_1000010757 486
707 3300031235 Ga0265330_10006445 Ga0265330_100064453 486
708 3300031238 Ga0265332_10006044 Ga0265332_100060442 486
709 3300031238 Ga0265332_10022224 Ga0265332_100222243 486
710 3300031239 Ga0265328_10000456 Ga0265328_1000045615 486
711 3300031239 Ga0265328_10003578 Ga0265328_100035782 486
712 3300031240 Ga0265320_10006467 Ga0265320_100064672 486
713 3300031240 Ga0265320_10040964 Ga0265320_100409642 486
714 3300031241 Ga0265325_10000066 Ga0265325_1000006620 486
715 3300031241 Ga0265325_10000701 Ga0265325_100007012 486
716 3300031241 Ga0265325_10010234 Ga0265325_100102342 486
717 3300031241 Ga0265325_10010895 Ga0265325_100108952 486
718 3300031247 Ga0265340_10001113 Ga0265340_1000111312 486
719 3300031247 Ga0265340_10006158 Ga0265340_100061586 486
720 3300031247 Ga0265340_10007209 Ga0265340_100072094 486
721 3300031247 Ga0265340_10039049 Ga0265340_100390491 486
722 3300031249 Ga0265339_10000029 Ga0265339_1000002934 486
723 3300031249 Ga0265339_10000555 Ga0265339_100005553 486
724 3300031249 Ga0265339_10000921 Ga0265339_1000092134 486
725 3300031249 Ga0265339_10036200 Ga0265339_100362003 486
726 3300031250 Ga0265331_10019068 Ga0265331_100190682 486
727 3300031344 Ga0265316_10000447 Ga0265316_1000044715 486
728 3300031344 Ga0265316_10003190 Ga0265316_1000319010 486
729 3300031344 Ga0265316_10010718 Ga0265316_100107184 486
730 3300031344 Ga0265316_10012698 Ga0265316_100126982 486
731 3300031344 Ga0265316_10101414 Ga0265316_101014142 486
732 3300031595 Ga0265313_10001112 Ga0265313_100011122 486
733 3300031595 Ga0265313_10001195 Ga0265313_1000119514 486
734 3300031595 Ga0265313_10023461 Ga0265313_100234612 486
735 3300031711 Ga0265314_10000195 Ga0265314_1000019573 486
736 3300031711 Ga0265314_10081880 Ga0265314_100818802 486
737 3300031712 Ga0265342_10000078 Ga0265342_1000007819 486
738 3300031712 Ga0265342_10000307 Ga0265342_1000030726 486
739 3300031712 Ga0265342_10001748 Ga0265342_100017488 486
740 3300031712 Ga0265342_10032177 Ga0265342_100321772 486
741 3300031712 Ga0265342_10040530 Ga0265342_100405302 486
742 3300031712 Ga0265342_10081202 Ga0265342_100812022 486
743 3300033180 Ga0307510_10027922 Ga0307510_100279224 486
744 3300035083 Ga0373926_0018032 Ga0373926_0018032_476_1981 486
745 3300035113 Ga0373936_0005113 Ga0373936_0005113_3137_4642 486
746 3300035119 Ga0373956_0027979 Ga0373956_0027979_508_2013 486
747 3300035170 Ga0373943_0000594 Ga0373943_0000594_11128_12633 486
748 3300035692 Ga0373935_0002647 Ga0373935_0002647_1297_2802 486
749 3300035695 Ga0373927_0000747 Ga0373927_0000747_6604_8109 486
750 3300035695 Ga0373927_0013916 Ga0373927_0013916_730_2241 486
751 3300035724 Ga0373933_0029156 Ga0373933_0029156_1344_2849 486
752 3300035724 Ga0373933_0039134 Ga0373933_0039134_282_1805 486
753 3300035725 Ga0373947_0000971 Ga0373947_0000971_11851_13356 486
754 3300035725 Ga0373947_0007329 Ga0373947_0007329_4722_6227 486
755 3300036401 Ga0373937_0110752 Ga0373937_0110752_258_1781 486
756 3300037068 Ga0373925_0015527 Ga0373925_0015527_2997_4502 486
757 3300037068 Ga0373925_0019549 Ga0373925_0019549_3200_4705 486
758 3300037068 Ga0373925_0028771 Ga0373925_0028771_2425_3936 486
759 3300039438 Ga0436360_1314441 Ga0436360_1314441_14785_16308 486
760 3300039447 Ga0436361_0350897 Ga0436361_0350897_7026_8642 486
761 3300039447 Ga0436361_0464047 Ga0436361_0464047_63719_65368 486
762 3300039450 Ga0436363_0100069 Ga0436363_0100069_255_1760 486
763 3300044694 Ga0466963_0117463 Ga0466963_0117463_152_1669 486
764 3300046459 Ga0495629_0011385 Ga0495629_0011385_4858_6381 486
765 3300046459 Ga0495629_0044354 Ga0495629_0044354_323_1843 486
766 3300046459 Ga0495629_0063849 Ga0495629_0063849_963_2486 486
767 3300046459 Ga0495629_0082179 Ga0495629_0082179_312_1835 486
768 3300046463 Ga0495653_0010352 Ga0495653_0010352_5271_6794 486
769 3300046471 Ga0495650_0000010 Ga0495650_0000010_54975_56498 486
770 3300046472 Ga0495580_0001289 Ga0495580_0001289_5037_6542 486
771 3300046472 Ga0495580_0004497 Ga0495580_0004497_9528_11033 486
772 3300046472 Ga0495580_0005237 Ga0495580_0005237_7947_9452 486
773 3300046472 Ga0495580_0046103 Ga0495580_0046103_224_1747 486
774 3300046473 Ga0495582_0000706 Ga0495582_0000706_6237_7760 486
775 3300046473 Ga0495582_0002662 Ga0495582_0002662_7399_8904 486
776 3300046477 Ga0495664_0016909 Ga0495664_0016909_1756_3279 486
777 3300046507 Ga0495606_0038902 Ga0495606_0038902_82_1605 486
778 3300046523 Ga0495644_0000350 Ga0495644_0000350_16329_17852 486
779 3300046531 Ga0495665_0000288 Ga0495665_0000288_23324_24847 486
780 3300046531 Ga0495665_0048691 Ga0495665_0048691_629_2152 486
781 3300046543 Ga0495645_0005411 Ga0495645_0005411_3989_5512 486
782 3300046559 Ga0495667_0004030 Ga0495667_0004030_225_1748 486
783 3300046616 Ga0495668_0022228 Ga0495668_0022228_1572_3095 486
784 3300046642 Ga0495634_0004373 Ga0495634_0004373_3913_5436 486
785 3300046660 Ga0495625_0035758 Ga0495625_0035758_1635_3158 486
786 3300046663 Ga0495635_0068704 Ga0495635_0068704_28_1551 486
787 3300046678 Ga0495599_0050103 Ga0495599_0050103_983_2506 486
788 3300046679 Ga0495623_0018844 Ga0495623_0018844_2296_3819 486
789 3300046680 Ga0495646_0048952 Ga0495646_0048952_429_1952 486
790 3300046683 Ga0495658_0011190 Ga0495658_0011190_2000_3505 486
791 3300046689 Ga0495613_0005267 Ga0495613_0005267_6723_8246 486
792 3300046690 Ga0495624_0008050 Ga0495624_0008050_161_1684 486
793 3300046809 Ga0495600_0003665 Ga0495600_0003665_4953_6476 486
794 3300047315 Ga0495581_0005319 Ga0495581_0005319_5701_7224 486
795 3300047315 Ga0495581_0086809 Ga0495581_0086809_221_1744 486
796 3300047319 Ga0495674_0117468 Ga0495674_0117468_562_2067 486
797 3300047320 Ga0495672_0082865 Ga0495672_0082865_154_1677 486
798 3300047321 Ga0495676_0021782 Ga0495676_0021782_2825_4348 486
799 3300047444 Ga0495675_0001165 Ga0495675_0001165_1351_2874 486
800 3300047444 Ga0495675_0049625 Ga0495675_0049625_726_2237 486
801 3300047471 Ga0495684_0040591 Ga0495684_0040591_1940_3463 486
802 3300047472 Ga0495686_0000027 Ga0495686_0000027_18826_20349 486
803 3300047472 Ga0495686_0008767 Ga0495686_0008767_1340_2863 486
804 3300048089 Ga0495614_0001042 Ga0495614_0001042_8604_10127 486
805 3300048907 Ga0496104_0000127 Ga0496104_0000127_17247_18770 486
806 3300048907 Ga0496104_0126993 Ga0496104_0126993_628_2148 486
807 3300048907 Ga0496104_0130612 Ga0496104_0130612_874_2385 486
808 3300048907 Ga0496104_0273838 Ga0496104_0273838_18_1538 486
809 3300048909 Ga0496106_0136959 Ga0496106_0136959_243_1763 486
810 3300048915 Ga0496112_0089113 Ga0496112_0089113_714_2219 486
811 3300048918 Ga0496115_0012549 Ga0496115_0012549_1705_3225 486
812 3300048918 Ga0496115_0148198 Ga0496115_0148198_113_1639 486
813 3300048918 Ga0496115_0149101 Ga0496115_0149101_261_1784 486
814 3300048929 Ga0496126_0002651 Ga0496126_0002651_4138_5661 486
815 3300048929 Ga0496126_0037039 Ga0496126_0037039_1540_3063 486
816 3300050514 nmdc:mga08x19_2984_c1 nmdc:mga08x19_2984_c1_4645_6150 486
817 3300053093 Ga0500651_0000002 Ga0500651_0000002_74453_75976 486
818 3300053119 Ga0500595_000014 Ga0500595_000014_97800_99323 486

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00478

IMPDH

IMP dehydrogenase / GMP reductase domain

9

492

0.99

PF00571

CBS

CBS domain

87

143

0.92

PF00571

CBS

CBS domain

149

206

0.91

PF01070

FMN_dh

FMN-dependent dehydrogenase

181

368

0.81

PF01645

Glu_synthase

Conserved region in glutamate synthase

249

364

0.77

PF03060

NMO

Nitronate monooxygenase

221

421

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vrd-assembly2.cif.gz_B crystal structure of inosine-5'-monophosphate dehydrogenase (tm1347) from thermotoga maritima at 2.18 a resolution 0.9671 6 462
1vrd-assembly1.cif.gz_A crystal structure of inosine-5'-monophosphate dehydrogenase (tm1347) from thermotoga maritima at 2.18 a resolution 0.9645 6 462
6kcf-assembly1.cif.gz_D-2 structure of inosine 5'-monophosphate dehydrogenase from candidatus liberibacter asiaticus str. psy62 0.9642 8 465
6kcf-assembly1.cif.gz_C-2 structure of inosine 5'-monophosphate dehydrogenase from candidatus liberibacter asiaticus str. psy62 0.9642 8 465
1vrd-assembly2.cif.gz_B crystal structure of inosine-5'-monophosphate dehydrogenase (tm1347) from thermotoga maritima at 2.18 a resolution 0.9641 6 462
ID Description Score Start End Superfamily
4qq3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.956 4 462 3.20.20.70
5x8oA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9521 6 464 3.20.20.70
4dqwB02 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9514 95 203 3.10.580.10
4qq3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9406 4 462 3.20.20.70
5x8oA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9309 6 464 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A351UUM3-F1-model_v4 IMP dehydrogenase (EC 1.1.1.205) 0.9895 201 294 GO:0003938
GO:0006183
AF-A0A2V9FMH8-F1-model_v4 IMP dehydrogenase (EC 1.1.1.205) 0.9725 92 234 GO:0003938
GO:0006183
AF-A0A3D3AS44-F1-model_v4 deleted 0.9719 205 370
AF-A0A7S2MLS1-F1-model_v4 IMP dehydrogenase/GMP reductase domain-containing protein 0.9652 195 299 GO:0003938
GO:0005737
GO:0006183
AF-A0A3R9WHI1-F1-model_v4 deleted 0.9636 191 320

Feature Viewer

pLDDT pTM Quality
82.24 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map