F482117
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 817 | 542 | 605 | 411 |
Family's Representative Sequence
| Representative Sequence | 3300053111|Ga0500572_000633|Ga0500572_000633_1399_2640 |
| Length | 376 |
| Sequence | MTDVTMNGEISDDARARRNVARLAAAQALTGANSAVIFTIAPDVSLATVPISMYVVGLAAGTLPTGAISRRFGRRVAFIIGTACGVVTGLLGSFAILRGSFVLFCAATFLGGLYGAVAQSYRFAAADGASAAFRPKAVSWVMAGGIFAGLLGPQLVQWTMEIWQPYLFDLHGGRPLLQIVRQPRFIAAALCGTVAYPVMNLVMTSAPLAMKMCGLTVSDSNFGLQWHIVAMYGPSFFTGALIARFGAPAIVALGLCLEAVAAMIGLSGLTAMHFWATLVMLGMGWNFGFVGASALVLETHLASERNKVQAFNDFLIFGMMALGSFSSGQLLANFGWSAVNLVVFPPVALGLCVLALVWSAKRRQARLEPVPELPEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 10 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 11 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 12 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 13 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 14 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 15 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 16 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 17 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 18 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 19 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 20 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 21 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 22 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 23 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 24 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 25 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 26 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 27 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 28 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 29 | 2791355199 | |||
| 30 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 31 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 32 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 33 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 34 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 35 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 36 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 37 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 38 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 39 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 40 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 41 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 42 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 43 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 44 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 45 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 46 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 47 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 48 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 49 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 50 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 51 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 52 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 53 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 54 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 55 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 56 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 57 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 58 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 59 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 60 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 61 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 62 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 63 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 64 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 65 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 66 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 67 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 68 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 69 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 70 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 71 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 72 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 73 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 74 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 75 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 76 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 77 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 78 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 79 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 80 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 81 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 82 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 83 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 84 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 85 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 86 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 87 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 88 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 89 | 2904699407 | |||
| 90 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 91 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 92 | 2906610324 | |||
| 93 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 94 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 95 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 96 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 97 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 98 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 99 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 100 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 101 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 102 | 2922368715 | |||
| 103 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 104 | 2922425934 | |||
| 105 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 106 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 107 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 108 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 109 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 110 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 111 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 112 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 113 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 114 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 115 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 116 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 117 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 118 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 119 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 120 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 121 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 122 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 123 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 124 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 125 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 126 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 127 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 128 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 129 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 130 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 131 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 132 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 133 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 134 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 135 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 136 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 137 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 138 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 139 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 140 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 141 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 142 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 143 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 144 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 145 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 146 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 147 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 148 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 149 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 150 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 151 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 152 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 153 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 154 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 155 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 156 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 157 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 158 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 159 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 160 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 161 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 162 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 163 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 164 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 165 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 166 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 167 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 168 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 169 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 170 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 171 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 172 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 173 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 174 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 175 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 176 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 177 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 178 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 179 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 180 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 181 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 182 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 184 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 186 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 187 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 188 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 189 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 191 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 195 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 197 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 198 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 202 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 203 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 204 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 205 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 206 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 207 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 210 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 212 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 213 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 214 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 215 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 216 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 217 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 218 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 219 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 220 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 221 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 222 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 224 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 225 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 226 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 227 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 229 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 231 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 232 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 233 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 239 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 252 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 253 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 254 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 255 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 256 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 261 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 297 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 298 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 299 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 300 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 304 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 305 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 306 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 307 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 308 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 309 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 310 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 311 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 312 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 313 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 314 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 315 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 316 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 317 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 318 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 319 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 320 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 321 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 322 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 323 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 324 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 325 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 326 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 327 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 328 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 329 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 330 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 331 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 332 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 333 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 334 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 335 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 336 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 337 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 338 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 339 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 340 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 341 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 342 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 343 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 344 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 345 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 346 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 347 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 348 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 349 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 350 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 351 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 352 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 353 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 354 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 355 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 356 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 357 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 358 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 359 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 360 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 361 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 362 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 363 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 421 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 422 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 423 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 424 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 425 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 426 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 428 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 429 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 430 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 431 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 432 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 433 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 434 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 435 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 436 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 437 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 438 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 439 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 440 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 441 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 442 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 443 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 469 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 470 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 472 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 475 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 476 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 477 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 478 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 479 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 480 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 481 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 482 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 483 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 484 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 485 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 486 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 487 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 488 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 489 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 490 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 491 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 492 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 493 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 494 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 495 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 496 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 497 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 498 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 499 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 500 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 501 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 502 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 503 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 504 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 505 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 506 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 507 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 508 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 509 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 510 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 511 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 512 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 513 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 514 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 515 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 516 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 517 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 518 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 519 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 520 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 521 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 522 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 523 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 524 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 525 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 526 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 527 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 528 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 529 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 530 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 531 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 532 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 533 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 534 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 535 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 536 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 537 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 538 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 539 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 540 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 541 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 542 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 74.38 |
| Metatranscriptomes | 0.12 |
| Isolates | 25.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.04 |
| Nodule | 20.56 |
| Rhizoplane | 4.65 |
| Rhizosphere | 50.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10002301 | 3300003203 | Bacteria | 9008 |
| 2 | JGI25406J46586_10006164 | 3300003203 | Bacteria | 5536 |
| 3 | JGI25406J46586_10007239 | 3300003203 | Bacteria | 5077 |
| 4 | JGI25153J46596_10000947 | 3300003215 | Bacteria | 17623 |
| 5 | JGI25160J50197_1002310 | 3300003354 | Bacteria | 8937 |
| 6 | Ga0055542_1006056 | 3300003762 | Bacteria | 2634 |
| 7 | Ga0055531_10002401 | 3300003794 | Bacteria | 12583 |
| 8 | Ga0065165_1005891 | 3300005262 | Bacteria | 6660 |
| 9 | Ga0065165_1023874 | 3300005262 | Bacteria | 2065 |
| 10 | Ga0070658_10033274 | 3300005327 | Bacteria | 4147 |
| 11 | Ga0070683_100014340 | 3300005329 | Bacteria | 6931 |
| 12 | Ga0070683_100050291 | 3300005329 | Bacteria | 3858 |
| 13 | Ga0070670_100152733 | 3300005331 | Bacteria | 1998 |
| 14 | Ga0068869_100112245 | 3300005334 | Bacteria | 2075 |
| 15 | Ga0070680_100006331 | 3300005336 | Bacteria | 8989 |
| 16 | Ga0070680_100105807 | 3300005336 | Bacteria | 2339 |
| 17 | Ga0070680_100148329 | 3300005336 | Bacteria | 1969 |
| 18 | Ga0070682_100044950 | 3300005337 | Bacteria | 2736 |
| 19 | Ga0068868_100047915 | 3300005338 | Bacteria | 3351 |
| 20 | Ga0070660_100009964 | 3300005339 | Bacteria | 6700 |
| 21 | Ga0070691_10017608 | 3300005341 | Bacteria | 3287 |
| 22 | Ga0070668_100091727 | 3300005347 | Bacteria | 2395 |
| 23 | Ga0070673_100050863 | 3300005364 | Bacteria | 3242 |
| 24 | Ga0070659_100108110 | 3300005366 | Bacteria | 2243 |
| 25 | Ga0070709_10000732 | 3300005434 | Bacteria | 18548 |
| 26 | Ga0070714_100001031 | 3300005435 | Bacteria | 19841 |
| 27 | Ga0070714_100018874 | 3300005435 | Bacteria | 5611 |
| 28 | Ga0070714_100136932 | 3300005435 | Bacteria | 2194 |
| 29 | Ga0070713_100000447 | 3300005436 | Bacteria | 26301 |
| 30 | Ga0070713_100014459 | 3300005436 | Bacteria | 5864 |
| 31 | Ga0070713_100039153 | 3300005436 | Bacteria | 3845 |
| 32 | Ga0070713_100048359 | 3300005436 | Bacteria | 3502 |
| 33 | Ga0070713_100054432 | 3300005436 | Bacteria | 3320 |
| 34 | Ga0070713_100319796 | 3300005436 | Bacteria | 1433 |
| 35 | Ga0070710_10000211 | 3300005437 | Bacteria | 27400 |
| 36 | Ga0070710_10002104 | 3300005437 | Bacteria | 9438 |
| 37 | Ga0070710_10011225 | 3300005437 | Bacteria | 4421 |
| 38 | Ga0070711_100005283 | 3300005439 | Bacteria | 7708 |
| 39 | Ga0070711_100009790 | 3300005439 | Bacteria | 5911 |
| 40 | Ga0070711_100023869 | 3300005439 | Bacteria | 3983 |
| 41 | Ga0070663_100029366 | 3300005455 | Bacteria | 3756 |
| 42 | Ga0070663_100161009 | 3300005455 | Bacteria | 1727 |
| 43 | Ga0070662_100009681 | 3300005457 | Bacteria | 6305 |
| 44 | Ga0070681_10036946 | 3300005458 | Bacteria | 4902 |
| 45 | Ga0070681_10133621 | 3300005458 | Bacteria | 2412 |
| 46 | Ga0070698_100143497 | 3300005471 | Bacteria | 2338 |
| 47 | Ga0070679_100022491 | 3300005530 | Bacteria | 6161 |
| 48 | Ga0070679_100096241 | 3300005530 | Bacteria | 2948 |
| 49 | Ga0070679_100197670 | 3300005530 | Bacteria | 1977 |
| 50 | Ga0070679_100230981 | 3300005530 | Bacteria | 1809 |
| 51 | Ga0070684_100003114 | 3300005535 | Bacteria | 12386 |
| 52 | Ga0070684_100008647 | 3300005535 | Bacteria | 7977 |
| 53 | Ga0070684_100042422 | 3300005535 | Bacteria | 3927 |
| 54 | Ga0070684_100071338 | 3300005535 | Bacteria | 3057 |
| 55 | Ga0070684_100091923 | 3300005535 | Bacteria | 2700 |
| 56 | Ga0070697_100134688 | 3300005536 | Bacteria | 2074 |
| 57 | Ga0068853_100008174 | 3300005539 | Bacteria | 8398 |
| 58 | Ga0070693_100036325 | 3300005547 | Bacteria | 2738 |
| 59 | Ga0070665_100057781 | 3300005548 | Bacteria | 3889 |
| 60 | Ga0070665_100059724 | 3300005548 | Bacteria | 3822 |
| 61 | Ga0068855_100033793 | 3300005563 | Bacteria | 6101 |
| 62 | Ga0068855_100040910 | 3300005563 | Bacteria | 5497 |
| 63 | Ga0068855_100055240 | 3300005563 | Bacteria | 4665 |
| 64 | Ga0068855_100286651 | 3300005563 | Bacteria | 1827 |
| 65 | Ga0070664_100041783 | 3300005564 | Bacteria | 3870 |
| 66 | Ga0070664_100046895 | 3300005564 | Bacteria | 3651 |
| 67 | Ga0068856_100002749 | 3300005614 | Bacteria | 18013 |
| 68 | Ga0068852_100027195 | 3300005616 | Bacteria | 4659 |
| 69 | Ga0068852_100146597 | 3300005616 | Bacteria | 2190 |
| 70 | Ga0068852_100260656 | 3300005616 | Bacteria | 1664 |
| 71 | Ga0068859_100093609 | 3300005617 | Bacteria | 3056 |
| 72 | Ga0068859_100094950 | 3300005617 | Bacteria | 3035 |
| 73 | Ga0068851_10005126 | 3300005834 | Bacteria | 5942 |
| 74 | Ga0068870_10030391 | 3300005840 | Bacteria | 2730 |
| 75 | Ga0068858_100103546 | 3300005842 | Bacteria | 2655 |
| 76 | Ga0068860_100000257 | 3300005843 | Bacteria | 78468 |
| 77 | Ga0068862_100059192 | 3300005844 | Bacteria | 3289 |
| 78 | Ga0081455_10006921 | 3300005937 | Bacteria | 12061 |
| 79 | Ga0081455_10007517 | 3300005937 | Bacteria | 11462 |
| 80 | Ga0081455_10036677 | 3300005937 | Bacteria | 4361 |
| 81 | Ga0081540_1002991 | 3300005983 | Bacteria | 13549 |
| 82 | Ga0081540_1005442 | 3300005983 | Bacteria | 9502 |
| 83 | Ga0081540_1006739 | 3300005983 | Bacteria | 8306 |
| 84 | Ga0081540_1006907 | 3300005983 | Bacteria | 8187 |
| 85 | Ga0081540_1035800 | 3300005983 | Bacteria | 2657 |
| 86 | Ga0081539_10000048 | 3300005985 | Bacteria | 272906 |
| 87 | Ga0081539_10000530 | 3300005985 | Bacteria | 79454 |
| 88 | Ga0081539_10023403 | 3300005985 | Bacteria | 4048 |
| 89 | Ga0070717_10004501 | 3300006028 | Bacteria | 10072 |
| 90 | Ga0075363_100030835 | 3300006048 | Bacteria | 2777 |
| 91 | Ga0070716_100001713 | 3300006173 | Bacteria | 9880 |
| 92 | Ga0075367_10085542 | 3300006178 | Bacteria | 1913 |
| 93 | Ga0075366_10041070 | 3300006195 | Bacteria | 2737 |
| 94 | Ga0097621_100213847 | 3300006237 | Bacteria | 1678 |
| 95 | Ga0075370_10018723 | 3300006353 | Bacteria | 3759 |
| 96 | Ga0075370_10032739 | 3300006353 | Bacteria | 2907 |
| 97 | Ga0075370_10121913 | 3300006353 | Bacteria | 1518 |
| 98 | Ga0097620_100093609 | 3300006931 | Bacteria | 3056 |
| 99 | Ga0097620_100094952 | 3300006931 | Bacteria | 3035 |
| 100 | Ga0099824_1001145 | 3300006942 | Bacteria | 36195 |
| 101 | Ga0099822_1000135 | 3300006943 | Bacteria | 49135 |
| 102 | Ga0099795_10035443 | 3300007788 | Bacteria | 1745 |
| 103 | Ga0105240_10005693 | 3300009093 | Bacteria | 18493 |
| 104 | Ga0105240_10069560 | 3300009093 | Bacteria | 4357 |
| 105 | Ga0105245_10040748 | 3300009098 | Bacteria | 4139 |
| 106 | Ga0105241_10116078 | 3300009174 | Bacteria | 2149 |
| 107 | Ga0105237_10004882 | 3300009545 | Bacteria | 15362 |
| 108 | Ga0105237_10022753 | 3300009545 | Bacteria | 6431 |
| 109 | Ga0105238_10008395 | 3300009551 | Bacteria | 10334 |
| 110 | Ga0099796_10008899 | 3300010159 | Bacteria | 2694 |
| 111 | Ga0105239_10023381 | 3300010375 | Bacteria | 6806 |
| 112 | Ga0105239_10117102 | 3300010375 | Bacteria | 2957 |
| 113 | Ga0105239_10151690 | 3300010375 | Bacteria | 2586 |
| 114 | Ga0105239_10448479 | 3300010375 | Bacteria | 1463 |
| 115 | Ga0105246_10017164 | 3300011119 | Bacteria | 4598 |
| 116 | Ga0157373_10075513 | 3300013100 | Bacteria | 2378 |
| 117 | Ga0157371_10023913 | 3300013102 | Bacteria | 4464 |
| 118 | Ga0157369_10024800 | 3300013105 | Bacteria | 6663 |
| 119 | Ga0157369_10028904 | 3300013105 | Bacteria | 6132 |
| 120 | Ga0157369_10031823 | 3300013105 | Bacteria | 5805 |
| 121 | Ga0157374_10012415 | 3300013296 | Bacteria | 7411 |
| 122 | Ga0157378_10038827 | 3300013297 | Bacteria | 4221 |
| 123 | Ga0157372_10064246 | 3300013307 | Bacteria | 4118 |
| 124 | Ga0157372_10081164 | 3300013307 | Bacteria | 3670 |
| 125 | Ga0157375_10036499 | 3300013308 | Bacteria | 4703 |
| 126 | Ga0163163_10058864 | 3300014325 | Bacteria | 3798 |
| 127 | Ga0157380_10063259 | 3300014326 | Bacteria | 2966 |
| 128 | Ga0157379_10134198 | 3300014968 | Bacteria | 2229 |
| 129 | Ga0214544_1000087 | 3300021320 | Bacteria | 119600 |
| 130 | Ga0214542_1000018 | 3300021321 | Bacteria | 202226 |
| 131 | Ga0214545_1000009 | 3300021324 | Bacteria | 202915 |
| 132 | Ga0213872_10036852 | 3300021361 | Bacteria | 2234 |
| 133 | Ga0213875_10007759 | 3300021388 | Bacteria | 5518 |
| 134 | Ga0209677_100351 | 3300025253 | Bacteria | 28656 |
| 135 | Ga0209148_1000694 | 3300025254 | Bacteria | 27288 |
| 136 | Ga0209233_1001183 | 3300025261 | Bacteria | 10540 |
| 137 | Ga0209233_1002715 | 3300025261 | Bacteria | 6385 |
| 138 | Ga0209233_1003057 | 3300025261 | Bacteria | 5951 |
| 139 | Ga0209455_1001551 | 3300025272 | Bacteria | 10178 |
| 140 | Ga0209564_1001755 | 3300025295 | Bacteria | 20242 |
| 141 | Ga0209564_1015806 | 3300025295 | Bacteria | 3049 |
| 142 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 143 | Ga0209758_1000224 | 3300025297 | Bacteria | 121530 |
| 144 | Ga0209758_1001187 | 3300025297 | Bacteria | 32935 |
| 145 | Ga0209758_1005118 | 3300025297 | Bacteria | 10363 |
| 146 | Ga0209758_1009011 | 3300025297 | Bacteria | 6304 |
| 147 | Ga0209758_1017848 | 3300025297 | Bacteria | 3508 |
| 148 | Ga0207426_1001141 | 3300025302 | Bacteria | 23982 |
| 149 | Ga0207426_1004819 | 3300025302 | Bacteria | 6402 |
| 150 | Ga0209051_1019809 | 3300025303 | Bacteria | 2923 |
| 151 | Ga0209257_1000440 | 3300025304 | Bacteria | 79182 |
| 152 | Ga0207656_10004685 | 3300025321 | Bacteria | 4793 |
| 153 | Ga0207692_10011320 | 3300025898 | Bacteria | 3791 |
| 154 | Ga0207692_10012479 | 3300025898 | Bacteria | 3650 |
| 155 | Ga0207692_10019710 | 3300025898 | Bacteria | 3053 |
| 156 | Ga0207685_10004111 | 3300025905 | Bacteria | 3649 |
| 157 | Ga0207699_10000480 | 3300025906 | Bacteria | 20266 |
| 158 | Ga0207699_10001027 | 3300025906 | Bacteria | 13164 |
| 159 | Ga0207705_10025816 | 3300025909 | Bacteria | 4192 |
| 160 | Ga0207654_10018569 | 3300025911 | Bacteria | 3651 |
| 161 | Ga0207707_10004596 | 3300025912 | Bacteria | 12123 |
| 162 | Ga0207707_10007086 | 3300025912 | Bacteria | 9771 |
| 163 | Ga0207695_10000065 | 3300025913 | Bacteria | 336949 |
| 164 | Ga0207695_10066385 | 3300025913 | Bacteria | 3705 |
| 165 | Ga0207695_10243066 | 3300025913 | Bacteria | 1701 |
| 166 | Ga0207671_10001858 | 3300025914 | Bacteria | 23570 |
| 167 | Ga0207671_10012315 | 3300025914 | Bacteria | 6884 |
| 168 | Ga0207671_10097887 | 3300025914 | Bacteria | 2218 |
| 169 | Ga0207671_10108087 | 3300025914 | Bacteria | 2114 |
| 170 | Ga0207671_10231229 | 3300025914 | Bacteria | 1450 |
| 171 | Ga0207693_10000774 | 3300025915 | Bacteria | 28742 |
| 172 | Ga0207693_10079234 | 3300025915 | Bacteria | 2571 |
| 173 | Ga0207663_10000356 | 3300025916 | Bacteria | 19925 |
| 174 | Ga0207663_10003833 | 3300025916 | Bacteria | 7424 |
| 175 | Ga0207663_10053410 | 3300025916 | Bacteria | 2524 |
| 176 | Ga0207660_10002711 | 3300025917 | Bacteria | 11604 |
| 177 | Ga0207657_10011430 | 3300025919 | Bacteria | 8815 |
| 178 | Ga0207657_10015396 | 3300025919 | Bacteria | 7409 |
| 179 | Ga0207652_10004991 | 3300025921 | Bacteria | 10747 |
| 180 | Ga0207652_10105103 | 3300025921 | Bacteria | 2498 |
| 181 | Ga0207652_10151680 | 3300025921 | Bacteria | 2075 |
| 182 | Ga0207652_10182397 | 3300025921 | Bacteria | 1887 |
| 183 | Ga0207694_10007898 | 3300025924 | Bacteria | 8055 |
| 184 | Ga0207687_10149472 | 3300025927 | Bacteria | 1781 |
| 185 | Ga0207700_10032190 | 3300025928 | Bacteria | 3736 |
| 186 | Ga0207700_10038888 | 3300025928 | Bacteria | 3457 |
| 187 | Ga0207700_10183069 | 3300025928 | Bacteria | 1756 |
| 188 | Ga0207664_10004313 | 3300025929 | Bacteria | 9629 |
| 189 | Ga0207664_10245442 | 3300025929 | Bacteria | 1561 |
| 190 | Ga0207664_10271154 | 3300025929 | Bacteria | 1487 |
| 191 | Ga0207644_10267073 | 3300025931 | Bacteria | 1370 |
| 192 | Ga0207706_10044195 | 3300025933 | Bacteria | 3949 |
| 193 | Ga0207665_10000289 | 3300025939 | Bacteria | 34924 |
| 194 | Ga0207665_10164468 | 3300025939 | Bacteria | 1598 |
| 195 | Ga0207661_10000678 | 3300025944 | Bacteria | 22066 |
| 196 | Ga0207661_10029561 | 3300025944 | Bacteria | 4210 |
| 197 | Ga0207661_10070023 | 3300025944 | Bacteria | 2862 |
| 198 | Ga0207679_10054377 | 3300025945 | Bacteria | 2947 |
| 199 | Ga0207667_10010722 | 3300025949 | Bacteria | 10691 |
| 200 | Ga0207667_10030890 | 3300025949 | Bacteria | 5789 |
| 201 | Ga0207667_10052700 | 3300025949 | Bacteria | 4284 |
| 202 | Ga0207668_10036396 | 3300025972 | Bacteria | 3284 |
| 203 | Ga0207639_10012139 | 3300026041 | Bacteria | 5993 |
| 204 | Ga0207678_10011493 | 3300026067 | Bacteria | 7776 |
| 205 | Ga0207678_10071759 | 3300026067 | Bacteria | 2968 |
| 206 | Ga0207702_10000056 | 3300026078 | Bacteria | 131186 |
| 207 | Ga0207702_10325395 | 3300026078 | Bacteria | 1465 |
| 208 | Ga0207674_10031657 | 3300026116 | Bacteria | 5553 |
| 209 | Ga0207683_10014468 | 3300026121 | Bacteria | 6718 |
| 210 | Ga0207683_10063341 | 3300026121 | Bacteria | 3257 |
| 211 | Ga0207698_10259015 | 3300026142 | Bacteria | 1597 |
| 212 | Ga0209389_1000076 | 3300027296 | Bacteria | 92447 |
| 213 | Ga0209589_1000017 | 3300027357 | Bacteria | 215546 |
| 214 | Ga0209489_100018 | 3300027361 | Bacteria | 215546 |
| 215 | Ga0209489_100416 | 3300027361 | Bacteria | 77981 |
| 216 | Ga0209700_100014 | 3300027363 | Bacteria | 299349 |
| 217 | Ga0209700_100028 | 3300027363 | Bacteria | 215546 |
| 218 | Ga0268266_10009701 | 3300028379 | Bacteria | 8460 |
| 219 | Ga0268266_10014397 | 3300028379 | Bacteria | 6800 |
| 220 | Ga0268266_10052181 | 3300028379 | Bacteria | 3511 |
| 221 | Ga0268266_10053044 | 3300028379 | Bacteria | 3483 |
| 222 | Ga0268265_10047858 | 3300028380 | Bacteria | 3206 |
| 223 | Ga0268264_10000049 | 3300028381 | Bacteria | 329992 |
| 224 | Ga0265318_10007398 | 3300028577 | Bacteria | 4968 |
| 225 | Ga0265323_10001811 | 3300028653 | Bacteria | 10147 |
| 226 | Ga0307517_10000766 | 3300028786 | Bacteria | 55210 |
| 227 | Ga0265338_10000024 | 3300028800 | Bacteria | 297778 |
| 228 | Ga0265324_10007310 | 3300029957 | Bacteria | 4493 |
| 229 | Ga0265330_10031484 | 3300031235 | Bacteria | 2378 |
| 230 | Ga0265332_10023238 | 3300031238 | Bacteria | 2734 |
| 231 | Ga0265325_10003471 | 3300031241 | Bacteria | 10279 |
| 232 | Ga0265340_10009442 | 3300031247 | Bacteria | 5235 |
| 233 | Ga0265339_10005247 | 3300031249 | Bacteria | 8648 |
| 234 | Ga0265339_10047978 | 3300031249 | Bacteria | 2343 |
| 235 | Ga0265331_10019815 | 3300031250 | Bacteria | 3465 |
| 236 | Ga0265316_10095944 | 3300031344 | Bacteria | 2258 |
| 237 | Ga0307513_10206949 | 3300031456 | Bacteria | 1797 |
| 238 | Ga0307509_10011529 | 3300031507 | Bacteria | 10685 |
| 239 | Ga0307509_10060767 | 3300031507 | Bacteria | 3992 |
| 240 | Ga0265313_10088268 | 3300031595 | Bacteria | 1396 |
| 241 | Ga0307508_10000005 | 3300031616 | Bacteria | 286511 |
| 242 | Ga0265314_10005659 | 3300031711 | Bacteria | 11226 |
| 243 | Ga0265314_10047193 | 3300031711 | Bacteria | 3033 |
| 244 | Ga0265342_10023127 | 3300031712 | Bacteria | 3938 |
| 245 | Ga0265342_10054469 | 3300031712 | Bacteria | 2376 |
| 246 | Ga0307516_10072365 | 3300031730 | Bacteria | 3307 |
| 247 | Ga0307516_10087107 | 3300031730 | Bacteria | 2958 |
| 248 | Ga0307412_10150773 | 3300031911 | Bacteria | 1715 |
| 249 | Ga0307507_10008595 | 3300033179 | Bacteria | 14023 |
| 250 | Ga0307510_10001273 | 3300033180 | Bacteria | 27490 |
| 251 | Ga0307510_10007616 | 3300033180 | Bacteria | 12905 |
| 252 | Ga0307510_10057910 | 3300033180 | Bacteria | 4016 |
| 253 | Ga0307510_10083442 | 3300033180 | Bacteria | 3085 |
| 254 | Ga0315911_1000033 | 3300033442 | Bacteria | 67159 |
| 255 | Ga0373926_0022912 | 3300035083 | Bacteria | 2167 |
| 256 | Ga0373944_0032530 | 3300035089 | Bacteria | 1576 |
| 257 | Ga0373923_0009031 | 3300035111 | Bacteria | 3580 |
| 258 | Ga0373936_0016157 | 3300035113 | Bacteria | 2869 |
| 259 | Ga0373936_0042319 | 3300035113 | Bacteria | 1828 |
| 260 | Ga0373953_0001082 | 3300035117 | Bacteria | 7700 |
| 261 | Ga0373953_0011203 | 3300035117 | Bacteria | 3142 |
| 262 | Ga0373954_0002766 | 3300035118 | Bacteria | 7387 |
| 263 | Ga0373954_0021858 | 3300035118 | Bacteria | 2898 |
| 264 | Ga0373956_0000296 | 3300035119 | Bacteria | 20068 |
| 265 | Ga0373957_0001181 | 3300035120 | Bacteria | 6958 |
| 266 | Ga0373957_0066047 | 3300035120 | Bacteria | 1408 |
| 267 | Ga0373943_0006477 | 3300035170 | Bacteria | 5259 |
| 268 | Ga0373946_0003449 | 3300035171 | Bacteria | 5614 |
| 269 | Ga0373924_0014868 | 3300035410 | Bacteria | 2946 |
| 270 | Ga0373924_0040505 | 3300035410 | Bacteria | 1907 |
| 271 | Ga0373935_0001604 | 3300035692 | Bacteria | 12605 |
| 272 | Ga0373935_0041010 | 3300035692 | Bacteria | 2907 |
| 273 | Ga0373935_0083390 | 3300035692 | Bacteria | 2080 |
| 274 | Ga0373927_0000071 | 3300035695 | Bacteria | 73794 |
| 275 | Ga0373927_0054529 | 3300035695 | Bacteria | 2586 |
| 276 | Ga0373933_0000114 | 3300035724 | Bacteria | 52016 |
| 277 | Ga0373933_0004010 | 3300035724 | Bacteria | 8111 |
| 278 | Ga0373933_0029787 | 3300035724 | Bacteria | 3158 |
| 279 | Ga0373933_0125855 | 3300035724 | Bacteria | 1608 |
| 280 | Ga0373947_0010412 | 3300035725 | Bacteria | 5336 |
| 281 | Ga0373947_0010721 | 3300035725 | Bacteria | 5260 |
| 282 | Ga0373947_0089639 | 3300035725 | Bacteria | 1916 |
| 283 | Ga0373937_0005314 | 3300036401 | Bacteria | 11007 |
| 284 | Ga0373937_0075537 | 3300036401 | Bacteria | 3111 |
| 285 | Ga0373937_0098220 | 3300036401 | Bacteria | 2716 |
| 286 | Ga0372808_005196 | 3300036459 | Bacteria | 1706 |
| 287 | Ga0373925_0009450 | 3300037068 | Bacteria | 7096 |
| 288 | Ga0373925_0050474 | 3300037068 | Bacteria | 3102 |
| 289 | Ga0373925_0133108 | 3300037068 | Bacteria | 1940 |
| 290 | Ga0373925_0228811 | 3300037068 | Bacteria | 1486 |
| 291 | Ga0395899_0067636 | 3300037312 | Bacteria | 2621 |
| 292 | Ga0395900_0006407 | 3300037418 | Bacteria | 12267 |
| 293 | Ga0395900_0038973 | 3300037418 | Bacteria | 4898 |
| 294 | Ga0395898_0017762 | 3300037466 | Bacteria | 7258 |
| 295 | Ga0395898_0067697 | 3300037466 | Bacteria | 3457 |
| 296 | Ga0395898_0124991 | 3300037466 | Bacteria | 2464 |
| 297 | Ga0395898_0262021 | 3300037466 | Bacteria | 1649 |
| 298 | Ga0395898_0270675 | 3300037466 | Bacteria | 1620 |
| 299 | Ga0395905_0005511 | 3300037471 | Bacteria | 12915 |
| 300 | Ga0436364_0194875 | 3300037853 | Bacteria | 16602 |
| 301 | Ga0436364_0806245 | 3300037853 | Bacteria | 1514 |
| 302 | Ga0395901_0019529 | 3300038443 | Bacteria | 6927 |
| 303 | Ga0395901_0025443 | 3300038443 | Bacteria | 6075 |
| 304 | Ga0436365_0409965 | 3300039437 | Bacteria | 4733 |
| 305 | Ga0436365_0650112 | 3300039437 | Bacteria | 58550 |
| 306 | Ga0436365_1054137 | 3300039437 | Bacteria | 5465 |
| 307 | Ga0436360_1265645 | 3300039438 | Bacteria | 3160 |
| 308 | Ga0436361_0808880 | 3300039447 | Bacteria | 2290 |
| 309 | Ga0436363_0356954 | 3300039450 | Bacteria | 6790 |
| 310 | Ga0466972_0000103 | 3300044658 | Bacteria | 75095 |
| 311 | Ga0466972_0028761 | 3300044658 | Bacteria | 2739 |
| 312 | Ga0466965_0019402 | 3300044683 | Bacteria | 3264 |
| 313 | Ga0466966_0002297 | 3300044684 | Bacteria | 12462 |
| 314 | Ga0466961_0000129 | 3300044693 | Bacteria | 50353 |
| 315 | Ga0466963_0028235 | 3300044694 | Bacteria | 3600 |
| 316 | Ga0466964_0089359 | 3300044706 | Bacteria | 1338 |
| 317 | Ga0466970_0108567 | 3300044765 | Bacteria | 1515 |
| 318 | Ga0466970_0130378 | 3300044765 | Bacteria | 1381 |
| 319 | Ga0466959_0014058 | 3300045049 | Bacteria | 5812 |
| 320 | Ga0466959_0044960 | 3300045049 | Bacteria | 3253 |
| 321 | Ga0466967_0058387 | 3300045976 | Bacteria | 3410 |
| 322 | Ga0466967_0101123 | 3300045976 | Bacteria | 2634 |
| 323 | Ga0466967_0157719 | 3300045976 | Bacteria | 2128 |
| 324 | Ga0466967_0430260 | 3300045976 | Bacteria | 1287 |
| 325 | Ga0495617_018889 | 3300046452 | Bacteria | 2332 |
| 326 | Ga0495592_0015882 | 3300046454 | Bacteria | 5712 |
| 327 | Ga0495592_0020793 | 3300046454 | Bacteria | 4993 |
| 328 | Ga0495603_0000035 | 3300046455 | Bacteria | 57510 |
| 329 | Ga0495603_0003901 | 3300046455 | Bacteria | 8884 |
| 330 | Ga0495603_0016647 | 3300046455 | Bacteria | 4449 |
| 331 | Ga0495629_0000081 | 3300046459 | Bacteria | 85305 |
| 332 | Ga0495629_0000380 | 3300046459 | Bacteria | 37205 |
| 333 | Ga0495629_0131200 | 3300046459 | Bacteria | 1745 |
| 334 | Ga0495638_0020842 | 3300046460 | Bacteria | 4328 |
| 335 | Ga0495638_0055340 | 3300046460 | Bacteria | 2463 |
| 336 | Ga0495638_0060947 | 3300046460 | Bacteria | 2332 |
| 337 | Ga0495641_0000707 | 3300046461 | Bacteria | 28228 |
| 338 | Ga0495651_0022758 | 3300046462 | Bacteria | 4872 |
| 339 | Ga0495651_0061285 | 3300046462 | Bacteria | 2879 |
| 340 | Ga0495651_0123348 | 3300046462 | Bacteria | 1900 |
| 341 | Ga0495653_0004990 | 3300046463 | Bacteria | 10769 |
| 342 | Ga0495580_0008037 | 3300046472 | Bacteria | 8423 |
| 343 | Ga0495582_0029958 | 3300046473 | Bacteria | 2986 |
| 344 | Ga0495639_0000010 | 3300046475 | Bacteria | 93685 |
| 345 | Ga0495639_0025094 | 3300046475 | Bacteria | 2627 |
| 346 | Ga0495662_0000034 | 3300046476 | Bacteria | 46636 |
| 347 | Ga0495662_0011744 | 3300046476 | Bacteria | 4281 |
| 348 | Ga0495664_0098622 | 3300046477 | Bacteria | 1759 |
| 349 | Ga0495606_0000265 | 3300046507 | Bacteria | 92526 |
| 350 | Ga0495608_0000629 | 3300046511 | Bacteria | 24325 |
| 351 | Ga0495618_0032818 | 3300046514 | Bacteria | 3253 |
| 352 | Ga0495620_0013656 | 3300046515 | Bacteria | 4153 |
| 353 | Ga0495628_0036472 | 3300046516 | Bacteria | 3945 |
| 354 | Ga0495628_0070096 | 3300046516 | Bacteria | 2733 |
| 355 | Ga0495628_0117489 | 3300046516 | Bacteria | 2042 |
| 356 | Ga0495630_0010715 | 3300046517 | Bacteria | 6621 |
| 357 | Ga0495630_0024944 | 3300046517 | Bacteria | 4420 |
| 358 | Ga0495644_0057973 | 3300046523 | Bacteria | 1456 |
| 359 | Ga0495663_0020109 | 3300046525 | Bacteria | 1915 |
| 360 | Ga0495666_0020735 | 3300046526 | Bacteria | 3254 |
| 361 | Ga0495666_0067074 | 3300046526 | Bacteria | 1710 |
| 362 | Ga0495652_0012668 | 3300046529 | Bacteria | 7595 |
| 363 | Ga0495652_0020294 | 3300046529 | Bacteria | 5907 |
| 364 | Ga0495652_0028332 | 3300046529 | Bacteria | 4928 |
| 365 | Ga0495652_0080688 | 3300046529 | Bacteria | 2686 |
| 366 | Ga0495665_0000005 | 3300046531 | Bacteria | 86491 |
| 367 | Ga0495665_0040768 | 3300046531 | Bacteria | 2472 |
| 368 | Ga0495640_0006078 | 3300046533 | Bacteria | 9576 |
| 369 | Ga0495640_0016321 | 3300046533 | Bacteria | 5558 |
| 370 | Ga0495586_0050165 | 3300046535 | Bacteria | 2258 |
| 371 | Ga0495587_0020500 | 3300046536 | Bacteria | 4080 |
| 372 | Ga0495587_0028203 | 3300046536 | Bacteria | 3415 |
| 373 | Ga0495598_0011495 | 3300046537 | Bacteria | 2149 |
| 374 | Ga0495598_0017575 | 3300046537 | Bacteria | 1846 |
| 375 | Ga0495645_0044947 | 3300046543 | Bacteria | 3221 |
| 376 | Ga0495622_0019641 | 3300046557 | Bacteria | 3146 |
| 377 | Ga0495622_0084231 | 3300046557 | Bacteria | 1462 |
| 378 | Ga0495667_0013125 | 3300046559 | Bacteria | 5610 |
| 379 | Ga0495667_0014316 | 3300046559 | Bacteria | 5357 |
| 380 | Ga0495667_0083861 | 3300046559 | Bacteria | 2069 |
| 381 | Ga0495668_0005573 | 3300046616 | Bacteria | 8466 |
| 382 | Ga0495634_0000261 | 3300046642 | Bacteria | 49735 |
| 383 | Ga0495634_0016748 | 3300046642 | Bacteria | 5237 |
| 384 | Ga0495634_0068872 | 3300046642 | Bacteria | 2336 |
| 385 | Ga0495634_0093259 | 3300046642 | Bacteria | 1953 |
| 386 | Ga0495635_0000281 | 3300046663 | Bacteria | 32699 |
| 387 | Ga0495635_0003387 | 3300046663 | Bacteria | 11015 |
| 388 | Ga0495635_0003556 | 3300046663 | Bacteria | 10781 |
| 389 | Ga0495661_0003673 | 3300046665 | Bacteria | 11270 |
| 390 | Ga0495588_0002575 | 3300046674 | Bacteria | 7757 |
| 391 | Ga0495588_0014606 | 3300046674 | Bacteria | 3761 |
| 392 | Ga0495588_0019137 | 3300046674 | Bacteria | 3351 |
| 393 | Ga0495599_0009607 | 3300046678 | Bacteria | 5918 |
| 394 | Ga0495599_0028089 | 3300046678 | Bacteria | 3525 |
| 395 | Ga0495599_0067607 | 3300046678 | Bacteria | 2232 |
| 396 | Ga0495623_0030438 | 3300046679 | Bacteria | 3471 |
| 397 | Ga0495646_0010990 | 3300046680 | Bacteria | 5752 |
| 398 | Ga0495646_0015831 | 3300046680 | Bacteria | 4788 |
| 399 | Ga0495646_0017354 | 3300046680 | Bacteria | 4566 |
| 400 | Ga0495646_0073094 | 3300046680 | Bacteria | 2015 |
| 401 | Ga0495647_0004374 | 3300046681 | Bacteria | 4588 |
| 402 | Ga0495658_0000367 | 3300046683 | Bacteria | 25339 |
| 403 | Ga0495658_0056832 | 3300046683 | Bacteria | 2233 |
| 404 | Ga0495658_0107073 | 3300046683 | Bacteria | 1676 |
| 405 | Ga0495613_0011795 | 3300046689 | Bacteria | 6491 |
| 406 | Ga0495613_0028734 | 3300046689 | Bacteria | 4136 |
| 407 | Ga0495613_0051530 | 3300046689 | Bacteria | 3033 |
| 408 | Ga0495624_0000094 | 3300046690 | Bacteria | 59911 |
| 409 | Ga0495624_0078047 | 3300046690 | Bacteria | 2054 |
| 410 | Ga0495670_0038212 | 3300046691 | Bacteria | 2393 |
| 411 | Ga0495600_0000567 | 3300046809 | Bacteria | 19167 |
| 412 | Ga0495600_0004278 | 3300046809 | Bacteria | 8533 |
| 413 | Ga0495581_0000018 | 3300047315 | Bacteria | 58791 |
| 414 | Ga0495604_0005727 | 3300047317 | Bacteria | 9854 |
| 415 | Ga0495604_0015120 | 3300047317 | Bacteria | 6157 |
| 416 | Ga0495604_0049671 | 3300047317 | Bacteria | 3257 |
| 417 | Ga0495674_0000134 | 3300047319 | Bacteria | 56618 |
| 418 | Ga0495674_0245331 | 3300047319 | Bacteria | 1475 |
| 419 | Ga0495672_0120975 | 3300047320 | Bacteria | 1392 |
| 420 | Ga0495676_0039786 | 3300047321 | Bacteria | 3890 |
| 421 | Ga0495680_0014317 | 3300047322 | Bacteria | 6876 |
| 422 | Ga0495680_0089299 | 3300047322 | Bacteria | 2313 |
| 423 | Ga0495675_0013953 | 3300047444 | Bacteria | 5081 |
| 424 | Ga0495675_0041292 | 3300047444 | Bacteria | 2940 |
| 425 | Ga0495677_0014584 | 3300047445 | Bacteria | 2859 |
| 426 | Ga0495684_0000052 | 3300047471 | Bacteria | 85125 |
| 427 | Ga0495684_0030899 | 3300047471 | Bacteria | 4112 |
| 428 | Ga0495684_0051622 | 3300047471 | Bacteria | 3138 |
| 429 | Ga0495686_0019613 | 3300047472 | Bacteria | 4518 |
| 430 | Ga0495686_0029614 | 3300047472 | Bacteria | 3561 |
| 431 | Ga0495686_0046333 | 3300047472 | Bacteria | 2749 |
| 432 | Ga0495593_0000084 | 3300047673 | Bacteria | 41155 |
| 433 | Ga0495593_0000214 | 3300047673 | Bacteria | 30567 |
| 434 | Ga0495593_0051122 | 3300047673 | Bacteria | 2187 |
| 435 | Ga0495614_0035274 | 3300048089 | Bacteria | 2149 |
| 436 | Ga0496101_0030946 | 3300048904 | Bacteria | 3758 |
| 437 | Ga0496102_0038452 | 3300048905 | Bacteria | 4318 |
| 438 | Ga0496104_0005304 | 3300048907 | Bacteria | 11278 |
| 439 | Ga0496104_0005388 | 3300048907 | Bacteria | 11198 |
| 440 | Ga0496104_0032218 | 3300048907 | Bacteria | 4877 |
| 441 | Ga0496104_0063104 | 3300048907 | Bacteria | 3513 |
| 442 | Ga0496105_0001275 | 3300048908 | Bacteria | 17613 |
| 443 | Ga0496105_0025939 | 3300048908 | Bacteria | 4775 |
| 444 | Ga0496105_0031279 | 3300048908 | Bacteria | 4364 |
| 445 | Ga0496105_0062404 | 3300048908 | Bacteria | 3075 |
| 446 | Ga0496106_0011156 | 3300048909 | Bacteria | 6648 |
| 447 | Ga0496106_0051335 | 3300048909 | Bacteria | 3109 |
| 448 | Ga0496106_0088701 | 3300048909 | Bacteria | 2384 |
| 449 | Ga0496106_0132616 | 3300048909 | Bacteria | 1954 |
| 450 | Ga0496106_0144963 | 3300048909 | Bacteria | 1870 |
| 451 | Ga0496106_0175271 | 3300048909 | Bacteria | 1701 |
| 452 | Ga0496107_0003794 | 3300048910 | Bacteria | 10148 |
| 453 | Ga0496108_0028116 | 3300048911 | Bacteria | 4652 |
| 454 | Ga0496108_0103808 | 3300048911 | Bacteria | 2425 |
| 455 | Ga0496108_0106127 | 3300048911 | Bacteria | 2399 |
| 456 | Ga0496109_0025525 | 3300048912 | Bacteria | 5267 |
| 457 | Ga0496110_0031931 | 3300048913 | Bacteria | 4545 |
| 458 | Ga0496110_0055172 | 3300048913 | Bacteria | 3496 |
| 459 | Ga0496110_0191113 | 3300048913 | Bacteria | 1859 |
| 460 | Ga0496110_0201284 | 3300048913 | Bacteria | 1809 |
| 461 | Ga0496110_0312919 | 3300048913 | Bacteria | 1430 |
| 462 | Ga0496112_0000019 | 3300048915 | Bacteria | 185531 |
| 463 | Ga0496112_0002348 | 3300048915 | Bacteria | 15192 |
| 464 | Ga0496112_0020579 | 3300048915 | Bacteria | 6256 |
| 465 | Ga0496112_0032266 | 3300048915 | Bacteria | 5084 |
| 466 | Ga0496112_0047324 | 3300048915 | Bacteria | 4219 |
| 467 | Ga0496113_0010309 | 3300048916 | Bacteria | 6174 |
| 468 | Ga0496114_0053466 | 3300048917 | Bacteria | 3366 |
| 469 | Ga0496115_0031637 | 3300048918 | Bacteria | 4169 |
| 470 | Ga0496115_0143804 | 3300048918 | Bacteria | 1968 |
| 471 | Ga0496115_0243485 | 3300048918 | Bacteria | 1482 |
| 472 | Ga0496115_0252624 | 3300048918 | Bacteria | 1451 |
| 473 | Ga0496116_0003138 | 3300048919 | Bacteria | 16576 |
| 474 | Ga0496116_0055772 | 3300048919 | Bacteria | 2594 |
| 475 | Ga0496117_0031153 | 3300048920 | Bacteria | 4077 |
| 476 | Ga0496117_0038991 | 3300048920 | Bacteria | 3512 |
| 477 | Ga0496118_0049117 | 3300048921 | Bacteria | 3251 |
| 478 | Ga0496118_0063626 | 3300048921 | Bacteria | 2713 |
| 479 | Ga0496118_0181629 | 3300048921 | Bacteria | 1270 |
| 480 | Ga0496119_0019380 | 3300048922 | Bacteria | 5014 |
| 481 | Ga0496120_0005446 | 3300048923 | Bacteria | 10152 |
| 482 | Ga0496120_0044907 | 3300048923 | Bacteria | 2564 |
| 483 | Ga0496120_0058151 | 3300048923 | Bacteria | 2173 |
| 484 | Ga0496121_0000716 | 3300048924 | Bacteria | 61451 |
| 485 | Ga0496121_0001737 | 3300048924 | Bacteria | 35592 |
| 486 | Ga0496121_0004612 | 3300048924 | Bacteria | 18357 |
| 487 | Ga0496121_0022824 | 3300048924 | Bacteria | 6049 |
| 488 | Ga0496121_0027214 | 3300048924 | Bacteria | 5357 |
| 489 | Ga0496121_0031957 | 3300048924 | Bacteria | 4797 |
| 490 | Ga0496121_0040197 | 3300048924 | Bacteria | 4106 |
| 491 | Ga0496121_0063144 | 3300048924 | Bacteria | 3029 |
| 492 | Ga0496121_0077681 | 3300048924 | Bacteria | 2642 |
| 493 | Ga0496121_0097573 | 3300048924 | Bacteria | 2277 |
| 494 | Ga0496121_0108417 | 3300048924 | Bacteria | 2124 |
| 495 | Ga0496121_0170217 | 3300048924 | Bacteria | 1583 |
| 496 | Ga0496122_0018007 | 3300048925 | Bacteria | 6552 |
| 497 | Ga0496124_0001529 | 3300048927 | Bacteria | 33656 |
| 498 | Ga0496124_0051737 | 3300048927 | Bacteria | 3493 |
| 499 | Ga0496124_0119606 | 3300048927 | Bacteria | 2107 |
| 500 | Ga0496125_0000048 | 3300048928 | Bacteria | 290651 |
| 501 | Ga0496125_0000746 | 3300048928 | Bacteria | 53671 |
| 502 | Ga0496125_0007153 | 3300048928 | Bacteria | 11912 |
| 503 | Ga0496125_0032850 | 3300048928 | Bacteria | 4603 |
| 504 | Ga0496125_0175190 | 3300048928 | Bacteria | 1436 |
| 505 | Ga0496126_0011417 | 3300048929 | Bacteria | 9199 |
| 506 | Ga0496126_0027182 | 3300048929 | Bacteria | 5469 |
| 507 | Ga0496126_0027460 | 3300048929 | Bacteria | 5435 |
| 508 | Ga0496126_0029037 | 3300048929 | Bacteria | 5258 |
| 509 | Ga0496126_0065763 | 3300048929 | Bacteria | 3244 |
| 510 | Ga0496126_0070482 | 3300048929 | Bacteria | 3114 |
| 511 | Ga0496126_0101584 | 3300048929 | Bacteria | 2515 |
| 512 | Ga0501031_0006545 | 3300049568 | Bacteria | 7596 |
| 513 | Ga0501032_0000048 | 3300049569 | Bacteria | 106326 |
| 514 | Ga0501033_0000184 | 3300049570 | Bacteria | 59970 |
| 515 | Ga0501034_0000082 | 3300049571 | Bacteria | 170039 |
| 516 | Ga0501034_0010558 | 3300049571 | Bacteria | 9613 |
| 517 | Ga0501036_0000791 | 3300049572 | Bacteria | 23456 |
| 518 | Ga0501037_0000063 | 3300049573 | Bacteria | 97745 |
| 519 | Ga0501037_0136567 | 3300049573 | Bacteria | 1756 |
| 520 | Ga0501038_0000295 | 3300049574 | Bacteria | 42291 |
| 521 | Ga0501039_0000082 | 3300049575 | Bacteria | 72201 |
| 522 | Ga0501043_0000148 | 3300049579 | Bacteria | 65190 |
| 523 | Ga0501046_0000101 | 3300049580 | Bacteria | 91179 |
| 524 | Ga0501047_0000671 | 3300049581 | Bacteria | 35653 |
| 525 | Ga0501047_0150449 | 3300049581 | Bacteria | 2204 |
| 526 | Ga0501048_0006649 | 3300049582 | Bacteria | 8789 |
| 527 | Ga0501048_0046199 | 3300049582 | Bacteria | 3109 |
| 528 | Ga0501067_0000056 | 3300049583 | Bacteria | 64757 |
| 529 | Ga0501067_0066309 | 3300049583 | Bacteria | 1998 |
| 530 | Ga0501067_0068332 | 3300049583 | Bacteria | 1967 |
| 531 | Ga0501068_0000310 | 3300049584 | Bacteria | 24404 |
| 532 | Ga0501069_0001375 | 3300049585 | Bacteria | 11943 |
| 533 | Ga0501069_0049199 | 3300049585 | Bacteria | 2343 |
| 534 | Ga0501070_0043351 | 3300049586 | Bacteria | 3744 |
| 535 | Ga0501072_0006466 | 3300049588 | Bacteria | 8922 |
| 536 | Ga0501073_0000053 | 3300049589 | Bacteria | 73023 |
| 537 | Ga0501074_0000331 | 3300049590 | Bacteria | 27484 |
| 538 | Ga0501074_0205662 | 3300049590 | Bacteria | 1403 |
| 539 | Ga0501079_0000586 | 3300049741 | Bacteria | 24123 |
| 540 | Ga0501080_0000922 | 3300049742 | Bacteria | 24020 |
| 541 | Ga0501080_0049187 | 3300049742 | Bacteria | 3924 |
| 542 | Ga0501083_0005043 | 3300049744 | Bacteria | 9353 |
| 543 | Ga0501035_0000474 | 3300049822 | Bacteria | 45071 |
| 544 | Ga0501035_0019650 | 3300049822 | Bacteria | 6208 |
| 545 | Ga0501044_0000408 | 3300049823 | Bacteria | 52994 |
| 546 | Ga0501044_0267764 | 3300049823 | Bacteria | 1645 |
| 547 | Ga0501045_0001959 | 3300049824 | Bacteria | 13895 |
| 548 | nmdc:mga07m45_37482_c2 | 3300050496 | Bacteria | 1593 |
| 549 | nmdc:mga07m45_9280_c1 | 3300050496 | Bacteria | 5095 |
| 550 | nmdc:mga0sz30_9859_c1 | 3300050516 | Bacteria | 3644 |
| 551 | Ga0495601_0135290 | 3300053077 | Bacteria | 1607 |
| 552 | Ga0500635_0000644 | 3300053080 | Bacteria | 8951 |
| 553 | Ga0495595_0003526 | 3300053084 | Bacteria | 6211 |
| 554 | Ga0495619_0003340 | 3300053085 | Bacteria | 10379 |
| 555 | Ga0495619_0178693 | 3300053085 | Bacteria | 1468 |
| 556 | Ga0500578_0035655 | 3300053086 | Bacteria | 3196 |
| 557 | Ga0500643_000062 | 3300053087 | Bacteria | 122407 |
| 558 | Ga0500643_007900 | 3300053087 | Bacteria | 4236 |
| 559 | Ga0500583_0067309 | 3300053092 | Bacteria | 1706 |
| 560 | Ga0500566_0000754 | 3300053094 | Bacteria | 18223 |
| 561 | Ga0500566_0000896 | 3300053094 | Bacteria | 17020 |
| 562 | Ga0500566_0002969 | 3300053094 | Bacteria | 10127 |
| 563 | Ga0500641_0005076 | 3300053096 | Bacteria | 4664 |
| 564 | Ga0500641_0012945 | 3300053096 | Bacteria | 3057 |
| 565 | Ga0500554_000781 | 3300053102 | Bacteria | 6353 |
| 566 | Ga0500556_0000012 | 3300053104 | Bacteria | 250391 |
| 567 | Ga0500557_000043 | 3300053105 | Bacteria | 63389 |
| 568 | Ga0500569_002435 | 3300053109 | Bacteria | 3664 |
| 569 | Ga0500572_000633 | 3300053111 | Bacteria | 11659 |
| 570 | Ga0500591_015490 | 3300053115 | Bacteria | 3669 |
| 571 | Ga0500594_0004199 | 3300053118 | Bacteria | 3177 |
| 572 | Ga0500595_003786 | 3300053119 | Bacteria | 6958 |
| 573 | Ga0500595_004250 | 3300053119 | Bacteria | 6461 |
| 574 | Ga0500595_008925 | 3300053119 | Bacteria | 4072 |
| 575 | Ga0500595_013017 | 3300053119 | Bacteria | 3194 |
| 576 | Ga0500595_025259 | 3300053119 | Bacteria | 2062 |
| 577 | Ga0500642_0000193 | 3300053130 | Bacteria | 24969 |
| 578 | Ga0500652_000891 | 3300053131 | Bacteria | 9886 |
| 579 | Ga0500559_0001232 | 3300053136 | Bacteria | 15083 |
| 580 | Ga0500559_0018624 | 3300053136 | Bacteria | 2933 |
| 581 | Ga0500568_0008164 | 3300053139 | Bacteria | 5074 |
| 582 | Ga0500568_0011131 | 3300053139 | Bacteria | 4191 |
| 583 | Ga0500568_0064106 | 3300053139 | Bacteria | 1416 |
| 584 | Ga0500573_0156872 | 3300053140 | Bacteria | 1241 |
| 585 | Ga0500577_0000112 | 3300053142 | Bacteria | 19856 |
| 586 | Ga0500590_039868 | 3300053148 | Bacteria | 2421 |
| 587 | Ga0500603_001634 | 3300053150 | Bacteria | 5050 |
| 588 | Ga0500603_017792 | 3300053150 | Bacteria | 1703 |
| 589 | Ga0500616_0000035 | 3300053153 | Bacteria | 394242 |
| 590 | Ga0500627_0075848 | 3300053158 | Bacteria | 1494 |
| 591 | Ga0500634_0008134 | 3300053161 | Bacteria | 5224 |
| 592 | Ga0500639_004728 | 3300053163 | Bacteria | 6929 |
| 593 | Ga0500636_0000075 | 3300053177 | Bacteria | 48415 |
| 594 | Ga0500636_0000934 | 3300053177 | Bacteria | 15698 |
| 595 | Ga0500636_0019627 | 3300053177 | Bacteria | 3999 |
| 596 | Ga0500637_0000155 | 3300053178 | Bacteria | 25033 |
| 597 | Ga0500637_0002240 | 3300053178 | Bacteria | 8531 |
| 598 | Ga0500637_0039657 | 3300053178 | Bacteria | 2657 |
| 599 | Ga0500625_000791 | 3300053729 | Bacteria | 9601 |
| 600 | Ga0500596_004199 | 3300053735 | Bacteria | 2664 |
| 601 | Ga0500596_004749 | 3300053735 | Bacteria | 2463 |
| 602 | Ga0500596_006081 | 3300053735 | Bacteria | 2071 |
| 603 | Ga0501084_0002066 | 3300054114 | Bacteria | 16019 |
| 604 | Ga0500661_000408 | 3300055283 | Bacteria | 7948 |
| 605 | Ga0501082_0007314 | 3300060353 | Bacteria | 9528 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003354 | JGI25160J50197_1002310 | JGI25160J50197_10023102 | 364 |
| 2 | 3300025302 | Ga0207426_1001141 | Ga0207426_10011414 | 364 |
| 3 | iso_pu_bacteria | 2879083081 | 2879087488 | 364 |
| 4 | 3300048929 | Ga0496126_0029037 | Ga0496126_0029037_1713_2957 | 373 |
| 5 | 3300006178 | Ga0075367_10085542 | Ga0075367_100855421 | 374 |
| 6 | 3300053111 | Ga0500572_000633 | Ga0500572_000633_1399_2640 | 375 |
| 7 | 3300053136 | Ga0500559_0001232 | Ga0500559_0001232_12584_13825 | 375 |
| 8 | 3300053735 | Ga0500596_004749 | Ga0500596_004749_522_1763 | 375 |
| 9 | 3300005334 | Ga0068869_100112245 | Ga0068869_1001122452 | 379 |
| 10 | 3300039447 | Ga0436361_0808880 | Ga0436361_0808880_802_2070 | 379 |
| 11 | 3300009545 | Ga0105237_10022753 | Ga0105237_100227536 | 381 |
| 12 | 3300025297 | Ga0209758_1000224 | Ga0209758_100022479 | 381 |
| 13 | 3300037471 | Ga0395905_0005511 | Ga0395905_0005511_9743_10990 | 381 |
| 14 | 3300048912 | Ga0496109_0025525 | Ga0496109_0025525_470_1660 | 381 |
| 15 | 3300021361 | Ga0213872_10036852 | Ga0213872_100368523 | 382 |
| 16 | 3300025898 | Ga0207692_10011320 | Ga0207692_100113204 | 382 |
| 17 | 3300025905 | Ga0207685_10004111 | Ga0207685_100041114 | 382 |
| 18 | 3300025906 | Ga0207699_10001027 | Ga0207699_1000102711 | 382 |
| 19 | 3300025915 | Ga0207693_10000774 | Ga0207693_1000077425 | 382 |
| 20 | 3300025916 | Ga0207663_10003833 | Ga0207663_100038334 | 382 |
| 21 | 3300025929 | Ga0207664_10245442 | Ga0207664_102454421 | 382 |
| 22 | 3300025939 | Ga0207665_10000289 | Ga0207665_1000028911 | 382 |
| 23 | 3300005435 | Ga0070714_100001031 | Ga0070714_10000103116 | 384 |
| 24 | 3300005436 | Ga0070713_100000447 | Ga0070713_10000044710 | 384 |
| 25 | 3300005437 | Ga0070710_10002104 | Ga0070710_100021046 | 384 |
| 26 | 3300005439 | Ga0070711_100005283 | Ga0070711_1000052839 | 384 |
| 27 | iso_pu_bacteria | 8019648815 | 8019652883 | 385 |
| 28 | 3300031730 | Ga0307516_10087107 | Ga0307516_100871072 | 387 |
| 29 | 3300005548 | Ga0070665_100059724 | Ga0070665_1000597242 | 388 |
| 30 | 3300005564 | Ga0070664_100046895 | Ga0070664_1000468954 | 388 |
| 31 | 3300005983 | Ga0081540_1035800 | Ga0081540_10358003 | 388 |
| 32 | 3300006353 | Ga0075370_10018723 | Ga0075370_100187233 | 388 |
| 33 | 3300025945 | Ga0207679_10054377 | Ga0207679_100543773 | 388 |
| 34 | 3300028379 | Ga0268266_10009701 | Ga0268266_100097014 | 388 |
| 35 | 3300039437 | Ga0436365_0409965 | Ga0436365_0409965_1130_2374 | 388 |
| 36 | 3300046537 | Ga0495598_0017575 | Ga0495598_0017575_16_1260 | 388 |
| 37 | 3300047445 | Ga0495677_0014584 | Ga0495677_0014584_951_2195 | 388 |
| 38 | 3300050496 | nmdc:mga07m45_9280_c1 | nmdc:mga07m45_9280_c1_2700_3944 | 388 |
| 39 | 3300053086 | Ga0500578_0035655 | Ga0500578_0035655_1660_2913 | 388 |
| 40 | 3300053177 | Ga0500636_0000075 | Ga0500636_0000075_13842_15095 | 388 |
| 41 | 3300005548 | Ga0070665_100057781 | Ga0070665_1000577812 | 389 |
| 42 | 3300021320 | Ga0214544_1000087 | Ga0214544_1000087103 | 389 |
| 43 | 3300021321 | Ga0214542_1000018 | Ga0214542_1000018174 | 389 |
| 44 | 3300021324 | Ga0214545_1000009 | Ga0214545_10000097 | 389 |
| 45 | 3300025915 | Ga0207693_10079234 | Ga0207693_100792342 | 389 |
| 46 | 3300028379 | Ga0268266_10052181 | Ga0268266_100521813 | 389 |
| 47 | 3300028379 | Ga0268266_10053044 | Ga0268266_100530442 | 389 |
| 48 | 3300025261 | Ga0209233_1001183 | Ga0209233_10011834 | 390 |
| 49 | 3300048911 | Ga0496108_0106127 | Ga0496108_0106127_1014_2267 | 390 |
| 50 | 3300048913 | Ga0496110_0201284 | Ga0496110_0201284_398_1651 | 390 |
| 51 | 3300003794 | Ga0055531_10002401 | Ga0055531_1000240111 | 391 |
| 52 | 3300005262 | Ga0065165_1005891 | Ga0065165_10058916 | 391 |
| 53 | 3300025297 | Ga0209758_1000015 | Ga0209758_1000015181 | 391 |
| 54 | 3300025303 | Ga0209051_1019809 | Ga0209051_10198092 | 391 |
| 55 | 3300025304 | Ga0209257_1000440 | Ga0209257_100044027 | 391 |
| 56 | 3300048907 | Ga0496104_0005304 | Ga0496104_0005304_1572_2747 | 391 |
| 57 | 3300048924 | Ga0496121_0097573 | Ga0496121_0097573_541_1749 | 391 |
| 58 | 3300005336 | Ga0070680_100105807 | Ga0070680_1001058072 | 392 |
| 59 | 3300005366 | Ga0070659_100108110 | Ga0070659_1001081102 | 392 |
| 60 | 3300005530 | Ga0070679_100197670 | Ga0070679_1001976701 | 392 |
| 61 | 3300013100 | Ga0157373_10075513 | Ga0157373_100755131 | 392 |
| 62 | 3300036401 | Ga0373937_0098220 | Ga0373937_0098220_1260_2501 | 392 |
| 63 | 3300046680 | Ga0495646_0017354 | Ga0495646_0017354_2738_3988 | 392 |
| 64 | 3300048919 | Ga0496116_0055772 | Ga0496116_0055772_1221_2453 | 392 |
| 65 | 3300047319 | Ga0495674_0245331 | Ga0495674_0245331_23_1207 | 393 |
| 66 | 3300048909 | Ga0496106_0011156 | Ga0496106_0011156_3310_4539 | 393 |
| 67 | 3300048920 | Ga0496117_0031153 | Ga0496117_0031153_2384_3613 | 393 |
| 68 | 3300048921 | Ga0496118_0049117 | Ga0496118_0049117_1945_3174 | 393 |
| 69 | 3300048924 | Ga0496121_0000716 | Ga0496121_0000716_57684_58913 | 393 |
| 70 | 3300048927 | Ga0496124_0001529 | Ga0496124_0001529_2422_3651 | 393 |
| 71 | 3300048928 | Ga0496125_0032850 | Ga0496125_0032850_1042_2271 | 393 |
| 72 | 3300048929 | Ga0496126_0070482 | Ga0496126_0070482_664_1893 | 393 |
| 73 | 3300005937 | Ga0081455_10007517 | Ga0081455_100075179 | 394 |
| 74 | 3300035118 | Ga0373954_0021858 | Ga0373954_0021858_1671_2858 | 394 |
| 75 | 3300035724 | Ga0373933_0125855 | Ga0373933_0125855_231_1475 | 394 |
| 76 | 3300039438 | Ga0436360_1265645 | Ga0436360_1265645_1129_2376 | 394 |
| 77 | 3300048921 | Ga0496118_0181629 | Ga0496118_0181629_71_1258 | 394 |
| 78 | 3300021388 | Ga0213875_10007759 | Ga0213875_100077595 | 395 |
| 79 | 3300035117 | Ga0373953_0011203 | Ga0373953_0011203_14_1201 | 395 |
| 80 | 3300053094 | Ga0500566_0000754 | Ga0500566_0000754_15937_17190 | 395 |
| 81 | 3300053139 | Ga0500568_0064106 | Ga0500568_0064106_14_1201 | 395 |
| 82 | 3300053140 | Ga0500573_0156872 | Ga0500573_0156872_40_1227 | 395 |
| 83 | 3300037853 | Ga0436364_0194875 | Ga0436364_0194875_4134_5327 | 396 |
| 84 | 3300046454 | Ga0495592_0020793 | Ga0495592_0020793_2641_3891 | 397 |
| 85 | 3300046462 | Ga0495651_0123348 | Ga0495651_0123348_425_1675 | 397 |
| 86 | 3300046516 | Ga0495628_0117489 | Ga0495628_0117489_361_1611 | 397 |
| 87 | 3300046536 | Ga0495587_0028203 | Ga0495587_0028203_2140_3390 | 397 |
| 88 | 3300046559 | Ga0495667_0013125 | Ga0495667_0013125_3213_4463 | 397 |
| 89 | 3300046642 | Ga0495634_0093259 | Ga0495634_0093259_282_1532 | 397 |
| 90 | 3300046678 | Ga0495599_0028089 | Ga0495599_0028089_408_1658 | 397 |
| 91 | 3300046689 | Ga0495613_0051530 | Ga0495613_0051530_125_1375 | 397 |
| 92 | 3300046809 | Ga0495600_0004278 | Ga0495600_0004278_3375_4625 | 397 |
| 93 | 3300047317 | Ga0495604_0005727 | Ga0495604_0005727_6717_7967 | 397 |
| 94 | 3300047322 | Ga0495680_0014317 | Ga0495680_0014317_5372_6622 | 397 |
| 95 | 3300047444 | Ga0495675_0013953 | Ga0495675_0013953_3198_4448 | 397 |
| 96 | 3300044765 | Ga0466970_0108567 | Ga0466970_0108567_180_1427 | 398 |
| 97 | 3300045049 | Ga0466959_0044960 | Ga0466959_0044960_1384_2631 | 398 |
| 98 | iso_pu_bacteria | 8019547302 | 8019550639 | 398 |
| 99 | 3300006353 | Ga0075370_10032739 | Ga0075370_100327392 | 399 |
| 100 | 3300005616 | Ga0068852_100260656 | Ga0068852_1002606562 | 400 |
| 101 | 3300026121 | Ga0207683_10014468 | Ga0207683_100144682 | 400 |
| 102 | 3300031456 | Ga0307513_10206949 | Ga0307513_102069492 | 400 |
| 103 | 3300033180 | Ga0307510_10083442 | Ga0307510_100834422 | 400 |
| 104 | 3300046523 | Ga0495644_0057973 | Ga0495644_0057973_97_1341 | 400 |
| 105 | 3300046525 | Ga0495663_0020109 | Ga0495663_0020109_476_1720 | 400 |
| 106 | 3300046537 | Ga0495598_0011495 | Ga0495598_0011495_837_2081 | 400 |
| 107 | 3300048924 | Ga0496121_0040197 | Ga0496121_0040197_370_1623 | 400 |
| 108 | 3300049571 | Ga0501034_0010558 | Ga0501034_0010558_7956_9164 | 400 |
| 109 | 3300049582 | Ga0501048_0046199 | Ga0501048_0046199_436_1644 | 400 |
| 110 | 3300049822 | Ga0501035_0019650 | Ga0501035_0019650_4947_6155 | 400 |
| 111 | 3300053119 | Ga0500595_004250 | Ga0500595_004250_2420_3664 | 400 |
| 112 | 3300003762 | Ga0055542_1006056 | Ga0055542_10060562 | 401 |
| 113 | 3300005262 | Ga0065165_1023874 | Ga0065165_10238742 | 401 |
| 114 | 3300005983 | Ga0081540_1006739 | Ga0081540_10067393 | 401 |
| 115 | 3300013102 | Ga0157371_10023913 | Ga0157371_100239132 | 401 |
| 116 | 3300013307 | Ga0157372_10081164 | Ga0157372_100811641 | 401 |
| 117 | 3300025254 | Ga0209148_1000694 | Ga0209148_100069415 | 401 |
| 118 | 3300025272 | Ga0209455_1001551 | Ga0209455_10015516 | 401 |
| 119 | 3300025302 | Ga0207426_1004819 | Ga0207426_10048196 | 401 |
| 120 | 3300049568 | Ga0501031_0006545 | Ga0501031_0006545_3024_4235 | 401 |
| 121 | 3300049569 | Ga0501032_0000048 | Ga0501032_0000048_26162_27373 | 401 |
| 122 | 3300049570 | Ga0501033_0000184 | Ga0501033_0000184_23492_24703 | 401 |
| 123 | 3300049571 | Ga0501034_0000082 | Ga0501034_0000082_73938_75149 | 401 |
| 124 | 3300049572 | Ga0501036_0000791 | Ga0501036_0000791_8362_9573 | 401 |
| 125 | 3300049573 | Ga0501037_0000063 | Ga0501037_0000063_78568_79779 | 401 |
| 126 | 3300049574 | Ga0501038_0000295 | Ga0501038_0000295_17149_18360 | 401 |
| 127 | 3300049575 | Ga0501039_0000082 | Ga0501039_0000082_40174_41385 | 401 |
| 128 | 3300049579 | Ga0501043_0000148 | Ga0501043_0000148_34342_35553 | 401 |
| 129 | 3300049580 | Ga0501046_0000101 | Ga0501046_0000101_57745_58956 | 401 |
| 130 | 3300049581 | Ga0501047_0000671 | Ga0501047_0000671_977_2188 | 401 |
| 131 | 3300049582 | Ga0501048_0006649 | Ga0501048_0006649_4114_5325 | 401 |
| 132 | 3300049583 | Ga0501067_0000056 | Ga0501067_0000056_52708_53919 | 401 |
| 133 | 3300049584 | Ga0501068_0000310 | Ga0501068_0000310_5279_6490 | 401 |
| 134 | 3300049585 | Ga0501069_0001375 | Ga0501069_0001375_9793_11004 | 401 |
| 135 | 3300049586 | Ga0501070_0043351 | Ga0501070_0043351_2202_3413 | 401 |
| 136 | 3300049588 | Ga0501072_0006466 | Ga0501072_0006466_822_2033 | 401 |
| 137 | 3300049589 | Ga0501073_0000053 | Ga0501073_0000053_69866_71077 | 401 |
| 138 | 3300049590 | Ga0501074_0000331 | Ga0501074_0000331_2362_3573 | 401 |
| 139 | 3300049741 | Ga0501079_0000586 | Ga0501079_0000586_17957_19168 | 401 |
| 140 | 3300049742 | Ga0501080_0000922 | Ga0501080_0000922_16012_17223 | 401 |
| 141 | 3300049744 | Ga0501083_0005043 | Ga0501083_0005043_6042_7253 | 401 |
| 142 | 3300049822 | Ga0501035_0000474 | Ga0501035_0000474_2186_3397 | 401 |
| 143 | 3300049823 | Ga0501044_0000408 | Ga0501044_0000408_32069_33280 | 401 |
| 144 | 3300049824 | Ga0501045_0001959 | Ga0501045_0001959_1702_2913 | 401 |
| 145 | 3300053087 | Ga0500643_000062 | Ga0500643_000062_110871_112124 | 401 |
| 146 | 3300054114 | Ga0501084_0002066 | Ga0501084_0002066_10000_11211 | 401 |
| 147 | 3300060353 | Ga0501082_0007314 | Ga0501082_0007314_1005_2216 | 401 |
| 148 | 3300005336 | Ga0070680_100148329 | Ga0070680_1001483292 | 402 |
| 149 | 3300005530 | Ga0070679_100230981 | Ga0070679_1002309812 | 402 |
| 150 | 3300005563 | Ga0068855_100055240 | Ga0068855_1000552403 | 402 |
| 151 | 3300010375 | Ga0105239_10117102 | Ga0105239_101171022 | 402 |
| 152 | 3300014968 | Ga0157379_10134198 | Ga0157379_101341983 | 402 |
| 153 | 3300025919 | Ga0207657_10015396 | Ga0207657_100153966 | 402 |
| 154 | 3300025949 | Ga0207667_10052700 | Ga0207667_100527004 | 402 |
| 155 | 3300031507 | Ga0307509_10060767 | Ga0307509_100607674 | 402 |
| 156 | 3300033180 | Ga0307510_10001273 | Ga0307510_1000127323 | 402 |
| 157 | 3300037312 | Ga0395899_0067636 | Ga0395899_0067636_1268_2482 | 402 |
| 158 | 3300037418 | Ga0395900_0038973 | Ga0395900_0038973_237_1451 | 402 |
| 159 | 3300037466 | Ga0395898_0262021 | Ga0395898_0262021_43_1257 | 402 |
| 160 | 3300038443 | Ga0395901_0025443 | Ga0395901_0025443_1772_2986 | 402 |
| 161 | 3300046452 | Ga0495617_018889 | Ga0495617_018889_690_1940 | 402 |
| 162 | 3300046455 | Ga0495603_0016647 | Ga0495603_0016647_2308_3558 | 402 |
| 163 | 3300046460 | Ga0495638_0055340 | Ga0495638_0055340_769_2019 | 402 |
| 164 | 3300046557 | Ga0495622_0019641 | Ga0495622_0019641_1675_2925 | 402 |
| 165 | 3300046616 | Ga0495668_0005573 | Ga0495668_0005573_3450_4700 | 402 |
| 166 | 3300048908 | Ga0496105_0031279 | Ga0496105_0031279_2254_3462 | 402 |
| 167 | 3300048909 | Ga0496106_0051335 | Ga0496106_0051335_483_1691 | 402 |
| 168 | 3300048911 | Ga0496108_0028116 | Ga0496108_0028116_3240_4448 | 402 |
| 169 | 3300048913 | Ga0496110_0031931 | Ga0496110_0031931_535_1743 | 402 |
| 170 | 3300048915 | Ga0496112_0002348 | Ga0496112_0002348_7242_8450 | 402 |
| 171 | 3300048918 | Ga0496115_0252624 | Ga0496115_0252624_58_1266 | 402 |
| 172 | 3300049573 | Ga0501037_0136567 | Ga0501037_0136567_117_1331 | 402 |
| 173 | 3300049585 | Ga0501069_0049199 | Ga0501069_0049199_56_1270 | 402 |
| 174 | 3300049590 | Ga0501074_0205662 | Ga0501074_0205662_59_1273 | 402 |
| 175 | 3300005436 | Ga0070713_100048359 | Ga0070713_1000483593 | 403 |
| 176 | 3300025928 | Ga0207700_10032190 | Ga0207700_100321902 | 403 |
| 177 | 3300031249 | Ga0265339_10047978 | Ga0265339_100479783 | 403 |
| 178 | 3300031250 | Ga0265331_10019815 | Ga0265331_100198152 | 403 |
| 179 | 3300031711 | Ga0265314_10047193 | Ga0265314_100471933 | 403 |
| 180 | 3300031712 | Ga0265342_10023127 | Ga0265342_100231274 | 403 |
| 181 | 3300048928 | Ga0496125_0000746 | Ga0496125_0000746_1736_2974 | 403 |
| 182 | iso_pu_bacteria | 2791355199 | 2793077416 | 403 |
| 183 | 3300033180 | Ga0307510_10007616 | Ga0307510_100076166 | 404 |
| 184 | 3300047320 | Ga0495672_0120975 | Ga0495672_0120975_125_1372 | 404 |
| 185 | 3300049823 | Ga0501044_0267764 | Ga0501044_0267764_238_1497 | 404 |
| 186 | 3300053092 | Ga0500583_0067309 | Ga0500583_0067309_215_1468 | 404 |
| 187 | 3300048924 | Ga0496121_0170217 | Ga0496121_0170217_227_1471 | 405 |
| 188 | 3300005331 | Ga0070670_100152733 | Ga0070670_1001527332 | 406 |
| 189 | 3300005338 | Ga0068868_100047915 | Ga0068868_1000479153 | 406 |
| 190 | 3300005347 | Ga0070668_100091727 | Ga0070668_1000917271 | 406 |
| 191 | 3300005547 | Ga0070693_100036325 | Ga0070693_1000363253 | 406 |
| 192 | 3300005842 | Ga0068858_100103546 | Ga0068858_1001035462 | 406 |
| 193 | 3300006048 | Ga0075363_100030835 | Ga0075363_1000308353 | 406 |
| 194 | 3300009098 | Ga0105245_10040748 | Ga0105245_100407483 | 406 |
| 195 | 3300009174 | Ga0105241_10116078 | Ga0105241_101160783 | 406 |
| 196 | 3300010375 | Ga0105239_10151690 | Ga0105239_101516902 | 406 |
| 197 | 3300011119 | Ga0105246_10017164 | Ga0105246_100171642 | 406 |
| 198 | 3300025911 | Ga0207654_10018569 | Ga0207654_100185694 | 406 |
| 199 | 3300025914 | Ga0207671_10108087 | Ga0207671_101080872 | 406 |
| 200 | 3300025927 | Ga0207687_10149472 | Ga0207687_101494722 | 406 |
| 201 | 3300025931 | Ga0207644_10267073 | Ga0207644_102670731 | 406 |
| 202 | 3300025972 | Ga0207668_10036396 | Ga0207668_100363962 | 406 |
| 203 | 3300026067 | Ga0207678_10071759 | Ga0207678_100717593 | 406 |
| 204 | 3300026078 | Ga0207702_10325395 | Ga0207702_103253951 | 406 |
| 205 | 3300028379 | Ga0268266_10014397 | Ga0268266_100143978 | 406 |
| 206 | 3300037068 | Ga0373925_0228811 | Ga0373925_0228811_149_1375 | 406 |
| 207 | 3300048913 | Ga0496110_0055172 | Ga0496110_0055172_1391_2641 | 406 |
| 208 | 3300048915 | Ga0496112_0047324 | Ga0496112_0047324_2654_3904 | 406 |
| 209 | 3300050496 | nmdc:mga07m45_37482_c2 | nmdc:mga07m45_37482_c2_200_1450 | 406 |
| 210 | iso_pu_bacteria | 2602042107 | 2603857874 | 406 |
| 211 | iso_pu_bacteria | 2844315083 | 2844321816 | 406 |
| 212 | iso_pu_bacteria | 2857524615 | 2857527247 | 406 |
| 213 | iso_pu_bacteria | 2893066018 | 2893067979 | 406 |
| 214 | iso_pu_bacteria | 2903727486 | 2903727634 | 406 |
| 215 | iso_pu_bacteria | 2906602504 | 2906602876 | 406 |
| 216 | iso_pu_bacteria | 2919073203 | 2919078364 | 406 |
| 217 | 3300006195 | Ga0075366_10041070 | Ga0075366_100410702 | 407 |
| 218 | 3300046557 | Ga0495622_0084231 | Ga0495622_0084231_187_1434 | 407 |
| 219 | 3300046674 | Ga0495588_0002575 | Ga0495588_0002575_4396_5643 | 407 |
| 220 | 3300048907 | Ga0496104_0063104 | Ga0496104_0063104_1235_2482 | 407 |
| 221 | 3300048908 | Ga0496105_0062404 | Ga0496105_0062404_1290_2537 | 407 |
| 222 | 3300048909 | Ga0496106_0175271 | Ga0496106_0175271_155_1402 | 407 |
| 223 | 3300048924 | Ga0496121_0022824 | Ga0496121_0022824_2185_3432 | 407 |
| 224 | 3300025297 | Ga0209758_1001187 | Ga0209758_100118724 | 408 |
| 225 | 3300028577 | Ga0265318_10007398 | Ga0265318_100073982 | 408 |
| 226 | 3300028653 | Ga0265323_10001811 | Ga0265323_100018112 | 408 |
| 227 | 3300028800 | Ga0265338_10000024 | Ga0265338_10000024101 | 408 |
| 228 | 3300029957 | Ga0265324_10007310 | Ga0265324_100073102 | 408 |
| 229 | 3300048913 | Ga0496110_0312919 | Ga0496110_0312919_102_1337 | 408 |
| 230 | 3300048915 | Ga0496112_0020579 | Ga0496112_0020579_2145_3380 | 408 |
| 231 | iso_pu_bacteria | 2876761206 | 2876766419 | 408 |
| 232 | 3300005843 | Ga0068860_100000257 | Ga0068860_10000025733 | 409 |
| 233 | 3300028381 | Ga0268264_10000049 | Ga0268264_10000049225 | 409 |
| 234 | 3300031507 | Ga0307509_10011529 | Ga0307509_100115295 | 409 |
| 235 | 3300033179 | Ga0307507_10008595 | Ga0307507_100085959 | 409 |
| 236 | 3300035725 | Ga0373947_0089639 | Ga0373947_0089639_165_1394 | 409 |
| 237 | 3300037068 | Ga0373925_0133108 | Ga0373925_0133108_683_1912 | 409 |
| 238 | 3300053077 | Ga0495601_0135290 | Ga0495601_0135290_290_1519 | 409 |
| 239 | 3300053094 | Ga0500566_0000896 | Ga0500566_0000896_6120_7367 | 409 |
| 240 | 3300053115 | Ga0500591_015490 | Ga0500591_015490_292_1539 | 409 |
| 241 | 3300053136 | Ga0500559_0018624 | Ga0500559_0018624_87_1316 | 409 |
| 242 | 3300053150 | Ga0500603_017792 | Ga0500603_017792_219_1466 | 409 |
| 243 | 3300053735 | Ga0500596_004199 | Ga0500596_004199_210_1439 | 409 |
| 244 | iso_pu_bacteria | 2507262055 | 2507504837 | 409 |
| 245 | iso_pu_bacteria | 2508501009 | 2508546192 | 409 |
| 246 | iso_pu_bacteria | 2508501042 | 2508695124 | 409 |
| 247 | iso_pu_bacteria | 2511231028 | 2511398309 | 409 |
| 248 | iso_pu_bacteria | 2513237092 | 2513625419 | 409 |
| 249 | iso_pu_bacteria | 2513237094 | 2513639548 | 409 |
| 250 | iso_pu_bacteria | 2513237095 | 2513647968 | 409 |
| 251 | iso_pu_bacteria | 2513237098 | 2513672984 | 409 |
| 252 | iso_pu_bacteria | 2513237102 | 2513703346 | 409 |
| 253 | iso_pu_bacteria | 2513237104 | 2513715703 | 409 |
| 254 | iso_pu_bacteria | 2515154112 | 2515625870 | 409 |
| 255 | iso_pu_bacteria | 2517093001 | 2517102393 | 409 |
| 256 | iso_pu_bacteria | 2524023205 | 2524435738 | 409 |
| 257 | iso_pu_bacteria | 2524023210 | 2524466460 | 409 |
| 258 | iso_pu_bacteria | 2744054633 | 2745079034 | 409 |
| 259 | iso_pu_bacteria | 2791355196 | 2793066042 | 409 |
| 260 | iso_pu_bacteria | 2816332527 | 2818237274 | 409 |
| 261 | iso_pu_bacteria | 2824600985 | 2824602569 | 409 |
| 262 | iso_pu_bacteria | 2824609381 | 2824612651 | 409 |
| 263 | iso_pu_bacteria | 2824617872 | 2824621113 | 409 |
| 264 | iso_pu_bacteria | 2824626560 | 2824630120 | 409 |
| 265 | iso_pu_bacteria | 2824635225 | 2824640725 | 409 |
| 266 | iso_pu_bacteria | 2824653114 | 2824654466 | 409 |
| 267 | iso_pu_bacteria | 2824671348 | 2824674860 | 409 |
| 268 | iso_pu_bacteria | 2824687955 | 2824691928 | 409 |
| 269 | iso_pu_bacteria | 2824723954 | 2824727937 | 409 |
| 270 | iso_pu_bacteria | 2824753945 | 2824757120 | 409 |
| 271 | iso_pu_bacteria | 2824773399 | 2824774949 | 409 |
| 272 | iso_pu_bacteria | 2838122688 | 2838129552 | 409 |
| 273 | iso_pu_bacteria | 2841941048 | 2841944453 | 409 |
| 274 | iso_pu_bacteria | 2841949485 | 2841951594 | 409 |
| 275 | iso_pu_bacteria | 2841957949 | 2841964619 | 409 |
| 276 | iso_pu_bacteria | 2841966195 | 2841969230 | 409 |
| 277 | iso_pu_bacteria | 2841974524 | 2841982895 | 409 |
| 278 | iso_pu_bacteria | 2841983080 | 2841991023 | 409 |
| 279 | iso_pu_bacteria | 2842038055 | 2842043889 | 409 |
| 280 | iso_pu_bacteria | 2842045827 | 2842052121 | 409 |
| 281 | iso_pu_bacteria | 2847930680 | 2847931475 | 409 |
| 282 | iso_pu_bacteria | 2847939898 | 2847941747 | 409 |
| 283 | iso_pu_bacteria | 2849076700 | 2849082669 | 409 |
| 284 | iso_pu_bacteria | 2857509624 | 2857511562 | 409 |
| 285 | iso_pu_bacteria | 2874590934 | 2874596831 | 409 |
| 286 | iso_pu_bacteria | 2874612657 | 2874617925 | 409 |
| 287 | iso_pu_bacteria | 2874620515 | 2874624415 | 409 |
| 288 | iso_pu_bacteria | 2874628541 | 2874636702 | 409 |
| 289 | iso_pu_bacteria | 2874645413 | 2874648636 | 409 |
| 290 | iso_pu_bacteria | 2876771140 | 2876777295 | 409 |
| 291 | iso_pu_bacteria | 2876818435 | 2876825377 | 409 |
| 292 | iso_pu_bacteria | 2879074833 | 2879077626 | 409 |
| 293 | iso_pu_bacteria | 2879099564 | 2879107219 | 409 |
| 294 | iso_pu_bacteria | 2879127579 | 2879130769 | 409 |
| 295 | iso_pu_bacteria | 2879142872 | 2879146071 | 409 |
| 296 | iso_pu_bacteria | 2881364244 | 2881371008 | 409 |
| 297 | iso_pu_bacteria | 2881665667 | 2881665689 | 409 |
| 298 | iso_pu_bacteria | 2885366525 | 2885371405 | 409 |
| 299 | iso_pu_bacteria | 2885383462 | 2885391426 | 409 |
| 300 | iso_pu_bacteria | 2885409591 | 2885414606 | 409 |
| 301 | iso_pu_bacteria | 2888378607 | 2888379969 | 409 |
| 302 | iso_pu_bacteria | 2888388044 | 2888391047 | 409 |
| 303 | iso_pu_bacteria | 2888419890 | 2888420778 | 409 |
| 304 | iso_pu_bacteria | 2903768456 | 2903772317 | 409 |
| 305 | iso_pu_bacteria | 2904666416 | 2904672246 | 409 |
| 306 | iso_pu_bacteria | 2904711408 | 2904716177 | 409 |
| 307 | iso_pu_bacteria | 2906626472 | 2906627035 | 409 |
| 308 | iso_pu_bacteria | 2906643746 | 2906647585 | 409 |
| 309 | iso_pu_bacteria | 2908775508 | 2908775759 | 409 |
| 310 | iso_pu_bacteria | 2922368715 | 2922378355 | 409 |
| 311 | iso_pu_bacteria | 2929615660 | 2929622544 | 409 |
| 312 | iso_pu_bacteria | 2929624759 | 2929631238 | 409 |
| 313 | iso_pu_bacteria | 2932784394 | 2932786340 | 409 |
| 314 | iso_pu_bacteria | 2932794094 | 2932794692 | 409 |
| 315 | iso_pu_bacteria | 2932801729 | 2932805497 | 409 |
| 316 | iso_pu_bacteria | 2932809354 | 2932812585 | 409 |
| 317 | iso_pu_bacteria | 2932818245 | 2932822947 | 409 |
| 318 | iso_pu_bacteria | 2932828146 | 2932829578 | 409 |
| 319 | iso_pu_bacteria | 2933577622 | 2933584377 | 409 |
| 320 | iso_pu_bacteria | 2935608549 | 2935614964 | 409 |
| 321 | iso_pu_bacteria | 2935616580 | 2935618096 | 409 |
| 322 | iso_pu_bacteria | 2935638405 | 2935641506 | 409 |
| 323 | iso_pu_bacteria | 2935648319 | 2935652991 | 409 |
| 324 | iso_pu_bacteria | 2935656913 | 2935661574 | 409 |
| 325 | iso_pu_bacteria | 2935665750 | 2935669436 | 409 |
| 326 | iso_pu_bacteria | 2935675223 | 2935677966 | 409 |
| 327 | iso_pu_bacteria | 2935684952 | 2935689583 | 409 |
| 328 | iso_pu_bacteria | 2935694250 | 2935701796 | 409 |
| 329 | iso_pu_bacteria | 2935703347 | 2935707261 | 409 |
| 330 | iso_pu_bacteria | 2935713505 | 2935717102 | 409 |
| 331 | iso_pu_bacteria | 2935722832 | 2935730064 | 409 |
| 332 | iso_pu_bacteria | 2935732158 | 2935738517 | 409 |
| 333 | iso_pu_bacteria | 2935741537 | 2935749235 | 409 |
| 334 | iso_pu_bacteria | 2935750917 | 2935756936 | 409 |
| 335 | iso_pu_bacteria | 2935760218 | 2935764450 | 409 |
| 336 | iso_pu_bacteria | 2935769743 | 2935772781 | 409 |
| 337 | iso_pu_bacteria | 2935777560 | 2935778082 | 409 |
| 338 | iso_pu_bacteria | 2935785616 | 2935787310 | 409 |
| 339 | iso_pu_bacteria | 2935793552 | 2935795902 | 409 |
| 340 | iso_pu_bacteria | 2935801545 | 2935804360 | 409 |
| 341 | iso_pu_bacteria | 2935810662 | 2935817221 | 409 |
| 342 | iso_pu_bacteria | 2935819856 | 2935825997 | 409 |
| 343 | iso_pu_bacteria | 2935827899 | 2935831237 | 409 |
| 344 | iso_pu_bacteria | 2935837841 | 2935841846 | 409 |
| 345 | iso_pu_bacteria | 2935847175 | 2935851616 | 409 |
| 346 | iso_pu_bacteria | 2935855204 | 2935856405 | 409 |
| 347 | iso_pu_bacteria | 2935864058 | 2935871072 | 409 |
| 348 | iso_pu_bacteria | 2935873716 | 2935874569 | 409 |
| 349 | iso_pu_bacteria | 2935883170 | 2935888906 | 409 |
| 350 | iso_pu_bacteria | 2935908558 | 2935910362 | 409 |
| 351 | iso_pu_bacteria | 2935916978 | 2935918352 | 409 |
| 352 | iso_pu_bacteria | 2935926038 | 2935927727 | 409 |
| 353 | iso_pu_bacteria | 2935934488 | 2935936401 | 409 |
| 354 | iso_pu_bacteria | 2935942939 | 2935944046 | 409 |
| 355 | iso_pu_bacteria | 2935951376 | 2935952483 | 409 |
| 356 | iso_pu_bacteria | 2935959822 | 2935964150 | 409 |
| 357 | iso_pu_bacteria | 2935967501 | 2935969323 | 409 |
| 358 | iso_pu_bacteria | 2935975950 | 2935977912 | 409 |
| 359 | iso_pu_bacteria | 2935984226 | 2935984784 | 409 |
| 360 | iso_pu_bacteria | 2935992306 | 2935994030 | 409 |
| 361 | iso_pu_bacteria | 2936002035 | 2936004959 | 409 |
| 362 | iso_pu_bacteria | 2936011229 | 2936015697 | 409 |
| 363 | iso_pu_bacteria | 2936019824 | 2936024331 | 409 |
| 364 | iso_pu_bacteria | 2936028420 | 2936031782 | 409 |
| 365 | iso_pu_bacteria | 2936037263 | 2936044017 | 409 |
| 366 | iso_pu_bacteria | 2936046547 | 2936051604 | 409 |
| 367 | iso_pu_bacteria | 2936055302 | 2936055955 | 409 |
| 368 | iso_pu_bacteria | 2940556831 | 2940562850 | 409 |
| 369 | iso_pu_bacteria | 2941531003 | 2941532348 | 409 |
| 370 | iso_pu_bacteria | 2941538514 | 2941543919 | 409 |
| 371 | iso_pu_bacteria | 3005483717 | 3005486423 | 409 |
| 372 | iso_pu_bacteria | 3005506211 | 3005509551 | 409 |
| 373 | iso_pu_bacteria | 3005587118 | 3005589016 | 409 |
| 374 | iso_pu_bacteria | 3005594810 | 3005602165 | 409 |
| 375 | iso_pu_bacteria | 3005710791 | 3005717922 | 409 |
| 376 | iso_pu_bacteria | 3005718088 | 3005724956 | 409 |
| 377 | iso_pu_bacteria | 8006926726 | 8006929783 | 409 |
| 378 | iso_pu_bacteria | 8016511872 | 8016518632 | 409 |
| 379 | iso_pu_bacteria | 8016522445 | 8016526610 | 409 |
| 380 | iso_pu_bacteria | 8016530956 | 8016531693 | 409 |
| 381 | iso_pu_bacteria | 8016539877 | 8016544890 | 409 |
| 382 | iso_pu_bacteria | 8016566248 | 8016569963 | 409 |
| 383 | iso_pu_bacteria | 8016575299 | 8016582541 | 409 |
| 384 | iso_pu_bacteria | 8016595262 | 8016603156 | 409 |
| 385 | iso_pu_bacteria | 8016613128 | 8016617954 | 409 |
| 386 | iso_pu_bacteria | 8016622563 | 8016623617 | 409 |
| 387 | iso_pu_bacteria | 8016630954 | 8016636092 | 409 |
| 388 | iso_pu_bacteria | 8017057580 | 8017058038 | 409 |
| 389 | iso_pu_bacteria | 8019538911 | 8019540017 | 409 |
| 390 | iso_pu_bacteria | 8019576017 | 8019577696 | 409 |
| 391 | iso_pu_bacteria | 8019586578 | 8019595795 | 409 |
| 392 | iso_pu_bacteria | 8019597564 | 8019605964 | 409 |
| 393 | iso_pu_bacteria | 8019608314 | 8019612568 | 409 |
| 394 | iso_pu_bacteria | 8019619141 | 8019622551 | 409 |
| 395 | iso_pu_bacteria | 8019629233 | 8019630564 | 409 |
| 396 | iso_pu_bacteria | 8019638758 | 8019640050 | 409 |
| 397 | iso_pu_bacteria | 8019668869 | 8019677162 | 409 |
| 398 | iso_pu_bacteria | 8019678201 | 8019678822 | 409 |
| 399 | iso_pu_bacteria | 8019687851 | 8019696709 | 409 |
| 400 | iso_pu_bacteria | 8055742211 | 8055750995 | 409 |
| 401 | iso_pu_bacteria | 8056681323 | 8056688453 | 409 |
| 402 | 3300025295 | Ga0209564_1001755 | Ga0209564_100175510 | 410 |
| 403 | 3300025295 | Ga0209564_1015806 | Ga0209564_10158061 | 410 |
| 404 | 3300031911 | Ga0307412_10150773 | Ga0307412_101507731 | 410 |
| 405 | 3300046460 | Ga0495638_0020842 | Ga0495638_0020842_77_1315 | 410 |
| 406 | 3300046515 | Ga0495620_0013656 | Ga0495620_0013656_2019_3257 | 410 |
| 407 | 3300046665 | Ga0495661_0003673 | Ga0495661_0003673_2807_4045 | 410 |
| 408 | 3300046674 | Ga0495588_0019137 | Ga0495588_0019137_1727_2965 | 410 |
| 409 | 3300046691 | Ga0495670_0038212 | Ga0495670_0038212_62_1300 | 410 |
| 410 | 3300047472 | Ga0495686_0019613 | Ga0495686_0019613_1236_2474 | 410 |
| 411 | 3300047472 | Ga0495686_0046333 | Ga0495686_0046333_949_2187 | 410 |
| 412 | 3300048909 | Ga0496106_0088701 | Ga0496106_0088701_379_1617 | 410 |
| 413 | 3300048919 | Ga0496116_0003138 | Ga0496116_0003138_7848_9086 | 410 |
| 414 | 3300048920 | Ga0496117_0038991 | Ga0496117_0038991_228_1466 | 410 |
| 415 | 3300048923 | Ga0496120_0058151 | Ga0496120_0058151_851_2089 | 410 |
| 416 | 3300048924 | Ga0496121_0027214 | Ga0496121_0027214_4013_5251 | 410 |
| 417 | 3300048927 | Ga0496124_0119606 | Ga0496124_0119606_170_1408 | 410 |
| 418 | 3300048928 | Ga0496125_0000048 | Ga0496125_0000048_112463_113701 | 410 |
| 419 | 3300048928 | Ga0496125_0007153 | Ga0496125_0007153_7510_8748 | 410 |
| 420 | 3300048929 | Ga0496126_0101584 | Ga0496126_0101584_338_1576 | 410 |
| 421 | 3300050516 | nmdc:mga0sz30_9859_c1 | nmdc:mga0sz30_9859_c1_10_1248 | 410 |
| 422 | 3300053096 | Ga0500641_0005076 | Ga0500641_0005076_261_1499 | 410 |
| 423 | 3300053104 | Ga0500556_0000012 | Ga0500556_0000012_216253_217491 | 410 |
| 424 | 3300053109 | Ga0500569_002435 | Ga0500569_002435_2112_3350 | 410 |
| 425 | 3300053131 | Ga0500652_000891 | Ga0500652_000891_6520_7758 | 410 |
| 426 | 3300053139 | Ga0500568_0008164 | Ga0500568_0008164_3221_4459 | 410 |
| 427 | 3300053142 | Ga0500577_0000112 | Ga0500577_0000112_13104_14342 | 410 |
| 428 | 3300053148 | Ga0500590_039868 | Ga0500590_039868_824_2062 | 410 |
| 429 | 3300053153 | Ga0500616_0000035 | Ga0500616_0000035_166214_167452 | 410 |
| 430 | 3300053158 | Ga0500627_0075848 | Ga0500627_0075848_171_1409 | 410 |
| 431 | 3300053161 | Ga0500634_0008134 | Ga0500634_0008134_902_2140 | 410 |
| 432 | 3300053163 | Ga0500639_004728 | Ga0500639_004728_442_1689 | 410 |
| 433 | 3300053177 | Ga0500636_0000934 | Ga0500636_0000934_13688_14926 | 410 |
| 434 | 3300053178 | Ga0500637_0039657 | Ga0500637_0039657_859_2097 | 410 |
| 435 | 3300053735 | Ga0500596_006081 | Ga0500596_006081_664_1911 | 410 |
| 436 | iso_pu_bacteria | 2508501128 | 2509149792 | 410 |
| 437 | iso_pu_bacteria | 2513237101 | 2513694918 | 410 |
| 438 | iso_pu_bacteria | 2513237141 | 2513889777 | 410 |
| 439 | iso_pu_bacteria | 2517572143 | 2517889310 | 410 |
| 440 | iso_pu_bacteria | 2524023228 | 2524540357 | 410 |
| 441 | iso_pu_bacteria | 2721755755 | 2723842033 | 410 |
| 442 | iso_pu_bacteria | 2728368998 | 2728755367 | 410 |
| 443 | iso_pu_bacteria | 2874604998 | 2874610353 | 410 |
| 444 | iso_pu_bacteria | 2885374607 | 2885377739 | 410 |
| 445 | iso_pu_bacteria | 2889033259 | 2889035064 | 410 |
| 446 | iso_pu_bacteria | 2903748898 | 2903749928 | 410 |
| 447 | iso_pu_bacteria | 2904690495 | 2904692498 | 410 |
| 448 | iso_pu_bacteria | 2904699407 | 2904709182 | 410 |
| 449 | iso_pu_bacteria | 2906610324 | 2906613213 | 410 |
| 450 | iso_pu_bacteria | 2906635258 | 2906635496 | 410 |
| 451 | iso_pu_bacteria | 2906660503 | 2906668627 | 410 |
| 452 | iso_pu_bacteria | 2908739725 | 2908747911 | 410 |
| 453 | iso_pu_bacteria | 2908756301 | 2908757234 | 410 |
| 454 | iso_pu_bacteria | 2922361189 | 2922363326 | 410 |
| 455 | iso_pu_bacteria | 2922386360 | 2922388605 | 410 |
| 456 | iso_pu_bacteria | 3005474847 | 3005475550 | 410 |
| 457 | iso_pu_bacteria | 8006933436 | 8006935747 | 410 |
| 458 | iso_pu_bacteria | 8006964411 | 8006968320 | 410 |
| 459 | iso_pu_bacteria | 8006973647 | 8006975666 | 410 |
| 460 | iso_pu_bacteria | 8006984368 | 8006985942 | 410 |
| 461 | iso_pu_bacteria | 8006994254 | 8007000253 | 410 |
| 462 | iso_pu_bacteria | 8019530166 | 8019531517 | 410 |
| 463 | iso_pu_bacteria | 8019555841 | 8019563044 | 410 |
| 464 | iso_pu_bacteria | 8019565922 | 8019573125 | 410 |
| 465 | iso_pu_bacteria | 8056673599 | 8056677733 | 410 |
| 466 | iso_pu_bacteria | 8056689827 | 8056694107 | 410 |
| 467 | 3300010375 | Ga0105239_10448479 | Ga0105239_104484791 | 411 |
| 468 | 3300048907 | Ga0496104_0032218 | Ga0496104_0032218_403_1644 | 411 |
| 469 | 3300048915 | Ga0496112_0032266 | Ga0496112_0032266_3386_4627 | 411 |
| 470 | iso_pu_bacteria | 2879110137 | 2879111671 | 411 |
| 471 | 3300005364 | Ga0070673_100050863 | Ga0070673_1000508631 | 412 |
| 472 | 3300005455 | Ga0070663_100029366 | Ga0070663_1000293663 | 412 |
| 473 | 3300005535 | Ga0070684_100042422 | Ga0070684_1000424224 | 412 |
| 474 | 3300013296 | Ga0157374_10012415 | Ga0157374_100124152 | 412 |
| 475 | 3300013308 | Ga0157375_10036499 | Ga0157375_100364996 | 412 |
| 476 | 3300014325 | Ga0163163_10058864 | Ga0163163_100588644 | 412 |
| 477 | 3300026067 | Ga0207678_10011493 | Ga0207678_100114933 | 412 |
| 478 | 3300048905 | Ga0496102_0038452 | Ga0496102_0038452_1020_2264 | 412 |
| 479 | 3300048908 | Ga0496105_0025939 | Ga0496105_0025939_593_1837 | 412 |
| 480 | 3300048909 | Ga0496106_0132616 | Ga0496106_0132616_342_1586 | 412 |
| 481 | 3300048910 | Ga0496107_0003794 | Ga0496107_0003794_5039_6283 | 412 |
| 482 | 3300048911 | Ga0496108_0103808 | Ga0496108_0103808_670_1914 | 412 |
| 483 | 3300048916 | Ga0496113_0010309 | Ga0496113_0010309_701_1945 | 412 |
| 484 | 3300048917 | Ga0496114_0053466 | Ga0496114_0053466_802_2046 | 412 |
| 485 | 3300048918 | Ga0496115_0031637 | Ga0496115_0031637_340_1584 | 412 |
| 486 | 3300005329 | Ga0070683_100014340 | Ga0070683_1000143403 | 413 |
| 487 | 3300005435 | Ga0070714_100136932 | Ga0070714_1001369322 | 413 |
| 488 | 3300005457 | Ga0070662_100009681 | Ga0070662_1000096812 | 413 |
| 489 | 3300005535 | Ga0070684_100003114 | Ga0070684_10000311410 | 413 |
| 490 | 3300005616 | Ga0068852_100027195 | Ga0068852_1000271955 | 413 |
| 491 | 3300005617 | Ga0068859_100094950 | Ga0068859_1000949501 | 413 |
| 492 | 3300006931 | Ga0097620_100094952 | Ga0097620_1000949521 | 413 |
| 493 | 3300009093 | Ga0105240_10005693 | Ga0105240_100056933 | 413 |
| 494 | 3300009093 | Ga0105240_10069560 | Ga0105240_100695603 | 413 |
| 495 | 3300009545 | Ga0105237_10004882 | Ga0105237_100048822 | 413 |
| 496 | 3300025253 | Ga0209677_100351 | Ga0209677_10035112 | 413 |
| 497 | 3300025261 | Ga0209233_1003057 | Ga0209233_10030575 | 413 |
| 498 | 3300025297 | Ga0209758_1005118 | Ga0209758_10051188 | 413 |
| 499 | 3300025913 | Ga0207695_10000065 | Ga0207695_10000065178 | 413 |
| 500 | 3300025914 | Ga0207671_10001858 | Ga0207671_1000185820 | 413 |
| 501 | 3300025914 | Ga0207671_10097887 | Ga0207671_100978871 | 413 |
| 502 | 3300025929 | Ga0207664_10271154 | Ga0207664_102711541 | 413 |
| 503 | 3300025933 | Ga0207706_10044195 | Ga0207706_100441952 | 413 |
| 504 | 3300025944 | Ga0207661_10000678 | Ga0207661_100006783 | 413 |
| 505 | 3300027296 | Ga0209389_1000076 | Ga0209389_100007632 | 413 |
| 506 | 3300027361 | Ga0209489_100416 | Ga0209489_10041632 | 413 |
| 507 | 3300027363 | Ga0209700_100014 | Ga0209700_10001494 | 413 |
| 508 | 3300031238 | Ga0265332_10023238 | Ga0265332_100232383 | 413 |
| 509 | 3300031616 | Ga0307508_10000005 | Ga0307508_10000005238 | 413 |
| 510 | 3300035113 | Ga0373936_0016157 | Ga0373936_0016157_1196_2440 | 413 |
| 511 | 3300035117 | Ga0373953_0001082 | Ga0373953_0001082_5616_6905 | 413 |
| 512 | 3300035118 | Ga0373954_0002766 | Ga0373954_0002766_5041_6330 | 413 |
| 513 | 3300035119 | Ga0373956_0000296 | Ga0373956_0000296_12568_13857 | 413 |
| 514 | 3300035120 | Ga0373957_0001181 | Ga0373957_0001181_2024_3313 | 413 |
| 515 | 3300035724 | Ga0373933_0004010 | Ga0373933_0004010_1630_2919 | 413 |
| 516 | 3300036401 | Ga0373937_0005314 | Ga0373937_0005314_30_1274 | 413 |
| 517 | 3300037418 | Ga0395900_0006407 | Ga0395900_0006407_454_1701 | 413 |
| 518 | 3300037466 | Ga0395898_0017762 | Ga0395898_0017762_5518_6765 | 413 |
| 519 | 3300037466 | Ga0395898_0067697 | Ga0395898_0067697_232_1485 | 413 |
| 520 | 3300037466 | Ga0395898_0270675 | Ga0395898_0270675_196_1446 | 413 |
| 521 | 3300037853 | Ga0436364_0806245 | Ga0436364_0806245_221_1465 | 413 |
| 522 | 3300038443 | Ga0395901_0019529 | Ga0395901_0019529_5535_6782 | 413 |
| 523 | 3300044658 | Ga0466972_0000103 | Ga0466972_0000103_68440_69687 | 413 |
| 524 | 3300044658 | Ga0466972_0028761 | Ga0466972_0028761_1426_2673 | 413 |
| 525 | 3300044683 | Ga0466965_0019402 | Ga0466965_0019402_1412_2659 | 413 |
| 526 | 3300044684 | Ga0466966_0002297 | Ga0466966_0002297_1825_3072 | 413 |
| 527 | 3300044693 | Ga0466961_0000129 | Ga0466961_0000129_8338_9585 | 413 |
| 528 | 3300044694 | Ga0466963_0028235 | Ga0466963_0028235_1731_2978 | 413 |
| 529 | 3300044706 | Ga0466964_0089359 | Ga0466964_0089359_71_1312 | 413 |
| 530 | 3300044765 | Ga0466970_0130378 | Ga0466970_0130378_124_1365 | 413 |
| 531 | 3300045049 | Ga0466959_0014058 | Ga0466959_0014058_1677_2924 | 413 |
| 532 | 3300045976 | Ga0466967_0101123 | Ga0466967_0101123_636_1889 | 413 |
| 533 | 3300045976 | Ga0466967_0157719 | Ga0466967_0157719_602_1849 | 413 |
| 534 | 3300046459 | Ga0495629_0000380 | Ga0495629_0000380_1187_2476 | 413 |
| 535 | 3300046460 | Ga0495638_0060947 | Ga0495638_0060947_1036_2280 | 413 |
| 536 | 3300046462 | Ga0495651_0061285 | Ga0495651_0061285_1502_2791 | 413 |
| 537 | 3300046463 | Ga0495653_0004990 | Ga0495653_0004990_4558_5847 | 413 |
| 538 | 3300046511 | Ga0495608_0000629 | Ga0495608_0000629_3627_4916 | 413 |
| 539 | 3300046516 | Ga0495628_0036472 | Ga0495628_0036472_1205_2494 | 413 |
| 540 | 3300046529 | Ga0495652_0012668 | Ga0495652_0012668_3690_4979 | 413 |
| 541 | 3300046529 | Ga0495652_0028332 | Ga0495652_0028332_2324_3577 | 413 |
| 542 | 3300046533 | Ga0495640_0006078 | Ga0495640_0006078_4030_5319 | 413 |
| 543 | 3300046536 | Ga0495587_0020500 | Ga0495587_0020500_2050_3339 | 413 |
| 544 | 3300046543 | Ga0495645_0044947 | Ga0495645_0044947_1837_3126 | 413 |
| 545 | 3300046559 | Ga0495667_0014316 | Ga0495667_0014316_722_2011 | 413 |
| 546 | 3300046642 | Ga0495634_0016748 | Ga0495634_0016748_529_1818 | 413 |
| 547 | 3300046642 | Ga0495634_0068872 | Ga0495634_0068872_1062_2315 | 413 |
| 548 | 3300046663 | Ga0495635_0003387 | Ga0495635_0003387_6974_8227 | 413 |
| 549 | 3300046663 | Ga0495635_0003556 | Ga0495635_0003556_4043_5332 | 413 |
| 550 | 3300046678 | Ga0495599_0009607 | Ga0495599_0009607_30_1274 | 413 |
| 551 | 3300046679 | Ga0495623_0030438 | Ga0495623_0030438_30_1274 | 413 |
| 552 | 3300046680 | Ga0495646_0015831 | Ga0495646_0015831_2196_3485 | 413 |
| 553 | 3300046689 | Ga0495613_0011795 | Ga0495613_0011795_4807_6096 | 413 |
| 554 | 3300046809 | Ga0495600_0000567 | Ga0495600_0000567_14678_15967 | 413 |
| 555 | 3300047317 | Ga0495604_0015120 | Ga0495604_0015120_3915_5204 | 413 |
| 556 | 3300047317 | Ga0495604_0049671 | Ga0495604_0049671_1387_2640 | 413 |
| 557 | 3300047321 | Ga0495676_0039786 | Ga0495676_0039786_449_1702 | 413 |
| 558 | 3300047322 | Ga0495680_0089299 | Ga0495680_0089299_742_2031 | 413 |
| 559 | 3300047444 | Ga0495675_0041292 | Ga0495675_0041292_1058_2347 | 413 |
| 560 | 3300047471 | Ga0495684_0000052 | Ga0495684_0000052_75044_76333 | 413 |
| 561 | 3300047472 | Ga0495686_0029614 | Ga0495686_0029614_1393_2646 | 413 |
| 562 | 3300047673 | Ga0495593_0000214 | Ga0495593_0000214_6376_7665 | 413 |
| 563 | 3300048907 | Ga0496104_0005388 | Ga0496104_0005388_6596_7849 | 413 |
| 564 | 3300048908 | Ga0496105_0001275 | Ga0496105_0001275_6216_7469 | 413 |
| 565 | 3300048918 | Ga0496115_0243485 | Ga0496115_0243485_201_1448 | 413 |
| 566 | 3300048922 | Ga0496119_0019380 | Ga0496119_0019380_1309_2562 | 413 |
| 567 | 3300048923 | Ga0496120_0005446 | Ga0496120_0005446_7685_8938 | 413 |
| 568 | 3300048924 | Ga0496121_0063144 | Ga0496121_0063144_1080_2324 | 413 |
| 569 | 3300048924 | Ga0496121_0077681 | Ga0496121_0077681_218_1462 | 413 |
| 570 | 3300048927 | Ga0496124_0051737 | Ga0496124_0051737_987_2288 | 413 |
| 571 | 3300048928 | Ga0496125_0175190 | Ga0496125_0175190_102_1346 | 413 |
| 572 | 3300048929 | Ga0496126_0027460 | Ga0496126_0027460_2581_3834 | 413 |
| 573 | 3300053085 | Ga0495619_0003340 | Ga0495619_0003340_8652_9941 | 413 |
| 574 | 3300053087 | Ga0500643_007900 | Ga0500643_007900_1732_2976 | 413 |
| 575 | 3300053096 | Ga0500641_0012945 | Ga0500641_0012945_827_2071 | 413 |
| 576 | 3300053105 | Ga0500557_000043 | Ga0500557_000043_53983_55236 | 413 |
| 577 | 3300053119 | Ga0500595_003786 | Ga0500595_003786_5060_6313 | 413 |
| 578 | 3300053130 | Ga0500642_0000193 | Ga0500642_0000193_5331_6584 | 413 |
| 579 | 3300053177 | Ga0500636_0019627 | Ga0500636_0019627_1344_2690 | 413 |
| 580 | 3300053729 | Ga0500625_000791 | Ga0500625_000791_1920_3173 | 413 |
| 581 | iso_pu_bacteria | 2513237161 | 2514012892 | 413 |
| 582 | iso_pu_bacteria | 2617270735 | 2617351695 | 413 |
| 583 | iso_pu_bacteria | 2802429603 | 2805916002 | 413 |
| 584 | 3300003203 | JGI25406J46586_10002301 | JGI25406J46586_100023017 | 414 |
| 585 | 3300003203 | JGI25406J46586_10006164 | JGI25406J46586_100061643 | 414 |
| 586 | 3300003203 | JGI25406J46586_10007239 | JGI25406J46586_100072394 | 414 |
| 587 | 3300003215 | JGI25153J46596_10000947 | JGI25153J46596_1000094718 | 414 |
| 588 | 3300005327 | Ga0070658_10033274 | Ga0070658_100332743 | 414 |
| 589 | 3300005329 | Ga0070683_100050291 | Ga0070683_1000502913 | 414 |
| 590 | 3300005336 | Ga0070680_100006331 | Ga0070680_1000063317 | 414 |
| 591 | 3300005337 | Ga0070682_100044950 | Ga0070682_1000449501 | 414 |
| 592 | 3300005339 | Ga0070660_100009964 | Ga0070660_1000099643 | 414 |
| 593 | 3300005341 | Ga0070691_10017608 | Ga0070691_100176082 | 414 |
| 594 | 3300005434 | Ga0070709_10000732 | Ga0070709_100007323 | 414 |
| 595 | 3300005435 | Ga0070714_100018874 | Ga0070714_1000188742 | 414 |
| 596 | 3300005436 | Ga0070713_100014459 | Ga0070713_1000144597 | 414 |
| 597 | 3300005436 | Ga0070713_100039153 | Ga0070713_1000391534 | 414 |
| 598 | 3300005436 | Ga0070713_100054432 | Ga0070713_1000544323 | 414 |
| 599 | 3300005436 | Ga0070713_100319796 | Ga0070713_1003197961 | 414 |
| 600 | 3300005437 | Ga0070710_10000211 | Ga0070710_1000021115 | 414 |
| 601 | 3300005437 | Ga0070710_10011225 | Ga0070710_100112254 | 414 |
| 602 | 3300005439 | Ga0070711_100009790 | Ga0070711_1000097902 | 414 |
| 603 | 3300005439 | Ga0070711_100023869 | Ga0070711_1000238692 | 414 |
| 604 | 3300005455 | Ga0070663_100161009 | Ga0070663_1001610091 | 414 |
| 605 | 3300005458 | Ga0070681_10036946 | Ga0070681_100369465 | 414 |
| 606 | 3300005458 | Ga0070681_10133621 | Ga0070681_101336212 | 414 |
| 607 | 3300005471 | Ga0070698_100143497 | Ga0070698_1001434972 | 414 |
| 608 | 3300005530 | Ga0070679_100022491 | Ga0070679_1000224914 | 414 |
| 609 | 3300005530 | Ga0070679_100096241 | Ga0070679_1000962412 | 414 |
| 610 | 3300005535 | Ga0070684_100008647 | Ga0070684_1000086477 | 414 |
| 611 | 3300005535 | Ga0070684_100071338 | Ga0070684_1000713382 | 414 |
| 612 | 3300005535 | Ga0070684_100091923 | Ga0070684_1000919233 | 414 |
| 613 | 3300005536 | Ga0070697_100134688 | Ga0070697_1001346882 | 414 |
| 614 | 3300005539 | Ga0068853_100008174 | Ga0068853_1000081749 | 414 |
| 615 | 3300005563 | Ga0068855_100033793 | Ga0068855_1000337935 | 414 |
| 616 | 3300005563 | Ga0068855_100040910 | Ga0068855_1000409104 | 414 |
| 617 | 3300005563 | Ga0068855_100286651 | Ga0068855_1002866511 | 414 |
| 618 | 3300005564 | Ga0070664_100041783 | Ga0070664_1000417832 | 414 |
| 619 | 3300005614 | Ga0068856_100002749 | Ga0068856_10000274921 | 414 |
| 620 | 3300005616 | Ga0068852_100146597 | Ga0068852_1001465972 | 414 |
| 621 | 3300005617 | Ga0068859_100093609 | Ga0068859_1000936091 | 414 |
| 622 | 3300005834 | Ga0068851_10005126 | Ga0068851_100051262 | 414 |
| 623 | 3300005840 | Ga0068870_10030391 | Ga0068870_100303912 | 414 |
| 624 | 3300005844 | Ga0068862_100059192 | Ga0068862_1000591923 | 414 |
| 625 | 3300005937 | Ga0081455_10006921 | Ga0081455_1000692113 | 414 |
| 626 | 3300005937 | Ga0081455_10036677 | Ga0081455_100366774 | 414 |
| 627 | 3300005983 | Ga0081540_1002991 | Ga0081540_100299114 | 414 |
| 628 | 3300005983 | Ga0081540_1005442 | Ga0081540_10054426 | 414 |
| 629 | 3300005983 | Ga0081540_1006907 | Ga0081540_10069075 | 414 |
| 630 | 3300005985 | Ga0081539_10000048 | Ga0081539_1000004846 | 414 |
| 631 | 3300005985 | Ga0081539_10000530 | Ga0081539_100005303 | 414 |
| 632 | 3300005985 | Ga0081539_10023403 | Ga0081539_100234034 | 414 |
| 633 | 3300006028 | Ga0070717_10004501 | Ga0070717_1000450110 | 414 |
| 634 | 3300006173 | Ga0070716_100001713 | Ga0070716_1000017131 | 414 |
| 635 | 3300006237 | Ga0097621_100213847 | Ga0097621_1002138471 | 414 |
| 636 | 3300006353 | Ga0075370_10121913 | Ga0075370_101219131 | 414 |
| 637 | 3300006931 | Ga0097620_100093609 | Ga0097620_1000936091 | 414 |
| 638 | 3300006942 | Ga0099824_1001145 | Ga0099824_100114517 | 414 |
| 639 | 3300006943 | Ga0099822_1000135 | Ga0099822_100013518 | 414 |
| 640 | 3300007788 | Ga0099795_10035443 | Ga0099795_100354432 | 414 |
| 641 | 3300009551 | Ga0105238_10008395 | Ga0105238_100083958 | 414 |
| 642 | 3300010159 | Ga0099796_10008899 | Ga0099796_100088992 | 414 |
| 643 | 3300010375 | Ga0105239_10023381 | Ga0105239_100233813 | 414 |
| 644 | 3300013105 | Ga0157369_10024800 | Ga0157369_100248004 | 414 |
| 645 | 3300013105 | Ga0157369_10028904 | Ga0157369_100289048 | 414 |
| 646 | 3300013105 | Ga0157369_10031823 | Ga0157369_100318235 | 414 |
| 647 | 3300013297 | Ga0157378_10038827 | Ga0157378_100388272 | 414 |
| 648 | 3300013307 | Ga0157372_10064246 | Ga0157372_100642463 | 414 |
| 649 | 3300014326 | Ga0157380_10063259 | Ga0157380_100632593 | 414 |
| 650 | 3300025261 | Ga0209233_1002715 | Ga0209233_10027154 | 414 |
| 651 | 3300025297 | Ga0209758_1009011 | Ga0209758_10090115 | 414 |
| 652 | 3300025297 | Ga0209758_1017848 | Ga0209758_10178484 | 414 |
| 653 | 3300025321 | Ga0207656_10004685 | Ga0207656_100046853 | 414 |
| 654 | 3300025898 | Ga0207692_10012479 | Ga0207692_100124792 | 414 |
| 655 | 3300025898 | Ga0207692_10019710 | Ga0207692_100197103 | 414 |
| 656 | 3300025906 | Ga0207699_10000480 | Ga0207699_1000048010 | 414 |
| 657 | 3300025909 | Ga0207705_10025816 | Ga0207705_100258163 | 414 |
| 658 | 3300025912 | Ga0207707_10004596 | Ga0207707_1000459610 | 414 |
| 659 | 3300025912 | Ga0207707_10007086 | Ga0207707_100070868 | 414 |
| 660 | 3300025913 | Ga0207695_10066385 | Ga0207695_100663853 | 414 |
| 661 | 3300025913 | Ga0207695_10243066 | Ga0207695_102430661 | 414 |
| 662 | 3300025914 | Ga0207671_10012315 | Ga0207671_100123154 | 414 |
| 663 | 3300025914 | Ga0207671_10231229 | Ga0207671_102312292 | 414 |
| 664 | 3300025916 | Ga0207663_10000356 | Ga0207663_1000035616 | 414 |
| 665 | 3300025916 | Ga0207663_10053410 | Ga0207663_100534102 | 414 |
| 666 | 3300025917 | Ga0207660_10002711 | Ga0207660_100027117 | 414 |
| 667 | 3300025919 | Ga0207657_10011430 | Ga0207657_100114305 | 414 |
| 668 | 3300025921 | Ga0207652_10004991 | Ga0207652_100049915 | 414 |
| 669 | 3300025921 | Ga0207652_10105103 | Ga0207652_101051031 | 414 |
| 670 | 3300025921 | Ga0207652_10151680 | Ga0207652_101516802 | 414 |
| 671 | 3300025921 | Ga0207652_10182397 | Ga0207652_101823972 | 414 |
| 672 | 3300025924 | Ga0207694_10007898 | Ga0207694_100078988 | 414 |
| 673 | 3300025928 | Ga0207700_10038888 | Ga0207700_100388882 | 414 |
| 674 | 3300025928 | Ga0207700_10183069 | Ga0207700_101830692 | 414 |
| 675 | 3300025929 | Ga0207664_10004313 | Ga0207664_100043139 | 414 |
| 676 | 3300025939 | Ga0207665_10164468 | Ga0207665_101644681 | 414 |
| 677 | 3300025944 | Ga0207661_10029561 | Ga0207661_100295615 | 414 |
| 678 | 3300025944 | Ga0207661_10070023 | Ga0207661_100700232 | 414 |
| 679 | 3300025949 | Ga0207667_10010722 | Ga0207667_100107226 | 414 |
| 680 | 3300025949 | Ga0207667_10030890 | Ga0207667_100308905 | 414 |
| 681 | 3300026041 | Ga0207639_10012139 | Ga0207639_100121395 | 414 |
| 682 | 3300026078 | Ga0207702_10000056 | Ga0207702_100000563 | 414 |
| 683 | 3300026116 | Ga0207674_10031657 | Ga0207674_100316575 | 414 |
| 684 | 3300026121 | Ga0207683_10063341 | Ga0207683_100633412 | 414 |
| 685 | 3300026142 | Ga0207698_10259015 | Ga0207698_102590151 | 414 |
| 686 | 3300027357 | Ga0209589_1000017 | Ga0209589_1000017111 | 414 |
| 687 | 3300027361 | Ga0209489_100018 | Ga0209489_100018111 | 414 |
| 688 | 3300027363 | Ga0209700_100028 | Ga0209700_100028111 | 414 |
| 689 | 3300028380 | Ga0268265_10047858 | Ga0268265_100478582 | 414 |
| 690 | 3300028786 | Ga0307517_10000766 | Ga0307517_1000076623 | 414 |
| 691 | 3300031235 | Ga0265330_10031484 | Ga0265330_100314842 | 414 |
| 692 | 3300031241 | Ga0265325_10003471 | Ga0265325_100034714 | 414 |
| 693 | 3300031247 | Ga0265340_10009442 | Ga0265340_100094426 | 414 |
| 694 | 3300031249 | Ga0265339_10005247 | Ga0265339_100052478 | 414 |
| 695 | 3300031344 | Ga0265316_10095944 | Ga0265316_100959442 | 414 |
| 696 | 3300031595 | Ga0265313_10088268 | Ga0265313_100882681 | 414 |
| 697 | 3300031711 | Ga0265314_10005659 | Ga0265314_100056593 | 414 |
| 698 | 3300031712 | Ga0265342_10054469 | Ga0265342_100544692 | 414 |
| 699 | 3300031730 | Ga0307516_10072365 | Ga0307516_100723651 | 414 |
| 700 | 3300033180 | Ga0307510_10057910 | Ga0307510_100579103 | 414 |
| 701 | 3300033442 | Ga0315911_1000033 | Ga0315911_100003324 | 414 |
| 702 | 3300035083 | Ga0373926_0022912 | Ga0373926_0022912_69_1313 | 414 |
| 703 | 3300035089 | Ga0373944_0032530 | Ga0373944_0032530_111_1358 | 414 |
| 704 | 3300035111 | Ga0373923_0009031 | Ga0373923_0009031_2204_3448 | 414 |
| 705 | 3300035113 | Ga0373936_0042319 | Ga0373936_0042319_268_1512 | 414 |
| 706 | 3300035120 | Ga0373957_0066047 | Ga0373957_0066047_129_1376 | 414 |
| 707 | 3300035170 | Ga0373943_0006477 | Ga0373943_0006477_2294_3538 | 414 |
| 708 | 3300035171 | Ga0373946_0003449 | Ga0373946_0003449_32_1276 | 414 |
| 709 | 3300035410 | Ga0373924_0014868 | Ga0373924_0014868_1516_2760 | 414 |
| 710 | 3300035410 | Ga0373924_0040505 | Ga0373924_0040505_582_1826 | 414 |
| 711 | 3300035692 | Ga0373935_0001604 | Ga0373935_0001604_5486_6730 | 414 |
| 712 | 3300035692 | Ga0373935_0041010 | Ga0373935_0041010_1274_2518 | 414 |
| 713 | 3300035692 | Ga0373935_0083390 | Ga0373935_0083390_799_2043 | 414 |
| 714 | 3300035695 | Ga0373927_0000071 | Ga0373927_0000071_48880_50124 | 414 |
| 715 | 3300035695 | Ga0373927_0054529 | Ga0373927_0054529_582_1826 | 414 |
| 716 | 3300035724 | Ga0373933_0000114 | Ga0373933_0000114_25381_26631 | 414 |
| 717 | 3300035724 | Ga0373933_0029787 | Ga0373933_0029787_1612_2856 | 414 |
| 718 | 3300035725 | Ga0373947_0010412 | Ga0373947_0010412_1101_2345 | 414 |
| 719 | 3300035725 | Ga0373947_0010721 | Ga0373947_0010721_2320_3564 | 414 |
| 720 | 3300036401 | Ga0373937_0075537 | Ga0373937_0075537_981_2225 | 414 |
| 721 | 3300036459 | Ga0372808_005196 | Ga0372808_005196_312_1556 | 414 |
| 722 | 3300037068 | Ga0373925_0009450 | Ga0373925_0009450_1879_3123 | 414 |
| 723 | 3300037068 | Ga0373925_0050474 | Ga0373925_0050474_77_1321 | 414 |
| 724 | 3300037466 | Ga0395898_0124991 | Ga0395898_0124991_900_2165 | 414 |
| 725 | 3300039437 | Ga0436365_0650112 | Ga0436365_0650112_54663_55907 | 414 |
| 726 | 3300039437 | Ga0436365_1054137 | Ga0436365_1054137_3360_4607 | 414 |
| 727 | 3300039450 | Ga0436363_0356954 | Ga0436363_0356954_3894_5141 | 414 |
| 728 | 3300045976 | Ga0466967_0058387 | Ga0466967_0058387_669_1913 | 414 |
| 729 | 3300045976 | Ga0466967_0430260 | Ga0466967_0430260_26_1270 | 414 |
| 730 | 3300046454 | Ga0495592_0015882 | Ga0495592_0015882_710_1954 | 414 |
| 731 | 3300046455 | Ga0495603_0000035 | Ga0495603_0000035_45242_46486 | 414 |
| 732 | 3300046455 | Ga0495603_0003901 | Ga0495603_0003901_3450_4694 | 414 |
| 733 | 3300046459 | Ga0495629_0000081 | Ga0495629_0000081_34608_35852 | 414 |
| 734 | 3300046459 | Ga0495629_0131200 | Ga0495629_0131200_437_1681 | 414 |
| 735 | 3300046461 | Ga0495641_0000707 | Ga0495641_0000707_13481_14725 | 414 |
| 736 | 3300046462 | Ga0495651_0022758 | Ga0495651_0022758_2034_3284 | 414 |
| 737 | 3300046472 | Ga0495580_0008037 | Ga0495580_0008037_1845_3089 | 414 |
| 738 | 3300046473 | Ga0495582_0029958 | Ga0495582_0029958_193_1437 | 414 |
| 739 | 3300046475 | Ga0495639_0000010 | Ga0495639_0000010_41136_42380 | 414 |
| 740 | 3300046475 | Ga0495639_0025094 | Ga0495639_0025094_1240_2484 | 414 |
| 741 | 3300046476 | Ga0495662_0000034 | Ga0495662_0000034_21498_22742 | 414 |
| 742 | 3300046476 | Ga0495662_0011744 | Ga0495662_0011744_504_1748 | 414 |
| 743 | 3300046477 | Ga0495664_0098622 | Ga0495664_0098622_376_1620 | 414 |
| 744 | 3300046507 | Ga0495606_0000265 | Ga0495606_0000265_38860_40104 | 414 |
| 745 | 3300046514 | Ga0495618_0032818 | Ga0495618_0032818_100_1344 | 414 |
| 746 | 3300046516 | Ga0495628_0070096 | Ga0495628_0070096_153_1508 | 414 |
| 747 | 3300046517 | Ga0495630_0010715 | Ga0495630_0010715_431_1675 | 414 |
| 748 | 3300046517 | Ga0495630_0024944 | Ga0495630_0024944_2648_3892 | 414 |
| 749 | 3300046526 | Ga0495666_0020735 | Ga0495666_0020735_1167_2411 | 414 |
| 750 | 3300046526 | Ga0495666_0067074 | Ga0495666_0067074_92_1336 | 414 |
| 751 | 3300046529 | Ga0495652_0020294 | Ga0495652_0020294_111_1355 | 414 |
| 752 | 3300046529 | Ga0495652_0080688 | Ga0495652_0080688_349_1596 | 414 |
| 753 | 3300046531 | Ga0495665_0000005 | Ga0495665_0000005_28263_29507 | 414 |
| 754 | 3300046531 | Ga0495665_0040768 | Ga0495665_0040768_122_1366 | 414 |
| 755 | 3300046533 | Ga0495640_0016321 | Ga0495640_0016321_2282_3526 | 414 |
| 756 | 3300046535 | Ga0495586_0050165 | Ga0495586_0050165_1001_2245 | 414 |
| 757 | 3300046559 | Ga0495667_0083861 | Ga0495667_0083861_17_1264 | 414 |
| 758 | 3300046642 | Ga0495634_0000261 | Ga0495634_0000261_44618_45862 | 414 |
| 759 | 3300046663 | Ga0495635_0000281 | Ga0495635_0000281_13658_14902 | 414 |
| 760 | 3300046674 | Ga0495588_0014606 | Ga0495588_0014606_1628_2872 | 414 |
| 761 | 3300046678 | Ga0495599_0067607 | Ga0495599_0067607_433_1785 | 414 |
| 762 | 3300046680 | Ga0495646_0010990 | Ga0495646_0010990_2111_3355 | 414 |
| 763 | 3300046680 | Ga0495646_0073094 | Ga0495646_0073094_670_1914 | 414 |
| 764 | 3300046681 | Ga0495647_0004374 | Ga0495647_0004374_1357_2601 | 414 |
| 765 | 3300046683 | Ga0495658_0000367 | Ga0495658_0000367_22656_23900 | 414 |
| 766 | 3300046683 | Ga0495658_0056832 | Ga0495658_0056832_612_1862 | 414 |
| 767 | 3300046683 | Ga0495658_0107073 | Ga0495658_0107073_346_1590 | 414 |
| 768 | 3300046689 | Ga0495613_0028734 | Ga0495613_0028734_2457_3701 | 414 |
| 769 | 3300046690 | Ga0495624_0000094 | Ga0495624_0000094_5893_7137 | 414 |
| 770 | 3300046690 | Ga0495624_0078047 | Ga0495624_0078047_317_1561 | 414 |
| 771 | 3300047315 | Ga0495581_0000018 | Ga0495581_0000018_43520_44764 | 414 |
| 772 | 3300047319 | Ga0495674_0000134 | Ga0495674_0000134_29898_31142 | 414 |
| 773 | 3300047471 | Ga0495684_0030899 | Ga0495684_0030899_2568_3818 | 414 |
| 774 | 3300047471 | Ga0495684_0051622 | Ga0495684_0051622_1013_2257 | 414 |
| 775 | 3300047673 | Ga0495593_0000084 | Ga0495593_0000084_34736_35980 | 414 |
| 776 | 3300047673 | Ga0495593_0051122 | Ga0495593_0051122_118_1362 | 414 |
| 777 | 3300048089 | Ga0495614_0035274 | Ga0495614_0035274_18_1262 | 414 |
| 778 | 3300048904 | Ga0496101_0030946 | Ga0496101_0030946_388_1638 | 414 |
| 779 | 3300048909 | Ga0496106_0144963 | Ga0496106_0144963_458_1708 | 414 |
| 780 | 3300048913 | Ga0496110_0191113 | Ga0496110_0191113_321_1568 | 414 |
| 781 | 3300048915 | Ga0496112_0000019 | Ga0496112_0000019_108220_109467 | 414 |
| 782 | 3300048918 | Ga0496115_0143804 | Ga0496115_0143804_35_1390 | 414 |
| 783 | 3300048921 | Ga0496118_0063626 | Ga0496118_0063626_874_2118 | 414 |
| 784 | 3300048923 | Ga0496120_0044907 | Ga0496120_0044907_967_2211 | 414 |
| 785 | 3300048924 | Ga0496121_0001737 | Ga0496121_0001737_3898_5142 | 414 |
| 786 | 3300048924 | Ga0496121_0004612 | Ga0496121_0004612_10170_11414 | 414 |
| 787 | 3300048924 | Ga0496121_0031957 | Ga0496121_0031957_2025_3305 | 414 |
| 788 | 3300048924 | Ga0496121_0108417 | Ga0496121_0108417_465_1709 | 414 |
| 789 | 3300048925 | Ga0496122_0018007 | Ga0496122_0018007_115_1368 | 414 |
| 790 | 3300048929 | Ga0496126_0011417 | Ga0496126_0011417_1142_2395 | 414 |
| 791 | 3300048929 | Ga0496126_0027182 | Ga0496126_0027182_1386_2630 | 414 |
| 792 | 3300048929 | Ga0496126_0065763 | Ga0496126_0065763_711_1955 | 414 |
| 793 | 3300049581 | Ga0501047_0150449 | Ga0501047_0150449_938_2182 | 414 |
| 794 | 3300049583 | Ga0501067_0066309 | Ga0501067_0066309_316_1560 | 414 |
| 795 | 3300049583 | Ga0501067_0068332 | Ga0501067_0068332_215_1465 | 414 |
| 796 | 3300049742 | Ga0501080_0049187 | Ga0501080_0049187_51_1295 | 414 |
| 797 | 3300053080 | Ga0500635_0000644 | Ga0500635_0000644_4677_5921 | 414 |
| 798 | 3300053084 | Ga0495595_0003526 | Ga0495595_0003526_2809_4059 | 414 |
| 799 | 3300053085 | Ga0495619_0178693 | Ga0495619_0178693_192_1442 | 414 |
| 800 | 3300053094 | Ga0500566_0002969 | Ga0500566_0002969_1600_2850 | 414 |
| 801 | 3300053102 | Ga0500554_000781 | Ga0500554_000781_4622_5866 | 414 |
| 802 | 3300053118 | Ga0500594_0004199 | Ga0500594_0004199_216_1460 | 414 |
| 803 | 3300053119 | Ga0500595_008925 | Ga0500595_008925_2250_3494 | 414 |
| 804 | 3300053119 | Ga0500595_013017 | Ga0500595_013017_712_1962 | 414 |
| 805 | 3300053119 | Ga0500595_025259 | Ga0500595_025259_469_1713 | 414 |
| 806 | 3300053139 | Ga0500568_0011131 | Ga0500568_0011131_2037_3323 | 414 |
| 807 | 3300053150 | Ga0500603_001634 | Ga0500603_001634_2219_3463 | 414 |
| 808 | 3300053178 | Ga0500637_0000155 | Ga0500637_0000155_21034_22278 | 414 |
| 809 | 3300053178 | Ga0500637_0002240 | Ga0500637_0002240_330_1580 | 414 |
| 810 | 3300055283 | Ga0500661_000408 | Ga0500661_000408_1409_2659 | 414 |
| 811 | iso_pu_bacteria | 2513237137 | 2513862931 | 414 |
| 812 | iso_pu_bacteria | 2791355197 | 2793070968 | 414 |
| 813 | iso_pu_bacteria | 2922425934 | 2922433711 | 414 |
| 814 | iso_pu_bacteria | 2935630451 | 2935634757 | 414 |
| 815 | iso_pu_bacteria | 2941507105 | 2941511913 | 414 |
| 816 | iso_pu_bacteria | 2941515067 | 2941519615 | 414 |
| 817 | iso_pu_bacteria | 2941523033 | 2941527693 | 414 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6zgr-assembly2.cif.gz_B | crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution | 0.8314 | 21 | 387 |
| 6zgu-assembly2.cif.gz_B | crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution | 0.8303 | 20 | 387 |
| 6n3i-assembly1.cif.gz_A | crystal structure of a double trp xyle mutants (g58w/l315w) | 0.8192 | 16 | 387 |
| 6rw3-assembly3.cif.gz_C | the molecular basis for sugar import in malaria parasites. | 0.8189 | 16 | 389 |
| 6zgu-assembly2.cif.gz_B | crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution | 0.816 | 20 | 387 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4D047_16_187_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9259 | 223 | 387 | 1.20.1250.20 |
| af_Q04301_34_211_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9159 | 216 | 388 | 1.20.1250.20 |
| af_Q2G1R0_3_202_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9119 | 212 | 388 | 1.20.1250.20 |
| af_Q2FW85_14_250_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9079 | 218 | 389 | 1.20.1250.20 |
| af_A0A1D8PTY2_75_285_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9075 | 218 | 389 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2H0ER64-F1-model_v4 | MFS transporter | 0.9652 | 55 | 395 |
GO:0016020
GO:0022857 |
| AF-A0A0A1PSC9-F1-model_v4 | Multidrug efflux system protein MdtL | 0.96 | 19 | 394 |
GO:0016020
GO:0022857 |
| AF-A0A351CXL4-F1-model_v4 | MFS transporter | 0.9589 | 16 | 395 |
GO:0016020
GO:0022857 |
| AF-A0A1E4FX45-F1-model_v4 | Major facilitator superfamily (MFS) profile domain-containing protein | 0.9586 | 14 | 396 |
GO:0016020
GO:0022857 |
| AF-A0A6L7ZVP9-F1-model_v4 | MFS transporter | 0.9507 | 16 | 401 |
GO:0016020
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar