F482117

General Info

Members Datasets Scaffolds Average Seq Length
817 542 605 411

Family's Representative Sequence

Representative Sequence 3300053111|Ga0500572_000633|Ga0500572_000633_1399_2640
Length 376
Sequence MTDVTMNGEISDDARARRNVARLAAAQALTGANSAVIFTIAPDVSLATVPISMYVVGLAAGTLPTGAISRRFGRRVAFIIGTACGVVTGLLGSFAILRGSFVLFCAATFLGGLYGAVAQSYRFAAADGASAAFRPKAVSWVMAGGIFAGLLGPQLVQWTMEIWQPYLFDLHGGRPLLQIVRQPRFIAAALCGTVAYPVMNLVMTSAPLAMKMCGLTVSDSNFGLQWHIVAMYGPSFFTGALIARFGAPAIVALGLCLEAVAAMIGLSGLTAMHFWATLVMLGMGWNFGFVGASALVLETHLASERNKVQAFNDFLIFGMMALGSFSSGQLLANFGWSAVNLVVFPPVALGLCVLALVWSAKRRQARLEPVPELPEL

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
10 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
11 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
12 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
13 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
14 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
15 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
16 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
17 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
18 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
19 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
20 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
21 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
22 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
23 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
24 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
25 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
26 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
27 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
28 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
29 2791355199
30 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
31 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
32 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
33 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
34 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
35 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
36 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
37 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
38 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
39 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
40 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
41 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
42 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
43 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
44 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
45 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
46 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
47 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
48 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
49 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
50 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
51 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
52 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
53 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
54 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
55 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
56 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
57 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
58 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
59 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
60 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
61 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
62 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
63 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
64 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
65 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
66 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
67 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
68 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
69 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
70 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
71 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
72 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
73 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
74 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
75 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
76 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
77 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
78 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
79 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
80 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
81 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
82 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
83 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
84 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
85 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
86 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
87 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
88 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
89 2904699407
90 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
91 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
92 2906610324
93 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
94 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
95 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
96 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
97 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
98 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
99 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
100 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
101 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
102 2922368715
103 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
104 2922425934
105 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
106 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
107 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
108 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
109 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
110 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
111 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
112 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
113 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
114 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
115 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
116 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
117 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
118 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
119 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
120 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
121 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
122 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
123 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
124 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
125 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
126 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
127 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
128 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
129 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
130 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
131 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
132 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
133 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
134 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
135 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
136 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
137 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
138 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
139 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
140 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
141 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
142 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
143 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
144 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
145 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
146 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
147 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
148 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
149 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
150 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
151 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
152 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
153 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
154 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
155 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
156 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
157 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
158 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
159 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
160 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
161 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
162 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
163 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
164 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
165 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
166 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
167 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
168 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
169 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
170 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
171 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
172 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
173 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
174 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
175 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
176 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
177 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
178 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
179 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
180 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
181 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
182 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
183 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
184 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
185 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
186 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
187 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
188 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
189 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
190 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
191 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
192 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
193 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
194 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
195 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
196 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
197 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
198 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
199 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
200 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
201 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
202 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
203 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
204 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
205 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
206 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
207 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
208 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
209 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
210 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
211 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
212 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
213 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
214 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
215 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
216 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
217 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
218 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
219 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
220 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
221 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
222 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
223 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
224 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
225 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
226 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
227 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
228 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
229 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
230 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
231 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
232 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
233 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
234 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
235 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
236 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
237 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
238 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
239 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
240 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
241 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
242 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
243 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
244 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
245 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
246 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
247 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
248 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
249 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
250 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
251 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
252 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
253 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
254 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
255 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
256 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
259 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
261 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
262 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
263 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
297 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
298 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
299 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
300 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
304 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
305 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
306 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
307 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
308 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
309 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
310 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
311 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
312 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
313 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
314 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
315 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
316 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
317 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
318 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
319 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
320 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
321 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
322 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
323 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
324 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
325 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
326 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
327 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
328 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
329 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
330 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
331 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
332 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
333 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
334 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
335 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
336 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
337 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
338 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
339 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
340 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
341 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
342 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
343 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
344 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
345 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
346 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
347 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
348 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
349 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
350 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
351 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
352 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
353 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
354 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
355 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
356 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
357 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
358 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
359 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
360 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
361 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
362 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
363 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
364 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
365 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
366 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
367 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
368 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
369 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
370 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
371 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
372 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
373 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
374 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
375 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
376 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
377 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
378 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
379 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
380 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
381 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
382 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
383 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
384 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
385 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
386 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
387 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
388 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
389 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
390 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
391 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
392 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
393 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
394 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
395 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
396 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
397 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
398 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
399 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
400 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
401 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
402 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
403 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
404 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
405 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
406 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
407 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
408 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
409 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
410 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
411 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
412 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
413 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
414 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
415 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
416 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
417 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
418 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
419 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
420 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
421 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
422 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
423 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
424 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
425 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
426 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
427 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
428 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
429 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
430 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
431 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
432 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
433 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
434 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
435 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
436 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
437 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
438 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
439 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
440 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
441 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
442 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
443 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
446 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
451 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
456 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
457 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
458 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
459 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
460 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
461 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
462 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
463 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
464 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
465 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
468 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
469 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
470 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
471 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
472 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
473 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
474 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
475 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
476 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
477 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
478 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
479 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
480 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
481 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
482 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
483 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
484 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
485 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
486 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
487 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
488 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
489 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
490 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
491 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
492 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
493 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
494 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
495 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
496 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
497 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
498 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
499 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
500 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
501 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
502 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
503 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
504 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
505 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
506 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
507 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
508 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
509 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
510 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
511 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
512 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
513 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
514 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
515 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
516 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
517 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
518 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
519 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
520 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
521 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
522 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
523 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
524 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
525 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
526 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
527 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
528 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
529 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
530 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
531 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
532 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
533 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
534 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
535 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
536 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
537 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
538 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
539 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
540 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
541 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
542 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.38
Metatranscriptomes 0.12
Isolates 25.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.04
Nodule 20.56
Rhizoplane 4.65
Rhizosphere 50.92
Stem 0
Stem Tuber 0
Unclassified 13.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002301 3300003203 Bacteria 9008
2 JGI25406J46586_10006164 3300003203 Bacteria 5536
3 JGI25406J46586_10007239 3300003203 Bacteria 5077
4 JGI25153J46596_10000947 3300003215 Bacteria 17623
5 JGI25160J50197_1002310 3300003354 Bacteria 8937
6 Ga0055542_1006056 3300003762 Bacteria 2634
7 Ga0055531_10002401 3300003794 Bacteria 12583
8 Ga0065165_1005891 3300005262 Bacteria 6660
9 Ga0065165_1023874 3300005262 Bacteria 2065
10 Ga0070658_10033274 3300005327 Bacteria 4147
11 Ga0070683_100014340 3300005329 Bacteria 6931
12 Ga0070683_100050291 3300005329 Bacteria 3858
13 Ga0070670_100152733 3300005331 Bacteria 1998
14 Ga0068869_100112245 3300005334 Bacteria 2075
15 Ga0070680_100006331 3300005336 Bacteria 8989
16 Ga0070680_100105807 3300005336 Bacteria 2339
17 Ga0070680_100148329 3300005336 Bacteria 1969
18 Ga0070682_100044950 3300005337 Bacteria 2736
19 Ga0068868_100047915 3300005338 Bacteria 3351
20 Ga0070660_100009964 3300005339 Bacteria 6700
21 Ga0070691_10017608 3300005341 Bacteria 3287
22 Ga0070668_100091727 3300005347 Bacteria 2395
23 Ga0070673_100050863 3300005364 Bacteria 3242
24 Ga0070659_100108110 3300005366 Bacteria 2243
25 Ga0070709_10000732 3300005434 Bacteria 18548
26 Ga0070714_100001031 3300005435 Bacteria 19841
27 Ga0070714_100018874 3300005435 Bacteria 5611
28 Ga0070714_100136932 3300005435 Bacteria 2194
29 Ga0070713_100000447 3300005436 Bacteria 26301
30 Ga0070713_100014459 3300005436 Bacteria 5864
31 Ga0070713_100039153 3300005436 Bacteria 3845
32 Ga0070713_100048359 3300005436 Bacteria 3502
33 Ga0070713_100054432 3300005436 Bacteria 3320
34 Ga0070713_100319796 3300005436 Bacteria 1433
35 Ga0070710_10000211 3300005437 Bacteria 27400
36 Ga0070710_10002104 3300005437 Bacteria 9438
37 Ga0070710_10011225 3300005437 Bacteria 4421
38 Ga0070711_100005283 3300005439 Bacteria 7708
39 Ga0070711_100009790 3300005439 Bacteria 5911
40 Ga0070711_100023869 3300005439 Bacteria 3983
41 Ga0070663_100029366 3300005455 Bacteria 3756
42 Ga0070663_100161009 3300005455 Bacteria 1727
43 Ga0070662_100009681 3300005457 Bacteria 6305
44 Ga0070681_10036946 3300005458 Bacteria 4902
45 Ga0070681_10133621 3300005458 Bacteria 2412
46 Ga0070698_100143497 3300005471 Bacteria 2338
47 Ga0070679_100022491 3300005530 Bacteria 6161
48 Ga0070679_100096241 3300005530 Bacteria 2948
49 Ga0070679_100197670 3300005530 Bacteria 1977
50 Ga0070679_100230981 3300005530 Bacteria 1809
51 Ga0070684_100003114 3300005535 Bacteria 12386
52 Ga0070684_100008647 3300005535 Bacteria 7977
53 Ga0070684_100042422 3300005535 Bacteria 3927
54 Ga0070684_100071338 3300005535 Bacteria 3057
55 Ga0070684_100091923 3300005535 Bacteria 2700
56 Ga0070697_100134688 3300005536 Bacteria 2074
57 Ga0068853_100008174 3300005539 Bacteria 8398
58 Ga0070693_100036325 3300005547 Bacteria 2738
59 Ga0070665_100057781 3300005548 Bacteria 3889
60 Ga0070665_100059724 3300005548 Bacteria 3822
61 Ga0068855_100033793 3300005563 Bacteria 6101
62 Ga0068855_100040910 3300005563 Bacteria 5497
63 Ga0068855_100055240 3300005563 Bacteria 4665
64 Ga0068855_100286651 3300005563 Bacteria 1827
65 Ga0070664_100041783 3300005564 Bacteria 3870
66 Ga0070664_100046895 3300005564 Bacteria 3651
67 Ga0068856_100002749 3300005614 Bacteria 18013
68 Ga0068852_100027195 3300005616 Bacteria 4659
69 Ga0068852_100146597 3300005616 Bacteria 2190
70 Ga0068852_100260656 3300005616 Bacteria 1664
71 Ga0068859_100093609 3300005617 Bacteria 3056
72 Ga0068859_100094950 3300005617 Bacteria 3035
73 Ga0068851_10005126 3300005834 Bacteria 5942
74 Ga0068870_10030391 3300005840 Bacteria 2730
75 Ga0068858_100103546 3300005842 Bacteria 2655
76 Ga0068860_100000257 3300005843 Bacteria 78468
77 Ga0068862_100059192 3300005844 Bacteria 3289
78 Ga0081455_10006921 3300005937 Bacteria 12061
79 Ga0081455_10007517 3300005937 Bacteria 11462
80 Ga0081455_10036677 3300005937 Bacteria 4361
81 Ga0081540_1002991 3300005983 Bacteria 13549
82 Ga0081540_1005442 3300005983 Bacteria 9502
83 Ga0081540_1006739 3300005983 Bacteria 8306
84 Ga0081540_1006907 3300005983 Bacteria 8187
85 Ga0081540_1035800 3300005983 Bacteria 2657
86 Ga0081539_10000048 3300005985 Bacteria 272906
87 Ga0081539_10000530 3300005985 Bacteria 79454
88 Ga0081539_10023403 3300005985 Bacteria 4048
89 Ga0070717_10004501 3300006028 Bacteria 10072
90 Ga0075363_100030835 3300006048 Bacteria 2777
91 Ga0070716_100001713 3300006173 Bacteria 9880
92 Ga0075367_10085542 3300006178 Bacteria 1913
93 Ga0075366_10041070 3300006195 Bacteria 2737
94 Ga0097621_100213847 3300006237 Bacteria 1678
95 Ga0075370_10018723 3300006353 Bacteria 3759
96 Ga0075370_10032739 3300006353 Bacteria 2907
97 Ga0075370_10121913 3300006353 Bacteria 1518
98 Ga0097620_100093609 3300006931 Bacteria 3056
99 Ga0097620_100094952 3300006931 Bacteria 3035
100 Ga0099824_1001145 3300006942 Bacteria 36195
101 Ga0099822_1000135 3300006943 Bacteria 49135
102 Ga0099795_10035443 3300007788 Bacteria 1745
103 Ga0105240_10005693 3300009093 Bacteria 18493
104 Ga0105240_10069560 3300009093 Bacteria 4357
105 Ga0105245_10040748 3300009098 Bacteria 4139
106 Ga0105241_10116078 3300009174 Bacteria 2149
107 Ga0105237_10004882 3300009545 Bacteria 15362
108 Ga0105237_10022753 3300009545 Bacteria 6431
109 Ga0105238_10008395 3300009551 Bacteria 10334
110 Ga0099796_10008899 3300010159 Bacteria 2694
111 Ga0105239_10023381 3300010375 Bacteria 6806
112 Ga0105239_10117102 3300010375 Bacteria 2957
113 Ga0105239_10151690 3300010375 Bacteria 2586
114 Ga0105239_10448479 3300010375 Bacteria 1463
115 Ga0105246_10017164 3300011119 Bacteria 4598
116 Ga0157373_10075513 3300013100 Bacteria 2378
117 Ga0157371_10023913 3300013102 Bacteria 4464
118 Ga0157369_10024800 3300013105 Bacteria 6663
119 Ga0157369_10028904 3300013105 Bacteria 6132
120 Ga0157369_10031823 3300013105 Bacteria 5805
121 Ga0157374_10012415 3300013296 Bacteria 7411
122 Ga0157378_10038827 3300013297 Bacteria 4221
123 Ga0157372_10064246 3300013307 Bacteria 4118
124 Ga0157372_10081164 3300013307 Bacteria 3670
125 Ga0157375_10036499 3300013308 Bacteria 4703
126 Ga0163163_10058864 3300014325 Bacteria 3798
127 Ga0157380_10063259 3300014326 Bacteria 2966
128 Ga0157379_10134198 3300014968 Bacteria 2229
129 Ga0214544_1000087 3300021320 Bacteria 119600
130 Ga0214542_1000018 3300021321 Bacteria 202226
131 Ga0214545_1000009 3300021324 Bacteria 202915
132 Ga0213872_10036852 3300021361 Bacteria 2234
133 Ga0213875_10007759 3300021388 Bacteria 5518
134 Ga0209677_100351 3300025253 Bacteria 28656
135 Ga0209148_1000694 3300025254 Bacteria 27288
136 Ga0209233_1001183 3300025261 Bacteria 10540
137 Ga0209233_1002715 3300025261 Bacteria 6385
138 Ga0209233_1003057 3300025261 Bacteria 5951
139 Ga0209455_1001551 3300025272 Bacteria 10178
140 Ga0209564_1001755 3300025295 Bacteria 20242
141 Ga0209564_1015806 3300025295 Bacteria 3049
142 Ga0209758_1000015 3300025297 Bacteria 851943
143 Ga0209758_1000224 3300025297 Bacteria 121530
144 Ga0209758_1001187 3300025297 Bacteria 32935
145 Ga0209758_1005118 3300025297 Bacteria 10363
146 Ga0209758_1009011 3300025297 Bacteria 6304
147 Ga0209758_1017848 3300025297 Bacteria 3508
148 Ga0207426_1001141 3300025302 Bacteria 23982
149 Ga0207426_1004819 3300025302 Bacteria 6402
150 Ga0209051_1019809 3300025303 Bacteria 2923
151 Ga0209257_1000440 3300025304 Bacteria 79182
152 Ga0207656_10004685 3300025321 Bacteria 4793
153 Ga0207692_10011320 3300025898 Bacteria 3791
154 Ga0207692_10012479 3300025898 Bacteria 3650
155 Ga0207692_10019710 3300025898 Bacteria 3053
156 Ga0207685_10004111 3300025905 Bacteria 3649
157 Ga0207699_10000480 3300025906 Bacteria 20266
158 Ga0207699_10001027 3300025906 Bacteria 13164
159 Ga0207705_10025816 3300025909 Bacteria 4192
160 Ga0207654_10018569 3300025911 Bacteria 3651
161 Ga0207707_10004596 3300025912 Bacteria 12123
162 Ga0207707_10007086 3300025912 Bacteria 9771
163 Ga0207695_10000065 3300025913 Bacteria 336949
164 Ga0207695_10066385 3300025913 Bacteria 3705
165 Ga0207695_10243066 3300025913 Bacteria 1701
166 Ga0207671_10001858 3300025914 Bacteria 23570
167 Ga0207671_10012315 3300025914 Bacteria 6884
168 Ga0207671_10097887 3300025914 Bacteria 2218
169 Ga0207671_10108087 3300025914 Bacteria 2114
170 Ga0207671_10231229 3300025914 Bacteria 1450
171 Ga0207693_10000774 3300025915 Bacteria 28742
172 Ga0207693_10079234 3300025915 Bacteria 2571
173 Ga0207663_10000356 3300025916 Bacteria 19925
174 Ga0207663_10003833 3300025916 Bacteria 7424
175 Ga0207663_10053410 3300025916 Bacteria 2524
176 Ga0207660_10002711 3300025917 Bacteria 11604
177 Ga0207657_10011430 3300025919 Bacteria 8815
178 Ga0207657_10015396 3300025919 Bacteria 7409
179 Ga0207652_10004991 3300025921 Bacteria 10747
180 Ga0207652_10105103 3300025921 Bacteria 2498
181 Ga0207652_10151680 3300025921 Bacteria 2075
182 Ga0207652_10182397 3300025921 Bacteria 1887
183 Ga0207694_10007898 3300025924 Bacteria 8055
184 Ga0207687_10149472 3300025927 Bacteria 1781
185 Ga0207700_10032190 3300025928 Bacteria 3736
186 Ga0207700_10038888 3300025928 Bacteria 3457
187 Ga0207700_10183069 3300025928 Bacteria 1756
188 Ga0207664_10004313 3300025929 Bacteria 9629
189 Ga0207664_10245442 3300025929 Bacteria 1561
190 Ga0207664_10271154 3300025929 Bacteria 1487
191 Ga0207644_10267073 3300025931 Bacteria 1370
192 Ga0207706_10044195 3300025933 Bacteria 3949
193 Ga0207665_10000289 3300025939 Bacteria 34924
194 Ga0207665_10164468 3300025939 Bacteria 1598
195 Ga0207661_10000678 3300025944 Bacteria 22066
196 Ga0207661_10029561 3300025944 Bacteria 4210
197 Ga0207661_10070023 3300025944 Bacteria 2862
198 Ga0207679_10054377 3300025945 Bacteria 2947
199 Ga0207667_10010722 3300025949 Bacteria 10691
200 Ga0207667_10030890 3300025949 Bacteria 5789
201 Ga0207667_10052700 3300025949 Bacteria 4284
202 Ga0207668_10036396 3300025972 Bacteria 3284
203 Ga0207639_10012139 3300026041 Bacteria 5993
204 Ga0207678_10011493 3300026067 Bacteria 7776
205 Ga0207678_10071759 3300026067 Bacteria 2968
206 Ga0207702_10000056 3300026078 Bacteria 131186
207 Ga0207702_10325395 3300026078 Bacteria 1465
208 Ga0207674_10031657 3300026116 Bacteria 5553
209 Ga0207683_10014468 3300026121 Bacteria 6718
210 Ga0207683_10063341 3300026121 Bacteria 3257
211 Ga0207698_10259015 3300026142 Bacteria 1597
212 Ga0209389_1000076 3300027296 Bacteria 92447
213 Ga0209589_1000017 3300027357 Bacteria 215546
214 Ga0209489_100018 3300027361 Bacteria 215546
215 Ga0209489_100416 3300027361 Bacteria 77981
216 Ga0209700_100014 3300027363 Bacteria 299349
217 Ga0209700_100028 3300027363 Bacteria 215546
218 Ga0268266_10009701 3300028379 Bacteria 8460
219 Ga0268266_10014397 3300028379 Bacteria 6800
220 Ga0268266_10052181 3300028379 Bacteria 3511
221 Ga0268266_10053044 3300028379 Bacteria 3483
222 Ga0268265_10047858 3300028380 Bacteria 3206
223 Ga0268264_10000049 3300028381 Bacteria 329992
224 Ga0265318_10007398 3300028577 Bacteria 4968
225 Ga0265323_10001811 3300028653 Bacteria 10147
226 Ga0307517_10000766 3300028786 Bacteria 55210
227 Ga0265338_10000024 3300028800 Bacteria 297778
228 Ga0265324_10007310 3300029957 Bacteria 4493
229 Ga0265330_10031484 3300031235 Bacteria 2378
230 Ga0265332_10023238 3300031238 Bacteria 2734
231 Ga0265325_10003471 3300031241 Bacteria 10279
232 Ga0265340_10009442 3300031247 Bacteria 5235
233 Ga0265339_10005247 3300031249 Bacteria 8648
234 Ga0265339_10047978 3300031249 Bacteria 2343
235 Ga0265331_10019815 3300031250 Bacteria 3465
236 Ga0265316_10095944 3300031344 Bacteria 2258
237 Ga0307513_10206949 3300031456 Bacteria 1797
238 Ga0307509_10011529 3300031507 Bacteria 10685
239 Ga0307509_10060767 3300031507 Bacteria 3992
240 Ga0265313_10088268 3300031595 Bacteria 1396
241 Ga0307508_10000005 3300031616 Bacteria 286511
242 Ga0265314_10005659 3300031711 Bacteria 11226
243 Ga0265314_10047193 3300031711 Bacteria 3033
244 Ga0265342_10023127 3300031712 Bacteria 3938
245 Ga0265342_10054469 3300031712 Bacteria 2376
246 Ga0307516_10072365 3300031730 Bacteria 3307
247 Ga0307516_10087107 3300031730 Bacteria 2958
248 Ga0307412_10150773 3300031911 Bacteria 1715
249 Ga0307507_10008595 3300033179 Bacteria 14023
250 Ga0307510_10001273 3300033180 Bacteria 27490
251 Ga0307510_10007616 3300033180 Bacteria 12905
252 Ga0307510_10057910 3300033180 Bacteria 4016
253 Ga0307510_10083442 3300033180 Bacteria 3085
254 Ga0315911_1000033 3300033442 Bacteria 67159
255 Ga0373926_0022912 3300035083 Bacteria 2167
256 Ga0373944_0032530 3300035089 Bacteria 1576
257 Ga0373923_0009031 3300035111 Bacteria 3580
258 Ga0373936_0016157 3300035113 Bacteria 2869
259 Ga0373936_0042319 3300035113 Bacteria 1828
260 Ga0373953_0001082 3300035117 Bacteria 7700
261 Ga0373953_0011203 3300035117 Bacteria 3142
262 Ga0373954_0002766 3300035118 Bacteria 7387
263 Ga0373954_0021858 3300035118 Bacteria 2898
264 Ga0373956_0000296 3300035119 Bacteria 20068
265 Ga0373957_0001181 3300035120 Bacteria 6958
266 Ga0373957_0066047 3300035120 Bacteria 1408
267 Ga0373943_0006477 3300035170 Bacteria 5259
268 Ga0373946_0003449 3300035171 Bacteria 5614
269 Ga0373924_0014868 3300035410 Bacteria 2946
270 Ga0373924_0040505 3300035410 Bacteria 1907
271 Ga0373935_0001604 3300035692 Bacteria 12605
272 Ga0373935_0041010 3300035692 Bacteria 2907
273 Ga0373935_0083390 3300035692 Bacteria 2080
274 Ga0373927_0000071 3300035695 Bacteria 73794
275 Ga0373927_0054529 3300035695 Bacteria 2586
276 Ga0373933_0000114 3300035724 Bacteria 52016
277 Ga0373933_0004010 3300035724 Bacteria 8111
278 Ga0373933_0029787 3300035724 Bacteria 3158
279 Ga0373933_0125855 3300035724 Bacteria 1608
280 Ga0373947_0010412 3300035725 Bacteria 5336
281 Ga0373947_0010721 3300035725 Bacteria 5260
282 Ga0373947_0089639 3300035725 Bacteria 1916
283 Ga0373937_0005314 3300036401 Bacteria 11007
284 Ga0373937_0075537 3300036401 Bacteria 3111
285 Ga0373937_0098220 3300036401 Bacteria 2716
286 Ga0372808_005196 3300036459 Bacteria 1706
287 Ga0373925_0009450 3300037068 Bacteria 7096
288 Ga0373925_0050474 3300037068 Bacteria 3102
289 Ga0373925_0133108 3300037068 Bacteria 1940
290 Ga0373925_0228811 3300037068 Bacteria 1486
291 Ga0395899_0067636 3300037312 Bacteria 2621
292 Ga0395900_0006407 3300037418 Bacteria 12267
293 Ga0395900_0038973 3300037418 Bacteria 4898
294 Ga0395898_0017762 3300037466 Bacteria 7258
295 Ga0395898_0067697 3300037466 Bacteria 3457
296 Ga0395898_0124991 3300037466 Bacteria 2464
297 Ga0395898_0262021 3300037466 Bacteria 1649
298 Ga0395898_0270675 3300037466 Bacteria 1620
299 Ga0395905_0005511 3300037471 Bacteria 12915
300 Ga0436364_0194875 3300037853 Bacteria 16602
301 Ga0436364_0806245 3300037853 Bacteria 1514
302 Ga0395901_0019529 3300038443 Bacteria 6927
303 Ga0395901_0025443 3300038443 Bacteria 6075
304 Ga0436365_0409965 3300039437 Bacteria 4733
305 Ga0436365_0650112 3300039437 Bacteria 58550
306 Ga0436365_1054137 3300039437 Bacteria 5465
307 Ga0436360_1265645 3300039438 Bacteria 3160
308 Ga0436361_0808880 3300039447 Bacteria 2290
309 Ga0436363_0356954 3300039450 Bacteria 6790
310 Ga0466972_0000103 3300044658 Bacteria 75095
311 Ga0466972_0028761 3300044658 Bacteria 2739
312 Ga0466965_0019402 3300044683 Bacteria 3264
313 Ga0466966_0002297 3300044684 Bacteria 12462
314 Ga0466961_0000129 3300044693 Bacteria 50353
315 Ga0466963_0028235 3300044694 Bacteria 3600
316 Ga0466964_0089359 3300044706 Bacteria 1338
317 Ga0466970_0108567 3300044765 Bacteria 1515
318 Ga0466970_0130378 3300044765 Bacteria 1381
319 Ga0466959_0014058 3300045049 Bacteria 5812
320 Ga0466959_0044960 3300045049 Bacteria 3253
321 Ga0466967_0058387 3300045976 Bacteria 3410
322 Ga0466967_0101123 3300045976 Bacteria 2634
323 Ga0466967_0157719 3300045976 Bacteria 2128
324 Ga0466967_0430260 3300045976 Bacteria 1287
325 Ga0495617_018889 3300046452 Bacteria 2332
326 Ga0495592_0015882 3300046454 Bacteria 5712
327 Ga0495592_0020793 3300046454 Bacteria 4993
328 Ga0495603_0000035 3300046455 Bacteria 57510
329 Ga0495603_0003901 3300046455 Bacteria 8884
330 Ga0495603_0016647 3300046455 Bacteria 4449
331 Ga0495629_0000081 3300046459 Bacteria 85305
332 Ga0495629_0000380 3300046459 Bacteria 37205
333 Ga0495629_0131200 3300046459 Bacteria 1745
334 Ga0495638_0020842 3300046460 Bacteria 4328
335 Ga0495638_0055340 3300046460 Bacteria 2463
336 Ga0495638_0060947 3300046460 Bacteria 2332
337 Ga0495641_0000707 3300046461 Bacteria 28228
338 Ga0495651_0022758 3300046462 Bacteria 4872
339 Ga0495651_0061285 3300046462 Bacteria 2879
340 Ga0495651_0123348 3300046462 Bacteria 1900
341 Ga0495653_0004990 3300046463 Bacteria 10769
342 Ga0495580_0008037 3300046472 Bacteria 8423
343 Ga0495582_0029958 3300046473 Bacteria 2986
344 Ga0495639_0000010 3300046475 Bacteria 93685
345 Ga0495639_0025094 3300046475 Bacteria 2627
346 Ga0495662_0000034 3300046476 Bacteria 46636
347 Ga0495662_0011744 3300046476 Bacteria 4281
348 Ga0495664_0098622 3300046477 Bacteria 1759
349 Ga0495606_0000265 3300046507 Bacteria 92526
350 Ga0495608_0000629 3300046511 Bacteria 24325
351 Ga0495618_0032818 3300046514 Bacteria 3253
352 Ga0495620_0013656 3300046515 Bacteria 4153
353 Ga0495628_0036472 3300046516 Bacteria 3945
354 Ga0495628_0070096 3300046516 Bacteria 2733
355 Ga0495628_0117489 3300046516 Bacteria 2042
356 Ga0495630_0010715 3300046517 Bacteria 6621
357 Ga0495630_0024944 3300046517 Bacteria 4420
358 Ga0495644_0057973 3300046523 Bacteria 1456
359 Ga0495663_0020109 3300046525 Bacteria 1915
360 Ga0495666_0020735 3300046526 Bacteria 3254
361 Ga0495666_0067074 3300046526 Bacteria 1710
362 Ga0495652_0012668 3300046529 Bacteria 7595
363 Ga0495652_0020294 3300046529 Bacteria 5907
364 Ga0495652_0028332 3300046529 Bacteria 4928
365 Ga0495652_0080688 3300046529 Bacteria 2686
366 Ga0495665_0000005 3300046531 Bacteria 86491
367 Ga0495665_0040768 3300046531 Bacteria 2472
368 Ga0495640_0006078 3300046533 Bacteria 9576
369 Ga0495640_0016321 3300046533 Bacteria 5558
370 Ga0495586_0050165 3300046535 Bacteria 2258
371 Ga0495587_0020500 3300046536 Bacteria 4080
372 Ga0495587_0028203 3300046536 Bacteria 3415
373 Ga0495598_0011495 3300046537 Bacteria 2149
374 Ga0495598_0017575 3300046537 Bacteria 1846
375 Ga0495645_0044947 3300046543 Bacteria 3221
376 Ga0495622_0019641 3300046557 Bacteria 3146
377 Ga0495622_0084231 3300046557 Bacteria 1462
378 Ga0495667_0013125 3300046559 Bacteria 5610
379 Ga0495667_0014316 3300046559 Bacteria 5357
380 Ga0495667_0083861 3300046559 Bacteria 2069
381 Ga0495668_0005573 3300046616 Bacteria 8466
382 Ga0495634_0000261 3300046642 Bacteria 49735
383 Ga0495634_0016748 3300046642 Bacteria 5237
384 Ga0495634_0068872 3300046642 Bacteria 2336
385 Ga0495634_0093259 3300046642 Bacteria 1953
386 Ga0495635_0000281 3300046663 Bacteria 32699
387 Ga0495635_0003387 3300046663 Bacteria 11015
388 Ga0495635_0003556 3300046663 Bacteria 10781
389 Ga0495661_0003673 3300046665 Bacteria 11270
390 Ga0495588_0002575 3300046674 Bacteria 7757
391 Ga0495588_0014606 3300046674 Bacteria 3761
392 Ga0495588_0019137 3300046674 Bacteria 3351
393 Ga0495599_0009607 3300046678 Bacteria 5918
394 Ga0495599_0028089 3300046678 Bacteria 3525
395 Ga0495599_0067607 3300046678 Bacteria 2232
396 Ga0495623_0030438 3300046679 Bacteria 3471
397 Ga0495646_0010990 3300046680 Bacteria 5752
398 Ga0495646_0015831 3300046680 Bacteria 4788
399 Ga0495646_0017354 3300046680 Bacteria 4566
400 Ga0495646_0073094 3300046680 Bacteria 2015
401 Ga0495647_0004374 3300046681 Bacteria 4588
402 Ga0495658_0000367 3300046683 Bacteria 25339
403 Ga0495658_0056832 3300046683 Bacteria 2233
404 Ga0495658_0107073 3300046683 Bacteria 1676
405 Ga0495613_0011795 3300046689 Bacteria 6491
406 Ga0495613_0028734 3300046689 Bacteria 4136
407 Ga0495613_0051530 3300046689 Bacteria 3033
408 Ga0495624_0000094 3300046690 Bacteria 59911
409 Ga0495624_0078047 3300046690 Bacteria 2054
410 Ga0495670_0038212 3300046691 Bacteria 2393
411 Ga0495600_0000567 3300046809 Bacteria 19167
412 Ga0495600_0004278 3300046809 Bacteria 8533
413 Ga0495581_0000018 3300047315 Bacteria 58791
414 Ga0495604_0005727 3300047317 Bacteria 9854
415 Ga0495604_0015120 3300047317 Bacteria 6157
416 Ga0495604_0049671 3300047317 Bacteria 3257
417 Ga0495674_0000134 3300047319 Bacteria 56618
418 Ga0495674_0245331 3300047319 Bacteria 1475
419 Ga0495672_0120975 3300047320 Bacteria 1392
420 Ga0495676_0039786 3300047321 Bacteria 3890
421 Ga0495680_0014317 3300047322 Bacteria 6876
422 Ga0495680_0089299 3300047322 Bacteria 2313
423 Ga0495675_0013953 3300047444 Bacteria 5081
424 Ga0495675_0041292 3300047444 Bacteria 2940
425 Ga0495677_0014584 3300047445 Bacteria 2859
426 Ga0495684_0000052 3300047471 Bacteria 85125
427 Ga0495684_0030899 3300047471 Bacteria 4112
428 Ga0495684_0051622 3300047471 Bacteria 3138
429 Ga0495686_0019613 3300047472 Bacteria 4518
430 Ga0495686_0029614 3300047472 Bacteria 3561
431 Ga0495686_0046333 3300047472 Bacteria 2749
432 Ga0495593_0000084 3300047673 Bacteria 41155
433 Ga0495593_0000214 3300047673 Bacteria 30567
434 Ga0495593_0051122 3300047673 Bacteria 2187
435 Ga0495614_0035274 3300048089 Bacteria 2149
436 Ga0496101_0030946 3300048904 Bacteria 3758
437 Ga0496102_0038452 3300048905 Bacteria 4318
438 Ga0496104_0005304 3300048907 Bacteria 11278
439 Ga0496104_0005388 3300048907 Bacteria 11198
440 Ga0496104_0032218 3300048907 Bacteria 4877
441 Ga0496104_0063104 3300048907 Bacteria 3513
442 Ga0496105_0001275 3300048908 Bacteria 17613
443 Ga0496105_0025939 3300048908 Bacteria 4775
444 Ga0496105_0031279 3300048908 Bacteria 4364
445 Ga0496105_0062404 3300048908 Bacteria 3075
446 Ga0496106_0011156 3300048909 Bacteria 6648
447 Ga0496106_0051335 3300048909 Bacteria 3109
448 Ga0496106_0088701 3300048909 Bacteria 2384
449 Ga0496106_0132616 3300048909 Bacteria 1954
450 Ga0496106_0144963 3300048909 Bacteria 1870
451 Ga0496106_0175271 3300048909 Bacteria 1701
452 Ga0496107_0003794 3300048910 Bacteria 10148
453 Ga0496108_0028116 3300048911 Bacteria 4652
454 Ga0496108_0103808 3300048911 Bacteria 2425
455 Ga0496108_0106127 3300048911 Bacteria 2399
456 Ga0496109_0025525 3300048912 Bacteria 5267
457 Ga0496110_0031931 3300048913 Bacteria 4545
458 Ga0496110_0055172 3300048913 Bacteria 3496
459 Ga0496110_0191113 3300048913 Bacteria 1859
460 Ga0496110_0201284 3300048913 Bacteria 1809
461 Ga0496110_0312919 3300048913 Bacteria 1430
462 Ga0496112_0000019 3300048915 Bacteria 185531
463 Ga0496112_0002348 3300048915 Bacteria 15192
464 Ga0496112_0020579 3300048915 Bacteria 6256
465 Ga0496112_0032266 3300048915 Bacteria 5084
466 Ga0496112_0047324 3300048915 Bacteria 4219
467 Ga0496113_0010309 3300048916 Bacteria 6174
468 Ga0496114_0053466 3300048917 Bacteria 3366
469 Ga0496115_0031637 3300048918 Bacteria 4169
470 Ga0496115_0143804 3300048918 Bacteria 1968
471 Ga0496115_0243485 3300048918 Bacteria 1482
472 Ga0496115_0252624 3300048918 Bacteria 1451
473 Ga0496116_0003138 3300048919 Bacteria 16576
474 Ga0496116_0055772 3300048919 Bacteria 2594
475 Ga0496117_0031153 3300048920 Bacteria 4077
476 Ga0496117_0038991 3300048920 Bacteria 3512
477 Ga0496118_0049117 3300048921 Bacteria 3251
478 Ga0496118_0063626 3300048921 Bacteria 2713
479 Ga0496118_0181629 3300048921 Bacteria 1270
480 Ga0496119_0019380 3300048922 Bacteria 5014
481 Ga0496120_0005446 3300048923 Bacteria 10152
482 Ga0496120_0044907 3300048923 Bacteria 2564
483 Ga0496120_0058151 3300048923 Bacteria 2173
484 Ga0496121_0000716 3300048924 Bacteria 61451
485 Ga0496121_0001737 3300048924 Bacteria 35592
486 Ga0496121_0004612 3300048924 Bacteria 18357
487 Ga0496121_0022824 3300048924 Bacteria 6049
488 Ga0496121_0027214 3300048924 Bacteria 5357
489 Ga0496121_0031957 3300048924 Bacteria 4797
490 Ga0496121_0040197 3300048924 Bacteria 4106
491 Ga0496121_0063144 3300048924 Bacteria 3029
492 Ga0496121_0077681 3300048924 Bacteria 2642
493 Ga0496121_0097573 3300048924 Bacteria 2277
494 Ga0496121_0108417 3300048924 Bacteria 2124
495 Ga0496121_0170217 3300048924 Bacteria 1583
496 Ga0496122_0018007 3300048925 Bacteria 6552
497 Ga0496124_0001529 3300048927 Bacteria 33656
498 Ga0496124_0051737 3300048927 Bacteria 3493
499 Ga0496124_0119606 3300048927 Bacteria 2107
500 Ga0496125_0000048 3300048928 Bacteria 290651
501 Ga0496125_0000746 3300048928 Bacteria 53671
502 Ga0496125_0007153 3300048928 Bacteria 11912
503 Ga0496125_0032850 3300048928 Bacteria 4603
504 Ga0496125_0175190 3300048928 Bacteria 1436
505 Ga0496126_0011417 3300048929 Bacteria 9199
506 Ga0496126_0027182 3300048929 Bacteria 5469
507 Ga0496126_0027460 3300048929 Bacteria 5435
508 Ga0496126_0029037 3300048929 Bacteria 5258
509 Ga0496126_0065763 3300048929 Bacteria 3244
510 Ga0496126_0070482 3300048929 Bacteria 3114
511 Ga0496126_0101584 3300048929 Bacteria 2515
512 Ga0501031_0006545 3300049568 Bacteria 7596
513 Ga0501032_0000048 3300049569 Bacteria 106326
514 Ga0501033_0000184 3300049570 Bacteria 59970
515 Ga0501034_0000082 3300049571 Bacteria 170039
516 Ga0501034_0010558 3300049571 Bacteria 9613
517 Ga0501036_0000791 3300049572 Bacteria 23456
518 Ga0501037_0000063 3300049573 Bacteria 97745
519 Ga0501037_0136567 3300049573 Bacteria 1756
520 Ga0501038_0000295 3300049574 Bacteria 42291
521 Ga0501039_0000082 3300049575 Bacteria 72201
522 Ga0501043_0000148 3300049579 Bacteria 65190
523 Ga0501046_0000101 3300049580 Bacteria 91179
524 Ga0501047_0000671 3300049581 Bacteria 35653
525 Ga0501047_0150449 3300049581 Bacteria 2204
526 Ga0501048_0006649 3300049582 Bacteria 8789
527 Ga0501048_0046199 3300049582 Bacteria 3109
528 Ga0501067_0000056 3300049583 Bacteria 64757
529 Ga0501067_0066309 3300049583 Bacteria 1998
530 Ga0501067_0068332 3300049583 Bacteria 1967
531 Ga0501068_0000310 3300049584 Bacteria 24404
532 Ga0501069_0001375 3300049585 Bacteria 11943
533 Ga0501069_0049199 3300049585 Bacteria 2343
534 Ga0501070_0043351 3300049586 Bacteria 3744
535 Ga0501072_0006466 3300049588 Bacteria 8922
536 Ga0501073_0000053 3300049589 Bacteria 73023
537 Ga0501074_0000331 3300049590 Bacteria 27484
538 Ga0501074_0205662 3300049590 Bacteria 1403
539 Ga0501079_0000586 3300049741 Bacteria 24123
540 Ga0501080_0000922 3300049742 Bacteria 24020
541 Ga0501080_0049187 3300049742 Bacteria 3924
542 Ga0501083_0005043 3300049744 Bacteria 9353
543 Ga0501035_0000474 3300049822 Bacteria 45071
544 Ga0501035_0019650 3300049822 Bacteria 6208
545 Ga0501044_0000408 3300049823 Bacteria 52994
546 Ga0501044_0267764 3300049823 Bacteria 1645
547 Ga0501045_0001959 3300049824 Bacteria 13895
548 nmdc:mga07m45_37482_c2 3300050496 Bacteria 1593
549 nmdc:mga07m45_9280_c1 3300050496 Bacteria 5095
550 nmdc:mga0sz30_9859_c1 3300050516 Bacteria 3644
551 Ga0495601_0135290 3300053077 Bacteria 1607
552 Ga0500635_0000644 3300053080 Bacteria 8951
553 Ga0495595_0003526 3300053084 Bacteria 6211
554 Ga0495619_0003340 3300053085 Bacteria 10379
555 Ga0495619_0178693 3300053085 Bacteria 1468
556 Ga0500578_0035655 3300053086 Bacteria 3196
557 Ga0500643_000062 3300053087 Bacteria 122407
558 Ga0500643_007900 3300053087 Bacteria 4236
559 Ga0500583_0067309 3300053092 Bacteria 1706
560 Ga0500566_0000754 3300053094 Bacteria 18223
561 Ga0500566_0000896 3300053094 Bacteria 17020
562 Ga0500566_0002969 3300053094 Bacteria 10127
563 Ga0500641_0005076 3300053096 Bacteria 4664
564 Ga0500641_0012945 3300053096 Bacteria 3057
565 Ga0500554_000781 3300053102 Bacteria 6353
566 Ga0500556_0000012 3300053104 Bacteria 250391
567 Ga0500557_000043 3300053105 Bacteria 63389
568 Ga0500569_002435 3300053109 Bacteria 3664
569 Ga0500572_000633 3300053111 Bacteria 11659
570 Ga0500591_015490 3300053115 Bacteria 3669
571 Ga0500594_0004199 3300053118 Bacteria 3177
572 Ga0500595_003786 3300053119 Bacteria 6958
573 Ga0500595_004250 3300053119 Bacteria 6461
574 Ga0500595_008925 3300053119 Bacteria 4072
575 Ga0500595_013017 3300053119 Bacteria 3194
576 Ga0500595_025259 3300053119 Bacteria 2062
577 Ga0500642_0000193 3300053130 Bacteria 24969
578 Ga0500652_000891 3300053131 Bacteria 9886
579 Ga0500559_0001232 3300053136 Bacteria 15083
580 Ga0500559_0018624 3300053136 Bacteria 2933
581 Ga0500568_0008164 3300053139 Bacteria 5074
582 Ga0500568_0011131 3300053139 Bacteria 4191
583 Ga0500568_0064106 3300053139 Bacteria 1416
584 Ga0500573_0156872 3300053140 Bacteria 1241
585 Ga0500577_0000112 3300053142 Bacteria 19856
586 Ga0500590_039868 3300053148 Bacteria 2421
587 Ga0500603_001634 3300053150 Bacteria 5050
588 Ga0500603_017792 3300053150 Bacteria 1703
589 Ga0500616_0000035 3300053153 Bacteria 394242
590 Ga0500627_0075848 3300053158 Bacteria 1494
591 Ga0500634_0008134 3300053161 Bacteria 5224
592 Ga0500639_004728 3300053163 Bacteria 6929
593 Ga0500636_0000075 3300053177 Bacteria 48415
594 Ga0500636_0000934 3300053177 Bacteria 15698
595 Ga0500636_0019627 3300053177 Bacteria 3999
596 Ga0500637_0000155 3300053178 Bacteria 25033
597 Ga0500637_0002240 3300053178 Bacteria 8531
598 Ga0500637_0039657 3300053178 Bacteria 2657
599 Ga0500625_000791 3300053729 Bacteria 9601
600 Ga0500596_004199 3300053735 Bacteria 2664
601 Ga0500596_004749 3300053735 Bacteria 2463
602 Ga0500596_006081 3300053735 Bacteria 2071
603 Ga0501084_0002066 3300054114 Bacteria 16019
604 Ga0500661_000408 3300055283 Bacteria 7948
605 Ga0501082_0007314 3300060353 Bacteria 9528

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003354 JGI25160J50197_1002310 JGI25160J50197_10023102 364
2 3300025302 Ga0207426_1001141 Ga0207426_10011414 364
3 iso_pu_bacteria 2879083081 2879087488 364
4 3300048929 Ga0496126_0029037 Ga0496126_0029037_1713_2957 373
5 3300006178 Ga0075367_10085542 Ga0075367_100855421 374
6 3300053111 Ga0500572_000633 Ga0500572_000633_1399_2640 375
7 3300053136 Ga0500559_0001232 Ga0500559_0001232_12584_13825 375
8 3300053735 Ga0500596_004749 Ga0500596_004749_522_1763 375
9 3300005334 Ga0068869_100112245 Ga0068869_1001122452 379
10 3300039447 Ga0436361_0808880 Ga0436361_0808880_802_2070 379
11 3300009545 Ga0105237_10022753 Ga0105237_100227536 381
12 3300025297 Ga0209758_1000224 Ga0209758_100022479 381
13 3300037471 Ga0395905_0005511 Ga0395905_0005511_9743_10990 381
14 3300048912 Ga0496109_0025525 Ga0496109_0025525_470_1660 381
15 3300021361 Ga0213872_10036852 Ga0213872_100368523 382
16 3300025898 Ga0207692_10011320 Ga0207692_100113204 382
17 3300025905 Ga0207685_10004111 Ga0207685_100041114 382
18 3300025906 Ga0207699_10001027 Ga0207699_1000102711 382
19 3300025915 Ga0207693_10000774 Ga0207693_1000077425 382
20 3300025916 Ga0207663_10003833 Ga0207663_100038334 382
21 3300025929 Ga0207664_10245442 Ga0207664_102454421 382
22 3300025939 Ga0207665_10000289 Ga0207665_1000028911 382
23 3300005435 Ga0070714_100001031 Ga0070714_10000103116 384
24 3300005436 Ga0070713_100000447 Ga0070713_10000044710 384
25 3300005437 Ga0070710_10002104 Ga0070710_100021046 384
26 3300005439 Ga0070711_100005283 Ga0070711_1000052839 384
27 iso_pu_bacteria 8019648815 8019652883 385
28 3300031730 Ga0307516_10087107 Ga0307516_100871072 387
29 3300005548 Ga0070665_100059724 Ga0070665_1000597242 388
30 3300005564 Ga0070664_100046895 Ga0070664_1000468954 388
31 3300005983 Ga0081540_1035800 Ga0081540_10358003 388
32 3300006353 Ga0075370_10018723 Ga0075370_100187233 388
33 3300025945 Ga0207679_10054377 Ga0207679_100543773 388
34 3300028379 Ga0268266_10009701 Ga0268266_100097014 388
35 3300039437 Ga0436365_0409965 Ga0436365_0409965_1130_2374 388
36 3300046537 Ga0495598_0017575 Ga0495598_0017575_16_1260 388
37 3300047445 Ga0495677_0014584 Ga0495677_0014584_951_2195 388
38 3300050496 nmdc:mga07m45_9280_c1 nmdc:mga07m45_9280_c1_2700_3944 388
39 3300053086 Ga0500578_0035655 Ga0500578_0035655_1660_2913 388
40 3300053177 Ga0500636_0000075 Ga0500636_0000075_13842_15095 388
41 3300005548 Ga0070665_100057781 Ga0070665_1000577812 389
42 3300021320 Ga0214544_1000087 Ga0214544_1000087103 389
43 3300021321 Ga0214542_1000018 Ga0214542_1000018174 389
44 3300021324 Ga0214545_1000009 Ga0214545_10000097 389
45 3300025915 Ga0207693_10079234 Ga0207693_100792342 389
46 3300028379 Ga0268266_10052181 Ga0268266_100521813 389
47 3300028379 Ga0268266_10053044 Ga0268266_100530442 389
48 3300025261 Ga0209233_1001183 Ga0209233_10011834 390
49 3300048911 Ga0496108_0106127 Ga0496108_0106127_1014_2267 390
50 3300048913 Ga0496110_0201284 Ga0496110_0201284_398_1651 390
51 3300003794 Ga0055531_10002401 Ga0055531_1000240111 391
52 3300005262 Ga0065165_1005891 Ga0065165_10058916 391
53 3300025297 Ga0209758_1000015 Ga0209758_1000015181 391
54 3300025303 Ga0209051_1019809 Ga0209051_10198092 391
55 3300025304 Ga0209257_1000440 Ga0209257_100044027 391
56 3300048907 Ga0496104_0005304 Ga0496104_0005304_1572_2747 391
57 3300048924 Ga0496121_0097573 Ga0496121_0097573_541_1749 391
58 3300005336 Ga0070680_100105807 Ga0070680_1001058072 392
59 3300005366 Ga0070659_100108110 Ga0070659_1001081102 392
60 3300005530 Ga0070679_100197670 Ga0070679_1001976701 392
61 3300013100 Ga0157373_10075513 Ga0157373_100755131 392
62 3300036401 Ga0373937_0098220 Ga0373937_0098220_1260_2501 392
63 3300046680 Ga0495646_0017354 Ga0495646_0017354_2738_3988 392
64 3300048919 Ga0496116_0055772 Ga0496116_0055772_1221_2453 392
65 3300047319 Ga0495674_0245331 Ga0495674_0245331_23_1207 393
66 3300048909 Ga0496106_0011156 Ga0496106_0011156_3310_4539 393
67 3300048920 Ga0496117_0031153 Ga0496117_0031153_2384_3613 393
68 3300048921 Ga0496118_0049117 Ga0496118_0049117_1945_3174 393
69 3300048924 Ga0496121_0000716 Ga0496121_0000716_57684_58913 393
70 3300048927 Ga0496124_0001529 Ga0496124_0001529_2422_3651 393
71 3300048928 Ga0496125_0032850 Ga0496125_0032850_1042_2271 393
72 3300048929 Ga0496126_0070482 Ga0496126_0070482_664_1893 393
73 3300005937 Ga0081455_10007517 Ga0081455_100075179 394
74 3300035118 Ga0373954_0021858 Ga0373954_0021858_1671_2858 394
75 3300035724 Ga0373933_0125855 Ga0373933_0125855_231_1475 394
76 3300039438 Ga0436360_1265645 Ga0436360_1265645_1129_2376 394
77 3300048921 Ga0496118_0181629 Ga0496118_0181629_71_1258 394
78 3300021388 Ga0213875_10007759 Ga0213875_100077595 395
79 3300035117 Ga0373953_0011203 Ga0373953_0011203_14_1201 395
80 3300053094 Ga0500566_0000754 Ga0500566_0000754_15937_17190 395
81 3300053139 Ga0500568_0064106 Ga0500568_0064106_14_1201 395
82 3300053140 Ga0500573_0156872 Ga0500573_0156872_40_1227 395
83 3300037853 Ga0436364_0194875 Ga0436364_0194875_4134_5327 396
84 3300046454 Ga0495592_0020793 Ga0495592_0020793_2641_3891 397
85 3300046462 Ga0495651_0123348 Ga0495651_0123348_425_1675 397
86 3300046516 Ga0495628_0117489 Ga0495628_0117489_361_1611 397
87 3300046536 Ga0495587_0028203 Ga0495587_0028203_2140_3390 397
88 3300046559 Ga0495667_0013125 Ga0495667_0013125_3213_4463 397
89 3300046642 Ga0495634_0093259 Ga0495634_0093259_282_1532 397
90 3300046678 Ga0495599_0028089 Ga0495599_0028089_408_1658 397
91 3300046689 Ga0495613_0051530 Ga0495613_0051530_125_1375 397
92 3300046809 Ga0495600_0004278 Ga0495600_0004278_3375_4625 397
93 3300047317 Ga0495604_0005727 Ga0495604_0005727_6717_7967 397
94 3300047322 Ga0495680_0014317 Ga0495680_0014317_5372_6622 397
95 3300047444 Ga0495675_0013953 Ga0495675_0013953_3198_4448 397
96 3300044765 Ga0466970_0108567 Ga0466970_0108567_180_1427 398
97 3300045049 Ga0466959_0044960 Ga0466959_0044960_1384_2631 398
98 iso_pu_bacteria 8019547302 8019550639 398
99 3300006353 Ga0075370_10032739 Ga0075370_100327392 399
100 3300005616 Ga0068852_100260656 Ga0068852_1002606562 400
101 3300026121 Ga0207683_10014468 Ga0207683_100144682 400
102 3300031456 Ga0307513_10206949 Ga0307513_102069492 400
103 3300033180 Ga0307510_10083442 Ga0307510_100834422 400
104 3300046523 Ga0495644_0057973 Ga0495644_0057973_97_1341 400
105 3300046525 Ga0495663_0020109 Ga0495663_0020109_476_1720 400
106 3300046537 Ga0495598_0011495 Ga0495598_0011495_837_2081 400
107 3300048924 Ga0496121_0040197 Ga0496121_0040197_370_1623 400
108 3300049571 Ga0501034_0010558 Ga0501034_0010558_7956_9164 400
109 3300049582 Ga0501048_0046199 Ga0501048_0046199_436_1644 400
110 3300049822 Ga0501035_0019650 Ga0501035_0019650_4947_6155 400
111 3300053119 Ga0500595_004250 Ga0500595_004250_2420_3664 400
112 3300003762 Ga0055542_1006056 Ga0055542_10060562 401
113 3300005262 Ga0065165_1023874 Ga0065165_10238742 401
114 3300005983 Ga0081540_1006739 Ga0081540_10067393 401
115 3300013102 Ga0157371_10023913 Ga0157371_100239132 401
116 3300013307 Ga0157372_10081164 Ga0157372_100811641 401
117 3300025254 Ga0209148_1000694 Ga0209148_100069415 401
118 3300025272 Ga0209455_1001551 Ga0209455_10015516 401
119 3300025302 Ga0207426_1004819 Ga0207426_10048196 401
120 3300049568 Ga0501031_0006545 Ga0501031_0006545_3024_4235 401
121 3300049569 Ga0501032_0000048 Ga0501032_0000048_26162_27373 401
122 3300049570 Ga0501033_0000184 Ga0501033_0000184_23492_24703 401
123 3300049571 Ga0501034_0000082 Ga0501034_0000082_73938_75149 401
124 3300049572 Ga0501036_0000791 Ga0501036_0000791_8362_9573 401
125 3300049573 Ga0501037_0000063 Ga0501037_0000063_78568_79779 401
126 3300049574 Ga0501038_0000295 Ga0501038_0000295_17149_18360 401
127 3300049575 Ga0501039_0000082 Ga0501039_0000082_40174_41385 401
128 3300049579 Ga0501043_0000148 Ga0501043_0000148_34342_35553 401
129 3300049580 Ga0501046_0000101 Ga0501046_0000101_57745_58956 401
130 3300049581 Ga0501047_0000671 Ga0501047_0000671_977_2188 401
131 3300049582 Ga0501048_0006649 Ga0501048_0006649_4114_5325 401
132 3300049583 Ga0501067_0000056 Ga0501067_0000056_52708_53919 401
133 3300049584 Ga0501068_0000310 Ga0501068_0000310_5279_6490 401
134 3300049585 Ga0501069_0001375 Ga0501069_0001375_9793_11004 401
135 3300049586 Ga0501070_0043351 Ga0501070_0043351_2202_3413 401
136 3300049588 Ga0501072_0006466 Ga0501072_0006466_822_2033 401
137 3300049589 Ga0501073_0000053 Ga0501073_0000053_69866_71077 401
138 3300049590 Ga0501074_0000331 Ga0501074_0000331_2362_3573 401
139 3300049741 Ga0501079_0000586 Ga0501079_0000586_17957_19168 401
140 3300049742 Ga0501080_0000922 Ga0501080_0000922_16012_17223 401
141 3300049744 Ga0501083_0005043 Ga0501083_0005043_6042_7253 401
142 3300049822 Ga0501035_0000474 Ga0501035_0000474_2186_3397 401
143 3300049823 Ga0501044_0000408 Ga0501044_0000408_32069_33280 401
144 3300049824 Ga0501045_0001959 Ga0501045_0001959_1702_2913 401
145 3300053087 Ga0500643_000062 Ga0500643_000062_110871_112124 401
146 3300054114 Ga0501084_0002066 Ga0501084_0002066_10000_11211 401
147 3300060353 Ga0501082_0007314 Ga0501082_0007314_1005_2216 401
148 3300005336 Ga0070680_100148329 Ga0070680_1001483292 402
149 3300005530 Ga0070679_100230981 Ga0070679_1002309812 402
150 3300005563 Ga0068855_100055240 Ga0068855_1000552403 402
151 3300010375 Ga0105239_10117102 Ga0105239_101171022 402
152 3300014968 Ga0157379_10134198 Ga0157379_101341983 402
153 3300025919 Ga0207657_10015396 Ga0207657_100153966 402
154 3300025949 Ga0207667_10052700 Ga0207667_100527004 402
155 3300031507 Ga0307509_10060767 Ga0307509_100607674 402
156 3300033180 Ga0307510_10001273 Ga0307510_1000127323 402
157 3300037312 Ga0395899_0067636 Ga0395899_0067636_1268_2482 402
158 3300037418 Ga0395900_0038973 Ga0395900_0038973_237_1451 402
159 3300037466 Ga0395898_0262021 Ga0395898_0262021_43_1257 402
160 3300038443 Ga0395901_0025443 Ga0395901_0025443_1772_2986 402
161 3300046452 Ga0495617_018889 Ga0495617_018889_690_1940 402
162 3300046455 Ga0495603_0016647 Ga0495603_0016647_2308_3558 402
163 3300046460 Ga0495638_0055340 Ga0495638_0055340_769_2019 402
164 3300046557 Ga0495622_0019641 Ga0495622_0019641_1675_2925 402
165 3300046616 Ga0495668_0005573 Ga0495668_0005573_3450_4700 402
166 3300048908 Ga0496105_0031279 Ga0496105_0031279_2254_3462 402
167 3300048909 Ga0496106_0051335 Ga0496106_0051335_483_1691 402
168 3300048911 Ga0496108_0028116 Ga0496108_0028116_3240_4448 402
169 3300048913 Ga0496110_0031931 Ga0496110_0031931_535_1743 402
170 3300048915 Ga0496112_0002348 Ga0496112_0002348_7242_8450 402
171 3300048918 Ga0496115_0252624 Ga0496115_0252624_58_1266 402
172 3300049573 Ga0501037_0136567 Ga0501037_0136567_117_1331 402
173 3300049585 Ga0501069_0049199 Ga0501069_0049199_56_1270 402
174 3300049590 Ga0501074_0205662 Ga0501074_0205662_59_1273 402
175 3300005436 Ga0070713_100048359 Ga0070713_1000483593 403
176 3300025928 Ga0207700_10032190 Ga0207700_100321902 403
177 3300031249 Ga0265339_10047978 Ga0265339_100479783 403
178 3300031250 Ga0265331_10019815 Ga0265331_100198152 403
179 3300031711 Ga0265314_10047193 Ga0265314_100471933 403
180 3300031712 Ga0265342_10023127 Ga0265342_100231274 403
181 3300048928 Ga0496125_0000746 Ga0496125_0000746_1736_2974 403
182 iso_pu_bacteria 2791355199 2793077416 403
183 3300033180 Ga0307510_10007616 Ga0307510_100076166 404
184 3300047320 Ga0495672_0120975 Ga0495672_0120975_125_1372 404
185 3300049823 Ga0501044_0267764 Ga0501044_0267764_238_1497 404
186 3300053092 Ga0500583_0067309 Ga0500583_0067309_215_1468 404
187 3300048924 Ga0496121_0170217 Ga0496121_0170217_227_1471 405
188 3300005331 Ga0070670_100152733 Ga0070670_1001527332 406
189 3300005338 Ga0068868_100047915 Ga0068868_1000479153 406
190 3300005347 Ga0070668_100091727 Ga0070668_1000917271 406
191 3300005547 Ga0070693_100036325 Ga0070693_1000363253 406
192 3300005842 Ga0068858_100103546 Ga0068858_1001035462 406
193 3300006048 Ga0075363_100030835 Ga0075363_1000308353 406
194 3300009098 Ga0105245_10040748 Ga0105245_100407483 406
195 3300009174 Ga0105241_10116078 Ga0105241_101160783 406
196 3300010375 Ga0105239_10151690 Ga0105239_101516902 406
197 3300011119 Ga0105246_10017164 Ga0105246_100171642 406
198 3300025911 Ga0207654_10018569 Ga0207654_100185694 406
199 3300025914 Ga0207671_10108087 Ga0207671_101080872 406
200 3300025927 Ga0207687_10149472 Ga0207687_101494722 406
201 3300025931 Ga0207644_10267073 Ga0207644_102670731 406
202 3300025972 Ga0207668_10036396 Ga0207668_100363962 406
203 3300026067 Ga0207678_10071759 Ga0207678_100717593 406
204 3300026078 Ga0207702_10325395 Ga0207702_103253951 406
205 3300028379 Ga0268266_10014397 Ga0268266_100143978 406
206 3300037068 Ga0373925_0228811 Ga0373925_0228811_149_1375 406
207 3300048913 Ga0496110_0055172 Ga0496110_0055172_1391_2641 406
208 3300048915 Ga0496112_0047324 Ga0496112_0047324_2654_3904 406
209 3300050496 nmdc:mga07m45_37482_c2 nmdc:mga07m45_37482_c2_200_1450 406
210 iso_pu_bacteria 2602042107 2603857874 406
211 iso_pu_bacteria 2844315083 2844321816 406
212 iso_pu_bacteria 2857524615 2857527247 406
213 iso_pu_bacteria 2893066018 2893067979 406
214 iso_pu_bacteria 2903727486 2903727634 406
215 iso_pu_bacteria 2906602504 2906602876 406
216 iso_pu_bacteria 2919073203 2919078364 406
217 3300006195 Ga0075366_10041070 Ga0075366_100410702 407
218 3300046557 Ga0495622_0084231 Ga0495622_0084231_187_1434 407
219 3300046674 Ga0495588_0002575 Ga0495588_0002575_4396_5643 407
220 3300048907 Ga0496104_0063104 Ga0496104_0063104_1235_2482 407
221 3300048908 Ga0496105_0062404 Ga0496105_0062404_1290_2537 407
222 3300048909 Ga0496106_0175271 Ga0496106_0175271_155_1402 407
223 3300048924 Ga0496121_0022824 Ga0496121_0022824_2185_3432 407
224 3300025297 Ga0209758_1001187 Ga0209758_100118724 408
225 3300028577 Ga0265318_10007398 Ga0265318_100073982 408
226 3300028653 Ga0265323_10001811 Ga0265323_100018112 408
227 3300028800 Ga0265338_10000024 Ga0265338_10000024101 408
228 3300029957 Ga0265324_10007310 Ga0265324_100073102 408
229 3300048913 Ga0496110_0312919 Ga0496110_0312919_102_1337 408
230 3300048915 Ga0496112_0020579 Ga0496112_0020579_2145_3380 408
231 iso_pu_bacteria 2876761206 2876766419 408
232 3300005843 Ga0068860_100000257 Ga0068860_10000025733 409
233 3300028381 Ga0268264_10000049 Ga0268264_10000049225 409
234 3300031507 Ga0307509_10011529 Ga0307509_100115295 409
235 3300033179 Ga0307507_10008595 Ga0307507_100085959 409
236 3300035725 Ga0373947_0089639 Ga0373947_0089639_165_1394 409
237 3300037068 Ga0373925_0133108 Ga0373925_0133108_683_1912 409
238 3300053077 Ga0495601_0135290 Ga0495601_0135290_290_1519 409
239 3300053094 Ga0500566_0000896 Ga0500566_0000896_6120_7367 409
240 3300053115 Ga0500591_015490 Ga0500591_015490_292_1539 409
241 3300053136 Ga0500559_0018624 Ga0500559_0018624_87_1316 409
242 3300053150 Ga0500603_017792 Ga0500603_017792_219_1466 409
243 3300053735 Ga0500596_004199 Ga0500596_004199_210_1439 409
244 iso_pu_bacteria 2507262055 2507504837 409
245 iso_pu_bacteria 2508501009 2508546192 409
246 iso_pu_bacteria 2508501042 2508695124 409
247 iso_pu_bacteria 2511231028 2511398309 409
248 iso_pu_bacteria 2513237092 2513625419 409
249 iso_pu_bacteria 2513237094 2513639548 409
250 iso_pu_bacteria 2513237095 2513647968 409
251 iso_pu_bacteria 2513237098 2513672984 409
252 iso_pu_bacteria 2513237102 2513703346 409
253 iso_pu_bacteria 2513237104 2513715703 409
254 iso_pu_bacteria 2515154112 2515625870 409
255 iso_pu_bacteria 2517093001 2517102393 409
256 iso_pu_bacteria 2524023205 2524435738 409
257 iso_pu_bacteria 2524023210 2524466460 409
258 iso_pu_bacteria 2744054633 2745079034 409
259 iso_pu_bacteria 2791355196 2793066042 409
260 iso_pu_bacteria 2816332527 2818237274 409
261 iso_pu_bacteria 2824600985 2824602569 409
262 iso_pu_bacteria 2824609381 2824612651 409
263 iso_pu_bacteria 2824617872 2824621113 409
264 iso_pu_bacteria 2824626560 2824630120 409
265 iso_pu_bacteria 2824635225 2824640725 409
266 iso_pu_bacteria 2824653114 2824654466 409
267 iso_pu_bacteria 2824671348 2824674860 409
268 iso_pu_bacteria 2824687955 2824691928 409
269 iso_pu_bacteria 2824723954 2824727937 409
270 iso_pu_bacteria 2824753945 2824757120 409
271 iso_pu_bacteria 2824773399 2824774949 409
272 iso_pu_bacteria 2838122688 2838129552 409
273 iso_pu_bacteria 2841941048 2841944453 409
274 iso_pu_bacteria 2841949485 2841951594 409
275 iso_pu_bacteria 2841957949 2841964619 409
276 iso_pu_bacteria 2841966195 2841969230 409
277 iso_pu_bacteria 2841974524 2841982895 409
278 iso_pu_bacteria 2841983080 2841991023 409
279 iso_pu_bacteria 2842038055 2842043889 409
280 iso_pu_bacteria 2842045827 2842052121 409
281 iso_pu_bacteria 2847930680 2847931475 409
282 iso_pu_bacteria 2847939898 2847941747 409
283 iso_pu_bacteria 2849076700 2849082669 409
284 iso_pu_bacteria 2857509624 2857511562 409
285 iso_pu_bacteria 2874590934 2874596831 409
286 iso_pu_bacteria 2874612657 2874617925 409
287 iso_pu_bacteria 2874620515 2874624415 409
288 iso_pu_bacteria 2874628541 2874636702 409
289 iso_pu_bacteria 2874645413 2874648636 409
290 iso_pu_bacteria 2876771140 2876777295 409
291 iso_pu_bacteria 2876818435 2876825377 409
292 iso_pu_bacteria 2879074833 2879077626 409
293 iso_pu_bacteria 2879099564 2879107219 409
294 iso_pu_bacteria 2879127579 2879130769 409
295 iso_pu_bacteria 2879142872 2879146071 409
296 iso_pu_bacteria 2881364244 2881371008 409
297 iso_pu_bacteria 2881665667 2881665689 409
298 iso_pu_bacteria 2885366525 2885371405 409
299 iso_pu_bacteria 2885383462 2885391426 409
300 iso_pu_bacteria 2885409591 2885414606 409
301 iso_pu_bacteria 2888378607 2888379969 409
302 iso_pu_bacteria 2888388044 2888391047 409
303 iso_pu_bacteria 2888419890 2888420778 409
304 iso_pu_bacteria 2903768456 2903772317 409
305 iso_pu_bacteria 2904666416 2904672246 409
306 iso_pu_bacteria 2904711408 2904716177 409
307 iso_pu_bacteria 2906626472 2906627035 409
308 iso_pu_bacteria 2906643746 2906647585 409
309 iso_pu_bacteria 2908775508 2908775759 409
310 iso_pu_bacteria 2922368715 2922378355 409
311 iso_pu_bacteria 2929615660 2929622544 409
312 iso_pu_bacteria 2929624759 2929631238 409
313 iso_pu_bacteria 2932784394 2932786340 409
314 iso_pu_bacteria 2932794094 2932794692 409
315 iso_pu_bacteria 2932801729 2932805497 409
316 iso_pu_bacteria 2932809354 2932812585 409
317 iso_pu_bacteria 2932818245 2932822947 409
318 iso_pu_bacteria 2932828146 2932829578 409
319 iso_pu_bacteria 2933577622 2933584377 409
320 iso_pu_bacteria 2935608549 2935614964 409
321 iso_pu_bacteria 2935616580 2935618096 409
322 iso_pu_bacteria 2935638405 2935641506 409
323 iso_pu_bacteria 2935648319 2935652991 409
324 iso_pu_bacteria 2935656913 2935661574 409
325 iso_pu_bacteria 2935665750 2935669436 409
326 iso_pu_bacteria 2935675223 2935677966 409
327 iso_pu_bacteria 2935684952 2935689583 409
328 iso_pu_bacteria 2935694250 2935701796 409
329 iso_pu_bacteria 2935703347 2935707261 409
330 iso_pu_bacteria 2935713505 2935717102 409
331 iso_pu_bacteria 2935722832 2935730064 409
332 iso_pu_bacteria 2935732158 2935738517 409
333 iso_pu_bacteria 2935741537 2935749235 409
334 iso_pu_bacteria 2935750917 2935756936 409
335 iso_pu_bacteria 2935760218 2935764450 409
336 iso_pu_bacteria 2935769743 2935772781 409
337 iso_pu_bacteria 2935777560 2935778082 409
338 iso_pu_bacteria 2935785616 2935787310 409
339 iso_pu_bacteria 2935793552 2935795902 409
340 iso_pu_bacteria 2935801545 2935804360 409
341 iso_pu_bacteria 2935810662 2935817221 409
342 iso_pu_bacteria 2935819856 2935825997 409
343 iso_pu_bacteria 2935827899 2935831237 409
344 iso_pu_bacteria 2935837841 2935841846 409
345 iso_pu_bacteria 2935847175 2935851616 409
346 iso_pu_bacteria 2935855204 2935856405 409
347 iso_pu_bacteria 2935864058 2935871072 409
348 iso_pu_bacteria 2935873716 2935874569 409
349 iso_pu_bacteria 2935883170 2935888906 409
350 iso_pu_bacteria 2935908558 2935910362 409
351 iso_pu_bacteria 2935916978 2935918352 409
352 iso_pu_bacteria 2935926038 2935927727 409
353 iso_pu_bacteria 2935934488 2935936401 409
354 iso_pu_bacteria 2935942939 2935944046 409
355 iso_pu_bacteria 2935951376 2935952483 409
356 iso_pu_bacteria 2935959822 2935964150 409
357 iso_pu_bacteria 2935967501 2935969323 409
358 iso_pu_bacteria 2935975950 2935977912 409
359 iso_pu_bacteria 2935984226 2935984784 409
360 iso_pu_bacteria 2935992306 2935994030 409
361 iso_pu_bacteria 2936002035 2936004959 409
362 iso_pu_bacteria 2936011229 2936015697 409
363 iso_pu_bacteria 2936019824 2936024331 409
364 iso_pu_bacteria 2936028420 2936031782 409
365 iso_pu_bacteria 2936037263 2936044017 409
366 iso_pu_bacteria 2936046547 2936051604 409
367 iso_pu_bacteria 2936055302 2936055955 409
368 iso_pu_bacteria 2940556831 2940562850 409
369 iso_pu_bacteria 2941531003 2941532348 409
370 iso_pu_bacteria 2941538514 2941543919 409
371 iso_pu_bacteria 3005483717 3005486423 409
372 iso_pu_bacteria 3005506211 3005509551 409
373 iso_pu_bacteria 3005587118 3005589016 409
374 iso_pu_bacteria 3005594810 3005602165 409
375 iso_pu_bacteria 3005710791 3005717922 409
376 iso_pu_bacteria 3005718088 3005724956 409
377 iso_pu_bacteria 8006926726 8006929783 409
378 iso_pu_bacteria 8016511872 8016518632 409
379 iso_pu_bacteria 8016522445 8016526610 409
380 iso_pu_bacteria 8016530956 8016531693 409
381 iso_pu_bacteria 8016539877 8016544890 409
382 iso_pu_bacteria 8016566248 8016569963 409
383 iso_pu_bacteria 8016575299 8016582541 409
384 iso_pu_bacteria 8016595262 8016603156 409
385 iso_pu_bacteria 8016613128 8016617954 409
386 iso_pu_bacteria 8016622563 8016623617 409
387 iso_pu_bacteria 8016630954 8016636092 409
388 iso_pu_bacteria 8017057580 8017058038 409
389 iso_pu_bacteria 8019538911 8019540017 409
390 iso_pu_bacteria 8019576017 8019577696 409
391 iso_pu_bacteria 8019586578 8019595795 409
392 iso_pu_bacteria 8019597564 8019605964 409
393 iso_pu_bacteria 8019608314 8019612568 409
394 iso_pu_bacteria 8019619141 8019622551 409
395 iso_pu_bacteria 8019629233 8019630564 409
396 iso_pu_bacteria 8019638758 8019640050 409
397 iso_pu_bacteria 8019668869 8019677162 409
398 iso_pu_bacteria 8019678201 8019678822 409
399 iso_pu_bacteria 8019687851 8019696709 409
400 iso_pu_bacteria 8055742211 8055750995 409
401 iso_pu_bacteria 8056681323 8056688453 409
402 3300025295 Ga0209564_1001755 Ga0209564_100175510 410
403 3300025295 Ga0209564_1015806 Ga0209564_10158061 410
404 3300031911 Ga0307412_10150773 Ga0307412_101507731 410
405 3300046460 Ga0495638_0020842 Ga0495638_0020842_77_1315 410
406 3300046515 Ga0495620_0013656 Ga0495620_0013656_2019_3257 410
407 3300046665 Ga0495661_0003673 Ga0495661_0003673_2807_4045 410
408 3300046674 Ga0495588_0019137 Ga0495588_0019137_1727_2965 410
409 3300046691 Ga0495670_0038212 Ga0495670_0038212_62_1300 410
410 3300047472 Ga0495686_0019613 Ga0495686_0019613_1236_2474 410
411 3300047472 Ga0495686_0046333 Ga0495686_0046333_949_2187 410
412 3300048909 Ga0496106_0088701 Ga0496106_0088701_379_1617 410
413 3300048919 Ga0496116_0003138 Ga0496116_0003138_7848_9086 410
414 3300048920 Ga0496117_0038991 Ga0496117_0038991_228_1466 410
415 3300048923 Ga0496120_0058151 Ga0496120_0058151_851_2089 410
416 3300048924 Ga0496121_0027214 Ga0496121_0027214_4013_5251 410
417 3300048927 Ga0496124_0119606 Ga0496124_0119606_170_1408 410
418 3300048928 Ga0496125_0000048 Ga0496125_0000048_112463_113701 410
419 3300048928 Ga0496125_0007153 Ga0496125_0007153_7510_8748 410
420 3300048929 Ga0496126_0101584 Ga0496126_0101584_338_1576 410
421 3300050516 nmdc:mga0sz30_9859_c1 nmdc:mga0sz30_9859_c1_10_1248 410
422 3300053096 Ga0500641_0005076 Ga0500641_0005076_261_1499 410
423 3300053104 Ga0500556_0000012 Ga0500556_0000012_216253_217491 410
424 3300053109 Ga0500569_002435 Ga0500569_002435_2112_3350 410
425 3300053131 Ga0500652_000891 Ga0500652_000891_6520_7758 410
426 3300053139 Ga0500568_0008164 Ga0500568_0008164_3221_4459 410
427 3300053142 Ga0500577_0000112 Ga0500577_0000112_13104_14342 410
428 3300053148 Ga0500590_039868 Ga0500590_039868_824_2062 410
429 3300053153 Ga0500616_0000035 Ga0500616_0000035_166214_167452 410
430 3300053158 Ga0500627_0075848 Ga0500627_0075848_171_1409 410
431 3300053161 Ga0500634_0008134 Ga0500634_0008134_902_2140 410
432 3300053163 Ga0500639_004728 Ga0500639_004728_442_1689 410
433 3300053177 Ga0500636_0000934 Ga0500636_0000934_13688_14926 410
434 3300053178 Ga0500637_0039657 Ga0500637_0039657_859_2097 410
435 3300053735 Ga0500596_006081 Ga0500596_006081_664_1911 410
436 iso_pu_bacteria 2508501128 2509149792 410
437 iso_pu_bacteria 2513237101 2513694918 410
438 iso_pu_bacteria 2513237141 2513889777 410
439 iso_pu_bacteria 2517572143 2517889310 410
440 iso_pu_bacteria 2524023228 2524540357 410
441 iso_pu_bacteria 2721755755 2723842033 410
442 iso_pu_bacteria 2728368998 2728755367 410
443 iso_pu_bacteria 2874604998 2874610353 410
444 iso_pu_bacteria 2885374607 2885377739 410
445 iso_pu_bacteria 2889033259 2889035064 410
446 iso_pu_bacteria 2903748898 2903749928 410
447 iso_pu_bacteria 2904690495 2904692498 410
448 iso_pu_bacteria 2904699407 2904709182 410
449 iso_pu_bacteria 2906610324 2906613213 410
450 iso_pu_bacteria 2906635258 2906635496 410
451 iso_pu_bacteria 2906660503 2906668627 410
452 iso_pu_bacteria 2908739725 2908747911 410
453 iso_pu_bacteria 2908756301 2908757234 410
454 iso_pu_bacteria 2922361189 2922363326 410
455 iso_pu_bacteria 2922386360 2922388605 410
456 iso_pu_bacteria 3005474847 3005475550 410
457 iso_pu_bacteria 8006933436 8006935747 410
458 iso_pu_bacteria 8006964411 8006968320 410
459 iso_pu_bacteria 8006973647 8006975666 410
460 iso_pu_bacteria 8006984368 8006985942 410
461 iso_pu_bacteria 8006994254 8007000253 410
462 iso_pu_bacteria 8019530166 8019531517 410
463 iso_pu_bacteria 8019555841 8019563044 410
464 iso_pu_bacteria 8019565922 8019573125 410
465 iso_pu_bacteria 8056673599 8056677733 410
466 iso_pu_bacteria 8056689827 8056694107 410
467 3300010375 Ga0105239_10448479 Ga0105239_104484791 411
468 3300048907 Ga0496104_0032218 Ga0496104_0032218_403_1644 411
469 3300048915 Ga0496112_0032266 Ga0496112_0032266_3386_4627 411
470 iso_pu_bacteria 2879110137 2879111671 411
471 3300005364 Ga0070673_100050863 Ga0070673_1000508631 412
472 3300005455 Ga0070663_100029366 Ga0070663_1000293663 412
473 3300005535 Ga0070684_100042422 Ga0070684_1000424224 412
474 3300013296 Ga0157374_10012415 Ga0157374_100124152 412
475 3300013308 Ga0157375_10036499 Ga0157375_100364996 412
476 3300014325 Ga0163163_10058864 Ga0163163_100588644 412
477 3300026067 Ga0207678_10011493 Ga0207678_100114933 412
478 3300048905 Ga0496102_0038452 Ga0496102_0038452_1020_2264 412
479 3300048908 Ga0496105_0025939 Ga0496105_0025939_593_1837 412
480 3300048909 Ga0496106_0132616 Ga0496106_0132616_342_1586 412
481 3300048910 Ga0496107_0003794 Ga0496107_0003794_5039_6283 412
482 3300048911 Ga0496108_0103808 Ga0496108_0103808_670_1914 412
483 3300048916 Ga0496113_0010309 Ga0496113_0010309_701_1945 412
484 3300048917 Ga0496114_0053466 Ga0496114_0053466_802_2046 412
485 3300048918 Ga0496115_0031637 Ga0496115_0031637_340_1584 412
486 3300005329 Ga0070683_100014340 Ga0070683_1000143403 413
487 3300005435 Ga0070714_100136932 Ga0070714_1001369322 413
488 3300005457 Ga0070662_100009681 Ga0070662_1000096812 413
489 3300005535 Ga0070684_100003114 Ga0070684_10000311410 413
490 3300005616 Ga0068852_100027195 Ga0068852_1000271955 413
491 3300005617 Ga0068859_100094950 Ga0068859_1000949501 413
492 3300006931 Ga0097620_100094952 Ga0097620_1000949521 413
493 3300009093 Ga0105240_10005693 Ga0105240_100056933 413
494 3300009093 Ga0105240_10069560 Ga0105240_100695603 413
495 3300009545 Ga0105237_10004882 Ga0105237_100048822 413
496 3300025253 Ga0209677_100351 Ga0209677_10035112 413
497 3300025261 Ga0209233_1003057 Ga0209233_10030575 413
498 3300025297 Ga0209758_1005118 Ga0209758_10051188 413
499 3300025913 Ga0207695_10000065 Ga0207695_10000065178 413
500 3300025914 Ga0207671_10001858 Ga0207671_1000185820 413
501 3300025914 Ga0207671_10097887 Ga0207671_100978871 413
502 3300025929 Ga0207664_10271154 Ga0207664_102711541 413
503 3300025933 Ga0207706_10044195 Ga0207706_100441952 413
504 3300025944 Ga0207661_10000678 Ga0207661_100006783 413
505 3300027296 Ga0209389_1000076 Ga0209389_100007632 413
506 3300027361 Ga0209489_100416 Ga0209489_10041632 413
507 3300027363 Ga0209700_100014 Ga0209700_10001494 413
508 3300031238 Ga0265332_10023238 Ga0265332_100232383 413
509 3300031616 Ga0307508_10000005 Ga0307508_10000005238 413
510 3300035113 Ga0373936_0016157 Ga0373936_0016157_1196_2440 413
511 3300035117 Ga0373953_0001082 Ga0373953_0001082_5616_6905 413
512 3300035118 Ga0373954_0002766 Ga0373954_0002766_5041_6330 413
513 3300035119 Ga0373956_0000296 Ga0373956_0000296_12568_13857 413
514 3300035120 Ga0373957_0001181 Ga0373957_0001181_2024_3313 413
515 3300035724 Ga0373933_0004010 Ga0373933_0004010_1630_2919 413
516 3300036401 Ga0373937_0005314 Ga0373937_0005314_30_1274 413
517 3300037418 Ga0395900_0006407 Ga0395900_0006407_454_1701 413
518 3300037466 Ga0395898_0017762 Ga0395898_0017762_5518_6765 413
519 3300037466 Ga0395898_0067697 Ga0395898_0067697_232_1485 413
520 3300037466 Ga0395898_0270675 Ga0395898_0270675_196_1446 413
521 3300037853 Ga0436364_0806245 Ga0436364_0806245_221_1465 413
522 3300038443 Ga0395901_0019529 Ga0395901_0019529_5535_6782 413
523 3300044658 Ga0466972_0000103 Ga0466972_0000103_68440_69687 413
524 3300044658 Ga0466972_0028761 Ga0466972_0028761_1426_2673 413
525 3300044683 Ga0466965_0019402 Ga0466965_0019402_1412_2659 413
526 3300044684 Ga0466966_0002297 Ga0466966_0002297_1825_3072 413
527 3300044693 Ga0466961_0000129 Ga0466961_0000129_8338_9585 413
528 3300044694 Ga0466963_0028235 Ga0466963_0028235_1731_2978 413
529 3300044706 Ga0466964_0089359 Ga0466964_0089359_71_1312 413
530 3300044765 Ga0466970_0130378 Ga0466970_0130378_124_1365 413
531 3300045049 Ga0466959_0014058 Ga0466959_0014058_1677_2924 413
532 3300045976 Ga0466967_0101123 Ga0466967_0101123_636_1889 413
533 3300045976 Ga0466967_0157719 Ga0466967_0157719_602_1849 413
534 3300046459 Ga0495629_0000380 Ga0495629_0000380_1187_2476 413
535 3300046460 Ga0495638_0060947 Ga0495638_0060947_1036_2280 413
536 3300046462 Ga0495651_0061285 Ga0495651_0061285_1502_2791 413
537 3300046463 Ga0495653_0004990 Ga0495653_0004990_4558_5847 413
538 3300046511 Ga0495608_0000629 Ga0495608_0000629_3627_4916 413
539 3300046516 Ga0495628_0036472 Ga0495628_0036472_1205_2494 413
540 3300046529 Ga0495652_0012668 Ga0495652_0012668_3690_4979 413
541 3300046529 Ga0495652_0028332 Ga0495652_0028332_2324_3577 413
542 3300046533 Ga0495640_0006078 Ga0495640_0006078_4030_5319 413
543 3300046536 Ga0495587_0020500 Ga0495587_0020500_2050_3339 413
544 3300046543 Ga0495645_0044947 Ga0495645_0044947_1837_3126 413
545 3300046559 Ga0495667_0014316 Ga0495667_0014316_722_2011 413
546 3300046642 Ga0495634_0016748 Ga0495634_0016748_529_1818 413
547 3300046642 Ga0495634_0068872 Ga0495634_0068872_1062_2315 413
548 3300046663 Ga0495635_0003387 Ga0495635_0003387_6974_8227 413
549 3300046663 Ga0495635_0003556 Ga0495635_0003556_4043_5332 413
550 3300046678 Ga0495599_0009607 Ga0495599_0009607_30_1274 413
551 3300046679 Ga0495623_0030438 Ga0495623_0030438_30_1274 413
552 3300046680 Ga0495646_0015831 Ga0495646_0015831_2196_3485 413
553 3300046689 Ga0495613_0011795 Ga0495613_0011795_4807_6096 413
554 3300046809 Ga0495600_0000567 Ga0495600_0000567_14678_15967 413
555 3300047317 Ga0495604_0015120 Ga0495604_0015120_3915_5204 413
556 3300047317 Ga0495604_0049671 Ga0495604_0049671_1387_2640 413
557 3300047321 Ga0495676_0039786 Ga0495676_0039786_449_1702 413
558 3300047322 Ga0495680_0089299 Ga0495680_0089299_742_2031 413
559 3300047444 Ga0495675_0041292 Ga0495675_0041292_1058_2347 413
560 3300047471 Ga0495684_0000052 Ga0495684_0000052_75044_76333 413
561 3300047472 Ga0495686_0029614 Ga0495686_0029614_1393_2646 413
562 3300047673 Ga0495593_0000214 Ga0495593_0000214_6376_7665 413
563 3300048907 Ga0496104_0005388 Ga0496104_0005388_6596_7849 413
564 3300048908 Ga0496105_0001275 Ga0496105_0001275_6216_7469 413
565 3300048918 Ga0496115_0243485 Ga0496115_0243485_201_1448 413
566 3300048922 Ga0496119_0019380 Ga0496119_0019380_1309_2562 413
567 3300048923 Ga0496120_0005446 Ga0496120_0005446_7685_8938 413
568 3300048924 Ga0496121_0063144 Ga0496121_0063144_1080_2324 413
569 3300048924 Ga0496121_0077681 Ga0496121_0077681_218_1462 413
570 3300048927 Ga0496124_0051737 Ga0496124_0051737_987_2288 413
571 3300048928 Ga0496125_0175190 Ga0496125_0175190_102_1346 413
572 3300048929 Ga0496126_0027460 Ga0496126_0027460_2581_3834 413
573 3300053085 Ga0495619_0003340 Ga0495619_0003340_8652_9941 413
574 3300053087 Ga0500643_007900 Ga0500643_007900_1732_2976 413
575 3300053096 Ga0500641_0012945 Ga0500641_0012945_827_2071 413
576 3300053105 Ga0500557_000043 Ga0500557_000043_53983_55236 413
577 3300053119 Ga0500595_003786 Ga0500595_003786_5060_6313 413
578 3300053130 Ga0500642_0000193 Ga0500642_0000193_5331_6584 413
579 3300053177 Ga0500636_0019627 Ga0500636_0019627_1344_2690 413
580 3300053729 Ga0500625_000791 Ga0500625_000791_1920_3173 413
581 iso_pu_bacteria 2513237161 2514012892 413
582 iso_pu_bacteria 2617270735 2617351695 413
583 iso_pu_bacteria 2802429603 2805916002 413
584 3300003203 JGI25406J46586_10002301 JGI25406J46586_100023017 414
585 3300003203 JGI25406J46586_10006164 JGI25406J46586_100061643 414
586 3300003203 JGI25406J46586_10007239 JGI25406J46586_100072394 414
587 3300003215 JGI25153J46596_10000947 JGI25153J46596_1000094718 414
588 3300005327 Ga0070658_10033274 Ga0070658_100332743 414
589 3300005329 Ga0070683_100050291 Ga0070683_1000502913 414
590 3300005336 Ga0070680_100006331 Ga0070680_1000063317 414
591 3300005337 Ga0070682_100044950 Ga0070682_1000449501 414
592 3300005339 Ga0070660_100009964 Ga0070660_1000099643 414
593 3300005341 Ga0070691_10017608 Ga0070691_100176082 414
594 3300005434 Ga0070709_10000732 Ga0070709_100007323 414
595 3300005435 Ga0070714_100018874 Ga0070714_1000188742 414
596 3300005436 Ga0070713_100014459 Ga0070713_1000144597 414
597 3300005436 Ga0070713_100039153 Ga0070713_1000391534 414
598 3300005436 Ga0070713_100054432 Ga0070713_1000544323 414
599 3300005436 Ga0070713_100319796 Ga0070713_1003197961 414
600 3300005437 Ga0070710_10000211 Ga0070710_1000021115 414
601 3300005437 Ga0070710_10011225 Ga0070710_100112254 414
602 3300005439 Ga0070711_100009790 Ga0070711_1000097902 414
603 3300005439 Ga0070711_100023869 Ga0070711_1000238692 414
604 3300005455 Ga0070663_100161009 Ga0070663_1001610091 414
605 3300005458 Ga0070681_10036946 Ga0070681_100369465 414
606 3300005458 Ga0070681_10133621 Ga0070681_101336212 414
607 3300005471 Ga0070698_100143497 Ga0070698_1001434972 414
608 3300005530 Ga0070679_100022491 Ga0070679_1000224914 414
609 3300005530 Ga0070679_100096241 Ga0070679_1000962412 414
610 3300005535 Ga0070684_100008647 Ga0070684_1000086477 414
611 3300005535 Ga0070684_100071338 Ga0070684_1000713382 414
612 3300005535 Ga0070684_100091923 Ga0070684_1000919233 414
613 3300005536 Ga0070697_100134688 Ga0070697_1001346882 414
614 3300005539 Ga0068853_100008174 Ga0068853_1000081749 414
615 3300005563 Ga0068855_100033793 Ga0068855_1000337935 414
616 3300005563 Ga0068855_100040910 Ga0068855_1000409104 414
617 3300005563 Ga0068855_100286651 Ga0068855_1002866511 414
618 3300005564 Ga0070664_100041783 Ga0070664_1000417832 414
619 3300005614 Ga0068856_100002749 Ga0068856_10000274921 414
620 3300005616 Ga0068852_100146597 Ga0068852_1001465972 414
621 3300005617 Ga0068859_100093609 Ga0068859_1000936091 414
622 3300005834 Ga0068851_10005126 Ga0068851_100051262 414
623 3300005840 Ga0068870_10030391 Ga0068870_100303912 414
624 3300005844 Ga0068862_100059192 Ga0068862_1000591923 414
625 3300005937 Ga0081455_10006921 Ga0081455_1000692113 414
626 3300005937 Ga0081455_10036677 Ga0081455_100366774 414
627 3300005983 Ga0081540_1002991 Ga0081540_100299114 414
628 3300005983 Ga0081540_1005442 Ga0081540_10054426 414
629 3300005983 Ga0081540_1006907 Ga0081540_10069075 414
630 3300005985 Ga0081539_10000048 Ga0081539_1000004846 414
631 3300005985 Ga0081539_10000530 Ga0081539_100005303 414
632 3300005985 Ga0081539_10023403 Ga0081539_100234034 414
633 3300006028 Ga0070717_10004501 Ga0070717_1000450110 414
634 3300006173 Ga0070716_100001713 Ga0070716_1000017131 414
635 3300006237 Ga0097621_100213847 Ga0097621_1002138471 414
636 3300006353 Ga0075370_10121913 Ga0075370_101219131 414
637 3300006931 Ga0097620_100093609 Ga0097620_1000936091 414
638 3300006942 Ga0099824_1001145 Ga0099824_100114517 414
639 3300006943 Ga0099822_1000135 Ga0099822_100013518 414
640 3300007788 Ga0099795_10035443 Ga0099795_100354432 414
641 3300009551 Ga0105238_10008395 Ga0105238_100083958 414
642 3300010159 Ga0099796_10008899 Ga0099796_100088992 414
643 3300010375 Ga0105239_10023381 Ga0105239_100233813 414
644 3300013105 Ga0157369_10024800 Ga0157369_100248004 414
645 3300013105 Ga0157369_10028904 Ga0157369_100289048 414
646 3300013105 Ga0157369_10031823 Ga0157369_100318235 414
647 3300013297 Ga0157378_10038827 Ga0157378_100388272 414
648 3300013307 Ga0157372_10064246 Ga0157372_100642463 414
649 3300014326 Ga0157380_10063259 Ga0157380_100632593 414
650 3300025261 Ga0209233_1002715 Ga0209233_10027154 414
651 3300025297 Ga0209758_1009011 Ga0209758_10090115 414
652 3300025297 Ga0209758_1017848 Ga0209758_10178484 414
653 3300025321 Ga0207656_10004685 Ga0207656_100046853 414
654 3300025898 Ga0207692_10012479 Ga0207692_100124792 414
655 3300025898 Ga0207692_10019710 Ga0207692_100197103 414
656 3300025906 Ga0207699_10000480 Ga0207699_1000048010 414
657 3300025909 Ga0207705_10025816 Ga0207705_100258163 414
658 3300025912 Ga0207707_10004596 Ga0207707_1000459610 414
659 3300025912 Ga0207707_10007086 Ga0207707_100070868 414
660 3300025913 Ga0207695_10066385 Ga0207695_100663853 414
661 3300025913 Ga0207695_10243066 Ga0207695_102430661 414
662 3300025914 Ga0207671_10012315 Ga0207671_100123154 414
663 3300025914 Ga0207671_10231229 Ga0207671_102312292 414
664 3300025916 Ga0207663_10000356 Ga0207663_1000035616 414
665 3300025916 Ga0207663_10053410 Ga0207663_100534102 414
666 3300025917 Ga0207660_10002711 Ga0207660_100027117 414
667 3300025919 Ga0207657_10011430 Ga0207657_100114305 414
668 3300025921 Ga0207652_10004991 Ga0207652_100049915 414
669 3300025921 Ga0207652_10105103 Ga0207652_101051031 414
670 3300025921 Ga0207652_10151680 Ga0207652_101516802 414
671 3300025921 Ga0207652_10182397 Ga0207652_101823972 414
672 3300025924 Ga0207694_10007898 Ga0207694_100078988 414
673 3300025928 Ga0207700_10038888 Ga0207700_100388882 414
674 3300025928 Ga0207700_10183069 Ga0207700_101830692 414
675 3300025929 Ga0207664_10004313 Ga0207664_100043139 414
676 3300025939 Ga0207665_10164468 Ga0207665_101644681 414
677 3300025944 Ga0207661_10029561 Ga0207661_100295615 414
678 3300025944 Ga0207661_10070023 Ga0207661_100700232 414
679 3300025949 Ga0207667_10010722 Ga0207667_100107226 414
680 3300025949 Ga0207667_10030890 Ga0207667_100308905 414
681 3300026041 Ga0207639_10012139 Ga0207639_100121395 414
682 3300026078 Ga0207702_10000056 Ga0207702_100000563 414
683 3300026116 Ga0207674_10031657 Ga0207674_100316575 414
684 3300026121 Ga0207683_10063341 Ga0207683_100633412 414
685 3300026142 Ga0207698_10259015 Ga0207698_102590151 414
686 3300027357 Ga0209589_1000017 Ga0209589_1000017111 414
687 3300027361 Ga0209489_100018 Ga0209489_100018111 414
688 3300027363 Ga0209700_100028 Ga0209700_100028111 414
689 3300028380 Ga0268265_10047858 Ga0268265_100478582 414
690 3300028786 Ga0307517_10000766 Ga0307517_1000076623 414
691 3300031235 Ga0265330_10031484 Ga0265330_100314842 414
692 3300031241 Ga0265325_10003471 Ga0265325_100034714 414
693 3300031247 Ga0265340_10009442 Ga0265340_100094426 414
694 3300031249 Ga0265339_10005247 Ga0265339_100052478 414
695 3300031344 Ga0265316_10095944 Ga0265316_100959442 414
696 3300031595 Ga0265313_10088268 Ga0265313_100882681 414
697 3300031711 Ga0265314_10005659 Ga0265314_100056593 414
698 3300031712 Ga0265342_10054469 Ga0265342_100544692 414
699 3300031730 Ga0307516_10072365 Ga0307516_100723651 414
700 3300033180 Ga0307510_10057910 Ga0307510_100579103 414
701 3300033442 Ga0315911_1000033 Ga0315911_100003324 414
702 3300035083 Ga0373926_0022912 Ga0373926_0022912_69_1313 414
703 3300035089 Ga0373944_0032530 Ga0373944_0032530_111_1358 414
704 3300035111 Ga0373923_0009031 Ga0373923_0009031_2204_3448 414
705 3300035113 Ga0373936_0042319 Ga0373936_0042319_268_1512 414
706 3300035120 Ga0373957_0066047 Ga0373957_0066047_129_1376 414
707 3300035170 Ga0373943_0006477 Ga0373943_0006477_2294_3538 414
708 3300035171 Ga0373946_0003449 Ga0373946_0003449_32_1276 414
709 3300035410 Ga0373924_0014868 Ga0373924_0014868_1516_2760 414
710 3300035410 Ga0373924_0040505 Ga0373924_0040505_582_1826 414
711 3300035692 Ga0373935_0001604 Ga0373935_0001604_5486_6730 414
712 3300035692 Ga0373935_0041010 Ga0373935_0041010_1274_2518 414
713 3300035692 Ga0373935_0083390 Ga0373935_0083390_799_2043 414
714 3300035695 Ga0373927_0000071 Ga0373927_0000071_48880_50124 414
715 3300035695 Ga0373927_0054529 Ga0373927_0054529_582_1826 414
716 3300035724 Ga0373933_0000114 Ga0373933_0000114_25381_26631 414
717 3300035724 Ga0373933_0029787 Ga0373933_0029787_1612_2856 414
718 3300035725 Ga0373947_0010412 Ga0373947_0010412_1101_2345 414
719 3300035725 Ga0373947_0010721 Ga0373947_0010721_2320_3564 414
720 3300036401 Ga0373937_0075537 Ga0373937_0075537_981_2225 414
721 3300036459 Ga0372808_005196 Ga0372808_005196_312_1556 414
722 3300037068 Ga0373925_0009450 Ga0373925_0009450_1879_3123 414
723 3300037068 Ga0373925_0050474 Ga0373925_0050474_77_1321 414
724 3300037466 Ga0395898_0124991 Ga0395898_0124991_900_2165 414
725 3300039437 Ga0436365_0650112 Ga0436365_0650112_54663_55907 414
726 3300039437 Ga0436365_1054137 Ga0436365_1054137_3360_4607 414
727 3300039450 Ga0436363_0356954 Ga0436363_0356954_3894_5141 414
728 3300045976 Ga0466967_0058387 Ga0466967_0058387_669_1913 414
729 3300045976 Ga0466967_0430260 Ga0466967_0430260_26_1270 414
730 3300046454 Ga0495592_0015882 Ga0495592_0015882_710_1954 414
731 3300046455 Ga0495603_0000035 Ga0495603_0000035_45242_46486 414
732 3300046455 Ga0495603_0003901 Ga0495603_0003901_3450_4694 414
733 3300046459 Ga0495629_0000081 Ga0495629_0000081_34608_35852 414
734 3300046459 Ga0495629_0131200 Ga0495629_0131200_437_1681 414
735 3300046461 Ga0495641_0000707 Ga0495641_0000707_13481_14725 414
736 3300046462 Ga0495651_0022758 Ga0495651_0022758_2034_3284 414
737 3300046472 Ga0495580_0008037 Ga0495580_0008037_1845_3089 414
738 3300046473 Ga0495582_0029958 Ga0495582_0029958_193_1437 414
739 3300046475 Ga0495639_0000010 Ga0495639_0000010_41136_42380 414
740 3300046475 Ga0495639_0025094 Ga0495639_0025094_1240_2484 414
741 3300046476 Ga0495662_0000034 Ga0495662_0000034_21498_22742 414
742 3300046476 Ga0495662_0011744 Ga0495662_0011744_504_1748 414
743 3300046477 Ga0495664_0098622 Ga0495664_0098622_376_1620 414
744 3300046507 Ga0495606_0000265 Ga0495606_0000265_38860_40104 414
745 3300046514 Ga0495618_0032818 Ga0495618_0032818_100_1344 414
746 3300046516 Ga0495628_0070096 Ga0495628_0070096_153_1508 414
747 3300046517 Ga0495630_0010715 Ga0495630_0010715_431_1675 414
748 3300046517 Ga0495630_0024944 Ga0495630_0024944_2648_3892 414
749 3300046526 Ga0495666_0020735 Ga0495666_0020735_1167_2411 414
750 3300046526 Ga0495666_0067074 Ga0495666_0067074_92_1336 414
751 3300046529 Ga0495652_0020294 Ga0495652_0020294_111_1355 414
752 3300046529 Ga0495652_0080688 Ga0495652_0080688_349_1596 414
753 3300046531 Ga0495665_0000005 Ga0495665_0000005_28263_29507 414
754 3300046531 Ga0495665_0040768 Ga0495665_0040768_122_1366 414
755 3300046533 Ga0495640_0016321 Ga0495640_0016321_2282_3526 414
756 3300046535 Ga0495586_0050165 Ga0495586_0050165_1001_2245 414
757 3300046559 Ga0495667_0083861 Ga0495667_0083861_17_1264 414
758 3300046642 Ga0495634_0000261 Ga0495634_0000261_44618_45862 414
759 3300046663 Ga0495635_0000281 Ga0495635_0000281_13658_14902 414
760 3300046674 Ga0495588_0014606 Ga0495588_0014606_1628_2872 414
761 3300046678 Ga0495599_0067607 Ga0495599_0067607_433_1785 414
762 3300046680 Ga0495646_0010990 Ga0495646_0010990_2111_3355 414
763 3300046680 Ga0495646_0073094 Ga0495646_0073094_670_1914 414
764 3300046681 Ga0495647_0004374 Ga0495647_0004374_1357_2601 414
765 3300046683 Ga0495658_0000367 Ga0495658_0000367_22656_23900 414
766 3300046683 Ga0495658_0056832 Ga0495658_0056832_612_1862 414
767 3300046683 Ga0495658_0107073 Ga0495658_0107073_346_1590 414
768 3300046689 Ga0495613_0028734 Ga0495613_0028734_2457_3701 414
769 3300046690 Ga0495624_0000094 Ga0495624_0000094_5893_7137 414
770 3300046690 Ga0495624_0078047 Ga0495624_0078047_317_1561 414
771 3300047315 Ga0495581_0000018 Ga0495581_0000018_43520_44764 414
772 3300047319 Ga0495674_0000134 Ga0495674_0000134_29898_31142 414
773 3300047471 Ga0495684_0030899 Ga0495684_0030899_2568_3818 414
774 3300047471 Ga0495684_0051622 Ga0495684_0051622_1013_2257 414
775 3300047673 Ga0495593_0000084 Ga0495593_0000084_34736_35980 414
776 3300047673 Ga0495593_0051122 Ga0495593_0051122_118_1362 414
777 3300048089 Ga0495614_0035274 Ga0495614_0035274_18_1262 414
778 3300048904 Ga0496101_0030946 Ga0496101_0030946_388_1638 414
779 3300048909 Ga0496106_0144963 Ga0496106_0144963_458_1708 414
780 3300048913 Ga0496110_0191113 Ga0496110_0191113_321_1568 414
781 3300048915 Ga0496112_0000019 Ga0496112_0000019_108220_109467 414
782 3300048918 Ga0496115_0143804 Ga0496115_0143804_35_1390 414
783 3300048921 Ga0496118_0063626 Ga0496118_0063626_874_2118 414
784 3300048923 Ga0496120_0044907 Ga0496120_0044907_967_2211 414
785 3300048924 Ga0496121_0001737 Ga0496121_0001737_3898_5142 414
786 3300048924 Ga0496121_0004612 Ga0496121_0004612_10170_11414 414
787 3300048924 Ga0496121_0031957 Ga0496121_0031957_2025_3305 414
788 3300048924 Ga0496121_0108417 Ga0496121_0108417_465_1709 414
789 3300048925 Ga0496122_0018007 Ga0496122_0018007_115_1368 414
790 3300048929 Ga0496126_0011417 Ga0496126_0011417_1142_2395 414
791 3300048929 Ga0496126_0027182 Ga0496126_0027182_1386_2630 414
792 3300048929 Ga0496126_0065763 Ga0496126_0065763_711_1955 414
793 3300049581 Ga0501047_0150449 Ga0501047_0150449_938_2182 414
794 3300049583 Ga0501067_0066309 Ga0501067_0066309_316_1560 414
795 3300049583 Ga0501067_0068332 Ga0501067_0068332_215_1465 414
796 3300049742 Ga0501080_0049187 Ga0501080_0049187_51_1295 414
797 3300053080 Ga0500635_0000644 Ga0500635_0000644_4677_5921 414
798 3300053084 Ga0495595_0003526 Ga0495595_0003526_2809_4059 414
799 3300053085 Ga0495619_0178693 Ga0495619_0178693_192_1442 414
800 3300053094 Ga0500566_0002969 Ga0500566_0002969_1600_2850 414
801 3300053102 Ga0500554_000781 Ga0500554_000781_4622_5866 414
802 3300053118 Ga0500594_0004199 Ga0500594_0004199_216_1460 414
803 3300053119 Ga0500595_008925 Ga0500595_008925_2250_3494 414
804 3300053119 Ga0500595_013017 Ga0500595_013017_712_1962 414
805 3300053119 Ga0500595_025259 Ga0500595_025259_469_1713 414
806 3300053139 Ga0500568_0011131 Ga0500568_0011131_2037_3323 414
807 3300053150 Ga0500603_001634 Ga0500603_001634_2219_3463 414
808 3300053178 Ga0500637_0000155 Ga0500637_0000155_21034_22278 414
809 3300053178 Ga0500637_0002240 Ga0500637_0002240_330_1580 414
810 3300055283 Ga0500661_000408 Ga0500661_000408_1409_2659 414
811 iso_pu_bacteria 2513237137 2513862931 414
812 iso_pu_bacteria 2791355197 2793070968 414
813 iso_pu_bacteria 2922425934 2922433711 414
814 iso_pu_bacteria 2935630451 2935634757 414
815 iso_pu_bacteria 2941507105 2941511913 414
816 iso_pu_bacteria 2941515067 2941519615 414
817 iso_pu_bacteria 2941523033 2941527693 414

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.8314 21 387
6zgu-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution 0.8303 20 387
6n3i-assembly1.cif.gz_A crystal structure of a double trp xyle mutants (g58w/l315w) 0.8192 16 387
6rw3-assembly3.cif.gz_C the molecular basis for sugar import in malaria parasites. 0.8189 16 389
6zgu-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution 0.816 20 387
ID Description Score Start End Superfamily
af_Q4D047_16_187_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9259 223 387 1.20.1250.20
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9159 216 388 1.20.1250.20
af_Q2G1R0_3_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9119 212 388 1.20.1250.20
af_Q2FW85_14_250_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9079 218 389 1.20.1250.20
af_A0A1D8PTY2_75_285_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9075 218 389 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2H0ER64-F1-model_v4 MFS transporter 0.9652 55 395 GO:0016020
GO:0022857
AF-A0A0A1PSC9-F1-model_v4 Multidrug efflux system protein MdtL 0.96 19 394 GO:0016020
GO:0022857
AF-A0A351CXL4-F1-model_v4 MFS transporter 0.9589 16 395 GO:0016020
GO:0022857
AF-A0A1E4FX45-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9586 14 396 GO:0016020
GO:0022857
AF-A0A6L7ZVP9-F1-model_v4 MFS transporter 0.9507 16 401 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
79.04 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map