F482122
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 818 | 307 | 818 | 495 |
Family's Representative Sequence
| Representative Sequence | 3300005338|Ga0068868_100019780|Ga0068868_1000197802 |
| Length | 506 |
| Sequence | MLAKNLTEALTFDDVLLIPAYSEVVPAQVSTQTQLTRDITLNTPLLSSAMDTVTESRMAIAMAQQGGIGIVHRNLTIEAQAGEIDKVKRSESGMIVDPVTIGPDQQIADALEVMRRYKISGVPVTKGTKLVGILTNRDLRFETRVDVPVGDVMTKENLITVAVGTTLEEAELILHKHRVEKLLVVDDQYNLKGLITVKDIQKKLKYPSASKDEKGRLRVGGAIGATGDFLERAEELVNARVDVLAIDSAHGHSSRVLEAVREVKKRFPGVGVLAGNVATYEGAQALMDAGADAIKVGIGPGSICTTRMVTGAGMPQITAIAESARAAQERGIPVIADGGIKYSGEVTKAIAAGASSVMIGSLFAGVDESPGETILYQGRSFKSYRGMGSLTAMSQGSGERYFQSAEDLAKEIDTEGVVQRERNGQNRLAKFVPEGIEGRVPYRGPLEAMVYQLVGGLRSGMGYLGCGTIAELQQKAQFVRISNAGLRESHVHDVIITREAPNYHVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 112 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 113 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 114 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 165 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 166 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 171 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 173 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 180 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 182 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 184 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 187 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 191 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 192 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 193 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 197 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 205 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 206 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 207 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 208 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 209 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 210 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 211 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 212 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 213 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 264 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 265 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 266 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 267 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 268 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 269 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 292 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 304 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 305 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.76 |
| Metatranscriptomes | 0.24 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.98 |
| Nodule | 0 |
| Rhizoplane | 1.47 |
| Rhizosphere | 95.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10093704 | 3300005293 | Bacteria | 4593 |
| 2 | Ga0070658_10057258 | 3300005327 | Bacteria | 3170 |
| 3 | Ga0070676_10009362 | 3300005328 | Bacteria | 5294 |
| 4 | Ga0070676_10051548 | 3300005328 | Bacteria | 2417 |
| 5 | Ga0070683_100000002 | 3300005329 | Bacteria | 427530 |
| 6 | Ga0070683_100007932 | 3300005329 | Bacteria | 9004 |
| 7 | Ga0070683_100078429 | 3300005329 | Bacteria | 3090 |
| 8 | Ga0070683_100099042 | 3300005329 | Bacteria | 2744 |
| 9 | Ga0070670_100001949 | 3300005331 | Bacteria | 16915 |
| 10 | Ga0070666_10017503 | 3300005335 | Bacteria | 4594 |
| 11 | Ga0070666_10041327 | 3300005335 | Bacteria | 3081 |
| 12 | Ga0070666_10103624 | 3300005335 | Bacteria | 1963 |
| 13 | Ga0070680_100026699 | 3300005336 | Bacteria | 4618 |
| 14 | Ga0070680_100032224 | 3300005336 | Bacteria | 4217 |
| 15 | Ga0070682_100064443 | 3300005337 | Bacteria | 2326 |
| 16 | Ga0068868_100001660 | 3300005338 | Bacteria | 15197 |
| 17 | Ga0068868_100015752 | 3300005338 | Bacteria | 5600 |
| 18 | Ga0068868_100019780 | 3300005338 | Bacteria | 5050 |
| 19 | Ga0068868_100021745 | 3300005338 | Bacteria | 4833 |
| 20 | Ga0068868_100066500 | 3300005338 | Bacteria | 2866 |
| 21 | Ga0068868_100067628 | 3300005338 | Bacteria | 2844 |
| 22 | Ga0070660_100007894 | 3300005339 | Bacteria | 7425 |
| 23 | Ga0070660_100115767 | 3300005339 | Bacteria | 2137 |
| 24 | Ga0070687_100054056 | 3300005343 | Bacteria | 2091 |
| 25 | Ga0070661_100008885 | 3300005344 | Bacteria | 6954 |
| 26 | Ga0070661_100019563 | 3300005344 | Bacteria | 4826 |
| 27 | Ga0070661_100025646 | 3300005344 | Bacteria | 4238 |
| 28 | Ga0070661_100054741 | 3300005344 | Bacteria | 2922 |
| 29 | Ga0070668_100011535 | 3300005347 | Bacteria | 6579 |
| 30 | Ga0070675_100003550 | 3300005354 | Bacteria | 11840 |
| 31 | Ga0070675_100020001 | 3300005354 | Bacteria | 5341 |
| 32 | Ga0070675_100020069 | 3300005354 | Bacteria | 5331 |
| 33 | Ga0070675_100055347 | 3300005354 | Bacteria | 3265 |
| 34 | Ga0070675_100114608 | 3300005354 | Bacteria | 2284 |
| 35 | Ga0070671_100000378 | 3300005355 | Bacteria | 30628 |
| 36 | Ga0070671_100015148 | 3300005355 | Bacteria | 6228 |
| 37 | Ga0070671_100042917 | 3300005355 | Bacteria | 3761 |
| 38 | Ga0070674_100012266 | 3300005356 | Bacteria | 5259 |
| 39 | Ga0070673_100007515 | 3300005364 | Bacteria | 7198 |
| 40 | Ga0070673_100098684 | 3300005364 | Bacteria | 2401 |
| 41 | Ga0070688_100038813 | 3300005365 | Bacteria | 2911 |
| 42 | Ga0070659_100016010 | 3300005366 | Bacteria | 5625 |
| 43 | Ga0070667_100004263 | 3300005367 | Bacteria | 12077 |
| 44 | Ga0070667_100015915 | 3300005367 | Bacteria | 6223 |
| 45 | Ga0070667_100019425 | 3300005367 | Bacteria | 5638 |
| 46 | Ga0070703_10009229 | 3300005406 | Bacteria | 2783 |
| 47 | Ga0070709_10000423 | 3300005434 | Bacteria | 25611 |
| 48 | Ga0070714_100000096 | 3300005435 | Bacteria | 74616 |
| 49 | Ga0070714_100001908 | 3300005435 | Bacteria | 15192 |
| 50 | Ga0070714_100102955 | 3300005435 | Bacteria | 2518 |
| 51 | Ga0070713_100000364 | 3300005436 | Bacteria | 29177 |
| 52 | Ga0070713_100008685 | 3300005436 | Bacteria | 7225 |
| 53 | Ga0070713_100011727 | 3300005436 | Bacteria | 6397 |
| 54 | Ga0070713_100103287 | 3300005436 | Bacteria | 2473 |
| 55 | Ga0070701_10007710 | 3300005438 | Bacteria | 4618 |
| 56 | Ga0070711_100103524 | 3300005439 | Bacteria | 2075 |
| 57 | Ga0070705_100047339 | 3300005440 | Bacteria | 2485 |
| 58 | Ga0070705_100049561 | 3300005440 | Bacteria | 2439 |
| 59 | Ga0070694_100012714 | 3300005444 | Bacteria | 5241 |
| 60 | Ga0070708_100000805 | 3300005445 | Bacteria | 23638 |
| 61 | Ga0070708_100003971 | 3300005445 | Bacteria | 11607 |
| 62 | Ga0070708_100007485 | 3300005445 | Bacteria | 8742 |
| 63 | Ga0070708_100012412 | 3300005445 | Bacteria | 6955 |
| 64 | Ga0070663_100010931 | 3300005455 | Bacteria | 5673 |
| 65 | Ga0070663_100062398 | 3300005455 | Bacteria | 2687 |
| 66 | Ga0070662_100006651 | 3300005457 | Bacteria | 7465 |
| 67 | Ga0070662_100053402 | 3300005457 | Bacteria | 2925 |
| 68 | Ga0070662_100056115 | 3300005457 | Bacteria | 2859 |
| 69 | Ga0070681_10006468 | 3300005458 | Bacteria | 11407 |
| 70 | Ga0070681_10073881 | 3300005458 | Bacteria | 3371 |
| 71 | Ga0070681_10092236 | 3300005458 | Bacteria | 2978 |
| 72 | Ga0070681_10157601 | 3300005458 | Bacteria | 2194 |
| 73 | Ga0068867_100007704 | 3300005459 | Bacteria | 7619 |
| 74 | Ga0068867_100022763 | 3300005459 | Bacteria | 4482 |
| 75 | Ga0070685_10019908 | 3300005466 | Bacteria | 3627 |
| 76 | Ga0070706_100000278 | 3300005467 | Bacteria | 62365 |
| 77 | Ga0070706_100021666 | 3300005467 | Bacteria | 5918 |
| 78 | Ga0070706_100245321 | 3300005467 | Bacteria | 1672 |
| 79 | Ga0070707_100000221 | 3300005468 | Bacteria | 57035 |
| 80 | Ga0070698_100023905 | 3300005471 | Bacteria | 6380 |
| 81 | Ga0070699_100015903 | 3300005518 | Bacteria | 6461 |
| 82 | Ga0070699_100018350 | 3300005518 | Bacteria | 6011 |
| 83 | Ga0070679_100003386 | 3300005530 | Bacteria | 14614 |
| 84 | Ga0070679_100009883 | 3300005530 | Bacteria | 9026 |
| 85 | Ga0070679_100047135 | 3300005530 | Bacteria | 4297 |
| 86 | Ga0070679_100068323 | 3300005530 | Bacteria | 3545 |
| 87 | Ga0070684_100000007 | 3300005535 | Bacteria | 217174 |
| 88 | Ga0070684_100039558 | 3300005535 | Bacteria | 4057 |
| 89 | Ga0070684_100044069 | 3300005535 | Bacteria | 3857 |
| 90 | Ga0070684_100099199 | 3300005535 | Bacteria | 2599 |
| 91 | Ga0070697_100000993 | 3300005536 | Bacteria | 21455 |
| 92 | Ga0070697_100001847 | 3300005536 | Bacteria | 16183 |
| 93 | Ga0070697_100033249 | 3300005536 | Bacteria | 4152 |
| 94 | Ga0068853_100014788 | 3300005539 | Bacteria | 6405 |
| 95 | Ga0068853_100022773 | 3300005539 | Bacteria | 5236 |
| 96 | Ga0070672_100101299 | 3300005543 | Bacteria | 2336 |
| 97 | Ga0070686_100032737 | 3300005544 | Bacteria | 3189 |
| 98 | Ga0070695_100010421 | 3300005545 | Bacteria | 5550 |
| 99 | Ga0070696_100002464 | 3300005546 | Bacteria | 12271 |
| 100 | Ga0070696_100006664 | 3300005546 | Bacteria | 7714 |
| 101 | Ga0070693_100000037 | 3300005547 | Bacteria | 50504 |
| 102 | Ga0070665_100028376 | 3300005548 | Bacteria | 5638 |
| 103 | Ga0068855_100000642 | 3300005563 | Bacteria | 42759 |
| 104 | Ga0068855_100002278 | 3300005563 | Bacteria | 23709 |
| 105 | Ga0068855_100013554 | 3300005563 | Bacteria | 9834 |
| 106 | Ga0068855_100022851 | 3300005563 | Bacteria | 7496 |
| 107 | Ga0068855_100085072 | 3300005563 | Bacteria | 3660 |
| 108 | Ga0068855_100158826 | 3300005563 | Bacteria | 2567 |
| 109 | Ga0068855_100235951 | 3300005563 | Bacteria | 2045 |
| 110 | Ga0070664_100001989 | 3300005564 | Bacteria | 16388 |
| 111 | Ga0070664_100104305 | 3300005564 | Bacteria | 2469 |
| 112 | Ga0070664_100204667 | 3300005564 | Bacteria | 1762 |
| 113 | Ga0068857_100001478 | 3300005577 | Bacteria | 18698 |
| 114 | Ga0068857_100009230 | 3300005577 | Bacteria | 8556 |
| 115 | Ga0068857_100040887 | 3300005577 | Bacteria | 4110 |
| 116 | Ga0068857_100134234 | 3300005577 | Bacteria | 2234 |
| 117 | Ga0068854_100029876 | 3300005578 | Bacteria | 3776 |
| 118 | Ga0068856_100003152 | 3300005614 | Bacteria | 16815 |
| 119 | Ga0068856_100014834 | 3300005614 | Bacteria | 7521 |
| 120 | Ga0068856_100014853 | 3300005614 | Bacteria | 7515 |
| 121 | Ga0068856_100016878 | 3300005614 | Bacteria | 7076 |
| 122 | Ga0068856_100042132 | 3300005614 | Bacteria | 4491 |
| 123 | Ga0068856_100043286 | 3300005614 | Bacteria | 4430 |
| 124 | Ga0068852_100000415 | 3300005616 | Bacteria | 28473 |
| 125 | Ga0068852_100073456 | 3300005616 | Bacteria | 3009 |
| 126 | Ga0068852_100081737 | 3300005616 | Bacteria | 2869 |
| 127 | Ga0068852_100206405 | 3300005616 | Bacteria | 1862 |
| 128 | Ga0068859_100006813 | 3300005617 | Bacteria | 11608 |
| 129 | Ga0068859_100010766 | 3300005617 | Bacteria | 9204 |
| 130 | Ga0068859_100033639 | 3300005617 | Bacteria | 5148 |
| 131 | Ga0068859_100077042 | 3300005617 | Bacteria | 3375 |
| 132 | Ga0068859_100100435 | 3300005617 | Bacteria | 2949 |
| 133 | Ga0068859_100120349 | 3300005617 | Bacteria | 2692 |
| 134 | Ga0068864_100001669 | 3300005618 | Bacteria | 18274 |
| 135 | Ga0068864_100003645 | 3300005618 | Bacteria | 12734 |
| 136 | Ga0068864_100004251 | 3300005618 | Bacteria | 11784 |
| 137 | Ga0068864_100135900 | 3300005618 | Bacteria | 2214 |
| 138 | Ga0068866_10021754 | 3300005718 | Bacteria | 2958 |
| 139 | Ga0068866_10038702 | 3300005718 | Bacteria | 2350 |
| 140 | Ga0068851_10006846 | 3300005834 | Bacteria | 5219 |
| 141 | Ga0068851_10008567 | 3300005834 | Bacteria | 4731 |
| 142 | Ga0068851_10015529 | 3300005834 | Bacteria | 3629 |
| 143 | Ga0068863_100004389 | 3300005841 | Bacteria | 13905 |
| 144 | Ga0068863_100030408 | 3300005841 | Bacteria | 5157 |
| 145 | Ga0068863_100064567 | 3300005841 | Bacteria | 3462 |
| 146 | Ga0068863_100067932 | 3300005841 | Bacteria | 3372 |
| 147 | Ga0068863_100138445 | 3300005841 | Bacteria | 2326 |
| 148 | Ga0068858_100003482 | 3300005842 | Bacteria | 15606 |
| 149 | Ga0068858_100004396 | 3300005842 | Bacteria | 13831 |
| 150 | Ga0068858_100007847 | 3300005842 | Bacteria | 10295 |
| 151 | Ga0068858_100014966 | 3300005842 | Bacteria | 7300 |
| 152 | Ga0068858_100026791 | 3300005842 | Bacteria | 5355 |
| 153 | Ga0068858_100031600 | 3300005842 | Bacteria | 4918 |
| 154 | Ga0068858_100083674 | 3300005842 | Bacteria | 2967 |
| 155 | Ga0068860_100002369 | 3300005843 | Bacteria | 19794 |
| 156 | Ga0068860_100011406 | 3300005843 | Bacteria | 8756 |
| 157 | Ga0068860_100023431 | 3300005843 | Bacteria | 5966 |
| 158 | Ga0068860_100049370 | 3300005843 | Bacteria | 4008 |
| 159 | Ga0068860_100072062 | 3300005843 | Bacteria | 3283 |
| 160 | Ga0081455_10000246 | 3300005937 | Bacteria | 70584 |
| 161 | Ga0081455_10013820 | 3300005937 | Bacteria | 7944 |
| 162 | Ga0081455_10047850 | 3300005937 | Bacteria | 3699 |
| 163 | Ga0081538_10000663 | 3300005981 | Bacteria | 38027 |
| 164 | Ga0081538_10001749 | 3300005981 | Bacteria | 22060 |
| 165 | Ga0081538_10006844 | 3300005981 | Bacteria | 9935 |
| 166 | Ga0081540_1005801 | 3300005983 | Bacteria | 9136 |
| 167 | Ga0081540_1016962 | 3300005983 | Bacteria | 4529 |
| 168 | Ga0070717_10002621 | 3300006028 | Bacteria | 12687 |
| 169 | Ga0070717_10045959 | 3300006028 | Bacteria | 3571 |
| 170 | Ga0070717_10193400 | 3300006028 | Bacteria | 1778 |
| 171 | Ga0075365_10021836 | 3300006038 | Bacteria | 3999 |
| 172 | Ga0075364_10005747 | 3300006051 | Bacteria | 7234 |
| 173 | Ga0070712_100002672 | 3300006175 | Bacteria | 11005 |
| 174 | Ga0070712_100010032 | 3300006175 | Bacteria | 5971 |
| 175 | Ga0070712_100137108 | 3300006175 | Bacteria | 1862 |
| 176 | Ga0075367_10009184 | 3300006178 | Bacteria | 5157 |
| 177 | Ga0075366_10001249 | 3300006195 | Bacteria | 12628 |
| 178 | Ga0097621_100004652 | 3300006237 | Bacteria | 9582 |
| 179 | Ga0097621_100015449 | 3300006237 | Bacteria | 5743 |
| 180 | Ga0097621_100020172 | 3300006237 | Bacteria | 5134 |
| 181 | Ga0097621_100024268 | 3300006237 | Bacteria | 4733 |
| 182 | Ga0097621_100031066 | 3300006237 | Bacteria | 4235 |
| 183 | Ga0097621_100036253 | 3300006237 | Bacteria | 3945 |
| 184 | Ga0097621_100052500 | 3300006237 | Bacteria | 3321 |
| 185 | Ga0097621_100111216 | 3300006237 | Bacteria | 2315 |
| 186 | Ga0068871_100014111 | 3300006358 | Bacteria | 5943 |
| 187 | Ga0068871_100026889 | 3300006358 | Bacteria | 4494 |
| 188 | Ga0068871_100030778 | 3300006358 | Bacteria | 4230 |
| 189 | Ga0068871_100039111 | 3300006358 | Bacteria | 3793 |
| 190 | Ga0068871_100058314 | 3300006358 | Bacteria | 3143 |
| 191 | Ga0068871_100078857 | 3300006358 | Bacteria | 2723 |
| 192 | Ga0075428_100003081 | 3300006844 | Bacteria | 18188 |
| 193 | Ga0075428_100132027 | 3300006844 | Bacteria | 2716 |
| 194 | Ga0075428_100357777 | 3300006844 | Bacteria | 1566 |
| 195 | Ga0075431_100005846 | 3300006847 | Bacteria | 12173 |
| 196 | Ga0075431_100109414 | 3300006847 | Bacteria | 2852 |
| 197 | Ga0075433_10015741 | 3300006852 | Bacteria | 6214 |
| 198 | Ga0075433_10082186 | 3300006852 | Bacteria | 2841 |
| 199 | Ga0075433_10089230 | 3300006852 | Bacteria | 2725 |
| 200 | Ga0075433_10209197 | 3300006852 | Bacteria | 1734 |
| 201 | Ga0075434_100003909 | 3300006871 | Bacteria | 13339 |
| 202 | Ga0075434_100005331 | 3300006871 | Bacteria | 11701 |
| 203 | Ga0075434_100008203 | 3300006871 | Bacteria | 9690 |
| 204 | Ga0075434_100033223 | 3300006871 | Bacteria | 5091 |
| 205 | Ga0075429_100024549 | 3300006880 | Bacteria | 5230 |
| 206 | Ga0068865_100007218 | 3300006881 | Bacteria | 6826 |
| 207 | Ga0068865_100011388 | 3300006881 | Bacteria | 5563 |
| 208 | Ga0068865_100019789 | 3300006881 | Bacteria | 4359 |
| 209 | Ga0068865_100020714 | 3300006881 | Bacteria | 4268 |
| 210 | Ga0097620_100006814 | 3300006931 | Bacteria | 11608 |
| 211 | Ga0097620_100010766 | 3300006931 | Bacteria | 9204 |
| 212 | Ga0097620_100033641 | 3300006931 | Bacteria | 5148 |
| 213 | Ga0097620_100077030 | 3300006931 | Bacteria | 3375 |
| 214 | Ga0097620_100100428 | 3300006931 | Bacteria | 2949 |
| 215 | Ga0097620_100120348 | 3300006931 | Bacteria | 2692 |
| 216 | Ga0075435_100009419 | 3300007076 | Bacteria | 7069 |
| 217 | Ga0099795_10031829 | 3300007788 | Bacteria | 1820 |
| 218 | Ga0105240_10000734 | 3300009093 | Bacteria | 59913 |
| 219 | Ga0105240_10001326 | 3300009093 | Bacteria | 42653 |
| 220 | Ga0105240_10001395 | 3300009093 | Bacteria | 41517 |
| 221 | Ga0105240_10025014 | 3300009093 | Bacteria | 7860 |
| 222 | Ga0105240_10030445 | 3300009093 | Bacteria | 7015 |
| 223 | Ga0105240_10032052 | 3300009093 | Bacteria | 6806 |
| 224 | Ga0105240_10081283 | 3300009093 | Bacteria | 3982 |
| 225 | Ga0105240_10098075 | 3300009093 | Bacteria | 3570 |
| 226 | Ga0111539_10004140 | 3300009094 | Bacteria | 19023 |
| 227 | Ga0111539_10009382 | 3300009094 | Bacteria | 12354 |
| 228 | Ga0111539_10012378 | 3300009094 | Bacteria | 10697 |
| 229 | Ga0111539_10029920 | 3300009094 | Bacteria | 6624 |
| 230 | Ga0111539_10035040 | 3300009094 | Bacteria | 6078 |
| 231 | Ga0111539_10219191 | 3300009094 | Bacteria | 2216 |
| 232 | Ga0105245_10007394 | 3300009098 | Bacteria | 9618 |
| 233 | Ga0105245_10028226 | 3300009098 | Bacteria | 4947 |
| 234 | Ga0105245_10029145 | 3300009098 | Bacteria | 4874 |
| 235 | Ga0105245_10036728 | 3300009098 | Bacteria | 4353 |
| 236 | Ga0105245_10055244 | 3300009098 | Bacteria | 3566 |
| 237 | Ga0105245_10073069 | 3300009098 | Bacteria | 3117 |
| 238 | Ga0105245_10126779 | 3300009098 | Bacteria | 2390 |
| 239 | Ga0114129_10000777 | 3300009147 | Bacteria | 40773 |
| 240 | Ga0114129_10008706 | 3300009147 | Bacteria | 14466 |
| 241 | Ga0114129_10058156 | 3300009147 | Bacteria | 5408 |
| 242 | Ga0114129_10147701 | 3300009147 | Bacteria | 3219 |
| 243 | Ga0114129_10225080 | 3300009147 | Bacteria | 2529 |
| 244 | Ga0114129_10501756 | 3300009147 | Bacteria | 1585 |
| 245 | Ga0105243_10019881 | 3300009148 | Bacteria | 5093 |
| 246 | Ga0105241_10032077 | 3300009174 | Bacteria | 3935 |
| 247 | Ga0105241_10043258 | 3300009174 | Bacteria | 3411 |
| 248 | Ga0105241_10049056 | 3300009174 | Bacteria | 3214 |
| 249 | Ga0105242_10056943 | 3300009176 | Bacteria | 3199 |
| 250 | Ga0105248_10000094 | 3300009177 | Bacteria | 98558 |
| 251 | Ga0105248_10000806 | 3300009177 | Bacteria | 35108 |
| 252 | Ga0105248_10001021 | 3300009177 | Bacteria | 30968 |
| 253 | Ga0105248_10003639 | 3300009177 | Bacteria | 17111 |
| 254 | Ga0105248_10013851 | 3300009177 | Bacteria | 8872 |
| 255 | Ga0105248_10020967 | 3300009177 | Bacteria | 7244 |
| 256 | Ga0105248_10056649 | 3300009177 | Bacteria | 4397 |
| 257 | Ga0105248_10064389 | 3300009177 | Bacteria | 4116 |
| 258 | Ga0105248_10138686 | 3300009177 | Bacteria | 2743 |
| 259 | Ga0105248_10261284 | 3300009177 | Bacteria | 1949 |
| 260 | Ga0105237_10022562 | 3300009545 | Bacteria | 6457 |
| 261 | Ga0105237_10031468 | 3300009545 | Bacteria | 5380 |
| 262 | Ga0105237_10076730 | 3300009545 | Bacteria | 3332 |
| 263 | Ga0105237_10231164 | 3300009545 | Bacteria | 1850 |
| 264 | Ga0105238_10000635 | 3300009551 | Bacteria | 37013 |
| 265 | Ga0105238_10017459 | 3300009551 | Bacteria | 7293 |
| 266 | Ga0105238_10060106 | 3300009551 | Bacteria | 3806 |
| 267 | Ga0105238_10064670 | 3300009551 | Bacteria | 3657 |
| 268 | Ga0105238_10067857 | 3300009551 | Bacteria | 3567 |
| 269 | Ga0105249_10032997 | 3300009553 | Bacteria | 4686 |
| 270 | Ga0105249_10055655 | 3300009553 | Bacteria | 3620 |
| 271 | Ga0105239_10002713 | 3300010375 | Bacteria | 22271 |
| 272 | Ga0105239_10029098 | 3300010375 | Bacteria | 6073 |
| 273 | Ga0105239_10030580 | 3300010375 | Bacteria | 5922 |
| 274 | Ga0105239_10069943 | 3300010375 | Bacteria | 3855 |
| 275 | Ga0105239_10105811 | 3300010375 | Bacteria | 3116 |
| 276 | Ga0105246_10016520 | 3300011119 | Bacteria | 4674 |
| 277 | Ga0157370_10000137 | 3300013104 | Bacteria | 88336 |
| 278 | Ga0157370_10058522 | 3300013104 | Bacteria | 3663 |
| 279 | Ga0157370_10179396 | 3300013104 | Bacteria | 1968 |
| 280 | Ga0157369_10001369 | 3300013105 | Bacteria | 30048 |
| 281 | Ga0157369_10001777 | 3300013105 | Bacteria | 26103 |
| 282 | Ga0157369_10023951 | 3300013105 | Bacteria | 6793 |
| 283 | Ga0157369_10097222 | 3300013105 | Bacteria | 3141 |
| 284 | Ga0157374_10000659 | 3300013296 | Bacteria | 30341 |
| 285 | Ga0157374_10007218 | 3300013296 | Bacteria | 9465 |
| 286 | Ga0157374_10011444 | 3300013296 | Bacteria | 7682 |
| 287 | Ga0157374_10014732 | 3300013296 | Bacteria | 6848 |
| 288 | Ga0157374_10015360 | 3300013296 | Bacteria | 6714 |
| 289 | Ga0157374_10021536 | 3300013296 | Bacteria | 5738 |
| 290 | Ga0157374_10041913 | 3300013296 | Bacteria | 4221 |
| 291 | Ga0157374_10112524 | 3300013296 | Bacteria | 2619 |
| 292 | Ga0157378_10000217 | 3300013297 | Bacteria | 55710 |
| 293 | Ga0157378_10000368 | 3300013297 | Bacteria | 44566 |
| 294 | Ga0157378_10009309 | 3300013297 | Bacteria | 8557 |
| 295 | Ga0157378_10105385 | 3300013297 | Bacteria | 2578 |
| 296 | Ga0157378_10142141 | 3300013297 | Bacteria | 2229 |
| 297 | Ga0163162_10003509 | 3300013306 | Bacteria | 14999 |
| 298 | Ga0163162_10010248 | 3300013306 | Bacteria | 9105 |
| 299 | Ga0163162_10013499 | 3300013306 | Bacteria | 7974 |
| 300 | Ga0163162_10044186 | 3300013306 | Bacteria | 4462 |
| 301 | Ga0163162_10050679 | 3300013306 | Bacteria | 4163 |
| 302 | Ga0163162_10194436 | 3300013306 | Bacteria | 2157 |
| 303 | Ga0163162_10253473 | 3300013306 | Bacteria | 1892 |
| 304 | Ga0163162_10328964 | 3300013306 | Bacteria | 1661 |
| 305 | Ga0157372_10000134 | 3300013307 | Bacteria | 81431 |
| 306 | Ga0157372_10000424 | 3300013307 | Bacteria | 46469 |
| 307 | Ga0157372_10005022 | 3300013307 | Bacteria | 14053 |
| 308 | Ga0157372_10022198 | 3300013307 | Bacteria | 6866 |
| 309 | Ga0157372_10109955 | 3300013307 | Bacteria | 3157 |
| 310 | Ga0157372_10249923 | 3300013307 | Bacteria | 2058 |
| 311 | Ga0157375_10001430 | 3300013308 | Bacteria | 20541 |
| 312 | Ga0157375_10051835 | 3300013308 | Bacteria | 4032 |
| 313 | Ga0157375_10060584 | 3300013308 | Bacteria | 3754 |
| 314 | Ga0157375_10122408 | 3300013308 | Bacteria | 2713 |
| 315 | Ga0157375_10129329 | 3300013308 | Bacteria | 2643 |
| 316 | Ga0157375_10287886 | 3300013308 | Bacteria | 1806 |
| 317 | Ga0163163_10000729 | 3300014325 | Bacteria | 27951 |
| 318 | Ga0163163_10007573 | 3300014325 | Bacteria | 9591 |
| 319 | Ga0163163_10026318 | 3300014325 | Bacteria | 5559 |
| 320 | Ga0163163_10051412 | 3300014325 | Bacteria | 4064 |
| 321 | Ga0163163_10075764 | 3300014325 | Bacteria | 3358 |
| 322 | Ga0163163_10205888 | 3300014325 | Bacteria | 2016 |
| 323 | Ga0157380_10023314 | 3300014326 | Bacteria | 4668 |
| 324 | Ga0157377_10039805 | 3300014745 | Bacteria | 2601 |
| 325 | Ga0157379_10022635 | 3300014968 | Bacteria | 5568 |
| 326 | Ga0157379_10045112 | 3300014968 | Bacteria | 3935 |
| 327 | Ga0157376_10021045 | 3300014969 | Bacteria | 5060 |
| 328 | Ga0157376_10032863 | 3300014969 | Bacteria | 4170 |
| 329 | Ga0157376_10036571 | 3300014969 | Bacteria | 3979 |
| 330 | Ga0157376_10066786 | 3300014969 | Bacteria | 3041 |
| 331 | Ga0157376_10067881 | 3300014969 | Bacteria | 3017 |
| 332 | Ga0157376_10094775 | 3300014969 | Bacteria | 2594 |
| 333 | Ga0182007_10005535 | 3300015262 | Bacteria | 5530 |
| 334 | Ga0163161_10018153 | 3300017792 | Bacteria | 4931 |
| 335 | Ga0213872_10001564 | 3300021361 | Bacteria | 14608 |
| 336 | Ga0213872_10034060 | 3300021361 | Bacteria | 2332 |
| 337 | Ga0213876_10036843 | 3300021384 | Bacteria | 2580 |
| 338 | Ga0213875_10000004 | 3300021388 | Bacteria | 703388 |
| 339 | Ga0213875_10000313 | 3300021388 | Bacteria | 46302 |
| 340 | Ga0213875_10010292 | 3300021388 | Bacteria | 4686 |
| 341 | Ga0213875_10010911 | 3300021388 | Bacteria | 4539 |
| 342 | Ga0213871_10003941 | 3300021441 | Bacteria | 2918 |
| 343 | Ga0224569_100108 | 3300022732 | Bacteria | 5748 |
| 344 | Ga0228598_1001374 | 3300024227 | Bacteria | 5347 |
| 345 | Ga0207656_10008171 | 3300025321 | Bacteria | 3841 |
| 346 | Ga0207692_10027104 | 3300025898 | Bacteria | 2695 |
| 347 | Ga0207642_10034805 | 3300025899 | Bacteria | 2145 |
| 348 | Ga0207680_10008418 | 3300025903 | Bacteria | 5063 |
| 349 | Ga0207680_10017582 | 3300025903 | Bacteria | 3781 |
| 350 | Ga0207680_10041434 | 3300025903 | Bacteria | 2686 |
| 351 | Ga0207699_10000209 | 3300025906 | Bacteria | 34945 |
| 352 | Ga0207699_10126074 | 3300025906 | Bacteria | 1662 |
| 353 | Ga0207643_10032617 | 3300025908 | Bacteria | 2910 |
| 354 | Ga0207684_10011624 | 3300025910 | Bacteria | 7688 |
| 355 | Ga0207684_10027366 | 3300025910 | Bacteria | 4859 |
| 356 | Ga0207684_10029639 | 3300025910 | Bacteria | 4659 |
| 357 | Ga0207684_10040107 | 3300025910 | Bacteria | 3969 |
| 358 | Ga0207684_10055510 | 3300025910 | Bacteria | 3360 |
| 359 | Ga0207654_10056884 | 3300025911 | Bacteria | 2271 |
| 360 | Ga0207654_10082870 | 3300025911 | Bacteria | 1935 |
| 361 | Ga0207707_10021854 | 3300025912 | Bacteria | 5592 |
| 362 | Ga0207707_10037500 | 3300025912 | Bacteria | 4236 |
| 363 | Ga0207695_10000379 | 3300025913 | Bacteria | 101331 |
| 364 | Ga0207695_10003457 | 3300025913 | Bacteria | 22260 |
| 365 | Ga0207695_10017528 | 3300025913 | Bacteria | 8330 |
| 366 | Ga0207695_10025208 | 3300025913 | Bacteria | 6664 |
| 367 | Ga0207695_10026384 | 3300025913 | Bacteria | 6484 |
| 368 | Ga0207695_10027004 | 3300025913 | Bacteria | 6397 |
| 369 | Ga0207695_10030031 | 3300025913 | Bacteria | 5992 |
| 370 | Ga0207695_10052463 | 3300025913 | Bacteria | 4272 |
| 371 | Ga0207695_10134305 | 3300025913 | Bacteria | 2429 |
| 372 | Ga0207695_10275964 | 3300025913 | Bacteria | 1575 |
| 373 | Ga0207671_10143354 | 3300025914 | Bacteria | 1842 |
| 374 | Ga0207671_10190968 | 3300025914 | Bacteria | 1597 |
| 375 | Ga0207693_10000026 | 3300025915 | Bacteria | 122717 |
| 376 | Ga0207693_10062889 | 3300025915 | Bacteria | 2908 |
| 377 | Ga0207693_10085307 | 3300025915 | Bacteria | 2474 |
| 378 | Ga0207693_10120672 | 3300025915 | Bacteria | 2059 |
| 379 | Ga0207663_10030366 | 3300025916 | Bacteria | 3188 |
| 380 | Ga0207663_10050554 | 3300025916 | Bacteria | 2584 |
| 381 | Ga0207663_10116911 | 3300025916 | Bacteria | 1819 |
| 382 | Ga0207662_10013090 | 3300025918 | Bacteria | 4634 |
| 383 | Ga0207657_10002375 | 3300025919 | Bacteria | 20365 |
| 384 | Ga0207657_10168175 | 3300025919 | Bacteria | 1777 |
| 385 | Ga0207652_10016109 | 3300025921 | Bacteria | 6097 |
| 386 | Ga0207652_10019567 | 3300025921 | Bacteria | 5569 |
| 387 | Ga0207652_10185568 | 3300025921 | Bacteria | 1870 |
| 388 | Ga0207652_10285851 | 3300025921 | Bacteria | 1488 |
| 389 | Ga0207646_10000037 | 3300025922 | Bacteria | 196362 |
| 390 | Ga0207646_10015090 | 3300025922 | Bacteria | 7310 |
| 391 | Ga0207646_10026227 | 3300025922 | Bacteria | 5320 |
| 392 | Ga0207646_10116923 | 3300025922 | Bacteria | 2395 |
| 393 | Ga0207646_10126089 | 3300025922 | Bacteria | 2302 |
| 394 | Ga0207694_10000580 | 3300025924 | Bacteria | 33080 |
| 395 | Ga0207694_10021413 | 3300025924 | Bacteria | 4899 |
| 396 | Ga0207694_10032572 | 3300025924 | Bacteria | 3990 |
| 397 | Ga0207694_10096202 | 3300025924 | Bacteria | 2342 |
| 398 | Ga0207694_10097298 | 3300025924 | Bacteria | 2329 |
| 399 | Ga0207694_10117124 | 3300025924 | Bacteria | 2124 |
| 400 | Ga0207650_10020427 | 3300025925 | Bacteria | 4671 |
| 401 | Ga0207659_10000323 | 3300025926 | Bacteria | 28799 |
| 402 | Ga0207687_10006068 | 3300025927 | Bacteria | 7996 |
| 403 | Ga0207687_10030888 | 3300025927 | Bacteria | 3616 |
| 404 | Ga0207687_10036583 | 3300025927 | Bacteria | 3344 |
| 405 | Ga0207687_10096892 | 3300025927 | Bacteria | 2163 |
| 406 | Ga0207700_10000306 | 3300025928 | Bacteria | 28993 |
| 407 | Ga0207700_10032295 | 3300025928 | Bacteria | 3732 |
| 408 | Ga0207700_10098503 | 3300025928 | Bacteria | 2326 |
| 409 | Ga0207664_10000087 | 3300025929 | Bacteria | 88607 |
| 410 | Ga0207664_10012309 | 3300025929 | Bacteria | 6111 |
| 411 | Ga0207664_10041011 | 3300025929 | Bacteria | 3604 |
| 412 | Ga0207664_10127559 | 3300025929 | Bacteria | 2138 |
| 413 | Ga0207644_10000680 | 3300025931 | Bacteria | 21467 |
| 414 | Ga0207644_10022432 | 3300025931 | Bacteria | 4314 |
| 415 | Ga0207644_10029090 | 3300025931 | Bacteria | 3830 |
| 416 | Ga0207690_10054616 | 3300025932 | Bacteria | 2686 |
| 417 | Ga0207706_10011869 | 3300025933 | Bacteria | 7931 |
| 418 | Ga0207706_10060961 | 3300025933 | Bacteria | 3322 |
| 419 | Ga0207670_10028880 | 3300025936 | Bacteria | 3527 |
| 420 | Ga0207665_10007676 | 3300025939 | Bacteria | 7121 |
| 421 | Ga0207665_10017617 | 3300025939 | Bacteria | 4694 |
| 422 | Ga0207665_10038334 | 3300025939 | Bacteria | 3191 |
| 423 | Ga0207665_10137176 | 3300025939 | Bacteria | 1742 |
| 424 | Ga0207691_10002288 | 3300025940 | Bacteria | 18746 |
| 425 | Ga0207691_10002504 | 3300025940 | Bacteria | 17973 |
| 426 | Ga0207691_10005514 | 3300025940 | Bacteria | 12227 |
| 427 | Ga0207711_10000086 | 3300025941 | Bacteria | 99422 |
| 428 | Ga0207711_10000700 | 3300025941 | Bacteria | 33079 |
| 429 | Ga0207711_10001388 | 3300025941 | Bacteria | 22791 |
| 430 | Ga0207711_10010324 | 3300025941 | Bacteria | 7758 |
| 431 | Ga0207711_10031160 | 3300025941 | Bacteria | 4500 |
| 432 | Ga0207711_10046036 | 3300025941 | Bacteria | 3727 |
| 433 | Ga0207711_10066709 | 3300025941 | Bacteria | 3112 |
| 434 | Ga0207711_10122552 | 3300025941 | Bacteria | 2322 |
| 435 | Ga0207689_10021270 | 3300025942 | Bacteria | 5454 |
| 436 | Ga0207661_10000003 | 3300025944 | Bacteria | 611941 |
| 437 | Ga0207661_10033901 | 3300025944 | Bacteria | 3966 |
| 438 | Ga0207661_10146655 | 3300025944 | Bacteria | 2037 |
| 439 | Ga0207679_10015286 | 3300025945 | Bacteria | 5067 |
| 440 | Ga0207679_10049078 | 3300025945 | Bacteria | 3077 |
| 441 | Ga0207679_10079496 | 3300025945 | Bacteria | 2501 |
| 442 | Ga0207679_10136949 | 3300025945 | Bacteria | 1973 |
| 443 | Ga0207667_10002416 | 3300025949 | Bacteria | 23398 |
| 444 | Ga0207667_10004201 | 3300025949 | Bacteria | 17682 |
| 445 | Ga0207667_10019621 | 3300025949 | Bacteria | 7540 |
| 446 | Ga0207667_10042670 | 3300025949 | Bacteria | 4820 |
| 447 | Ga0207667_10109697 | 3300025949 | Bacteria | 2846 |
| 448 | Ga0207667_10117717 | 3300025949 | Bacteria | 2738 |
| 449 | Ga0207667_10162015 | 3300025949 | Bacteria | 2300 |
| 450 | Ga0207651_10018593 | 3300025960 | Bacteria | 4141 |
| 451 | Ga0207640_10009549 | 3300025981 | Bacteria | 5435 |
| 452 | Ga0207640_10068528 | 3300025981 | Bacteria | 2378 |
| 453 | Ga0207658_10013308 | 3300025986 | Bacteria | 5618 |
| 454 | Ga0207658_10027029 | 3300025986 | Bacteria | 4029 |
| 455 | Ga0207677_10008947 | 3300026023 | Bacteria | 5617 |
| 456 | Ga0207677_10084994 | 3300026023 | Bacteria | 2282 |
| 457 | Ga0207703_10001176 | 3300026035 | Bacteria | 24683 |
| 458 | Ga0207703_10042274 | 3300026035 | Bacteria | 3655 |
| 459 | Ga0207703_10152881 | 3300026035 | Bacteria | 2014 |
| 460 | Ga0207639_10002985 | 3300026041 | Bacteria | 11391 |
| 461 | Ga0207639_10012613 | 3300026041 | Bacteria | 5890 |
| 462 | Ga0207702_10016913 | 3300026078 | Bacteria | 6036 |
| 463 | Ga0207702_10033923 | 3300026078 | Bacteria | 4265 |
| 464 | Ga0207702_10045554 | 3300026078 | Bacteria | 3689 |
| 465 | Ga0207702_10060335 | 3300026078 | Bacteria | 3233 |
| 466 | Ga0207702_10076439 | 3300026078 | Bacteria | 2895 |
| 467 | Ga0207702_10113976 | 3300026078 | Bacteria | 2409 |
| 468 | Ga0207641_10008247 | 3300026088 | Bacteria | 8611 |
| 469 | Ga0207641_10024896 | 3300026088 | Bacteria | 4934 |
| 470 | Ga0207641_10039613 | 3300026088 | Bacteria | 3942 |
| 471 | Ga0207641_10131929 | 3300026088 | Bacteria | 2244 |
| 472 | Ga0207641_10223320 | 3300026088 | Bacteria | 1748 |
| 473 | Ga0207641_10243380 | 3300026088 | Bacteria | 1677 |
| 474 | Ga0207648_10051935 | 3300026089 | Bacteria | 3584 |
| 475 | Ga0207676_10001580 | 3300026095 | Bacteria | 16746 |
| 476 | Ga0207676_10007865 | 3300026095 | Bacteria | 7582 |
| 477 | Ga0207676_10023619 | 3300026095 | Bacteria | 4539 |
| 478 | Ga0207676_10120621 | 3300026095 | Bacteria | 2211 |
| 479 | Ga0207674_10045779 | 3300026116 | Bacteria | 4497 |
| 480 | Ga0207683_10031448 | 3300026121 | Bacteria | 4607 |
| 481 | Ga0207683_10199904 | 3300026121 | Bacteria | 1816 |
| 482 | Ga0207698_10000039 | 3300026142 | Bacteria | 101073 |
| 483 | Ga0207698_10146550 | 3300026142 | Bacteria | 2043 |
| 484 | Ga0209179_1000419 | 3300027512 | Bacteria | 4230 |
| 485 | Ga0209588_1008548 | 3300027671 | Bacteria | 3039 |
| 486 | Ga0207428_10000328 | 3300027907 | Bacteria | 61709 |
| 487 | Ga0207428_10014125 | 3300027907 | Bacteria | 6952 |
| 488 | Ga0207428_10017744 | 3300027907 | Bacteria | 6103 |
| 489 | Ga0207428_10049822 | 3300027907 | Bacteria | 3354 |
| 490 | Ga0207428_10126900 | 3300027907 | Bacteria | 1953 |
| 491 | Ga0265354_1001157 | 3300028016 | Bacteria | 4025 |
| 492 | Ga0265356_1000458 | 3300028017 | Bacteria | 7408 |
| 493 | Ga0268266_10007530 | 3300028379 | Bacteria | 9809 |
| 494 | Ga0268266_10018388 | 3300028379 | Bacteria | 5956 |
| 495 | Ga0268266_10019116 | 3300028379 | Bacteria | 5834 |
| 496 | Ga0268266_10032090 | 3300028379 | Bacteria | 4461 |
| 497 | Ga0268265_10036808 | 3300028380 | Bacteria | 3587 |
| 498 | Ga0268264_10002388 | 3300028381 | Bacteria | 16546 |
| 499 | Ga0268264_10003579 | 3300028381 | Bacteria | 13380 |
| 500 | Ga0268264_10009249 | 3300028381 | Bacteria | 8158 |
| 501 | Ga0268264_10047817 | 3300028381 | Bacteria | 3557 |
| 502 | Ga0268264_10183319 | 3300028381 | Bacteria | 1903 |
| 503 | Ga0265319_1000426 | 3300028563 | Bacteria | 30400 |
| 504 | Ga0265318_10000466 | 3300028577 | Bacteria | 30068 |
| 505 | Ga0265318_10002124 | 3300028577 | Bacteria | 10787 |
| 506 | Ga0265323_10001872 | 3300028653 | Bacteria | 9946 |
| 507 | Ga0265336_10002446 | 3300028666 | Bacteria | 7654 |
| 508 | Ga0265336_10003601 | 3300028666 | Bacteria | 6050 |
| 509 | Ga0265338_10007828 | 3300028800 | Bacteria | 13133 |
| 510 | Ga0265338_10045724 | 3300028800 | Bacteria | 4021 |
| 511 | Ga0265338_10132983 | 3300028800 | Bacteria | 1961 |
| 512 | Ga0265762_1003998 | 3300030760 | Bacteria | 2643 |
| 513 | Ga0265760_10000014 | 3300031090 | Bacteria | 93274 |
| 514 | Ga0265330_10000107 | 3300031235 | Bacteria | 69658 |
| 515 | Ga0265330_10006445 | 3300031235 | Bacteria | 5801 |
| 516 | Ga0265332_10006044 | 3300031238 | Bacteria | 5530 |
| 517 | Ga0265332_10022224 | 3300031238 | Bacteria | 2800 |
| 518 | Ga0265328_10000456 | 3300031239 | Bacteria | 19024 |
| 519 | Ga0265328_10003578 | 3300031239 | Bacteria | 6851 |
| 520 | Ga0265320_10000126 | 3300031240 | Bacteria | 66933 |
| 521 | Ga0265320_10006467 | 3300031240 | Bacteria | 7386 |
| 522 | Ga0265320_10040964 | 3300031240 | Bacteria | 2306 |
| 523 | Ga0265325_10000066 | 3300031241 | Bacteria | 73035 |
| 524 | Ga0265325_10000701 | 3300031241 | Bacteria | 24270 |
| 525 | Ga0265325_10001419 | 3300031241 | Bacteria | 16872 |
| 526 | Ga0265325_10005096 | 3300031241 | Bacteria | 8175 |
| 527 | Ga0265325_10010234 | 3300031241 | Bacteria | 5442 |
| 528 | Ga0265325_10010895 | 3300031241 | Bacteria | 5238 |
| 529 | Ga0265329_10000274 | 3300031242 | Bacteria | 27297 |
| 530 | Ga0265340_10001016 | 3300031247 | Bacteria | 15986 |
| 531 | Ga0265340_10001113 | 3300031247 | Bacteria | 15346 |
| 532 | Ga0265340_10006158 | 3300031247 | Bacteria | 6616 |
| 533 | Ga0265340_10007209 | 3300031247 | Bacteria | 6053 |
| 534 | Ga0265340_10039049 | 3300031247 | Bacteria | 2346 |
| 535 | Ga0265339_10000029 | 3300031249 | Bacteria | 139089 |
| 536 | Ga0265339_10000555 | 3300031249 | Bacteria | 29182 |
| 537 | Ga0265339_10000921 | 3300031249 | Bacteria | 22618 |
| 538 | Ga0265339_10001016 | 3300031249 | Bacteria | 21354 |
| 539 | Ga0265339_10003294 | 3300031249 | Bacteria | 11307 |
| 540 | Ga0265339_10036200 | 3300031249 | Bacteria | 2764 |
| 541 | Ga0265331_10000025 | 3300031250 | Bacteria | 229346 |
| 542 | Ga0265331_10009321 | 3300031250 | Bacteria | 5518 |
| 543 | Ga0265331_10019068 | 3300031250 | Bacteria | 3546 |
| 544 | Ga0265316_10000447 | 3300031344 | Bacteria | 46965 |
| 545 | Ga0265316_10000784 | 3300031344 | Bacteria | 35048 |
| 546 | Ga0265316_10003190 | 3300031344 | Bacteria | 16676 |
| 547 | Ga0265316_10008523 | 3300031344 | Bacteria | 9504 |
| 548 | Ga0265316_10010718 | 3300031344 | Bacteria | 8328 |
| 549 | Ga0265316_10012698 | 3300031344 | Bacteria | 7537 |
| 550 | Ga0265316_10052881 | 3300031344 | Bacteria | 3184 |
| 551 | Ga0265316_10101414 | 3300031344 | Bacteria | 2187 |
| 552 | Ga0265313_10001112 | 3300031595 | Bacteria | 25726 |
| 553 | Ga0265313_10001195 | 3300031595 | Bacteria | 24872 |
| 554 | Ga0265313_10001537 | 3300031595 | Bacteria | 21459 |
| 555 | Ga0265313_10012844 | 3300031595 | Bacteria | 5082 |
| 556 | Ga0265313_10023461 | 3300031595 | Bacteria | 3322 |
| 557 | Ga0265314_10000195 | 3300031711 | Bacteria | 90391 |
| 558 | Ga0265314_10001212 | 3300031711 | Bacteria | 29629 |
| 559 | Ga0265314_10001907 | 3300031711 | Bacteria | 22286 |
| 560 | Ga0265314_10029621 | 3300031711 | Bacteria | 4064 |
| 561 | Ga0265314_10081880 | 3300031711 | Bacteria | 2125 |
| 562 | Ga0265342_10000078 | 3300031712 | Bacteria | 105279 |
| 563 | Ga0265342_10000307 | 3300031712 | Bacteria | 55504 |
| 564 | Ga0265342_10000362 | 3300031712 | Bacteria | 50260 |
| 565 | Ga0265342_10001748 | 3300031712 | Bacteria | 19819 |
| 566 | Ga0265342_10008829 | 3300031712 | Bacteria | 7186 |
| 567 | Ga0265342_10032177 | 3300031712 | Bacteria | 3236 |
| 568 | Ga0265342_10040530 | 3300031712 | Bacteria | 2824 |
| 569 | Ga0265342_10081202 | 3300031712 | Bacteria | 1873 |
| 570 | Ga0265342_10089954 | 3300031712 | Bacteria | 1761 |
| 571 | Ga0307510_10027922 | 3300033180 | Bacteria | 6455 |
| 572 | Ga0373926_0018032 | 3300035083 | Bacteria | 2426 |
| 573 | Ga0373936_0005113 | 3300035113 | Bacteria | 4938 |
| 574 | Ga0373956_0027979 | 3300035119 | Bacteria | 2451 |
| 575 | Ga0373943_0000594 | 3300035170 | Bacteria | 15714 |
| 576 | Ga0373935_0002647 | 3300035692 | Bacteria | 10291 |
| 577 | Ga0373927_0000747 | 3300035695 | Bacteria | 24845 |
| 578 | Ga0373927_0000934 | 3300035695 | Bacteria | 22198 |
| 579 | Ga0373927_0013916 | 3300035695 | Bacteria | 5337 |
| 580 | Ga0373927_0020079 | 3300035695 | Bacteria | 4382 |
| 581 | Ga0373927_0095626 | 3300035695 | Bacteria | 1931 |
| 582 | Ga0373933_0000129 | 3300035724 | Bacteria | 47946 |
| 583 | Ga0373933_0029156 | 3300035724 | Bacteria | 3189 |
| 584 | Ga0373933_0039134 | 3300035724 | Bacteria | 2789 |
| 585 | Ga0373947_0000971 | 3300035725 | Bacteria | 17501 |
| 586 | Ga0373947_0007329 | 3300035725 | Bacteria | 6387 |
| 587 | Ga0373947_0020980 | 3300035725 | Bacteria | 3779 |
| 588 | Ga0373947_0037861 | 3300035725 | Bacteria | 2863 |
| 589 | Ga0373937_0000015 | 3300036401 | Bacteria | 148228 |
| 590 | Ga0373937_0010379 | 3300036401 | Bacteria | 8133 |
| 591 | Ga0373937_0063269 | 3300036401 | Bacteria | 3403 |
| 592 | Ga0373937_0083455 | 3300036401 | Bacteria | 2956 |
| 593 | Ga0373937_0110752 | 3300036401 | Bacteria | 2553 |
| 594 | Ga0373937_0166954 | 3300036401 | Bacteria | 2064 |
| 595 | Ga0373925_0015527 | 3300037068 | Bacteria | 5509 |
| 596 | Ga0373925_0019549 | 3300037068 | Bacteria | 4927 |
| 597 | Ga0373925_0028771 | 3300037068 | Bacteria | 4073 |
| 598 | Ga0373925_0118237 | 3300037068 | Bacteria | 2055 |
| 599 | Ga0395905_0057134 | 3300037471 | Bacteria | 3650 |
| 600 | Ga0436364_0177309 | 3300037853 | Bacteria | 4598 |
| 601 | Ga0436364_0288437 | 3300037853 | Bacteria | 7086 |
| 602 | Ga0436364_0748068 | 3300037853 | Bacteria | 528910 |
| 603 | Ga0436364_0880534 | 3300037853 | Bacteria | 127762 |
| 604 | Ga0436364_0895125 | 3300037853 | Bacteria | 1982 |
| 605 | Ga0436364_1448794 | 3300037853 | Bacteria | 5505 |
| 606 | Ga0436364_1499157 | 3300037853 | Bacteria | 5197 |
| 607 | Ga0436364_1535143 | 3300037853 | Bacteria | 15848 |
| 608 | Ga0436365_0343849 | 3300039437 | Bacteria | 5409 |
| 609 | Ga0436365_0612444 | 3300039437 | Bacteria | 5369 |
| 610 | Ga0436365_1466946 | 3300039437 | Bacteria | 2639 |
| 611 | Ga0436360_1307109 | 3300039438 | Bacteria | 36883 |
| 612 | Ga0436360_1314441 | 3300039438 | Bacteria | 19937 |
| 613 | Ga0436361_0350897 | 3300039447 | Bacteria | 18933 |
| 614 | Ga0436361_0379682 | 3300039447 | Bacteria | 5824 |
| 615 | Ga0436361_0464047 | 3300039447 | Bacteria | 78853 |
| 616 | Ga0436363_0100069 | 3300039450 | Bacteria | 1900 |
| 617 | Ga0451577_0044266 | 3300042876 | Bacteria | 3985 |
| 618 | Ga0453683_0042654 | 3300044673 | Bacteria | 2848 |
| 619 | Ga0466963_0117463 | 3300044694 | Bacteria | 1828 |
| 620 | Ga0453684_0000397 | 3300044712 | Bacteria | 179262 |
| 621 | Ga0451576_0013704 | 3300045051 | Bacteria | 9056 |
| 622 | Ga0451576_0100191 | 3300045051 | Bacteria | 3013 |
| 623 | Ga0466967_0135452 | 3300045976 | Bacteria | 2290 |
| 624 | Ga0495592_0004333 | 3300046454 | Bacteria | 10382 |
| 625 | Ga0495592_0007581 | 3300046454 | Bacteria | 8126 |
| 626 | Ga0495592_0079214 | 3300046454 | Bacteria | 2378 |
| 627 | Ga0495603_0047299 | 3300046455 | Bacteria | 2562 |
| 628 | Ga0495629_0011385 | 3300046459 | Bacteria | 6461 |
| 629 | Ga0495629_0044354 | 3300046459 | Bacteria | 3121 |
| 630 | Ga0495629_0063849 | 3300046459 | Bacteria | 2571 |
| 631 | Ga0495629_0082179 | 3300046459 | Bacteria | 2248 |
| 632 | Ga0495651_0000269 | 3300046462 | Bacteria | 40351 |
| 633 | Ga0495651_0006179 | 3300046462 | Bacteria | 9147 |
| 634 | Ga0495651_0006705 | 3300046462 | Bacteria | 8801 |
| 635 | Ga0495651_0029939 | 3300046462 | Bacteria | 4245 |
| 636 | Ga0495651_0080881 | 3300046462 | Bacteria | 2453 |
| 637 | Ga0495653_0007181 | 3300046463 | Bacteria | 9131 |
| 638 | Ga0495653_0010352 | 3300046463 | Bacteria | 7627 |
| 639 | Ga0495650_0000010 | 3300046471 | Bacteria | 645599 |
| 640 | Ga0495580_0001289 | 3300046472 | Bacteria | 22103 |
| 641 | Ga0495580_0004497 | 3300046472 | Bacteria | 11712 |
| 642 | Ga0495580_0004544 | 3300046472 | Bacteria | 11653 |
| 643 | Ga0495580_0005237 | 3300046472 | Bacteria | 10776 |
| 644 | Ga0495580_0009412 | 3300046472 | Bacteria | 7686 |
| 645 | Ga0495580_0017276 | 3300046472 | Bacteria | 5400 |
| 646 | Ga0495580_0025378 | 3300046472 | Bacteria | 4332 |
| 647 | Ga0495580_0026686 | 3300046472 | Bacteria | 4208 |
| 648 | Ga0495580_0046103 | 3300046472 | Bacteria | 3095 |
| 649 | Ga0495580_0048974 | 3300046472 | Bacteria | 2990 |
| 650 | Ga0495582_0000706 | 3300046473 | Bacteria | 18439 |
| 651 | Ga0495582_0002662 | 3300046473 | Bacteria | 9966 |
| 652 | Ga0495582_0008306 | 3300046473 | Bacteria | 5731 |
| 653 | Ga0495582_0017131 | 3300046473 | Bacteria | 3966 |
| 654 | Ga0495639_0011597 | 3300046475 | Bacteria | 3803 |
| 655 | Ga0495662_0007670 | 3300046476 | Bacteria | 5318 |
| 656 | Ga0495662_0053847 | 3300046476 | Bacteria | 1943 |
| 657 | Ga0495664_0007875 | 3300046477 | Bacteria | 5931 |
| 658 | Ga0495664_0016909 | 3300046477 | Bacteria | 4164 |
| 659 | Ga0495594_0032020 | 3300046499 | Bacteria | 2852 |
| 660 | Ga0495606_0038902 | 3300046507 | Bacteria | 3213 |
| 661 | Ga0495608_0038397 | 3300046511 | Bacteria | 3216 |
| 662 | Ga0495628_0001626 | 3300046516 | Bacteria | 20577 |
| 663 | Ga0495628_0021843 | 3300046516 | Bacteria | 5260 |
| 664 | Ga0495628_0048485 | 3300046516 | Bacteria | 3367 |
| 665 | Ga0495630_0065793 | 3300046517 | Bacteria | 2724 |
| 666 | Ga0495644_0000350 | 3300046523 | Bacteria | 20849 |
| 667 | Ga0495652_0002034 | 3300046529 | Bacteria | 21479 |
| 668 | Ga0495652_0071196 | 3300046529 | Bacteria | 2904 |
| 669 | Ga0495652_0079728 | 3300046529 | Bacteria | 2706 |
| 670 | Ga0495665_0000288 | 3300046531 | Bacteria | 25561 |
| 671 | Ga0495665_0048691 | 3300046531 | Bacteria | 2247 |
| 672 | Ga0495640_0033523 | 3300046533 | Bacteria | 3647 |
| 673 | Ga0495586_0046721 | 3300046535 | Bacteria | 2335 |
| 674 | Ga0495587_0000081 | 3300046536 | Bacteria | 74942 |
| 675 | Ga0495587_0010143 | 3300046536 | Bacteria | 6009 |
| 676 | Ga0495587_0065985 | 3300046536 | Bacteria | 2112 |
| 677 | Ga0495587_0093025 | 3300046536 | Bacteria | 1741 |
| 678 | Ga0495645_0005411 | 3300046543 | Bacteria | 8757 |
| 679 | Ga0495645_0047065 | 3300046543 | Bacteria | 3143 |
| 680 | Ga0495645_0063109 | 3300046543 | Bacteria | 2683 |
| 681 | Ga0495667_0000465 | 3300046559 | Bacteria | 25809 |
| 682 | Ga0495667_0000598 | 3300046559 | Bacteria | 22976 |
| 683 | Ga0495667_0004027 | 3300046559 | Bacteria | 9878 |
| 684 | Ga0495667_0004030 | 3300046559 | Bacteria | 9875 |
| 685 | Ga0495667_0032624 | 3300046559 | Bacteria | 3489 |
| 686 | Ga0495668_0022228 | 3300046616 | Bacteria | 3627 |
| 687 | Ga0495634_0004373 | 3300046642 | Bacteria | 11123 |
| 688 | Ga0495634_0027186 | 3300046642 | Bacteria | 3981 |
| 689 | Ga0495634_0065842 | 3300046642 | Bacteria | 2400 |
| 690 | Ga0495625_0035758 | 3300046660 | Bacteria | 3658 |
| 691 | Ga0495635_0026072 | 3300046663 | Bacteria | 4070 |
| 692 | Ga0495635_0068704 | 3300046663 | Bacteria | 2430 |
| 693 | Ga0495659_0002458 | 3300046664 | Bacteria | 5983 |
| 694 | Ga0495657_0001605 | 3300046675 | Bacteria | 19438 |
| 695 | Ga0495657_0019966 | 3300046675 | Bacteria | 4826 |
| 696 | Ga0495657_0026775 | 3300046675 | Bacteria | 4080 |
| 697 | Ga0495599_0005464 | 3300046678 | Bacteria | 7600 |
| 698 | Ga0495599_0013062 | 3300046678 | Bacteria | 5127 |
| 699 | Ga0495599_0050103 | 3300046678 | Bacteria | 2617 |
| 700 | Ga0495599_0053415 | 3300046678 | Bacteria | 2531 |
| 701 | Ga0495623_0012532 | 3300046679 | Bacteria | 5485 |
| 702 | Ga0495623_0018844 | 3300046679 | Bacteria | 4456 |
| 703 | Ga0495623_0023174 | 3300046679 | Bacteria | 4007 |
| 704 | Ga0495646_0048952 | 3300046680 | Bacteria | 2566 |
| 705 | Ga0495658_0011190 | 3300046683 | Bacteria | 4505 |
| 706 | Ga0495669_0017547 | 3300046684 | Bacteria | 3072 |
| 707 | Ga0495613_0005267 | 3300046689 | Bacteria | 9714 |
| 708 | Ga0495613_0014721 | 3300046689 | Bacteria | 5805 |
| 709 | Ga0495624_0008050 | 3300046690 | Bacteria | 7383 |
| 710 | Ga0495624_0058452 | 3300046690 | Bacteria | 2421 |
| 711 | Ga0495600_0002044 | 3300046809 | Bacteria | 11367 |
| 712 | Ga0495600_0003665 | 3300046809 | Bacteria | 9069 |
| 713 | Ga0495600_0076059 | 3300046809 | Bacteria | 2192 |
| 714 | Ga0495581_0005319 | 3300047315 | Bacteria | 7447 |
| 715 | Ga0495581_0016892 | 3300047315 | Bacteria | 4241 |
| 716 | Ga0495581_0086809 | 3300047315 | Bacteria | 1814 |
| 717 | Ga0495604_0000736 | 3300047317 | Bacteria | 27505 |
| 718 | Ga0495604_0022691 | 3300047317 | Bacteria | 5011 |
| 719 | Ga0495604_0072850 | 3300047317 | Bacteria | 2595 |
| 720 | Ga0495636_0016157 | 3300047318 | Bacteria | 2979 |
| 721 | Ga0495674_0006123 | 3300047319 | Bacteria | 11552 |
| 722 | Ga0495674_0047949 | 3300047319 | Bacteria | 3784 |
| 723 | Ga0495674_0117468 | 3300047319 | Bacteria | 2250 |
| 724 | Ga0495674_0168743 | 3300047319 | Bacteria | 1827 |
| 725 | Ga0495672_0082865 | 3300047320 | Bacteria | 1783 |
| 726 | Ga0495676_0021782 | 3300047321 | Bacteria | 5589 |
| 727 | Ga0495676_0044034 | 3300047321 | Bacteria | 3647 |
| 728 | Ga0495680_0000041 | 3300047322 | Bacteria | 99386 |
| 729 | Ga0495680_0082475 | 3300047322 | Bacteria | 2426 |
| 730 | Ga0495675_0000349 | 3300047444 | Bacteria | 32511 |
| 731 | Ga0495675_0001165 | 3300047444 | Bacteria | 15958 |
| 732 | Ga0495675_0001405 | 3300047444 | Bacteria | 14584 |
| 733 | Ga0495675_0049625 | 3300047444 | Bacteria | 2667 |
| 734 | Ga0495684_0000521 | 3300047471 | Bacteria | 31227 |
| 735 | Ga0495684_0001787 | 3300047471 | Bacteria | 17259 |
| 736 | Ga0495684_0035646 | 3300047471 | Bacteria | 3814 |
| 737 | Ga0495684_0040591 | 3300047471 | Bacteria | 3567 |
| 738 | Ga0495686_0000027 | 3300047472 | Bacteria | 382657 |
| 739 | Ga0495686_0008767 | 3300047472 | Bacteria | 7371 |
| 740 | Ga0495602_0000101 | 3300048088 | Bacteria | 81181 |
| 741 | Ga0495602_0019378 | 3300048088 | Bacteria | 6756 |
| 742 | Ga0495602_0038136 | 3300048088 | Bacteria | 4449 |
| 743 | Ga0495602_0087148 | 3300048088 | Bacteria | 2604 |
| 744 | Ga0495602_0179256 | 3300048088 | Bacteria | 1636 |
| 745 | Ga0495614_0001042 | 3300048089 | Bacteria | 11847 |
| 746 | Ga0496104_0000127 | 3300048907 | Bacteria | 70210 |
| 747 | Ga0496104_0126993 | 3300048907 | Bacteria | 2449 |
| 748 | Ga0496104_0130612 | 3300048907 | Bacteria | 2413 |
| 749 | Ga0496104_0273838 | 3300048907 | Bacteria | 1601 |
| 750 | Ga0496105_0125334 | 3300048908 | Bacteria | 2117 |
| 751 | Ga0496106_0066069 | 3300048909 | Bacteria | 2754 |
| 752 | Ga0496106_0136959 | 3300048909 | Bacteria | 1924 |
| 753 | Ga0496112_0057421 | 3300048915 | Bacteria | 3832 |
| 754 | Ga0496112_0089113 | 3300048915 | Bacteria | 3053 |
| 755 | Ga0496115_0012549 | 3300048918 | Bacteria | 6383 |
| 756 | Ga0496115_0148198 | 3300048918 | Bacteria | 1937 |
| 757 | Ga0496115_0149101 | 3300048918 | Bacteria | 1931 |
| 758 | Ga0496126_0002651 | 3300048929 | Bacteria | 23706 |
| 759 | Ga0496126_0037039 | 3300048929 | Bacteria | 4556 |
| 760 | Ga0501031_0004063 | 3300049568 | Bacteria | 9437 |
| 761 | Ga0501032_0001455 | 3300049569 | Bacteria | 18825 |
| 762 | Ga0501036_0000255 | 3300049572 | Bacteria | 36165 |
| 763 | Ga0501038_0013708 | 3300049574 | Bacteria | 7389 |
| 764 | Ga0501039_0022459 | 3300049575 | Bacteria | 4843 |
| 765 | Ga0501043_0071340 | 3300049579 | Bacteria | 2728 |
| 766 | Ga0501046_0013244 | 3300049580 | Bacteria | 6988 |
| 767 | Ga0501047_0011142 | 3300049581 | Bacteria | 8509 |
| 768 | Ga0501047_0014185 | 3300049581 | Bacteria | 7574 |
| 769 | Ga0501048_0009515 | 3300049582 | Bacteria | 7294 |
| 770 | Ga0501067_0002621 | 3300049583 | Bacteria | 9957 |
| 771 | Ga0501068_0004334 | 3300049584 | Bacteria | 7714 |
| 772 | Ga0501069_0000224 | 3300049585 | Bacteria | 25263 |
| 773 | Ga0501070_0023337 | 3300049586 | Bacteria | 5182 |
| 774 | Ga0501072_0053330 | 3300049588 | Bacteria | 3184 |
| 775 | Ga0501073_0127128 | 3300049589 | Bacteria | 1766 |
| 776 | Ga0501074_0023820 | 3300049590 | Bacteria | 4450 |
| 777 | Ga0501076_0033461 | 3300049592 | Bacteria | 4013 |
| 778 | Ga0501077_0019257 | 3300049593 | Bacteria | 4316 |
| 779 | Ga0501079_0005002 | 3300049741 | Bacteria | 9829 |
| 780 | Ga0501080_0000961 | 3300049742 | Bacteria | 23597 |
| 781 | Ga0501035_0151531 | 3300049822 | Bacteria | 2012 |
| 782 | Ga0501044_0000216 | 3300049823 | Bacteria | 73383 |
| 783 | Ga0501044_0035476 | 3300049823 | Bacteria | 5222 |
| 784 | nmdc:mga0k408_2781_c1 | 3300050493 | Bacteria | 9306 |
| 785 | nmdc:mga06z11_2467_c1 | 3300050494 | Bacteria | 7069 |
| 786 | nmdc:mga05p37_1967_c1 | 3300050507 | Bacteria | 23970 |
| 787 | nmdc:mga05p37_333532_c1 | 3300050507 | Bacteria | 1791 |
| 788 | nmdc:mga09592_38331_c1 | 3300050508 | Bacteria | 4023 |
| 789 | nmdc:mga09592_61815_c1 | 3300050508 | Bacteria | 3168 |
| 790 | nmdc:mga09592_97438_c1 | 3300050508 | Bacteria | 2517 |
| 791 | nmdc:mga0qj67_24639_c1 | 3300050509 | Bacteria | 4139 |
| 792 | nmdc:mga06r32_167709_c1 | 3300050510 | Bacteria | 2179 |
| 793 | nmdc:mga08y16_128789_c1 | 3300050511 | Bacteria | 2633 |
| 794 | nmdc:mga08y16_133358_c1 | 3300050511 | Bacteria | 2582 |
| 795 | nmdc:mga08y16_1357_c1 | 3300050511 | Bacteria | 24450 |
| 796 | nmdc:mga08y16_138199_c1 | 3300050511 | Bacteria | 2533 |
| 797 | nmdc:mga08y16_20326_c1 | 3300050511 | Bacteria | 7009 |
| 798 | nmdc:mga08y16_30012_c1 | 3300050511 | Bacteria | 5725 |
| 799 | nmdc:mga08y16_38313_c1 | 3300050511 | Bacteria | 5035 |
| 800 | nmdc:mga08y16_9411_c1 | 3300050511 | Bacteria | 10247 |
| 801 | nmdc:mga0n895_125489_c1 | 3300050512 | Bacteria | 2590 |
| 802 | nmdc:mga0n895_17754_c1 | 3300050512 | Bacteria | 6566 |
| 803 | nmdc:mga0n895_30674_c1 | 3300050512 | Bacteria | 5140 |
| 804 | nmdc:mga0rr50_30299_c1 | 3300050513 | Bacteria | 3829 |
| 805 | nmdc:mga08x19_2984_c1 | 3300050514 | Bacteria | 10168 |
| 806 | nmdc:mga0a205_172227_c1 | 3300050515 | Bacteria | 2060 |
| 807 | nmdc:mga0a205_18616_c1 | 3300050515 | Bacteria | 6533 |
| 808 | nmdc:mga0a205_18636_c1 | 3300050515 | Bacteria | 6530 |
| 809 | nmdc:mga0a205_28589_c1 | 3300050515 | Bacteria | 5331 |
| 810 | nmdc:mga0a205_83518_c1 | 3300050515 | Bacteria | 3085 |
| 811 | nmdc:mga0a205_91204_c1 | 3300050515 | Bacteria | 2944 |
| 812 | Ga0495601_0006486 | 3300053077 | Bacteria | 6844 |
| 813 | Ga0500651_0000002 | 3300053093 | Bacteria | 476609 |
| 814 | Ga0500595_000014 | 3300053119 | Bacteria | 247996 |
| 815 | Ga0501084_0000854 | 3300054114 | Bacteria | 23555 |
| 816 | Ga0501082_0018177 | 3300060353 | Bacteria | 6053 |
| 817 | Ga0501082_0096290 | 3300060353 | Bacteria | 2559 |
| 818 | Ga0530510_0006805 | 3300061734 | Bacteria | 7965 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048908 | Ga0496105_0125334 | Ga0496105_0125334_10_1359 | 429 |
| 2 | 3300039447 | Ga0436361_0379682 | Ga0436361_0379682_25_1479 | 463 |
| 3 | 3300046472 | Ga0495580_0009412 | Ga0495580_0009412_127_1635 | 470 |
| 4 | 3300005440 | Ga0070705_100047339 | Ga0070705_1000473391 | 475 |
| 5 | 3300005445 | Ga0070708_100012412 | Ga0070708_1000124122 | 476 |
| 6 | 3300006844 | Ga0075428_100132027 | Ga0075428_1001320271 | 476 |
| 7 | 3300031344 | Ga0265316_10008523 | Ga0265316_100085232 | 477 |
| 8 | 3300005546 | Ga0070696_100006664 | Ga0070696_1000066648 | 480 |
| 9 | 3300005842 | Ga0068858_100014966 | Ga0068858_1000149666 | 480 |
| 10 | 3300006852 | Ga0075433_10015741 | Ga0075433_100157414 | 480 |
| 11 | 3300006871 | Ga0075434_100008203 | Ga0075434_1000082038 | 480 |
| 12 | 3300009177 | Ga0105248_10003639 | Ga0105248_1000363913 | 480 |
| 13 | 3300014968 | Ga0157379_10022635 | Ga0157379_100226354 | 480 |
| 14 | 3300025908 | Ga0207643_10032617 | Ga0207643_100326172 | 480 |
| 15 | 3300025916 | Ga0207663_10050554 | Ga0207663_100505543 | 480 |
| 16 | 3300025936 | Ga0207670_10028880 | Ga0207670_100288802 | 480 |
| 17 | 3300025939 | Ga0207665_10038334 | Ga0207665_100383343 | 480 |
| 18 | 3300025941 | Ga0207711_10031160 | Ga0207711_100311602 | 480 |
| 19 | 3300026035 | Ga0207703_10001176 | Ga0207703_100011765 | 480 |
| 20 | 3300027907 | Ga0207428_10049822 | Ga0207428_100498224 | 480 |
| 21 | 3300042876 | Ga0451577_0044266 | Ga0451577_0044266_1209_2729 | 480 |
| 22 | 3300045051 | Ga0451576_0013704 | Ga0451576_0013704_465_1985 | 480 |
| 23 | 3300046473 | Ga0495582_0017131 | Ga0495582_0017131_1583_3103 | 480 |
| 24 | 3300046664 | Ga0495659_0002458 | Ga0495659_0002458_3775_5301 | 480 |
| 25 | 3300050511 | nmdc:mga08y16_9411_c1 | nmdc:mga08y16_9411_c1_1832_3352 | 480 |
| 26 | 3300050515 | nmdc:mga0a205_18636_c1 | nmdc:mga0a205_18636_c1_4351_5883 | 480 |
| 27 | 3300006852 | Ga0075433_10089230 | Ga0075433_100892302 | 482 |
| 28 | 3300007076 | Ga0075435_100009419 | Ga0075435_1000094192 | 482 |
| 29 | 3300009094 | Ga0111539_10009382 | Ga0111539_100093826 | 482 |
| 30 | 3300009094 | Ga0111539_10219191 | Ga0111539_102191912 | 482 |
| 31 | 3300009147 | Ga0114129_10008706 | Ga0114129_1000870610 | 482 |
| 32 | 3300027907 | Ga0207428_10017744 | Ga0207428_100177443 | 482 |
| 33 | 3300035725 | Ga0373947_0020980 | Ga0373947_0020980_224_1705 | 482 |
| 34 | 3300036401 | Ga0373937_0166954 | Ga0373937_0166954_368_1849 | 482 |
| 35 | 3300050511 | nmdc:mga08y16_38313_c1 | nmdc:mga08y16_38313_c1_2762_4234 | 482 |
| 36 | 3300050512 | nmdc:mga0n895_125489_c1 | nmdc:mga0n895_125489_c1_223_1695 | 482 |
| 37 | 3300050513 | nmdc:mga0rr50_30299_c1 | nmdc:mga0rr50_30299_c1_1324_2796 | 482 |
| 38 | 3300050515 | nmdc:mga0a205_28589_c1 | nmdc:mga0a205_28589_c1_3784_5256 | 482 |
| 39 | 3300005406 | Ga0070703_10009229 | Ga0070703_100092291 | 483 |
| 40 | 3300005435 | Ga0070714_100001908 | Ga0070714_10000190813 | 483 |
| 41 | 3300005436 | Ga0070713_100011727 | Ga0070713_1000117277 | 483 |
| 42 | 3300005440 | Ga0070705_100049561 | Ga0070705_1000495612 | 483 |
| 43 | 3300005444 | Ga0070694_100012714 | Ga0070694_1000127142 | 483 |
| 44 | 3300005445 | Ga0070708_100000805 | Ga0070708_10000080519 | 483 |
| 45 | 3300005518 | Ga0070699_100015903 | Ga0070699_1000159034 | 483 |
| 46 | 3300005536 | Ga0070697_100001847 | Ga0070697_1000018475 | 483 |
| 47 | 3300005536 | Ga0070697_100033249 | Ga0070697_1000332492 | 483 |
| 48 | 3300005545 | Ga0070695_100010421 | Ga0070695_1000104212 | 483 |
| 49 | 3300005546 | Ga0070696_100002464 | Ga0070696_1000024647 | 483 |
| 50 | 3300005547 | Ga0070693_100000037 | Ga0070693_10000003733 | 483 |
| 51 | 3300005841 | Ga0068863_100138445 | Ga0068863_1001384452 | 483 |
| 52 | 3300005843 | Ga0068860_100002369 | Ga0068860_10000236910 | 483 |
| 53 | 3300006028 | Ga0070717_10002621 | Ga0070717_100026215 | 483 |
| 54 | 3300006871 | Ga0075434_100003909 | Ga0075434_1000039092 | 483 |
| 55 | 3300009094 | Ga0111539_10004140 | Ga0111539_1000414010 | 483 |
| 56 | 3300009098 | Ga0105245_10126779 | Ga0105245_101267792 | 483 |
| 57 | 3300009177 | Ga0105248_10261284 | Ga0105248_102612842 | 483 |
| 58 | 3300009553 | Ga0105249_10055655 | Ga0105249_100556553 | 483 |
| 59 | 3300013296 | Ga0157374_10041913 | Ga0157374_100419132 | 483 |
| 60 | 3300013297 | Ga0157378_10000368 | Ga0157378_100003687 | 483 |
| 61 | 3300013297 | Ga0157378_10009309 | Ga0157378_1000930910 | 483 |
| 62 | 3300013306 | Ga0163162_10050679 | Ga0163162_100506793 | 483 |
| 63 | 3300013306 | Ga0163162_10194436 | Ga0163162_101944362 | 483 |
| 64 | 3300013308 | Ga0157375_10122408 | Ga0157375_101224082 | 483 |
| 65 | 3300013308 | Ga0157375_10129329 | Ga0157375_101293292 | 483 |
| 66 | 3300014326 | Ga0157380_10023314 | Ga0157380_100233142 | 483 |
| 67 | 3300014745 | Ga0157377_10039805 | Ga0157377_100398052 | 483 |
| 68 | 3300021384 | Ga0213876_10036843 | Ga0213876_100368433 | 483 |
| 69 | 3300025910 | Ga0207684_10027366 | Ga0207684_100273664 | 483 |
| 70 | 3300025916 | Ga0207663_10030366 | Ga0207663_100303662 | 483 |
| 71 | 3300025921 | Ga0207652_10016109 | Ga0207652_100161092 | 483 |
| 72 | 3300025922 | Ga0207646_10026227 | Ga0207646_100262275 | 483 |
| 73 | 3300025922 | Ga0207646_10126089 | Ga0207646_101260891 | 483 |
| 74 | 3300025928 | Ga0207700_10032295 | Ga0207700_100322952 | 483 |
| 75 | 3300025929 | Ga0207664_10012309 | Ga0207664_100123092 | 483 |
| 76 | 3300026088 | Ga0207641_10243380 | Ga0207641_102433801 | 483 |
| 77 | 3300028016 | Ga0265354_1001157 | Ga0265354_10011572 | 483 |
| 78 | 3300028381 | Ga0268264_10002388 | Ga0268264_100023889 | 483 |
| 79 | 3300028563 | Ga0265319_1000426 | Ga0265319_100042632 | 483 |
| 80 | 3300028577 | Ga0265318_10000466 | Ga0265318_100004665 | 483 |
| 81 | 3300028800 | Ga0265338_10132983 | Ga0265338_101329832 | 483 |
| 82 | 3300031240 | Ga0265320_10000126 | Ga0265320_1000012631 | 483 |
| 83 | 3300031242 | Ga0265329_10000274 | Ga0265329_1000027435 | 483 |
| 84 | 3300031247 | Ga0265340_10001016 | Ga0265340_1000101610 | 483 |
| 85 | 3300031249 | Ga0265339_10001016 | Ga0265339_1000101616 | 483 |
| 86 | 3300031249 | Ga0265339_10003294 | Ga0265339_100032941 | 483 |
| 87 | 3300031250 | Ga0265331_10000025 | Ga0265331_10000025175 | 483 |
| 88 | 3300031250 | Ga0265331_10009321 | Ga0265331_100093213 | 483 |
| 89 | 3300031344 | Ga0265316_10000784 | Ga0265316_100007842 | 483 |
| 90 | 3300031595 | Ga0265313_10001537 | Ga0265313_1000153713 | 483 |
| 91 | 3300031711 | Ga0265314_10001212 | Ga0265314_1000121213 | 483 |
| 92 | 3300031711 | Ga0265314_10029621 | Ga0265314_100296213 | 483 |
| 93 | 3300031712 | Ga0265342_10000362 | Ga0265342_1000036245 | 483 |
| 94 | 3300031712 | Ga0265342_10008829 | Ga0265342_100088293 | 483 |
| 95 | 3300035695 | Ga0373927_0000934 | Ga0373927_0000934_1403_2866 | 483 |
| 96 | 3300035695 | Ga0373927_0095626 | Ga0373927_0095626_418_1881 | 483 |
| 97 | 3300037853 | Ga0436364_0177309 | Ga0436364_0177309_2078_3529 | 483 |
| 98 | 3300037853 | Ga0436364_1499157 | Ga0436364_1499157_41_1510 | 483 |
| 99 | 3300046454 | Ga0495592_0004333 | Ga0495592_0004333_1105_2568 | 483 |
| 100 | 3300046455 | Ga0495603_0047299 | Ga0495603_0047299_359_1822 | 483 |
| 101 | 3300046462 | Ga0495651_0000269 | Ga0495651_0000269_17213_18676 | 483 |
| 102 | 3300046462 | Ga0495651_0006179 | Ga0495651_0006179_261_1724 | 483 |
| 103 | 3300046462 | Ga0495651_0029939 | Ga0495651_0029939_723_2186 | 483 |
| 104 | 3300046463 | Ga0495653_0007181 | Ga0495653_0007181_2616_4079 | 483 |
| 105 | 3300046472 | Ga0495580_0026686 | Ga0495580_0026686_277_1740 | 483 |
| 106 | 3300046473 | Ga0495582_0008306 | Ga0495582_0008306_560_2023 | 483 |
| 107 | 3300046475 | Ga0495639_0011597 | Ga0495639_0011597_779_2242 | 483 |
| 108 | 3300046476 | Ga0495662_0053847 | Ga0495662_0053847_359_1822 | 483 |
| 109 | 3300046499 | Ga0495594_0032020 | Ga0495594_0032020_359_1822 | 483 |
| 110 | 3300046511 | Ga0495608_0038397 | Ga0495608_0038397_488_1951 | 483 |
| 111 | 3300046516 | Ga0495628_0001626 | Ga0495628_0001626_10471_11934 | 483 |
| 112 | 3300046516 | Ga0495628_0021843 | Ga0495628_0021843_1541_3004 | 483 |
| 113 | 3300046516 | Ga0495628_0048485 | Ga0495628_0048485_605_2074 | 483 |
| 114 | 3300046517 | Ga0495630_0065793 | Ga0495630_0065793_44_1507 | 483 |
| 115 | 3300046529 | Ga0495652_0002034 | Ga0495652_0002034_13265_14728 | 483 |
| 116 | 3300046533 | Ga0495640_0033523 | Ga0495640_0033523_734_2197 | 483 |
| 117 | 3300046536 | Ga0495587_0010143 | Ga0495587_0010143_3398_4861 | 483 |
| 118 | 3300046536 | Ga0495587_0065985 | Ga0495587_0065985_139_1602 | 483 |
| 119 | 3300046536 | Ga0495587_0093025 | Ga0495587_0093025_261_1724 | 483 |
| 120 | 3300046543 | Ga0495645_0047065 | Ga0495645_0047065_261_1724 | 483 |
| 121 | 3300046543 | Ga0495645_0063109 | Ga0495645_0063109_1198_2661 | 483 |
| 122 | 3300046559 | Ga0495667_0000598 | Ga0495667_0000598_15763_17226 | 483 |
| 123 | 3300046559 | Ga0495667_0004027 | Ga0495667_0004027_6667_8130 | 483 |
| 124 | 3300046642 | Ga0495634_0065842 | Ga0495634_0065842_233_1696 | 483 |
| 125 | 3300046663 | Ga0495635_0026072 | Ga0495635_0026072_2196_3659 | 483 |
| 126 | 3300046675 | Ga0495657_0019966 | Ga0495657_0019966_1896_3359 | 483 |
| 127 | 3300046675 | Ga0495657_0026775 | Ga0495657_0026775_463_1926 | 483 |
| 128 | 3300046678 | Ga0495599_0005464 | Ga0495599_0005464_5199_6662 | 483 |
| 129 | 3300046679 | Ga0495623_0012532 | Ga0495623_0012532_504_1967 | 483 |
| 130 | 3300046684 | Ga0495669_0017547 | Ga0495669_0017547_1025_2485 | 483 |
| 131 | 3300046690 | Ga0495624_0058452 | Ga0495624_0058452_879_2342 | 483 |
| 132 | 3300046809 | Ga0495600_0002044 | Ga0495600_0002044_5036_6499 | 483 |
| 133 | 3300046809 | Ga0495600_0076059 | Ga0495600_0076059_133_1596 | 483 |
| 134 | 3300047315 | Ga0495581_0016892 | Ga0495581_0016892_1729_3192 | 483 |
| 135 | 3300047317 | Ga0495604_0000736 | Ga0495604_0000736_16640_18103 | 483 |
| 136 | 3300047317 | Ga0495604_0072850 | Ga0495604_0072850_886_2349 | 483 |
| 137 | 3300047319 | Ga0495674_0006123 | Ga0495674_0006123_2544_4007 | 483 |
| 138 | 3300047319 | Ga0495674_0168743 | Ga0495674_0168743_177_1640 | 483 |
| 139 | 3300047321 | Ga0495676_0044034 | Ga0495676_0044034_871_2334 | 483 |
| 140 | 3300047322 | Ga0495680_0000041 | Ga0495680_0000041_54018_55481 | 483 |
| 141 | 3300047444 | Ga0495675_0000349 | Ga0495675_0000349_17890_19353 | 483 |
| 142 | 3300047471 | Ga0495684_0000521 | Ga0495684_0000521_10796_12259 | 483 |
| 143 | 3300047471 | Ga0495684_0001787 | Ga0495684_0001787_573_2036 | 483 |
| 144 | 3300048088 | Ga0495602_0019378 | Ga0495602_0019378_2924_4387 | 483 |
| 145 | 3300048088 | Ga0495602_0038136 | Ga0495602_0038136_2623_4086 | 483 |
| 146 | 3300048909 | Ga0496106_0066069 | Ga0496106_0066069_331_1806 | 483 |
| 147 | 3300050493 | nmdc:mga0k408_2781_c1 | nmdc:mga0k408_2781_c1_7698_9158 | 483 |
| 148 | 3300050494 | nmdc:mga06z11_2467_c1 | nmdc:mga06z11_2467_c1_4731_6191 | 483 |
| 149 | 3300050508 | nmdc:mga09592_38331_c1 | nmdc:mga09592_38331_c1_525_1985 | 483 |
| 150 | 3300050511 | nmdc:mga08y16_1357_c1 | nmdc:mga08y16_1357_c1_16896_18356 | 483 |
| 151 | 3300050512 | nmdc:mga0n895_30674_c1 | nmdc:mga0n895_30674_c1_397_1860 | 483 |
| 152 | 3300053077 | Ga0495601_0006486 | Ga0495601_0006486_1185_2654 | 483 |
| 153 | 3300005328 | Ga0070676_10051548 | Ga0070676_100515482 | 484 |
| 154 | 3300005329 | Ga0070683_100000002 | Ga0070683_100000002199 | 484 |
| 155 | 3300005329 | Ga0070683_100078429 | Ga0070683_1000784292 | 484 |
| 156 | 3300005335 | Ga0070666_10017503 | Ga0070666_100175033 | 484 |
| 157 | 3300005335 | Ga0070666_10041327 | Ga0070666_100413272 | 484 |
| 158 | 3300005338 | Ga0068868_100066500 | Ga0068868_1000665002 | 484 |
| 159 | 3300005338 | Ga0068868_100067628 | Ga0068868_1000676282 | 484 |
| 160 | 3300005339 | Ga0070660_100115767 | Ga0070660_1001157672 | 484 |
| 161 | 3300005343 | Ga0070687_100054056 | Ga0070687_1000540562 | 484 |
| 162 | 3300005344 | Ga0070661_100054741 | Ga0070661_1000547412 | 484 |
| 163 | 3300005354 | Ga0070675_100003550 | Ga0070675_1000035502 | 484 |
| 164 | 3300005354 | Ga0070675_100020001 | Ga0070675_1000200014 | 484 |
| 165 | 3300005354 | Ga0070675_100055347 | Ga0070675_1000553471 | 484 |
| 166 | 3300005355 | Ga0070671_100015148 | Ga0070671_1000151482 | 484 |
| 167 | 3300005356 | Ga0070674_100012266 | Ga0070674_1000122663 | 484 |
| 168 | 3300005364 | Ga0070673_100098684 | Ga0070673_1000986842 | 484 |
| 169 | 3300005365 | Ga0070688_100038813 | Ga0070688_1000388133 | 484 |
| 170 | 3300005366 | Ga0070659_100016010 | Ga0070659_1000160102 | 484 |
| 171 | 3300005367 | Ga0070667_100004263 | Ga0070667_1000042637 | 484 |
| 172 | 3300005367 | Ga0070667_100015915 | Ga0070667_1000159156 | 484 |
| 173 | 3300005436 | Ga0070713_100103287 | Ga0070713_1001032872 | 484 |
| 174 | 3300005438 | Ga0070701_10007710 | Ga0070701_100077102 | 484 |
| 175 | 3300005445 | Ga0070708_100003971 | Ga0070708_1000039712 | 484 |
| 176 | 3300005457 | Ga0070662_100056115 | Ga0070662_1000561152 | 484 |
| 177 | 3300005458 | Ga0070681_10092236 | Ga0070681_100922363 | 484 |
| 178 | 3300005466 | Ga0070685_10019908 | Ga0070685_100199081 | 484 |
| 179 | 3300005467 | Ga0070706_100245321 | Ga0070706_1002453211 | 484 |
| 180 | 3300005468 | Ga0070707_100000221 | Ga0070707_10000022122 | 484 |
| 181 | 3300005471 | Ga0070698_100023905 | Ga0070698_1000239052 | 484 |
| 182 | 3300005518 | Ga0070699_100018350 | Ga0070699_1000183503 | 484 |
| 183 | 3300005530 | Ga0070679_100009883 | Ga0070679_1000098832 | 484 |
| 184 | 3300005535 | Ga0070684_100000007 | Ga0070684_100000007199 | 484 |
| 185 | 3300005539 | Ga0068853_100022773 | Ga0068853_1000227733 | 484 |
| 186 | 3300005543 | Ga0070672_100101299 | Ga0070672_1001012992 | 484 |
| 187 | 3300005544 | Ga0070686_100032737 | Ga0070686_1000327373 | 484 |
| 188 | 3300005548 | Ga0070665_100028376 | Ga0070665_1000283762 | 484 |
| 189 | 3300005563 | Ga0068855_100002278 | Ga0068855_10000227810 | 484 |
| 190 | 3300005563 | Ga0068855_100085072 | Ga0068855_1000850724 | 484 |
| 191 | 3300005564 | Ga0070664_100104305 | Ga0070664_1001043052 | 484 |
| 192 | 3300005577 | Ga0068857_100009230 | Ga0068857_1000092309 | 484 |
| 193 | 3300005577 | Ga0068857_100040887 | Ga0068857_1000408875 | 484 |
| 194 | 3300005614 | Ga0068856_100014834 | Ga0068856_1000148342 | 484 |
| 195 | 3300005614 | Ga0068856_100014853 | Ga0068856_1000148538 | 484 |
| 196 | 3300005614 | Ga0068856_100042132 | Ga0068856_1000421323 | 484 |
| 197 | 3300005614 | Ga0068856_100043286 | Ga0068856_1000432862 | 484 |
| 198 | 3300005617 | Ga0068859_100033639 | Ga0068859_1000336393 | 484 |
| 199 | 3300005617 | Ga0068859_100077042 | Ga0068859_1000770422 | 484 |
| 200 | 3300005617 | Ga0068859_100100435 | Ga0068859_1001004355 | 484 |
| 201 | 3300005617 | Ga0068859_100120349 | Ga0068859_1001203492 | 484 |
| 202 | 3300005618 | Ga0068864_100003645 | Ga0068864_1000036452 | 484 |
| 203 | 3300005618 | Ga0068864_100004251 | Ga0068864_1000042516 | 484 |
| 204 | 3300005618 | Ga0068864_100135900 | Ga0068864_1001359002 | 484 |
| 205 | 3300005841 | Ga0068863_100030408 | Ga0068863_1000304083 | 484 |
| 206 | 3300005841 | Ga0068863_100067932 | Ga0068863_1000679323 | 484 |
| 207 | 3300005842 | Ga0068858_100003482 | Ga0068858_1000034826 | 484 |
| 208 | 3300005842 | Ga0068858_100004396 | Ga0068858_10000439610 | 484 |
| 209 | 3300005842 | Ga0068858_100026791 | Ga0068858_1000267912 | 484 |
| 210 | 3300005842 | Ga0068858_100031600 | Ga0068858_1000316005 | 484 |
| 211 | 3300005843 | Ga0068860_100011406 | Ga0068860_1000114069 | 484 |
| 212 | 3300005843 | Ga0068860_100023431 | Ga0068860_1000234312 | 484 |
| 213 | 3300005937 | Ga0081455_10000246 | Ga0081455_1000024635 | 484 |
| 214 | 3300005937 | Ga0081455_10013820 | Ga0081455_100138205 | 484 |
| 215 | 3300005937 | Ga0081455_10047850 | Ga0081455_100478502 | 484 |
| 216 | 3300005981 | Ga0081538_10000663 | Ga0081538_1000066310 | 484 |
| 217 | 3300005981 | Ga0081538_10001749 | Ga0081538_100017498 | 484 |
| 218 | 3300005981 | Ga0081538_10006844 | Ga0081538_100068442 | 484 |
| 219 | 3300005983 | Ga0081540_1016962 | Ga0081540_10169622 | 484 |
| 220 | 3300006028 | Ga0070717_10045959 | Ga0070717_100459591 | 484 |
| 221 | 3300006028 | Ga0070717_10193400 | Ga0070717_101934003 | 484 |
| 222 | 3300006038 | Ga0075365_10021836 | Ga0075365_100218362 | 484 |
| 223 | 3300006051 | Ga0075364_10005747 | Ga0075364_100057472 | 484 |
| 224 | 3300006175 | Ga0070712_100137108 | Ga0070712_1001371081 | 484 |
| 225 | 3300006178 | Ga0075367_10009184 | Ga0075367_100091842 | 484 |
| 226 | 3300006195 | Ga0075366_10001249 | Ga0075366_100012498 | 484 |
| 227 | 3300006237 | Ga0097621_100004652 | Ga0097621_1000046525 | 484 |
| 228 | 3300006237 | Ga0097621_100020172 | Ga0097621_1000201723 | 484 |
| 229 | 3300006237 | Ga0097621_100024268 | Ga0097621_1000242684 | 484 |
| 230 | 3300006237 | Ga0097621_100036253 | Ga0097621_1000362533 | 484 |
| 231 | 3300006237 | Ga0097621_100111216 | Ga0097621_1001112161 | 484 |
| 232 | 3300006358 | Ga0068871_100014111 | Ga0068871_1000141114 | 484 |
| 233 | 3300006358 | Ga0068871_100030778 | Ga0068871_1000307783 | 484 |
| 234 | 3300006358 | Ga0068871_100039111 | Ga0068871_1000391112 | 484 |
| 235 | 3300006358 | Ga0068871_100078857 | Ga0068871_1000788572 | 484 |
| 236 | 3300006844 | Ga0075428_100003081 | Ga0075428_1000030818 | 484 |
| 237 | 3300006844 | Ga0075428_100357777 | Ga0075428_1003577771 | 484 |
| 238 | 3300006847 | Ga0075431_100005846 | Ga0075431_1000058462 | 484 |
| 239 | 3300006847 | Ga0075431_100109414 | Ga0075431_1001094142 | 484 |
| 240 | 3300006852 | Ga0075433_10082186 | Ga0075433_100821862 | 484 |
| 241 | 3300006852 | Ga0075433_10209197 | Ga0075433_102091971 | 484 |
| 242 | 3300006871 | Ga0075434_100033223 | Ga0075434_1000332232 | 484 |
| 243 | 3300006880 | Ga0075429_100024549 | Ga0075429_1000245492 | 484 |
| 244 | 3300006881 | Ga0068865_100007218 | Ga0068865_1000072182 | 484 |
| 245 | 3300006931 | Ga0097620_100033641 | Ga0097620_1000336413 | 484 |
| 246 | 3300006931 | Ga0097620_100077030 | Ga0097620_1000770303 | 484 |
| 247 | 3300006931 | Ga0097620_100100428 | Ga0097620_1001004281 | 484 |
| 248 | 3300006931 | Ga0097620_100120348 | Ga0097620_1001203482 | 484 |
| 249 | 3300007788 | Ga0099795_10031829 | Ga0099795_100318291 | 484 |
| 250 | 3300009093 | Ga0105240_10000734 | Ga0105240_1000073465 | 484 |
| 251 | 3300009093 | Ga0105240_10025014 | Ga0105240_100250142 | 484 |
| 252 | 3300009093 | Ga0105240_10030445 | Ga0105240_100304453 | 484 |
| 253 | 3300009093 | Ga0105240_10098075 | Ga0105240_100980754 | 484 |
| 254 | 3300009094 | Ga0111539_10012378 | Ga0111539_100123782 | 484 |
| 255 | 3300009094 | Ga0111539_10029920 | Ga0111539_100299206 | 484 |
| 256 | 3300009094 | Ga0111539_10035040 | Ga0111539_100350402 | 484 |
| 257 | 3300009098 | Ga0105245_10029145 | Ga0105245_100291455 | 484 |
| 258 | 3300009098 | Ga0105245_10036728 | Ga0105245_100367284 | 484 |
| 259 | 3300009147 | Ga0114129_10000777 | Ga0114129_1000077732 | 484 |
| 260 | 3300009147 | Ga0114129_10058156 | Ga0114129_100581562 | 484 |
| 261 | 3300009147 | Ga0114129_10147701 | Ga0114129_101477013 | 484 |
| 262 | 3300009147 | Ga0114129_10225080 | Ga0114129_102250802 | 484 |
| 263 | 3300009147 | Ga0114129_10501756 | Ga0114129_105017561 | 484 |
| 264 | 3300009174 | Ga0105241_10032077 | Ga0105241_100320773 | 484 |
| 265 | 3300009174 | Ga0105241_10049056 | Ga0105241_100490564 | 484 |
| 266 | 3300009176 | Ga0105242_10056943 | Ga0105242_100569434 | 484 |
| 267 | 3300009177 | Ga0105248_10000806 | Ga0105248_1000080615 | 484 |
| 268 | 3300009177 | Ga0105248_10056649 | Ga0105248_100566492 | 484 |
| 269 | 3300009177 | Ga0105248_10064389 | Ga0105248_100643894 | 484 |
| 270 | 3300009177 | Ga0105248_10138686 | Ga0105248_101386862 | 484 |
| 271 | 3300009545 | Ga0105237_10031468 | Ga0105237_100314684 | 484 |
| 272 | 3300009545 | Ga0105237_10076730 | Ga0105237_100767303 | 484 |
| 273 | 3300009545 | Ga0105237_10231164 | Ga0105237_102311641 | 484 |
| 274 | 3300009551 | Ga0105238_10017459 | Ga0105238_100174594 | 484 |
| 275 | 3300009551 | Ga0105238_10060106 | Ga0105238_100601063 | 484 |
| 276 | 3300009551 | Ga0105238_10064670 | Ga0105238_100646701 | 484 |
| 277 | 3300009551 | Ga0105238_10067857 | Ga0105238_100678573 | 484 |
| 278 | 3300009553 | Ga0105249_10032997 | Ga0105249_100329972 | 484 |
| 279 | 3300010375 | Ga0105239_10029098 | Ga0105239_100290983 | 484 |
| 280 | 3300010375 | Ga0105239_10030580 | Ga0105239_100305805 | 484 |
| 281 | 3300013296 | Ga0157374_10007218 | Ga0157374_100072186 | 484 |
| 282 | 3300013296 | Ga0157374_10014732 | Ga0157374_100147324 | 484 |
| 283 | 3300013297 | Ga0157378_10105385 | Ga0157378_101053853 | 484 |
| 284 | 3300013297 | Ga0157378_10142141 | Ga0157378_101421412 | 484 |
| 285 | 3300013306 | Ga0163162_10003509 | Ga0163162_100035096 | 484 |
| 286 | 3300013306 | Ga0163162_10013499 | Ga0163162_100134992 | 484 |
| 287 | 3300013306 | Ga0163162_10044186 | Ga0163162_100441864 | 484 |
| 288 | 3300013306 | Ga0163162_10253473 | Ga0163162_102534732 | 484 |
| 289 | 3300013306 | Ga0163162_10328964 | Ga0163162_103289641 | 484 |
| 290 | 3300013308 | Ga0157375_10001430 | Ga0157375_100014302 | 484 |
| 291 | 3300013308 | Ga0157375_10051835 | Ga0157375_100518352 | 484 |
| 292 | 3300013308 | Ga0157375_10060584 | Ga0157375_100605842 | 484 |
| 293 | 3300013308 | Ga0157375_10287886 | Ga0157375_102878862 | 484 |
| 294 | 3300014325 | Ga0163163_10007573 | Ga0163163_100075732 | 484 |
| 295 | 3300014325 | Ga0163163_10026318 | Ga0163163_100263183 | 484 |
| 296 | 3300014325 | Ga0163163_10075764 | Ga0163163_100757643 | 484 |
| 297 | 3300014325 | Ga0163163_10205888 | Ga0163163_102058882 | 484 |
| 298 | 3300014968 | Ga0157379_10045112 | Ga0157379_100451121 | 484 |
| 299 | 3300014969 | Ga0157376_10032863 | Ga0157376_100328634 | 484 |
| 300 | 3300014969 | Ga0157376_10036571 | Ga0157376_100365712 | 484 |
| 301 | 3300014969 | Ga0157376_10094775 | Ga0157376_100947751 | 484 |
| 302 | 3300021388 | Ga0213875_10000004 | Ga0213875_10000004277 | 484 |
| 303 | 3300021388 | Ga0213875_10000313 | Ga0213875_1000031315 | 484 |
| 304 | 3300021388 | Ga0213875_10010292 | Ga0213875_100102924 | 484 |
| 305 | 3300021388 | Ga0213875_10010911 | Ga0213875_100109111 | 484 |
| 306 | 3300021441 | Ga0213871_10003941 | Ga0213871_100039412 | 484 |
| 307 | 3300025899 | Ga0207642_10034805 | Ga0207642_100348052 | 484 |
| 308 | 3300025903 | Ga0207680_10017582 | Ga0207680_100175822 | 484 |
| 309 | 3300025903 | Ga0207680_10041434 | Ga0207680_100414342 | 484 |
| 310 | 3300025910 | Ga0207684_10029639 | Ga0207684_100296393 | 484 |
| 311 | 3300025910 | Ga0207684_10040107 | Ga0207684_100401072 | 484 |
| 312 | 3300025911 | Ga0207654_10056884 | Ga0207654_100568842 | 484 |
| 313 | 3300025912 | Ga0207707_10037500 | Ga0207707_100375001 | 484 |
| 314 | 3300025913 | Ga0207695_10017528 | Ga0207695_100175286 | 484 |
| 315 | 3300025913 | Ga0207695_10025208 | Ga0207695_100252082 | 484 |
| 316 | 3300025913 | Ga0207695_10027004 | Ga0207695_100270043 | 484 |
| 317 | 3300025913 | Ga0207695_10030031 | Ga0207695_100300314 | 484 |
| 318 | 3300025913 | Ga0207695_10275964 | Ga0207695_102759641 | 484 |
| 319 | 3300025914 | Ga0207671_10143354 | Ga0207671_101433542 | 484 |
| 320 | 3300025914 | Ga0207671_10190968 | Ga0207671_101909682 | 484 |
| 321 | 3300025915 | Ga0207693_10120672 | Ga0207693_101206722 | 484 |
| 322 | 3300025918 | Ga0207662_10013090 | Ga0207662_100130902 | 484 |
| 323 | 3300025919 | Ga0207657_10002375 | Ga0207657_1000237512 | 484 |
| 324 | 3300025921 | Ga0207652_10019567 | Ga0207652_100195672 | 484 |
| 325 | 3300025921 | Ga0207652_10285851 | Ga0207652_102858511 | 484 |
| 326 | 3300025922 | Ga0207646_10000037 | Ga0207646_10000037146 | 484 |
| 327 | 3300025922 | Ga0207646_10015090 | Ga0207646_100150904 | 484 |
| 328 | 3300025924 | Ga0207694_10032572 | Ga0207694_100325723 | 484 |
| 329 | 3300025924 | Ga0207694_10096202 | Ga0207694_100962022 | 484 |
| 330 | 3300025924 | Ga0207694_10097298 | Ga0207694_100972981 | 484 |
| 331 | 3300025924 | Ga0207694_10117124 | Ga0207694_101171241 | 484 |
| 332 | 3300025925 | Ga0207650_10020427 | Ga0207650_100204272 | 484 |
| 333 | 3300025926 | Ga0207659_10000323 | Ga0207659_1000032315 | 484 |
| 334 | 3300025927 | Ga0207687_10006068 | Ga0207687_100060686 | 484 |
| 335 | 3300025927 | Ga0207687_10030888 | Ga0207687_100308884 | 484 |
| 336 | 3300025931 | Ga0207644_10022432 | Ga0207644_100224322 | 484 |
| 337 | 3300025932 | Ga0207690_10054616 | Ga0207690_100546162 | 484 |
| 338 | 3300025940 | Ga0207691_10002288 | Ga0207691_100022882 | 484 |
| 339 | 3300025940 | Ga0207691_10005514 | Ga0207691_100055148 | 484 |
| 340 | 3300025941 | Ga0207711_10000700 | Ga0207711_1000070021 | 484 |
| 341 | 3300025941 | Ga0207711_10066709 | Ga0207711_100667094 | 484 |
| 342 | 3300025941 | Ga0207711_10122552 | Ga0207711_101225522 | 484 |
| 343 | 3300025942 | Ga0207689_10021270 | Ga0207689_100212702 | 484 |
| 344 | 3300025944 | Ga0207661_10000003 | Ga0207661_10000003195 | 484 |
| 345 | 3300025944 | Ga0207661_10033901 | Ga0207661_100339013 | 484 |
| 346 | 3300025945 | Ga0207679_10015286 | Ga0207679_100152862 | 484 |
| 347 | 3300025945 | Ga0207679_10079496 | Ga0207679_100794962 | 484 |
| 348 | 3300025949 | Ga0207667_10002416 | Ga0207667_100024166 | 484 |
| 349 | 3300025949 | Ga0207667_10109697 | Ga0207667_101096972 | 484 |
| 350 | 3300025949 | Ga0207667_10162015 | Ga0207667_101620152 | 484 |
| 351 | 3300025960 | Ga0207651_10018593 | Ga0207651_100185932 | 484 |
| 352 | 3300025986 | Ga0207658_10013308 | Ga0207658_100133084 | 484 |
| 353 | 3300025986 | Ga0207658_10027029 | Ga0207658_100270293 | 484 |
| 354 | 3300026023 | Ga0207677_10084994 | Ga0207677_100849942 | 484 |
| 355 | 3300026035 | Ga0207703_10042274 | Ga0207703_100422743 | 484 |
| 356 | 3300026041 | Ga0207639_10002985 | Ga0207639_100029856 | 484 |
| 357 | 3300026078 | Ga0207702_10016913 | Ga0207702_100169132 | 484 |
| 358 | 3300026078 | Ga0207702_10060335 | Ga0207702_100603355 | 484 |
| 359 | 3300026078 | Ga0207702_10113976 | Ga0207702_101139762 | 484 |
| 360 | 3300026088 | Ga0207641_10008247 | Ga0207641_100082472 | 484 |
| 361 | 3300026088 | Ga0207641_10024896 | Ga0207641_100248963 | 484 |
| 362 | 3300026088 | Ga0207641_10039613 | Ga0207641_100396132 | 484 |
| 363 | 3300026088 | Ga0207641_10131929 | Ga0207641_101319293 | 484 |
| 364 | 3300026088 | Ga0207641_10223320 | Ga0207641_102233201 | 484 |
| 365 | 3300026089 | Ga0207648_10051935 | Ga0207648_100519353 | 484 |
| 366 | 3300026095 | Ga0207676_10001580 | Ga0207676_100015805 | 484 |
| 367 | 3300026095 | Ga0207676_10007865 | Ga0207676_100078654 | 484 |
| 368 | 3300026095 | Ga0207676_10120621 | Ga0207676_101206211 | 484 |
| 369 | 3300026116 | Ga0207674_10045779 | Ga0207674_100457792 | 484 |
| 370 | 3300026121 | Ga0207683_10199904 | Ga0207683_101999042 | 484 |
| 371 | 3300026142 | Ga0207698_10146550 | Ga0207698_101465501 | 484 |
| 372 | 3300027512 | Ga0209179_1000419 | Ga0209179_10004192 | 484 |
| 373 | 3300027671 | Ga0209588_1008548 | Ga0209588_10085483 | 484 |
| 374 | 3300027907 | Ga0207428_10000328 | Ga0207428_1000032824 | 484 |
| 375 | 3300027907 | Ga0207428_10014125 | Ga0207428_100141252 | 484 |
| 376 | 3300027907 | Ga0207428_10126900 | Ga0207428_101269002 | 484 |
| 377 | 3300028379 | Ga0268266_10018388 | Ga0268266_100183884 | 484 |
| 378 | 3300028379 | Ga0268266_10019116 | Ga0268266_100191164 | 484 |
| 379 | 3300028380 | Ga0268265_10036808 | Ga0268265_100368082 | 484 |
| 380 | 3300028381 | Ga0268264_10003579 | Ga0268264_100035795 | 484 |
| 381 | 3300028381 | Ga0268264_10009249 | Ga0268264_100092492 | 484 |
| 382 | 3300028381 | Ga0268264_10047817 | Ga0268264_100478172 | 484 |
| 383 | 3300028381 | Ga0268264_10183319 | Ga0268264_101833192 | 484 |
| 384 | 3300028653 | Ga0265323_10001872 | Ga0265323_100018726 | 484 |
| 385 | 3300031090 | Ga0265760_10000014 | Ga0265760_1000001429 | 484 |
| 386 | 3300031241 | Ga0265325_10001419 | Ga0265325_1000141911 | 484 |
| 387 | 3300031241 | Ga0265325_10005096 | Ga0265325_100050964 | 484 |
| 388 | 3300031344 | Ga0265316_10052881 | Ga0265316_100528812 | 484 |
| 389 | 3300031595 | Ga0265313_10012844 | Ga0265313_100128444 | 484 |
| 390 | 3300031711 | Ga0265314_10001907 | Ga0265314_100019076 | 484 |
| 391 | 3300031712 | Ga0265342_10089954 | Ga0265342_100899542 | 484 |
| 392 | 3300035695 | Ga0373927_0020079 | Ga0373927_0020079_269_1723 | 484 |
| 393 | 3300035724 | Ga0373933_0000129 | Ga0373933_0000129_801_2261 | 484 |
| 394 | 3300035725 | Ga0373947_0037861 | Ga0373947_0037861_745_2199 | 484 |
| 395 | 3300036401 | Ga0373937_0000015 | Ga0373937_0000015_71275_72735 | 484 |
| 396 | 3300036401 | Ga0373937_0010379 | Ga0373937_0010379_4204_5688 | 484 |
| 397 | 3300036401 | Ga0373937_0063269 | Ga0373937_0063269_1452_2936 | 484 |
| 398 | 3300036401 | Ga0373937_0083455 | Ga0373937_0083455_942_2396 | 484 |
| 399 | 3300037068 | Ga0373925_0118237 | Ga0373925_0118237_266_1720 | 484 |
| 400 | 3300037853 | Ga0436364_0288437 | Ga0436364_0288437_850_2304 | 484 |
| 401 | 3300037853 | Ga0436364_0748068 | Ga0436364_0748068_304287_305741 | 484 |
| 402 | 3300037853 | Ga0436364_0880534 | Ga0436364_0880534_10070_11524 | 484 |
| 403 | 3300037853 | Ga0436364_0895125 | Ga0436364_0895125_216_1685 | 484 |
| 404 | 3300037853 | Ga0436364_1448794 | Ga0436364_1448794_3197_4654 | 484 |
| 405 | 3300037853 | Ga0436364_1535143 | Ga0436364_1535143_10974_12428 | 484 |
| 406 | 3300039437 | Ga0436365_0343849 | Ga0436365_0343849_1887_3341 | 484 |
| 407 | 3300039437 | Ga0436365_0612444 | Ga0436365_0612444_2005_3459 | 484 |
| 408 | 3300039437 | Ga0436365_1466946 | Ga0436365_1466946_1025_2497 | 484 |
| 409 | 3300039438 | Ga0436360_1307109 | Ga0436360_1307109_23220_24674 | 484 |
| 410 | 3300044673 | Ga0453683_0042654 | Ga0453683_0042654_1149_2609 | 484 |
| 411 | 3300044712 | Ga0453684_0000397 | Ga0453684_0000397_118779_120251 | 484 |
| 412 | 3300045051 | Ga0451576_0100191 | Ga0451576_0100191_1291_2751 | 484 |
| 413 | 3300046454 | Ga0495592_0007581 | Ga0495592_0007581_4818_6302 | 484 |
| 414 | 3300046454 | Ga0495592_0079214 | Ga0495592_0079214_718_2172 | 484 |
| 415 | 3300046462 | Ga0495651_0006705 | Ga0495651_0006705_6907_8367 | 484 |
| 416 | 3300046462 | Ga0495651_0080881 | Ga0495651_0080881_533_1987 | 484 |
| 417 | 3300046472 | Ga0495580_0004544 | Ga0495580_0004544_210_1664 | 484 |
| 418 | 3300046472 | Ga0495580_0017276 | Ga0495580_0017276_1587_3041 | 484 |
| 419 | 3300046472 | Ga0495580_0025378 | Ga0495580_0025378_2710_4164 | 484 |
| 420 | 3300046472 | Ga0495580_0048974 | Ga0495580_0048974_421_1875 | 484 |
| 421 | 3300046476 | Ga0495662_0007670 | Ga0495662_0007670_1629_3083 | 484 |
| 422 | 3300046477 | Ga0495664_0007875 | Ga0495664_0007875_157_1611 | 484 |
| 423 | 3300046529 | Ga0495652_0071196 | Ga0495652_0071196_55_1515 | 484 |
| 424 | 3300046529 | Ga0495652_0079728 | Ga0495652_0079728_198_1652 | 484 |
| 425 | 3300046535 | Ga0495586_0046721 | Ga0495586_0046721_644_2128 | 484 |
| 426 | 3300046536 | Ga0495587_0000081 | Ga0495587_0000081_11382_12842 | 484 |
| 427 | 3300046559 | Ga0495667_0000465 | Ga0495667_0000465_10280_11764 | 484 |
| 428 | 3300046559 | Ga0495667_0032624 | Ga0495667_0032624_1996_3450 | 484 |
| 429 | 3300046642 | Ga0495634_0027186 | Ga0495634_0027186_2210_3664 | 484 |
| 430 | 3300046675 | Ga0495657_0001605 | Ga0495657_0001605_9987_11471 | 484 |
| 431 | 3300046678 | Ga0495599_0013062 | Ga0495599_0013062_1902_3356 | 484 |
| 432 | 3300046678 | Ga0495599_0053415 | Ga0495599_0053415_502_1956 | 484 |
| 433 | 3300046679 | Ga0495623_0023174 | Ga0495623_0023174_2482_3936 | 484 |
| 434 | 3300046689 | Ga0495613_0014721 | Ga0495613_0014721_1410_2894 | 484 |
| 435 | 3300047317 | Ga0495604_0022691 | Ga0495604_0022691_1575_3035 | 484 |
| 436 | 3300047318 | Ga0495636_0016157 | Ga0495636_0016157_176_1645 | 484 |
| 437 | 3300047319 | Ga0495674_0047949 | Ga0495674_0047949_1038_2492 | 484 |
| 438 | 3300047322 | Ga0495680_0082475 | Ga0495680_0082475_875_2329 | 484 |
| 439 | 3300047444 | Ga0495675_0001405 | Ga0495675_0001405_11545_13005 | 484 |
| 440 | 3300047471 | Ga0495684_0035646 | Ga0495684_0035646_1763_3217 | 484 |
| 441 | 3300048088 | Ga0495602_0000101 | Ga0495602_0000101_17067_18527 | 484 |
| 442 | 3300048088 | Ga0495602_0087148 | Ga0495602_0087148_770_2224 | 484 |
| 443 | 3300048088 | Ga0495602_0179256 | Ga0495602_0179256_132_1586 | 484 |
| 444 | 3300048915 | Ga0496112_0057421 | Ga0496112_0057421_2066_3520 | 484 |
| 445 | 3300049568 | Ga0501031_0004063 | Ga0501031_0004063_229_1683 | 484 |
| 446 | 3300049569 | Ga0501032_0001455 | Ga0501032_0001455_2914_4368 | 484 |
| 447 | 3300049572 | Ga0501036_0000255 | Ga0501036_0000255_29060_30514 | 484 |
| 448 | 3300049574 | Ga0501038_0013708 | Ga0501038_0013708_598_2052 | 484 |
| 449 | 3300049575 | Ga0501039_0022459 | Ga0501039_0022459_251_1705 | 484 |
| 450 | 3300049579 | Ga0501043_0071340 | Ga0501043_0071340_924_2378 | 484 |
| 451 | 3300049580 | Ga0501046_0013244 | Ga0501046_0013244_3104_4558 | 484 |
| 452 | 3300049581 | Ga0501047_0011142 | Ga0501047_0011142_2293_3747 | 484 |
| 453 | 3300049581 | Ga0501047_0014185 | Ga0501047_0014185_195_1649 | 484 |
| 454 | 3300049582 | Ga0501048_0009515 | Ga0501048_0009515_2968_4422 | 484 |
| 455 | 3300049583 | Ga0501067_0002621 | Ga0501067_0002621_3294_4748 | 484 |
| 456 | 3300049584 | Ga0501068_0004334 | Ga0501068_0004334_5337_6791 | 484 |
| 457 | 3300049585 | Ga0501069_0000224 | Ga0501069_0000224_4064_5518 | 484 |
| 458 | 3300049586 | Ga0501070_0023337 | Ga0501070_0023337_2037_3491 | 484 |
| 459 | 3300049588 | Ga0501072_0053330 | Ga0501072_0053330_832_2286 | 484 |
| 460 | 3300049589 | Ga0501073_0127128 | Ga0501073_0127128_103_1557 | 484 |
| 461 | 3300049590 | Ga0501074_0023820 | Ga0501074_0023820_338_1792 | 484 |
| 462 | 3300049592 | Ga0501076_0033461 | Ga0501076_0033461_482_1936 | 484 |
| 463 | 3300049593 | Ga0501077_0019257 | Ga0501077_0019257_2292_3746 | 484 |
| 464 | 3300049741 | Ga0501079_0005002 | Ga0501079_0005002_5210_6664 | 484 |
| 465 | 3300049742 | Ga0501080_0000961 | Ga0501080_0000961_9579_11033 | 484 |
| 466 | 3300049822 | Ga0501035_0151531 | Ga0501035_0151531_339_1793 | 484 |
| 467 | 3300049823 | Ga0501044_0000216 | Ga0501044_0000216_59908_61362 | 484 |
| 468 | 3300049823 | Ga0501044_0035476 | Ga0501044_0035476_3294_4748 | 484 |
| 469 | 3300050507 | nmdc:mga05p37_1967_c1 | nmdc:mga05p37_1967_c1_486_1997 | 484 |
| 470 | 3300050507 | nmdc:mga05p37_333532_c1 | nmdc:mga05p37_333532_c1_143_1654 | 484 |
| 471 | 3300050508 | nmdc:mga09592_61815_c1 | nmdc:mga09592_61815_c1_1609_3072 | 484 |
| 472 | 3300050508 | nmdc:mga09592_97438_c1 | nmdc:mga09592_97438_c1_632_2143 | 484 |
| 473 | 3300050509 | nmdc:mga0qj67_24639_c1 | nmdc:mga0qj67_24639_c1_110_1576 | 484 |
| 474 | 3300050510 | nmdc:mga06r32_167709_c1 | nmdc:mga06r32_167709_c1_515_1978 | 484 |
| 475 | 3300050511 | nmdc:mga08y16_128789_c1 | nmdc:mga08y16_128789_c1_620_2107 | 484 |
| 476 | 3300050511 | nmdc:mga08y16_133358_c1 | nmdc:mga08y16_133358_c1_971_2437 | 484 |
| 477 | 3300050511 | nmdc:mga08y16_138199_c1 | nmdc:mga08y16_138199_c1_929_2440 | 484 |
| 478 | 3300050511 | nmdc:mga08y16_20326_c1 | nmdc:mga08y16_20326_c1_4884_6347 | 484 |
| 479 | 3300050511 | nmdc:mga08y16_30012_c1 | nmdc:mga08y16_30012_c1_2797_4284 | 484 |
| 480 | 3300050512 | nmdc:mga0n895_17754_c1 | nmdc:mga0n895_17754_c1_3117_4628 | 484 |
| 481 | 3300050515 | nmdc:mga0a205_172227_c1 | nmdc:mga0a205_172227_c1_460_1923 | 484 |
| 482 | 3300050515 | nmdc:mga0a205_18616_c1 | nmdc:mga0a205_18616_c1_1286_2797 | 484 |
| 483 | 3300050515 | nmdc:mga0a205_83518_c1 | nmdc:mga0a205_83518_c1_97_1560 | 484 |
| 484 | 3300050515 | nmdc:mga0a205_91204_c1 | nmdc:mga0a205_91204_c1_1079_2590 | 484 |
| 485 | 3300054114 | Ga0501084_0000854 | Ga0501084_0000854_6148_7602 | 484 |
| 486 | 3300060353 | Ga0501082_0018177 | Ga0501082_0018177_2139_3593 | 484 |
| 487 | 3300060353 | Ga0501082_0096290 | Ga0501082_0096290_678_2141 | 484 |
| 488 | 3300061734 | Ga0530510_0006805 | Ga0530510_0006805_6456_7919 | 484 |
| 489 | 3300025945 | Ga0207679_10136949 | Ga0207679_101369492 | 485 |
| 490 | 3300037471 | Ga0395905_0057134 | Ga0395905_0057134_1820_3331 | 485 |
| 491 | 3300045976 | Ga0466967_0135452 | Ga0466967_0135452_58_1566 | 485 |
| 492 | 3300005293 | Ga0065715_10093704 | Ga0065715_100937043 | 486 |
| 493 | 3300005327 | Ga0070658_10057258 | Ga0070658_100572582 | 486 |
| 494 | 3300005328 | Ga0070676_10009362 | Ga0070676_100093622 | 486 |
| 495 | 3300005329 | Ga0070683_100007932 | Ga0070683_1000079322 | 486 |
| 496 | 3300005329 | Ga0070683_100099042 | Ga0070683_1000990422 | 486 |
| 497 | 3300005331 | Ga0070670_100001949 | Ga0070670_1000019496 | 486 |
| 498 | 3300005335 | Ga0070666_10103624 | Ga0070666_101036241 | 486 |
| 499 | 3300005336 | Ga0070680_100026699 | Ga0070680_1000266993 | 486 |
| 500 | 3300005336 | Ga0070680_100032224 | Ga0070680_1000322242 | 486 |
| 501 | 3300005337 | Ga0070682_100064443 | Ga0070682_1000644432 | 486 |
| 502 | 3300005338 | Ga0068868_100001660 | Ga0068868_1000016602 | 486 |
| 503 | 3300005338 | Ga0068868_100015752 | Ga0068868_1000157524 | 486 |
| 504 | 3300005338 | Ga0068868_100019780 | Ga0068868_1000197802 | 486 |
| 505 | 3300005338 | Ga0068868_100021745 | Ga0068868_1000217452 | 486 |
| 506 | 3300005339 | Ga0070660_100007894 | Ga0070660_1000078948 | 486 |
| 507 | 3300005344 | Ga0070661_100008885 | Ga0070661_1000088858 | 486 |
| 508 | 3300005344 | Ga0070661_100019563 | Ga0070661_1000195633 | 486 |
| 509 | 3300005344 | Ga0070661_100025646 | Ga0070661_1000256462 | 486 |
| 510 | 3300005347 | Ga0070668_100011535 | Ga0070668_1000115354 | 486 |
| 511 | 3300005354 | Ga0070675_100020069 | Ga0070675_1000200692 | 486 |
| 512 | 3300005354 | Ga0070675_100114608 | Ga0070675_1001146081 | 486 |
| 513 | 3300005355 | Ga0070671_100000378 | Ga0070671_10000037819 | 486 |
| 514 | 3300005355 | Ga0070671_100042917 | Ga0070671_1000429173 | 486 |
| 515 | 3300005364 | Ga0070673_100007515 | Ga0070673_1000075155 | 486 |
| 516 | 3300005367 | Ga0070667_100019425 | Ga0070667_1000194252 | 486 |
| 517 | 3300005434 | Ga0070709_10000423 | Ga0070709_1000042315 | 486 |
| 518 | 3300005435 | Ga0070714_100000096 | Ga0070714_10000009648 | 486 |
| 519 | 3300005435 | Ga0070714_100102955 | Ga0070714_1001029553 | 486 |
| 520 | 3300005436 | Ga0070713_100000364 | Ga0070713_1000003649 | 486 |
| 521 | 3300005436 | Ga0070713_100008685 | Ga0070713_1000086854 | 486 |
| 522 | 3300005439 | Ga0070711_100103524 | Ga0070711_1001035242 | 486 |
| 523 | 3300005445 | Ga0070708_100007485 | Ga0070708_1000074852 | 486 |
| 524 | 3300005455 | Ga0070663_100010931 | Ga0070663_1000109312 | 486 |
| 525 | 3300005455 | Ga0070663_100062398 | Ga0070663_1000623982 | 486 |
| 526 | 3300005457 | Ga0070662_100006651 | Ga0070662_1000066515 | 486 |
| 527 | 3300005457 | Ga0070662_100053402 | Ga0070662_1000534022 | 486 |
| 528 | 3300005458 | Ga0070681_10006468 | Ga0070681_1000646810 | 486 |
| 529 | 3300005458 | Ga0070681_10073881 | Ga0070681_100738812 | 486 |
| 530 | 3300005458 | Ga0070681_10157601 | Ga0070681_101576011 | 486 |
| 531 | 3300005459 | Ga0068867_100007704 | Ga0068867_1000077042 | 486 |
| 532 | 3300005459 | Ga0068867_100022763 | Ga0068867_1000227633 | 486 |
| 533 | 3300005467 | Ga0070706_100000278 | Ga0070706_10000027833 | 486 |
| 534 | 3300005467 | Ga0070706_100021666 | Ga0070706_1000216662 | 486 |
| 535 | 3300005530 | Ga0070679_100003386 | Ga0070679_1000033862 | 486 |
| 536 | 3300005530 | Ga0070679_100047135 | Ga0070679_1000471351 | 486 |
| 537 | 3300005530 | Ga0070679_100068323 | Ga0070679_1000683233 | 486 |
| 538 | 3300005535 | Ga0070684_100039558 | Ga0070684_1000395582 | 486 |
| 539 | 3300005535 | Ga0070684_100044069 | Ga0070684_1000440693 | 486 |
| 540 | 3300005535 | Ga0070684_100099199 | Ga0070684_1000991994 | 486 |
| 541 | 3300005536 | Ga0070697_100000993 | Ga0070697_1000009932 | 486 |
| 542 | 3300005539 | Ga0068853_100014788 | Ga0068853_1000147882 | 486 |
| 543 | 3300005563 | Ga0068855_100000642 | Ga0068855_10000064231 | 486 |
| 544 | 3300005563 | Ga0068855_100013554 | Ga0068855_1000135546 | 486 |
| 545 | 3300005563 | Ga0068855_100022851 | Ga0068855_1000228513 | 486 |
| 546 | 3300005563 | Ga0068855_100158826 | Ga0068855_1001588262 | 486 |
| 547 | 3300005563 | Ga0068855_100235951 | Ga0068855_1002359512 | 486 |
| 548 | 3300005564 | Ga0070664_100001989 | Ga0070664_10000198911 | 486 |
| 549 | 3300005564 | Ga0070664_100204667 | Ga0070664_1002046672 | 486 |
| 550 | 3300005577 | Ga0068857_100001478 | Ga0068857_10000147814 | 486 |
| 551 | 3300005577 | Ga0068857_100134234 | Ga0068857_1001342342 | 486 |
| 552 | 3300005578 | Ga0068854_100029876 | Ga0068854_1000298762 | 486 |
| 553 | 3300005614 | Ga0068856_100003152 | Ga0068856_10000315211 | 486 |
| 554 | 3300005614 | Ga0068856_100016878 | Ga0068856_1000168784 | 486 |
| 555 | 3300005616 | Ga0068852_100000415 | Ga0068852_1000004154 | 486 |
| 556 | 3300005616 | Ga0068852_100073456 | Ga0068852_1000734563 | 486 |
| 557 | 3300005616 | Ga0068852_100081737 | Ga0068852_1000817374 | 486 |
| 558 | 3300005616 | Ga0068852_100206405 | Ga0068852_1002064051 | 486 |
| 559 | 3300005617 | Ga0068859_100006813 | Ga0068859_1000068139 | 486 |
| 560 | 3300005617 | Ga0068859_100010766 | Ga0068859_1000107668 | 486 |
| 561 | 3300005618 | Ga0068864_100001669 | Ga0068864_1000016697 | 486 |
| 562 | 3300005718 | Ga0068866_10021754 | Ga0068866_100217543 | 486 |
| 563 | 3300005718 | Ga0068866_10038702 | Ga0068866_100387022 | 486 |
| 564 | 3300005834 | Ga0068851_10006846 | Ga0068851_100068462 | 486 |
| 565 | 3300005834 | Ga0068851_10008567 | Ga0068851_100085673 | 486 |
| 566 | 3300005834 | Ga0068851_10015529 | Ga0068851_100155292 | 486 |
| 567 | 3300005841 | Ga0068863_100004389 | Ga0068863_1000043892 | 486 |
| 568 | 3300005841 | Ga0068863_100064567 | Ga0068863_1000645672 | 486 |
| 569 | 3300005842 | Ga0068858_100007847 | Ga0068858_1000078478 | 486 |
| 570 | 3300005842 | Ga0068858_100083674 | Ga0068858_1000836742 | 486 |
| 571 | 3300005843 | Ga0068860_100049370 | Ga0068860_1000493702 | 486 |
| 572 | 3300005843 | Ga0068860_100072062 | Ga0068860_1000720624 | 486 |
| 573 | 3300005983 | Ga0081540_1005801 | Ga0081540_10058013 | 486 |
| 574 | 3300006175 | Ga0070712_100002672 | Ga0070712_1000026727 | 486 |
| 575 | 3300006175 | Ga0070712_100010032 | Ga0070712_1000100325 | 486 |
| 576 | 3300006237 | Ga0097621_100015449 | Ga0097621_1000154495 | 486 |
| 577 | 3300006237 | Ga0097621_100031066 | Ga0097621_1000310664 | 486 |
| 578 | 3300006237 | Ga0097621_100052500 | Ga0097621_1000525002 | 486 |
| 579 | 3300006358 | Ga0068871_100026889 | Ga0068871_1000268895 | 486 |
| 580 | 3300006358 | Ga0068871_100058314 | Ga0068871_1000583142 | 486 |
| 581 | 3300006871 | Ga0075434_100005331 | Ga0075434_1000053319 | 486 |
| 582 | 3300006881 | Ga0068865_100011388 | Ga0068865_1000113884 | 486 |
| 583 | 3300006881 | Ga0068865_100019789 | Ga0068865_1000197893 | 486 |
| 584 | 3300006881 | Ga0068865_100020714 | Ga0068865_1000207142 | 486 |
| 585 | 3300006931 | Ga0097620_100006814 | Ga0097620_1000068142 | 486 |
| 586 | 3300006931 | Ga0097620_100010766 | Ga0097620_1000107664 | 486 |
| 587 | 3300009093 | Ga0105240_10001326 | Ga0105240_1000132623 | 486 |
| 588 | 3300009093 | Ga0105240_10001395 | Ga0105240_1000139524 | 486 |
| 589 | 3300009093 | Ga0105240_10032052 | Ga0105240_100320527 | 486 |
| 590 | 3300009093 | Ga0105240_10081283 | Ga0105240_100812832 | 486 |
| 591 | 3300009098 | Ga0105245_10007394 | Ga0105245_100073949 | 486 |
| 592 | 3300009098 | Ga0105245_10028226 | Ga0105245_100282266 | 486 |
| 593 | 3300009098 | Ga0105245_10055244 | Ga0105245_100552442 | 486 |
| 594 | 3300009098 | Ga0105245_10073069 | Ga0105245_100730692 | 486 |
| 595 | 3300009148 | Ga0105243_10019881 | Ga0105243_100198815 | 486 |
| 596 | 3300009174 | Ga0105241_10043258 | Ga0105241_100432582 | 486 |
| 597 | 3300009177 | Ga0105248_10000094 | Ga0105248_1000009453 | 486 |
| 598 | 3300009177 | Ga0105248_10001021 | Ga0105248_1000102115 | 486 |
| 599 | 3300009177 | Ga0105248_10013851 | Ga0105248_100138514 | 486 |
| 600 | 3300009177 | Ga0105248_10020967 | Ga0105248_100209674 | 486 |
| 601 | 3300009545 | Ga0105237_10022562 | Ga0105237_100225622 | 486 |
| 602 | 3300009551 | Ga0105238_10000635 | Ga0105238_1000063524 | 486 |
| 603 | 3300010375 | Ga0105239_10002713 | Ga0105239_100027138 | 486 |
| 604 | 3300010375 | Ga0105239_10069943 | Ga0105239_100699432 | 486 |
| 605 | 3300010375 | Ga0105239_10105811 | Ga0105239_101058112 | 486 |
| 606 | 3300011119 | Ga0105246_10016520 | Ga0105246_100165202 | 486 |
| 607 | 3300013104 | Ga0157370_10000137 | Ga0157370_1000013711 | 486 |
| 608 | 3300013104 | Ga0157370_10058522 | Ga0157370_100585224 | 486 |
| 609 | 3300013104 | Ga0157370_10179396 | Ga0157370_101793962 | 486 |
| 610 | 3300013105 | Ga0157369_10001369 | Ga0157369_1000136924 | 486 |
| 611 | 3300013105 | Ga0157369_10001777 | Ga0157369_100017774 | 486 |
| 612 | 3300013105 | Ga0157369_10023951 | Ga0157369_100239512 | 486 |
| 613 | 3300013105 | Ga0157369_10097222 | Ga0157369_100972223 | 486 |
| 614 | 3300013296 | Ga0157374_10000659 | Ga0157374_1000065911 | 486 |
| 615 | 3300013296 | Ga0157374_10011444 | Ga0157374_100114442 | 486 |
| 616 | 3300013296 | Ga0157374_10015360 | Ga0157374_100153602 | 486 |
| 617 | 3300013296 | Ga0157374_10021536 | Ga0157374_100215364 | 486 |
| 618 | 3300013296 | Ga0157374_10112524 | Ga0157374_101125242 | 486 |
| 619 | 3300013297 | Ga0157378_10000217 | Ga0157378_1000021717 | 486 |
| 620 | 3300013306 | Ga0163162_10010248 | Ga0163162_100102486 | 486 |
| 621 | 3300013307 | Ga0157372_10000134 | Ga0157372_100001347 | 486 |
| 622 | 3300013307 | Ga0157372_10000424 | Ga0157372_1000042424 | 486 |
| 623 | 3300013307 | Ga0157372_10005022 | Ga0157372_100050227 | 486 |
| 624 | 3300013307 | Ga0157372_10022198 | Ga0157372_100221982 | 486 |
| 625 | 3300013307 | Ga0157372_10109955 | Ga0157372_101099553 | 486 |
| 626 | 3300013307 | Ga0157372_10249923 | Ga0157372_102499232 | 486 |
| 627 | 3300014325 | Ga0163163_10000729 | Ga0163163_1000072911 | 486 |
| 628 | 3300014325 | Ga0163163_10051412 | Ga0163163_100514125 | 486 |
| 629 | 3300014969 | Ga0157376_10021045 | Ga0157376_100210452 | 486 |
| 630 | 3300014969 | Ga0157376_10066786 | Ga0157376_100667862 | 486 |
| 631 | 3300014969 | Ga0157376_10067881 | Ga0157376_100678813 | 486 |
| 632 | 3300015262 | Ga0182007_10005535 | Ga0182007_100055355 | 486 |
| 633 | 3300017792 | Ga0163161_10018153 | Ga0163161_100181532 | 486 |
| 634 | 3300021361 | Ga0213872_10001564 | Ga0213872_100015646 | 486 |
| 635 | 3300021361 | Ga0213872_10034060 | Ga0213872_100340602 | 486 |
| 636 | 3300022732 | Ga0224569_100108 | Ga0224569_1001086 | 486 |
| 637 | 3300024227 | Ga0228598_1001374 | Ga0228598_10013743 | 486 |
| 638 | 3300025321 | Ga0207656_10008171 | Ga0207656_100081712 | 486 |
| 639 | 3300025898 | Ga0207692_10027104 | Ga0207692_100271041 | 486 |
| 640 | 3300025903 | Ga0207680_10008418 | Ga0207680_100084183 | 486 |
| 641 | 3300025906 | Ga0207699_10000209 | Ga0207699_1000020930 | 486 |
| 642 | 3300025906 | Ga0207699_10126074 | Ga0207699_101260741 | 486 |
| 643 | 3300025910 | Ga0207684_10011624 | Ga0207684_100116247 | 486 |
| 644 | 3300025910 | Ga0207684_10055510 | Ga0207684_100555104 | 486 |
| 645 | 3300025911 | Ga0207654_10082870 | Ga0207654_100828702 | 486 |
| 646 | 3300025912 | Ga0207707_10021854 | Ga0207707_100218546 | 486 |
| 647 | 3300025913 | Ga0207695_10000379 | Ga0207695_1000037966 | 486 |
| 648 | 3300025913 | Ga0207695_10003457 | Ga0207695_1000345724 | 486 |
| 649 | 3300025913 | Ga0207695_10026384 | Ga0207695_100263847 | 486 |
| 650 | 3300025913 | Ga0207695_10052463 | Ga0207695_100524633 | 486 |
| 651 | 3300025913 | Ga0207695_10134305 | Ga0207695_101343052 | 486 |
| 652 | 3300025915 | Ga0207693_10000026 | Ga0207693_1000002657 | 486 |
| 653 | 3300025915 | Ga0207693_10062889 | Ga0207693_100628892 | 486 |
| 654 | 3300025915 | Ga0207693_10085307 | Ga0207693_100853072 | 486 |
| 655 | 3300025916 | Ga0207663_10116911 | Ga0207663_101169112 | 486 |
| 656 | 3300025919 | Ga0207657_10168175 | Ga0207657_101681751 | 486 |
| 657 | 3300025921 | Ga0207652_10185568 | Ga0207652_101855682 | 486 |
| 658 | 3300025922 | Ga0207646_10116923 | Ga0207646_101169233 | 486 |
| 659 | 3300025924 | Ga0207694_10000580 | Ga0207694_1000058011 | 486 |
| 660 | 3300025924 | Ga0207694_10021413 | Ga0207694_100214132 | 486 |
| 661 | 3300025927 | Ga0207687_10036583 | Ga0207687_100365832 | 486 |
| 662 | 3300025927 | Ga0207687_10096892 | Ga0207687_100968922 | 486 |
| 663 | 3300025928 | Ga0207700_10000306 | Ga0207700_1000030610 | 486 |
| 664 | 3300025928 | Ga0207700_10098503 | Ga0207700_100985032 | 486 |
| 665 | 3300025929 | Ga0207664_10000087 | Ga0207664_1000008757 | 486 |
| 666 | 3300025929 | Ga0207664_10041011 | Ga0207664_100410112 | 486 |
| 667 | 3300025929 | Ga0207664_10127559 | Ga0207664_101275592 | 486 |
| 668 | 3300025931 | Ga0207644_10000680 | Ga0207644_100006803 | 486 |
| 669 | 3300025931 | Ga0207644_10029090 | Ga0207644_100290903 | 486 |
| 670 | 3300025933 | Ga0207706_10011869 | Ga0207706_100118694 | 486 |
| 671 | 3300025933 | Ga0207706_10060961 | Ga0207706_100609612 | 486 |
| 672 | 3300025939 | Ga0207665_10007676 | Ga0207665_100076764 | 486 |
| 673 | 3300025939 | Ga0207665_10017617 | Ga0207665_100176172 | 486 |
| 674 | 3300025939 | Ga0207665_10137176 | Ga0207665_101371761 | 486 |
| 675 | 3300025940 | Ga0207691_10002504 | Ga0207691_1000250413 | 486 |
| 676 | 3300025941 | Ga0207711_10000086 | Ga0207711_1000008636 | 486 |
| 677 | 3300025941 | Ga0207711_10001388 | Ga0207711_1000138819 | 486 |
| 678 | 3300025941 | Ga0207711_10010324 | Ga0207711_100103244 | 486 |
| 679 | 3300025941 | Ga0207711_10046036 | Ga0207711_100460364 | 486 |
| 680 | 3300025944 | Ga0207661_10146655 | Ga0207661_101466551 | 486 |
| 681 | 3300025945 | Ga0207679_10049078 | Ga0207679_100490782 | 486 |
| 682 | 3300025949 | Ga0207667_10004201 | Ga0207667_1000420110 | 486 |
| 683 | 3300025949 | Ga0207667_10019621 | Ga0207667_100196214 | 486 |
| 684 | 3300025949 | Ga0207667_10042670 | Ga0207667_100426704 | 486 |
| 685 | 3300025949 | Ga0207667_10117717 | Ga0207667_101177172 | 486 |
| 686 | 3300025981 | Ga0207640_10009549 | Ga0207640_100095493 | 486 |
| 687 | 3300025981 | Ga0207640_10068528 | Ga0207640_100685281 | 486 |
| 688 | 3300026023 | Ga0207677_10008947 | Ga0207677_100089475 | 486 |
| 689 | 3300026035 | Ga0207703_10152881 | Ga0207703_101528811 | 486 |
| 690 | 3300026041 | Ga0207639_10012613 | Ga0207639_100126132 | 486 |
| 691 | 3300026078 | Ga0207702_10033923 | Ga0207702_100339234 | 486 |
| 692 | 3300026078 | Ga0207702_10045554 | Ga0207702_100455542 | 486 |
| 693 | 3300026078 | Ga0207702_10076439 | Ga0207702_100764392 | 486 |
| 694 | 3300026095 | Ga0207676_10023619 | Ga0207676_100236192 | 486 |
| 695 | 3300026121 | Ga0207683_10031448 | Ga0207683_100314484 | 486 |
| 696 | 3300026142 | Ga0207698_10000039 | Ga0207698_1000003934 | 486 |
| 697 | 3300028017 | Ga0265356_1000458 | Ga0265356_10004583 | 486 |
| 698 | 3300028379 | Ga0268266_10007530 | Ga0268266_100075306 | 486 |
| 699 | 3300028379 | Ga0268266_10032090 | Ga0268266_100320902 | 486 |
| 700 | 3300028577 | Ga0265318_10002124 | Ga0265318_1000212414 | 486 |
| 701 | 3300028666 | Ga0265336_10002446 | Ga0265336_100024465 | 486 |
| 702 | 3300028666 | Ga0265336_10003601 | Ga0265336_100036012 | 486 |
| 703 | 3300028800 | Ga0265338_10007828 | Ga0265338_100078288 | 486 |
| 704 | 3300028800 | Ga0265338_10045724 | Ga0265338_100457241 | 486 |
| 705 | 3300030760 | Ga0265762_1003998 | Ga0265762_10039981 | 486 |
| 706 | 3300031235 | Ga0265330_10000107 | Ga0265330_1000010757 | 486 |
| 707 | 3300031235 | Ga0265330_10006445 | Ga0265330_100064453 | 486 |
| 708 | 3300031238 | Ga0265332_10006044 | Ga0265332_100060442 | 486 |
| 709 | 3300031238 | Ga0265332_10022224 | Ga0265332_100222243 | 486 |
| 710 | 3300031239 | Ga0265328_10000456 | Ga0265328_1000045615 | 486 |
| 711 | 3300031239 | Ga0265328_10003578 | Ga0265328_100035782 | 486 |
| 712 | 3300031240 | Ga0265320_10006467 | Ga0265320_100064672 | 486 |
| 713 | 3300031240 | Ga0265320_10040964 | Ga0265320_100409642 | 486 |
| 714 | 3300031241 | Ga0265325_10000066 | Ga0265325_1000006620 | 486 |
| 715 | 3300031241 | Ga0265325_10000701 | Ga0265325_100007012 | 486 |
| 716 | 3300031241 | Ga0265325_10010234 | Ga0265325_100102342 | 486 |
| 717 | 3300031241 | Ga0265325_10010895 | Ga0265325_100108952 | 486 |
| 718 | 3300031247 | Ga0265340_10001113 | Ga0265340_1000111312 | 486 |
| 719 | 3300031247 | Ga0265340_10006158 | Ga0265340_100061586 | 486 |
| 720 | 3300031247 | Ga0265340_10007209 | Ga0265340_100072094 | 486 |
| 721 | 3300031247 | Ga0265340_10039049 | Ga0265340_100390491 | 486 |
| 722 | 3300031249 | Ga0265339_10000029 | Ga0265339_1000002934 | 486 |
| 723 | 3300031249 | Ga0265339_10000555 | Ga0265339_100005553 | 486 |
| 724 | 3300031249 | Ga0265339_10000921 | Ga0265339_1000092134 | 486 |
| 725 | 3300031249 | Ga0265339_10036200 | Ga0265339_100362003 | 486 |
| 726 | 3300031250 | Ga0265331_10019068 | Ga0265331_100190682 | 486 |
| 727 | 3300031344 | Ga0265316_10000447 | Ga0265316_1000044715 | 486 |
| 728 | 3300031344 | Ga0265316_10003190 | Ga0265316_1000319010 | 486 |
| 729 | 3300031344 | Ga0265316_10010718 | Ga0265316_100107184 | 486 |
| 730 | 3300031344 | Ga0265316_10012698 | Ga0265316_100126982 | 486 |
| 731 | 3300031344 | Ga0265316_10101414 | Ga0265316_101014142 | 486 |
| 732 | 3300031595 | Ga0265313_10001112 | Ga0265313_100011122 | 486 |
| 733 | 3300031595 | Ga0265313_10001195 | Ga0265313_1000119514 | 486 |
| 734 | 3300031595 | Ga0265313_10023461 | Ga0265313_100234612 | 486 |
| 735 | 3300031711 | Ga0265314_10000195 | Ga0265314_1000019573 | 486 |
| 736 | 3300031711 | Ga0265314_10081880 | Ga0265314_100818802 | 486 |
| 737 | 3300031712 | Ga0265342_10000078 | Ga0265342_1000007819 | 486 |
| 738 | 3300031712 | Ga0265342_10000307 | Ga0265342_1000030726 | 486 |
| 739 | 3300031712 | Ga0265342_10001748 | Ga0265342_100017488 | 486 |
| 740 | 3300031712 | Ga0265342_10032177 | Ga0265342_100321772 | 486 |
| 741 | 3300031712 | Ga0265342_10040530 | Ga0265342_100405302 | 486 |
| 742 | 3300031712 | Ga0265342_10081202 | Ga0265342_100812022 | 486 |
| 743 | 3300033180 | Ga0307510_10027922 | Ga0307510_100279224 | 486 |
| 744 | 3300035083 | Ga0373926_0018032 | Ga0373926_0018032_476_1981 | 486 |
| 745 | 3300035113 | Ga0373936_0005113 | Ga0373936_0005113_3137_4642 | 486 |
| 746 | 3300035119 | Ga0373956_0027979 | Ga0373956_0027979_508_2013 | 486 |
| 747 | 3300035170 | Ga0373943_0000594 | Ga0373943_0000594_11128_12633 | 486 |
| 748 | 3300035692 | Ga0373935_0002647 | Ga0373935_0002647_1297_2802 | 486 |
| 749 | 3300035695 | Ga0373927_0000747 | Ga0373927_0000747_6604_8109 | 486 |
| 750 | 3300035695 | Ga0373927_0013916 | Ga0373927_0013916_730_2241 | 486 |
| 751 | 3300035724 | Ga0373933_0029156 | Ga0373933_0029156_1344_2849 | 486 |
| 752 | 3300035724 | Ga0373933_0039134 | Ga0373933_0039134_282_1805 | 486 |
| 753 | 3300035725 | Ga0373947_0000971 | Ga0373947_0000971_11851_13356 | 486 |
| 754 | 3300035725 | Ga0373947_0007329 | Ga0373947_0007329_4722_6227 | 486 |
| 755 | 3300036401 | Ga0373937_0110752 | Ga0373937_0110752_258_1781 | 486 |
| 756 | 3300037068 | Ga0373925_0015527 | Ga0373925_0015527_2997_4502 | 486 |
| 757 | 3300037068 | Ga0373925_0019549 | Ga0373925_0019549_3200_4705 | 486 |
| 758 | 3300037068 | Ga0373925_0028771 | Ga0373925_0028771_2425_3936 | 486 |
| 759 | 3300039438 | Ga0436360_1314441 | Ga0436360_1314441_14785_16308 | 486 |
| 760 | 3300039447 | Ga0436361_0350897 | Ga0436361_0350897_7026_8642 | 486 |
| 761 | 3300039447 | Ga0436361_0464047 | Ga0436361_0464047_63719_65368 | 486 |
| 762 | 3300039450 | Ga0436363_0100069 | Ga0436363_0100069_255_1760 | 486 |
| 763 | 3300044694 | Ga0466963_0117463 | Ga0466963_0117463_152_1669 | 486 |
| 764 | 3300046459 | Ga0495629_0011385 | Ga0495629_0011385_4858_6381 | 486 |
| 765 | 3300046459 | Ga0495629_0044354 | Ga0495629_0044354_323_1843 | 486 |
| 766 | 3300046459 | Ga0495629_0063849 | Ga0495629_0063849_963_2486 | 486 |
| 767 | 3300046459 | Ga0495629_0082179 | Ga0495629_0082179_312_1835 | 486 |
| 768 | 3300046463 | Ga0495653_0010352 | Ga0495653_0010352_5271_6794 | 486 |
| 769 | 3300046471 | Ga0495650_0000010 | Ga0495650_0000010_54975_56498 | 486 |
| 770 | 3300046472 | Ga0495580_0001289 | Ga0495580_0001289_5037_6542 | 486 |
| 771 | 3300046472 | Ga0495580_0004497 | Ga0495580_0004497_9528_11033 | 486 |
| 772 | 3300046472 | Ga0495580_0005237 | Ga0495580_0005237_7947_9452 | 486 |
| 773 | 3300046472 | Ga0495580_0046103 | Ga0495580_0046103_224_1747 | 486 |
| 774 | 3300046473 | Ga0495582_0000706 | Ga0495582_0000706_6237_7760 | 486 |
| 775 | 3300046473 | Ga0495582_0002662 | Ga0495582_0002662_7399_8904 | 486 |
| 776 | 3300046477 | Ga0495664_0016909 | Ga0495664_0016909_1756_3279 | 486 |
| 777 | 3300046507 | Ga0495606_0038902 | Ga0495606_0038902_82_1605 | 486 |
| 778 | 3300046523 | Ga0495644_0000350 | Ga0495644_0000350_16329_17852 | 486 |
| 779 | 3300046531 | Ga0495665_0000288 | Ga0495665_0000288_23324_24847 | 486 |
| 780 | 3300046531 | Ga0495665_0048691 | Ga0495665_0048691_629_2152 | 486 |
| 781 | 3300046543 | Ga0495645_0005411 | Ga0495645_0005411_3989_5512 | 486 |
| 782 | 3300046559 | Ga0495667_0004030 | Ga0495667_0004030_225_1748 | 486 |
| 783 | 3300046616 | Ga0495668_0022228 | Ga0495668_0022228_1572_3095 | 486 |
| 784 | 3300046642 | Ga0495634_0004373 | Ga0495634_0004373_3913_5436 | 486 |
| 785 | 3300046660 | Ga0495625_0035758 | Ga0495625_0035758_1635_3158 | 486 |
| 786 | 3300046663 | Ga0495635_0068704 | Ga0495635_0068704_28_1551 | 486 |
| 787 | 3300046678 | Ga0495599_0050103 | Ga0495599_0050103_983_2506 | 486 |
| 788 | 3300046679 | Ga0495623_0018844 | Ga0495623_0018844_2296_3819 | 486 |
| 789 | 3300046680 | Ga0495646_0048952 | Ga0495646_0048952_429_1952 | 486 |
| 790 | 3300046683 | Ga0495658_0011190 | Ga0495658_0011190_2000_3505 | 486 |
| 791 | 3300046689 | Ga0495613_0005267 | Ga0495613_0005267_6723_8246 | 486 |
| 792 | 3300046690 | Ga0495624_0008050 | Ga0495624_0008050_161_1684 | 486 |
| 793 | 3300046809 | Ga0495600_0003665 | Ga0495600_0003665_4953_6476 | 486 |
| 794 | 3300047315 | Ga0495581_0005319 | Ga0495581_0005319_5701_7224 | 486 |
| 795 | 3300047315 | Ga0495581_0086809 | Ga0495581_0086809_221_1744 | 486 |
| 796 | 3300047319 | Ga0495674_0117468 | Ga0495674_0117468_562_2067 | 486 |
| 797 | 3300047320 | Ga0495672_0082865 | Ga0495672_0082865_154_1677 | 486 |
| 798 | 3300047321 | Ga0495676_0021782 | Ga0495676_0021782_2825_4348 | 486 |
| 799 | 3300047444 | Ga0495675_0001165 | Ga0495675_0001165_1351_2874 | 486 |
| 800 | 3300047444 | Ga0495675_0049625 | Ga0495675_0049625_726_2237 | 486 |
| 801 | 3300047471 | Ga0495684_0040591 | Ga0495684_0040591_1940_3463 | 486 |
| 802 | 3300047472 | Ga0495686_0000027 | Ga0495686_0000027_18826_20349 | 486 |
| 803 | 3300047472 | Ga0495686_0008767 | Ga0495686_0008767_1340_2863 | 486 |
| 804 | 3300048089 | Ga0495614_0001042 | Ga0495614_0001042_8604_10127 | 486 |
| 805 | 3300048907 | Ga0496104_0000127 | Ga0496104_0000127_17247_18770 | 486 |
| 806 | 3300048907 | Ga0496104_0126993 | Ga0496104_0126993_628_2148 | 486 |
| 807 | 3300048907 | Ga0496104_0130612 | Ga0496104_0130612_874_2385 | 486 |
| 808 | 3300048907 | Ga0496104_0273838 | Ga0496104_0273838_18_1538 | 486 |
| 809 | 3300048909 | Ga0496106_0136959 | Ga0496106_0136959_243_1763 | 486 |
| 810 | 3300048915 | Ga0496112_0089113 | Ga0496112_0089113_714_2219 | 486 |
| 811 | 3300048918 | Ga0496115_0012549 | Ga0496115_0012549_1705_3225 | 486 |
| 812 | 3300048918 | Ga0496115_0148198 | Ga0496115_0148198_113_1639 | 486 |
| 813 | 3300048918 | Ga0496115_0149101 | Ga0496115_0149101_261_1784 | 486 |
| 814 | 3300048929 | Ga0496126_0002651 | Ga0496126_0002651_4138_5661 | 486 |
| 815 | 3300048929 | Ga0496126_0037039 | Ga0496126_0037039_1540_3063 | 486 |
| 816 | 3300050514 | nmdc:mga08x19_2984_c1 | nmdc:mga08x19_2984_c1_4645_6150 | 486 |
| 817 | 3300053093 | Ga0500651_0000002 | Ga0500651_0000002_74453_75976 | 486 |
| 818 | 3300053119 | Ga0500595_000014 | Ga0500595_000014_97800_99323 | 486 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vrd-assembly2.cif.gz_B | crystal structure of inosine-5'-monophosphate dehydrogenase (tm1347) from thermotoga maritima at 2.18 a resolution | 0.9671 | 6 | 462 |
| 1vrd-assembly1.cif.gz_A | crystal structure of inosine-5'-monophosphate dehydrogenase (tm1347) from thermotoga maritima at 2.18 a resolution | 0.9645 | 6 | 462 |
| 6kcf-assembly1.cif.gz_D-2 | structure of inosine 5'-monophosphate dehydrogenase from candidatus liberibacter asiaticus str. psy62 | 0.9642 | 8 | 465 |
| 6kcf-assembly1.cif.gz_C-2 | structure of inosine 5'-monophosphate dehydrogenase from candidatus liberibacter asiaticus str. psy62 | 0.9642 | 8 | 465 |
| 1vrd-assembly2.cif.gz_B | crystal structure of inosine-5'-monophosphate dehydrogenase (tm1347) from thermotoga maritima at 2.18 a resolution | 0.9641 | 6 | 462 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4qq3A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.956 | 4 | 462 | 3.20.20.70 |
| 5x8oA01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9521 | 6 | 464 | 3.20.20.70 |
| 4dqwB02 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9514 | 95 | 203 | 3.10.580.10 |
| 4qq3A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9406 | 4 | 462 | 3.20.20.70 |
| 5x8oA01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9309 | 6 | 464 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A351UUM3-F1-model_v4 | IMP dehydrogenase (EC 1.1.1.205) | 0.9895 | 201 | 294 |
GO:0003938
GO:0006183 |
| AF-A0A2V9FMH8-F1-model_v4 | IMP dehydrogenase (EC 1.1.1.205) | 0.9725 | 92 | 234 |
GO:0003938
GO:0006183 |
| AF-A0A3D3AS44-F1-model_v4 | deleted | 0.9719 | 205 | 370 |
|
| AF-A0A7S2MLS1-F1-model_v4 | IMP dehydrogenase/GMP reductase domain-containing protein | 0.9652 | 195 | 299 |
GO:0003938
GO:0005737 GO:0006183 |
| AF-A0A3R9WHI1-F1-model_v4 | deleted | 0.9636 | 191 | 320 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar