F482109
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 817 | 363 | 770 | 599 |
Family's Representative Sequence
| Representative Sequence | 3300048925|Ga0496122_0001187|Ga0496122_0001187_16293_18197 |
| Length | 634 |
| Sequence | MTITISRFALAAALAFGTAGGGIAHAEVAQASGAPTAAQAQAFVDAAEKESYDFSLDSSRVQWINATNITDDTDAVAAKFGAQYTEMSVRFAKEAAKYATVPGLSAELRRKLDMFRSGIVLPAPTTPGAAAELNQIATKLQSDYGKGMGKLDGKPINGSDIEAEMGALGHTPAQYQEMWTSWHDQVGKPMKADYARLVEIANQGAKELGFADTGAMWRSGYDMPPEQFAALTEKIWQEVKPLYDALHCYTRTKLNEKYGDAVQAKTGPIRADLLGNMWAQEWGNIYPLVAPKGAGDLGYDIGDLLVAKGFKQTTPAMFDTSDTPETQRRGYWEKQMFKIGEGFYSSLGFEPLPASFWERTQFIKPRDREVVCHASAWDLDNKNDIRVKMCTKVNSDDFITIHHELGHNYYQRAYQKQDPIYLNGANDGFHEAIGDFIALSITPQYLVDIKLLDPAKVPSADKDIGLLLRQAMDKVAFLPFGLLIDRWRWGVFDGSIKPADYNKAWTDMRLQYQGIVPPVDRPADAFDAGAKYHVPGNTPYTRYFLARVLQFQFYEAACKQAGWKGPLHRCSFYGNKDVGAKLNQMLEMGASKPWPDALQTFTGSREMSGKALIAYFAPLKKWLDQQNKGKACGW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 4 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 5 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 6 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 7 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 8 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 9 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 10 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 11 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 12 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 13 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 14 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 15 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 16 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 17 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 18 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 19 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 20 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 21 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 22 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 23 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 24 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 25 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 26 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 27 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 28 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 29 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 30 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 31 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 32 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 33 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 34 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 35 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 36 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 37 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 38 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 39 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 40 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 41 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 42 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 43 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 44 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 45 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 46 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 47 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 48 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 49 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 50 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 51 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 52 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 53 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 54 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 55 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 56 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 57 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 58 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 59 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 60 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 61 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 62 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 63 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 64 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 65 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 66 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 67 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 68 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 69 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 70 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 71 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 72 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 73 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 74 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 75 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 76 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 79 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 84 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 91 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 98 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 99 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 105 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 106 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 107 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 108 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 109 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 110 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 111 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 112 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 113 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 114 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 115 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 116 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 117 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 118 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 119 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 120 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 121 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 134 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 146 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 147 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 151 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 218 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 219 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 220 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 221 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 223 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 224 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 225 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 226 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 230 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 231 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 232 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 241 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 242 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 243 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 244 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 245 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 246 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 247 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 248 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 249 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 285 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 286 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 287 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 288 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 289 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 291 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 292 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 295 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 296 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 297 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 298 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 299 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 300 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 301 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 302 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 303 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 304 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 305 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 306 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 307 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 308 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 309 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 316 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 317 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 318 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 319 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 320 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 321 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 322 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 323 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 325 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 326 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 327 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 328 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 329 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 332 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 333 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 334 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 335 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 336 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 338 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 339 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 340 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 341 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 342 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 343 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 344 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 345 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 346 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 347 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 348 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 349 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 351 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 352 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 353 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 354 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 355 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 356 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 358 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 359 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 360 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 361 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 362 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.25 |
| Metatranscriptomes | 0 |
| Isolates | 5.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.37 |
| Bulb | 0 |
| Endosphere | 15.91 |
| Nodule | 0 |
| Rhizoplane | 3.06 |
| Rhizosphere | 71.85 |
| Stem | 0 |
| Stem Tuber | 0.12 |
| Unclassified | 8.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3540226 | 2162886007 | Bacteria | 4193 |
| 2 | SwRhRL2b_contig_3705000 | 2162886007 | Bacteria | 37959 |
| 3 | JGI24736J21556_1000121 | 3300001904 | Bacteria | 13331 |
| 4 | JGI24752J21851_1000155 | 3300001976 | Bacteria | 9311 |
| 5 | JGI24752J21851_1000461 | 3300001976 | Bacteria | 5495 |
| 6 | JGI24737J22298_10003404 | 3300001990 | Bacteria | 5622 |
| 7 | JGI24735J21928_10000918 | 3300002067 | Bacteria | 10528 |
| 8 | JGI24750J21931_1000359 | 3300002070 | Bacteria | 7796 |
| 9 | JGI24748J21848_1000044 | 3300002074 | Bacteria | 59119 |
| 10 | JGI24749J21850_1000330 | 3300002076 | Bacteria | 7176 |
| 11 | JGI24749J21850_1000531 | 3300002076 | Bacteria | 5590 |
| 12 | JGI24034J26672_10000020 | 3300002239 | Bacteria | 122643 |
| 13 | JGI24742J22300_10001043 | 3300002244 | Bacteria | 4265 |
| 14 | JGI24751J29686_10000052 | 3300002459 | Bacteria | 65492 |
| 15 | JGI25150J39212_1000046 | 3300002774 | Bacteria | 78180 |
| 16 | JGI25159J45721_1007784 | 3300002987 | Bacteria | 3024 |
| 17 | JGI25151J46595_10001638 | 3300003187 | Bacteria | 14729 |
| 18 | JGI25165J46597_1000073 | 3300003214 | Bacteria | 192140 |
| 19 | JGI25153J46596_10000006 | 3300003215 | Bacteria | 447760 |
| 20 | JGI25153J46596_10000124 | 3300003215 | Bacteria | 86430 |
| 21 | Ga0055525_1000090 | 3300003759 | Bacteria | 141071 |
| 22 | Ga0055542_1000046 | 3300003762 | Bacteria | 201922 |
| 23 | Ga0055529_1000007 | 3300003763 | Bacteria | 403604 |
| 24 | Ga0055529_1000109 | 3300003763 | Bacteria | 121019 |
| 25 | Ga0055526_1007061 | 3300003771 | Bacteria | 5938 |
| 26 | Ga0055524_1001907 | 3300003775 | Bacteria | 11300 |
| 27 | Ga0055536_1003381 | 3300003781 | Bacteria | 8607 |
| 28 | Ga0055536_1006713 | 3300003781 | Bacteria | 5289 |
| 29 | Ga0055536_1008867 | 3300003781 | Bacteria | 4251 |
| 30 | Ga0055530_10001655 | 3300003791 | Bacteria | 15864 |
| 31 | Ga0055530_10002492 | 3300003791 | Bacteria | 11790 |
| 32 | Ga0055530_10013862 | 3300003791 | Bacteria | 2724 |
| 33 | Ga0055540_1003937 | 3300003792 | Bacteria | 6941 |
| 34 | Ga0055531_10000008 | 3300003794 | Bacteria | 222269 |
| 35 | Ga0055531_10001714 | 3300003794 | Bacteria | 15705 |
| 36 | Ga0055531_10001722 | 3300003794 | Bacteria | 15672 |
| 37 | Ga0055531_10009693 | 3300003794 | Bacteria | 4895 |
| 38 | Ga0065165_1001443 | 3300005262 | Bacteria | 25758 |
| 39 | Ga0065165_1002698 | 3300005262 | Bacteria | 14260 |
| 40 | Ga0065704_10000191 | 3300005289 | Bacteria | 318191 |
| 41 | Ga0065704_10070744 | 3300005289 | Bacteria | 16791 |
| 42 | Ga0065704_10081289 | 3300005289 | Bacteria | 3786 |
| 43 | Ga0065704_10100052 | 3300005289 | Bacteria | 2288 |
| 44 | Ga0065715_10000978 | 3300005293 | Bacteria | 7475 |
| 45 | Ga0065707_10081865 | 3300005295 | Bacteria | 32547 |
| 46 | Ga0065707_10086251 | 3300005295 | Bacteria | 5572 |
| 47 | Ga0070658_10000227 | 3300005327 | Bacteria | 50101 |
| 48 | Ga0070658_10024952 | 3300005327 | Bacteria | 4793 |
| 49 | Ga0070676_10007834 | 3300005328 | Bacteria | 5743 |
| 50 | Ga0070690_100000180 | 3300005330 | Bacteria | 32463 |
| 51 | Ga0070670_100000024 | 3300005331 | Bacteria | 189811 |
| 52 | Ga0070670_100000792 | 3300005331 | Bacteria | 24611 |
| 53 | Ga0070670_100003165 | 3300005331 | Bacteria | 13607 |
| 54 | Ga0070670_100005522 | 3300005331 | Bacteria | 10672 |
| 55 | Ga0070670_100032156 | 3300005331 | Bacteria | 4519 |
| 56 | Ga0070670_100052533 | 3300005331 | Bacteria | 3499 |
| 57 | Ga0070670_100087376 | 3300005331 | Bacteria | 2679 |
| 58 | Ga0070677_10001757 | 3300005333 | Bacteria | 6845 |
| 59 | Ga0070666_10000027 | 3300005335 | Bacteria | 151010 |
| 60 | Ga0070666_10000352 | 3300005335 | Bacteria | 28924 |
| 61 | Ga0070666_10010284 | 3300005335 | Bacteria | 5848 |
| 62 | Ga0070666_10029018 | 3300005335 | Bacteria | 3635 |
| 63 | Ga0070660_100004165 | 3300005339 | Bacteria | 9989 |
| 64 | Ga0070689_100008132 | 3300005340 | Bacteria | 7372 |
| 65 | Ga0070661_100000010 | 3300005344 | Bacteria | 175777 |
| 66 | Ga0070661_100002364 | 3300005344 | Bacteria | 12951 |
| 67 | Ga0070661_100015823 | 3300005344 | Bacteria | 5325 |
| 68 | Ga0070661_100026844 | 3300005344 | Bacteria | 4144 |
| 69 | Ga0070668_100000027 | 3300005347 | Bacteria | 89913 |
| 70 | Ga0070668_100000068 | 3300005347 | Bacteria | 64209 |
| 71 | Ga0070668_100000646 | 3300005347 | Bacteria | 23522 |
| 72 | Ga0070668_100004087 | 3300005347 | Bacteria | 10803 |
| 73 | Ga0070668_100019269 | 3300005347 | Bacteria | 5135 |
| 74 | Ga0070668_100019894 | 3300005347 | Bacteria | 5058 |
| 75 | Ga0070668_100066155 | 3300005347 | Bacteria | 2804 |
| 76 | Ga0070669_100000018 | 3300005353 | Bacteria | 195789 |
| 77 | Ga0070669_100000047 | 3300005353 | Bacteria | 118892 |
| 78 | Ga0070669_100000099 | 3300005353 | Bacteria | 85328 |
| 79 | Ga0070669_100001232 | 3300005353 | Bacteria | 18563 |
| 80 | Ga0070669_100016595 | 3300005353 | Bacteria | 5257 |
| 81 | Ga0070669_100021839 | 3300005353 | Bacteria | 4577 |
| 82 | Ga0070675_100004161 | 3300005354 | Bacteria | 10987 |
| 83 | Ga0070675_100012526 | 3300005354 | Bacteria | 6648 |
| 84 | Ga0070675_100023281 | 3300005354 | Bacteria | 4951 |
| 85 | Ga0070671_100000011 | 3300005355 | Bacteria | 202057 |
| 86 | Ga0070671_100000353 | 3300005355 | Bacteria | 31530 |
| 87 | Ga0070671_100001241 | 3300005355 | Bacteria | 19109 |
| 88 | Ga0070671_100004632 | 3300005355 | Bacteria | 10905 |
| 89 | Ga0070671_100008988 | 3300005355 | Bacteria | 8018 |
| 90 | Ga0070673_100029291 | 3300005364 | Bacteria | 4105 |
| 91 | Ga0070673_100032493 | 3300005364 | Bacteria | 3930 |
| 92 | Ga0070688_100000293 | 3300005365 | Bacteria | 25617 |
| 93 | Ga0070659_100013031 | 3300005366 | Bacteria | 6182 |
| 94 | Ga0070667_100000017 | 3300005367 | Bacteria | 230531 |
| 95 | Ga0070667_100000066 | 3300005367 | Bacteria | 134529 |
| 96 | Ga0070667_100000067 | 3300005367 | Bacteria | 133023 |
| 97 | Ga0070667_100000290 | 3300005367 | Bacteria | 56841 |
| 98 | Ga0070667_100000459 | 3300005367 | Bacteria | 41954 |
| 99 | Ga0070667_100000480 | 3300005367 | Bacteria | 40910 |
| 100 | Ga0070667_100001292 | 3300005367 | Bacteria | 22636 |
| 101 | Ga0070667_100011712 | 3300005367 | Bacteria | 7247 |
| 102 | Ga0070667_100012620 | 3300005367 | Bacteria | 6988 |
| 103 | Ga0070667_100019588 | 3300005367 | Bacteria | 5613 |
| 104 | Ga0070678_100000076 | 3300005456 | Bacteria | 37213 |
| 105 | Ga0070662_100005311 | 3300005457 | Bacteria | 8227 |
| 106 | Ga0070662_100058572 | 3300005457 | Bacteria | 2804 |
| 107 | Ga0070681_10089493 | 3300005458 | Bacteria | 3030 |
| 108 | Ga0070685_10000238 | 3300005466 | Bacteria | 36209 |
| 109 | Ga0070679_100000168 | 3300005530 | Bacteria | 52996 |
| 110 | Ga0070679_100165301 | 3300005530 | Bacteria | 2186 |
| 111 | Ga0068853_100002669 | 3300005539 | Bacteria | 13447 |
| 112 | Ga0068853_100020182 | 3300005539 | Bacteria | 5539 |
| 113 | Ga0070672_100003237 | 3300005543 | Bacteria | 10542 |
| 114 | Ga0070686_100000010 | 3300005544 | Bacteria | 192116 |
| 115 | Ga0070695_100075744 | 3300005545 | Bacteria | 2215 |
| 116 | Ga0070665_100000086 | 3300005548 | Bacteria | 178229 |
| 117 | Ga0070665_100000254 | 3300005548 | Bacteria | 88587 |
| 118 | Ga0070665_100002933 | 3300005548 | Bacteria | 18422 |
| 119 | Ga0070665_100013328 | 3300005548 | Bacteria | 8274 |
| 120 | Ga0070665_100015010 | 3300005548 | Bacteria | 7774 |
| 121 | Ga0070664_100009278 | 3300005564 | Bacteria | 7986 |
| 122 | Ga0070664_100090692 | 3300005564 | Bacteria | 2645 |
| 123 | Ga0068854_100013256 | 3300005578 | Bacteria | 5404 |
| 124 | Ga0068852_100034615 | 3300005616 | Bacteria | 4205 |
| 125 | Ga0068852_100156023 | 3300005616 | Bacteria | 2126 |
| 126 | Ga0068859_100002363 | 3300005617 | Bacteria | 19203 |
| 127 | Ga0068859_100004889 | 3300005617 | Bacteria | 13646 |
| 128 | Ga0068859_100006146 | 3300005617 | Bacteria | 12204 |
| 129 | Ga0068859_100013485 | 3300005617 | Bacteria | 8195 |
| 130 | Ga0068859_100020790 | 3300005617 | Bacteria | 6588 |
| 131 | Ga0068859_100027164 | 3300005617 | Bacteria | 5743 |
| 132 | Ga0068859_100109660 | 3300005617 | Bacteria | 2821 |
| 133 | Ga0068859_100169626 | 3300005617 | Bacteria | 2263 |
| 134 | Ga0068864_100000036 | 3300005618 | Bacteria | 189811 |
| 135 | Ga0068864_100000063 | 3300005618 | Bacteria | 119845 |
| 136 | Ga0068864_100001646 | 3300005618 | Bacteria | 18401 |
| 137 | Ga0068864_100003044 | 3300005618 | Bacteria | 13839 |
| 138 | Ga0068861_100000005 | 3300005719 | Bacteria | 101677 |
| 139 | Ga0068861_100002905 | 3300005719 | Bacteria | 11293 |
| 140 | Ga0068861_100007125 | 3300005719 | Bacteria | 7655 |
| 141 | Ga0068861_100013995 | 3300005719 | Bacteria | 5624 |
| 142 | Ga0068863_100000001 | 3300005841 | Bacteria | 581116 |
| 143 | Ga0068863_100000038 | 3300005841 | Bacteria | 161477 |
| 144 | Ga0068863_100000062 | 3300005841 | Bacteria | 119845 |
| 145 | Ga0068863_100000603 | 3300005841 | Bacteria | 36544 |
| 146 | Ga0068863_100000775 | 3300005841 | Bacteria | 32088 |
| 147 | Ga0068863_100003283 | 3300005841 | Bacteria | 15970 |
| 148 | Ga0068863_100006015 | 3300005841 | Bacteria | 11900 |
| 149 | Ga0068863_100006939 | 3300005841 | Bacteria | 11104 |
| 150 | Ga0068863_100008950 | 3300005841 | Bacteria | 9776 |
| 151 | Ga0068863_100010531 | 3300005841 | Bacteria | 8979 |
| 152 | Ga0068863_100011823 | 3300005841 | Bacteria | 8440 |
| 153 | Ga0068858_100000103 | 3300005842 | Bacteria | 88754 |
| 154 | Ga0068858_100000530 | 3300005842 | Bacteria | 39968 |
| 155 | Ga0068858_100000777 | 3300005842 | Bacteria | 33348 |
| 156 | Ga0068858_100003512 | 3300005842 | Bacteria | 15537 |
| 157 | Ga0068860_100000013 | 3300005843 | Bacteria | 323055 |
| 158 | Ga0068860_100000056 | 3300005843 | Bacteria | 202751 |
| 159 | Ga0068860_100000080 | 3300005843 | Bacteria | 170152 |
| 160 | Ga0068860_100024655 | 3300005843 | Bacteria | 5808 |
| 161 | Ga0068862_100000033 | 3300005844 | Bacteria | 176515 |
| 162 | Ga0068862_100000069 | 3300005844 | Bacteria | 122535 |
| 163 | Ga0068862_100000115 | 3300005844 | Bacteria | 94951 |
| 164 | Ga0068862_100000485 | 3300005844 | Bacteria | 42458 |
| 165 | Ga0068862_100004188 | 3300005844 | Bacteria | 12217 |
| 166 | Ga0068862_100005376 | 3300005844 | Bacteria | 10718 |
| 167 | Ga0068862_100005633 | 3300005844 | Bacteria | 10458 |
| 168 | Ga0068862_100012106 | 3300005844 | Bacteria | 7128 |
| 169 | Ga0068862_100018068 | 3300005844 | Bacteria | 5873 |
| 170 | Ga0068862_100030185 | 3300005844 | Bacteria | 4568 |
| 171 | Ga0068862_100032674 | 3300005844 | Bacteria | 4397 |
| 172 | Ga0068862_100059599 | 3300005844 | Bacteria | 3278 |
| 173 | Ga0081455_10002228 | 3300005937 | Bacteria | 23082 |
| 174 | Ga0081539_10018190 | 3300005985 | Bacteria | 4891 |
| 175 | Ga0081539_10019805 | 3300005985 | Bacteria | 4584 |
| 176 | Ga0075368_10000704 | 3300006042 | Bacteria | 10189 |
| 177 | Ga0075367_10000042 | 3300006178 | Bacteria | 28460 |
| 178 | Ga0075366_10004887 | 3300006195 | Bacteria | 7230 |
| 179 | Ga0075366_10012022 | 3300006195 | Bacteria | 4903 |
| 180 | Ga0075370_10024116 | 3300006353 | Bacteria | 3357 |
| 181 | Ga0075430_100018966 | 3300006846 | Bacteria | 5853 |
| 182 | Ga0075431_100007563 | 3300006847 | Bacteria | 10816 |
| 183 | Ga0097620_100002363 | 3300006931 | Bacteria | 19203 |
| 184 | Ga0097620_100004889 | 3300006931 | Bacteria | 13646 |
| 185 | Ga0097620_100006146 | 3300006931 | Bacteria | 12204 |
| 186 | Ga0097620_100013486 | 3300006931 | Bacteria | 8195 |
| 187 | Ga0097620_100020789 | 3300006931 | Bacteria | 6588 |
| 188 | Ga0097620_100027165 | 3300006931 | Bacteria | 5743 |
| 189 | Ga0097620_100109659 | 3300006931 | Bacteria | 2821 |
| 190 | Ga0097620_100169630 | 3300006931 | Bacteria | 2263 |
| 191 | Ga0105251_10001006 | 3300009011 | Bacteria | 24692 |
| 192 | Ga0111539_10000017 | 3300009094 | Bacteria | 275456 |
| 193 | Ga0111539_10029495 | 3300009094 | Bacteria | 6681 |
| 194 | Ga0105245_10002260 | 3300009098 | Bacteria | 17440 |
| 195 | Ga0105247_10004862 | 3300009101 | Bacteria | 8547 |
| 196 | Ga0105247_10016928 | 3300009101 | Bacteria | 4372 |
| 197 | Ga0105243_10000224 | 3300009148 | Bacteria | 65196 |
| 198 | Ga0105241_10097937 | 3300009174 | Bacteria | 2326 |
| 199 | Ga0105248_10000091 | 3300009177 | Bacteria | 101191 |
| 200 | Ga0105248_10000536 | 3300009177 | Bacteria | 43208 |
| 201 | Ga0105248_10003098 | 3300009177 | Bacteria | 18437 |
| 202 | Ga0105248_10008150 | 3300009177 | Bacteria | 11507 |
| 203 | Ga0105248_10009842 | 3300009177 | Bacteria | 10530 |
| 204 | Ga0105248_10025435 | 3300009177 | Bacteria | 6582 |
| 205 | Ga0105248_10036917 | 3300009177 | Bacteria | 5465 |
| 206 | Ga0105237_10050794 | 3300009545 | Bacteria | 4166 |
| 207 | Ga0105238_10047095 | 3300009551 | Bacteria | 4349 |
| 208 | Ga0105238_10062799 | 3300009551 | Bacteria | 3715 |
| 209 | Ga0105249_10000064 | 3300009553 | Bacteria | 151646 |
| 210 | Ga0105249_10000160 | 3300009553 | Bacteria | 81883 |
| 211 | Ga0105249_10000567 | 3300009553 | Bacteria | 33975 |
| 212 | Ga0105249_10017175 | 3300009553 | Bacteria | 6423 |
| 213 | Ga0105249_10025445 | 3300009553 | Bacteria | 5328 |
| 214 | Ga0105249_10040062 | 3300009553 | Bacteria | 4255 |
| 215 | Ga0105249_10064607 | 3300009553 | Bacteria | 3365 |
| 216 | Ga0105239_10113654 | 3300010375 | Bacteria | 3002 |
| 217 | Ga0157326_1000059 | 3300012513 | Bacteria | 10517 |
| 218 | Ga0157373_10009216 | 3300013100 | Bacteria | 7299 |
| 219 | Ga0157371_10000097 | 3300013102 | Bacteria | 134150 |
| 220 | Ga0157369_10025937 | 3300013105 | Bacteria | 6504 |
| 221 | Ga0157378_10003298 | 3300013297 | Bacteria | 14370 |
| 222 | Ga0157378_10094681 | 3300013297 | Bacteria | 2720 |
| 223 | Ga0163162_10035914 | 3300013306 | Bacteria | 4937 |
| 224 | Ga0163162_10048106 | 3300013306 | Bacteria | 4273 |
| 225 | Ga0163162_10085262 | 3300013306 | Bacteria | 3235 |
| 226 | Ga0157372_10214297 | 3300013307 | Bacteria | 2232 |
| 227 | Ga0163163_10000107 | 3300014325 | Bacteria | 87926 |
| 228 | Ga0157380_10000086 | 3300014326 | Bacteria | 51604 |
| 229 | Ga0157380_10000217 | 3300014326 | Bacteria | 34251 |
| 230 | Ga0157380_10003002 | 3300014326 | Bacteria | 11489 |
| 231 | Ga0157380_10003455 | 3300014326 | Bacteria | 10849 |
| 232 | Ga0157380_10013463 | 3300014326 | Bacteria | 5963 |
| 233 | Ga0157380_10051349 | 3300014326 | Bacteria | 3261 |
| 234 | Ga0157379_10009125 | 3300014968 | Bacteria | 8637 |
| 235 | Ga0157379_10065983 | 3300014968 | Bacteria | 3235 |
| 236 | Ga0183363_1001 | 3300015690 | Bacteria | 611534 |
| 237 | Ga0163161_10000110 | 3300017792 | Bacteria | 78102 |
| 238 | Ga0163161_10103664 | 3300017792 | Bacteria | 2120 |
| 239 | Ga0213873_10000015 | 3300021358 | Bacteria | 131343 |
| 240 | Ga0213876_10000005 | 3300021384 | Bacteria | 727326 |
| 241 | Ga0209147_100321 | 3300025229 | Bacteria | 36587 |
| 242 | Ga0209563_100111 | 3300025230 | Bacteria | 141123 |
| 243 | Ga0207425_1000020 | 3300025245 | Bacteria | 372623 |
| 244 | Ga0209646_1004636 | 3300025246 | Bacteria | 2482 |
| 245 | Ga0209148_1000026 | 3300025254 | Bacteria | 629213 |
| 246 | Ga0209129_1000586 | 3300025258 | Bacteria | 25017 |
| 247 | Ga0209233_1000142 | 3300025261 | Bacteria | 192193 |
| 248 | Ga0209565_1000008 | 3300025263 | Bacteria | 774179 |
| 249 | Ga0209565_1000210 | 3300025263 | Bacteria | 67800 |
| 250 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 251 | Ga0209673_1000984 | 3300025273 | Bacteria | 34864 |
| 252 | Ga0209130_1000512 | 3300025284 | Bacteria | 39134 |
| 253 | Ga0209675_1000838 | 3300025291 | Bacteria | 20134 |
| 254 | Ga0209676_1000518 | 3300025292 | Bacteria | 60512 |
| 255 | Ga0209676_1000554 | 3300025292 | Bacteria | 56925 |
| 256 | Ga0209676_1000929 | 3300025292 | Bacteria | 36184 |
| 257 | Ga0209676_1008339 | 3300025292 | Bacteria | 4637 |
| 258 | Ga0209025_1000114 | 3300025294 | Bacteria | 218921 |
| 259 | Ga0209025_1000326 | 3300025294 | Bacteria | 106087 |
| 260 | Ga0209564_1001114 | 3300025295 | Bacteria | 31654 |
| 261 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 262 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 263 | Ga0209758_1001428 | 3300025297 | Bacteria | 28251 |
| 264 | Ga0209758_1017781 | 3300025297 | Bacteria | 3517 |
| 265 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 266 | Ga0209050_1000017 | 3300025298 | Bacteria | 728928 |
| 267 | Ga0209050_1000026 | 3300025298 | Bacteria | 499134 |
| 268 | Ga0209050_1002610 | 3300025298 | Bacteria | 14895 |
| 269 | Ga0209050_1008085 | 3300025298 | Bacteria | 5710 |
| 270 | Ga0209050_1014081 | 3300025298 | Bacteria | 3480 |
| 271 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 272 | Ga0209256_1000010 | 3300025299 | Bacteria | 912110 |
| 273 | Ga0207426_1000181 | 3300025302 | Bacteria | 158308 |
| 274 | Ga0209051_1000476 | 3300025303 | Bacteria | 51944 |
| 275 | Ga0209257_1000009 | 3300025304 | Bacteria | 1205047 |
| 276 | Ga0209257_1001405 | 3300025304 | Bacteria | 28723 |
| 277 | Ga0209257_1002894 | 3300025304 | Bacteria | 15934 |
| 278 | Ga0209257_1003790 | 3300025304 | Bacteria | 12457 |
| 279 | Ga0209257_1005509 | 3300025304 | Bacteria | 8841 |
| 280 | Ga0207697_10000211 | 3300025315 | Bacteria | 31108 |
| 281 | Ga0207697_10003297 | 3300025315 | Bacteria | 8029 |
| 282 | Ga0207713_1001151 | 3300025735 | Bacteria | 22391 |
| 283 | Ga0207713_1002611 | 3300025735 | Bacteria | 12984 |
| 284 | Ga0207682_10002080 | 3300025893 | Bacteria | 9063 |
| 285 | Ga0207710_10002208 | 3300025900 | Bacteria | 9150 |
| 286 | Ga0207710_10008695 | 3300025900 | Bacteria | 4281 |
| 287 | Ga0207710_10034094 | 3300025900 | Bacteria | 2235 |
| 288 | Ga0207680_10000009 | 3300025903 | Bacteria | 464571 |
| 289 | Ga0207680_10023993 | 3300025903 | Bacteria | 3340 |
| 290 | Ga0207680_10049495 | 3300025903 | Bacteria | 2501 |
| 291 | Ga0207647_10031699 | 3300025904 | Bacteria | 3399 |
| 292 | Ga0207645_10004405 | 3300025907 | Bacteria | 10428 |
| 293 | Ga0207645_10012931 | 3300025907 | Bacteria | 5647 |
| 294 | Ga0207705_10000450 | 3300025909 | Bacteria | 35404 |
| 295 | Ga0207705_10051400 | 3300025909 | Bacteria | 2966 |
| 296 | Ga0207654_10004079 | 3300025911 | Bacteria | 7359 |
| 297 | Ga0207707_10075179 | 3300025912 | Bacteria | 2947 |
| 298 | Ga0207707_10090256 | 3300025912 | Bacteria | 2678 |
| 299 | Ga0207671_10006655 | 3300025914 | Bacteria | 10244 |
| 300 | Ga0207671_10014738 | 3300025914 | Bacteria | 6164 |
| 301 | Ga0207657_10009966 | 3300025919 | Bacteria | 9511 |
| 302 | Ga0207657_10011805 | 3300025919 | Bacteria | 8648 |
| 303 | Ga0207657_10022107 | 3300025919 | Bacteria | 5969 |
| 304 | Ga0207649_10000178 | 3300025920 | Bacteria | 52146 |
| 305 | Ga0207649_10002255 | 3300025920 | Bacteria | 10883 |
| 306 | Ga0207652_10000282 | 3300025921 | Bacteria | 52954 |
| 307 | Ga0207681_10000008 | 3300025923 | Bacteria | 414329 |
| 308 | Ga0207681_10000014 | 3300025923 | Bacteria | 353422 |
| 309 | Ga0207681_10000106 | 3300025923 | Bacteria | 71721 |
| 310 | Ga0207681_10000259 | 3300025923 | Bacteria | 40452 |
| 311 | Ga0207681_10027414 | 3300025923 | Bacteria | 3683 |
| 312 | Ga0207681_10053593 | 3300025923 | Bacteria | 2739 |
| 313 | Ga0207694_10020172 | 3300025924 | Bacteria | 5041 |
| 314 | Ga0207694_10023064 | 3300025924 | Bacteria | 4724 |
| 315 | Ga0207694_10025520 | 3300025924 | Bacteria | 4492 |
| 316 | Ga0207650_10000015 | 3300025925 | Bacteria | 369173 |
| 317 | Ga0207650_10015218 | 3300025925 | Bacteria | 5354 |
| 318 | Ga0207650_10018925 | 3300025925 | Bacteria | 4839 |
| 319 | Ga0207650_10020051 | 3300025925 | Bacteria | 4709 |
| 320 | Ga0207650_10032859 | 3300025925 | Bacteria | 3755 |
| 321 | Ga0207650_10035934 | 3300025925 | Bacteria | 3601 |
| 322 | Ga0207659_10045306 | 3300025926 | Bacteria | 3100 |
| 323 | Ga0207659_10054702 | 3300025926 | Bacteria | 2851 |
| 324 | Ga0207644_10000006 | 3300025931 | Bacteria | 408793 |
| 325 | Ga0207644_10000544 | 3300025931 | Bacteria | 24497 |
| 326 | Ga0207644_10000574 | 3300025931 | Bacteria | 23595 |
| 327 | Ga0207644_10003236 | 3300025931 | Bacteria | 10496 |
| 328 | Ga0207644_10003746 | 3300025931 | Bacteria | 9848 |
| 329 | Ga0207644_10008789 | 3300025931 | Bacteria | 6613 |
| 330 | Ga0207644_10033072 | 3300025931 | Bacteria | 3611 |
| 331 | Ga0207690_10004587 | 3300025932 | Bacteria | 8166 |
| 332 | Ga0207706_10004467 | 3300025933 | Bacteria | 13136 |
| 333 | Ga0207706_10006993 | 3300025933 | Bacteria | 10426 |
| 334 | Ga0207706_10014593 | 3300025933 | Bacteria | 7116 |
| 335 | Ga0207706_10031363 | 3300025933 | Bacteria | 4735 |
| 336 | Ga0207706_10092745 | 3300025933 | Bacteria | 2655 |
| 337 | Ga0207706_10120023 | 3300025933 | Bacteria | 2311 |
| 338 | Ga0207709_10000519 | 3300025935 | Bacteria | 33581 |
| 339 | Ga0207709_10011498 | 3300025935 | Bacteria | 4884 |
| 340 | Ga0207670_10010660 | 3300025936 | Bacteria | 5303 |
| 341 | Ga0207669_10000161 | 3300025937 | Bacteria | 32114 |
| 342 | Ga0207669_10006712 | 3300025937 | Bacteria | 5278 |
| 343 | Ga0207669_10083879 | 3300025937 | Bacteria | 2051 |
| 344 | Ga0207691_10004823 | 3300025940 | Bacteria | 13043 |
| 345 | Ga0207691_10005772 | 3300025940 | Bacteria | 11974 |
| 346 | Ga0207711_10000017 | 3300025941 | Bacteria | 441730 |
| 347 | Ga0207711_10000252 | 3300025941 | Bacteria | 57840 |
| 348 | Ga0207711_10003251 | 3300025941 | Bacteria | 14161 |
| 349 | Ga0207711_10003634 | 3300025941 | Bacteria | 13336 |
| 350 | Ga0207711_10018314 | 3300025941 | Bacteria | 5820 |
| 351 | Ga0207711_10023381 | 3300025941 | Bacteria | 5174 |
| 352 | Ga0207711_10041275 | 3300025941 | Bacteria | 3929 |
| 353 | Ga0207711_10074113 | 3300025941 | Bacteria | 2960 |
| 354 | Ga0207711_10075264 | 3300025941 | Bacteria | 2938 |
| 355 | Ga0207689_10093863 | 3300025942 | Bacteria | 2465 |
| 356 | Ga0207661_10114574 | 3300025944 | Bacteria | 2286 |
| 357 | Ga0207679_10004610 | 3300025945 | Bacteria | 8581 |
| 358 | Ga0207667_10000010 | 3300025949 | Bacteria | 477432 |
| 359 | Ga0207667_10014565 | 3300025949 | Bacteria | 8957 |
| 360 | Ga0207667_10105697 | 3300025949 | Bacteria | 2904 |
| 361 | Ga0207712_10000008 | 3300025961 | Bacteria | 527957 |
| 362 | Ga0207712_10000044 | 3300025961 | Bacteria | 171240 |
| 363 | Ga0207712_10000222 | 3300025961 | Bacteria | 56073 |
| 364 | Ga0207712_10006379 | 3300025961 | Bacteria | 7441 |
| 365 | Ga0207712_10009432 | 3300025961 | Bacteria | 6175 |
| 366 | Ga0207712_10015834 | 3300025961 | Bacteria | 4872 |
| 367 | Ga0207712_10038733 | 3300025961 | Bacteria | 3261 |
| 368 | Ga0207668_10000012 | 3300025972 | Bacteria | 182541 |
| 369 | Ga0207668_10000629 | 3300025972 | Bacteria | 21816 |
| 370 | Ga0207668_10000860 | 3300025972 | Bacteria | 18295 |
| 371 | Ga0207668_10001683 | 3300025972 | Bacteria | 12933 |
| 372 | Ga0207668_10002528 | 3300025972 | Bacteria | 10677 |
| 373 | Ga0207668_10003159 | 3300025972 | Bacteria | 9645 |
| 374 | Ga0207668_10009770 | 3300025972 | Bacteria | 5763 |
| 375 | Ga0207668_10041715 | 3300025972 | Bacteria | 3104 |
| 376 | Ga0207668_10052374 | 3300025972 | Bacteria | 2823 |
| 377 | Ga0207668_10055215 | 3300025972 | Bacteria | 2760 |
| 378 | Ga0207668_10068228 | 3300025972 | Bacteria | 2527 |
| 379 | Ga0207668_10074452 | 3300025972 | Bacteria | 2438 |
| 380 | Ga0207668_10085580 | 3300025972 | Bacteria | 2301 |
| 381 | Ga0207640_10009509 | 3300025981 | Bacteria | 5445 |
| 382 | Ga0207640_10009819 | 3300025981 | Bacteria | 5369 |
| 383 | Ga0207658_10000011 | 3300025986 | Bacteria | 239620 |
| 384 | Ga0207658_10000089 | 3300025986 | Bacteria | 100308 |
| 385 | Ga0207658_10000132 | 3300025986 | Bacteria | 80078 |
| 386 | Ga0207658_10000133 | 3300025986 | Bacteria | 78402 |
| 387 | Ga0207658_10000291 | 3300025986 | Bacteria | 52585 |
| 388 | Ga0207658_10002473 | 3300025986 | Bacteria | 13492 |
| 389 | Ga0207658_10002564 | 3300025986 | Bacteria | 13198 |
| 390 | Ga0207658_10009504 | 3300025986 | Bacteria | 6600 |
| 391 | Ga0207658_10012206 | 3300025986 | Bacteria | 5863 |
| 392 | Ga0207658_10025815 | 3300025986 | Bacteria | 4114 |
| 393 | Ga0207658_10026771 | 3300025986 | Bacteria | 4046 |
| 394 | Ga0207658_10033271 | 3300025986 | Bacteria | 3676 |
| 395 | Ga0207703_10000691 | 3300026035 | Bacteria | 33391 |
| 396 | Ga0207703_10001013 | 3300026035 | Bacteria | 27010 |
| 397 | Ga0207703_10003167 | 3300026035 | Bacteria | 13874 |
| 398 | Ga0207639_10026227 | 3300026041 | Bacteria | 4234 |
| 399 | Ga0207639_10026739 | 3300026041 | Bacteria | 4194 |
| 400 | Ga0207678_10020460 | 3300026067 | Bacteria | 5803 |
| 401 | Ga0207702_10007378 | 3300026078 | Bacteria | 9388 |
| 402 | Ga0207702_10032064 | 3300026078 | Bacteria | 4383 |
| 403 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 404 | Ga0207641_10000022 | 3300026088 | Bacteria | 279334 |
| 405 | Ga0207641_10000047 | 3300026088 | Bacteria | 179977 |
| 406 | Ga0207641_10000060 | 3300026088 | Bacteria | 161514 |
| 407 | Ga0207641_10001074 | 3300026088 | Bacteria | 27484 |
| 408 | Ga0207641_10002092 | 3300026088 | Bacteria | 18889 |
| 409 | Ga0207641_10004584 | 3300026088 | Bacteria | 11938 |
| 410 | Ga0207641_10006843 | 3300026088 | Bacteria | 9546 |
| 411 | Ga0207641_10016494 | 3300026088 | Bacteria | 6049 |
| 412 | Ga0207641_10018011 | 3300026088 | Bacteria | 5788 |
| 413 | Ga0207676_10000021 | 3300026095 | Bacteria | 296572 |
| 414 | Ga0207676_10000056 | 3300026095 | Bacteria | 124484 |
| 415 | Ga0207676_10000827 | 3300026095 | Bacteria | 24173 |
| 416 | Ga0207676_10000894 | 3300026095 | Bacteria | 23124 |
| 417 | Ga0207676_10001517 | 3300026095 | Bacteria | 17145 |
| 418 | Ga0207676_10002294 | 3300026095 | Bacteria | 13722 |
| 419 | Ga0207674_10007137 | 3300026116 | Bacteria | 13050 |
| 420 | Ga0207674_10069644 | 3300026116 | Bacteria | 3538 |
| 421 | Ga0207674_10084252 | 3300026116 | Bacteria | 3177 |
| 422 | Ga0207675_100000020 | 3300026118 | Bacteria | 117374 |
| 423 | Ga0207675_100000207 | 3300026118 | Bacteria | 54791 |
| 424 | Ga0207675_100002282 | 3300026118 | Bacteria | 19053 |
| 425 | Ga0207675_100004785 | 3300026118 | Bacteria | 13038 |
| 426 | Ga0207675_100084771 | 3300026118 | Bacteria | 2973 |
| 427 | Ga0207675_100150282 | 3300026118 | Bacteria | 2216 |
| 428 | Ga0207683_10000655 | 3300026121 | Bacteria | 31727 |
| 429 | Ga0207683_10033010 | 3300026121 | Bacteria | 4496 |
| 430 | Ga0207698_10051391 | 3300026142 | Bacteria | 3151 |
| 431 | Ga0209813_10000042 | 3300027866 | Bacteria | 53213 |
| 432 | Ga0209813_10000126 | 3300027866 | Bacteria | 27944 |
| 433 | Ga0209974_10003218 | 3300027876 | Bacteria | 5903 |
| 434 | Ga0209974_10003430 | 3300027876 | Bacteria | 5723 |
| 435 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 436 | Ga0268266_10000069 | 3300028379 | Bacteria | 239714 |
| 437 | Ga0268266_10004036 | 3300028379 | Bacteria | 14190 |
| 438 | Ga0268266_10011818 | 3300028379 | Bacteria | 7568 |
| 439 | Ga0268266_10016904 | 3300028379 | Bacteria | 6233 |
| 440 | Ga0268265_10000013 | 3300028380 | Bacteria | 341536 |
| 441 | Ga0268265_10000044 | 3300028380 | Bacteria | 182545 |
| 442 | Ga0268265_10000082 | 3300028380 | Bacteria | 120835 |
| 443 | Ga0268265_10000100 | 3300028380 | Bacteria | 108659 |
| 444 | Ga0268265_10000958 | 3300028380 | Bacteria | 26520 |
| 445 | Ga0268265_10006174 | 3300028380 | Bacteria | 8115 |
| 446 | Ga0268265_10006969 | 3300028380 | Bacteria | 7645 |
| 447 | Ga0268264_10000010 | 3300028381 | Bacteria | 596543 |
| 448 | Ga0268264_10000039 | 3300028381 | Bacteria | 376641 |
| 449 | Ga0268264_10000089 | 3300028381 | Bacteria | 234760 |
| 450 | Ga0268264_10000131 | 3300028381 | Bacteria | 181459 |
| 451 | Ga0268264_10000933 | 3300028381 | Bacteria | 30321 |
| 452 | Ga0268264_10000935 | 3300028381 | Bacteria | 30301 |
| 453 | Ga0268264_10021281 | 3300028381 | Bacteria | 5297 |
| 454 | Ga0268264_10053953 | 3300028381 | Bacteria | 3355 |
| 455 | Ga0307513_10075874 | 3300031456 | Bacteria | 3489 |
| 456 | Ga0307509_10000115 | 3300031507 | Bacteria | 116444 |
| 457 | Ga0307408_100015727 | 3300031548 | Bacteria | 5041 |
| 458 | Ga0307408_100017748 | 3300031548 | Bacteria | 4768 |
| 459 | Ga0307408_100019173 | 3300031548 | Bacteria | 4603 |
| 460 | Ga0307408_100087906 | 3300031548 | Bacteria | 2340 |
| 461 | Ga0307508_10025163 | 3300031616 | Bacteria | 5398 |
| 462 | Ga0307405_10000391 | 3300031731 | Bacteria | 16410 |
| 463 | Ga0307405_10010450 | 3300031731 | Bacteria | 4811 |
| 464 | Ga0307405_10041028 | 3300031731 | Bacteria | 2807 |
| 465 | Ga0307405_10054567 | 3300031731 | Bacteria | 2495 |
| 466 | Ga0307413_10001504 | 3300031824 | Bacteria | 8914 |
| 467 | Ga0307413_10007329 | 3300031824 | Bacteria | 5114 |
| 468 | Ga0307413_10007679 | 3300031824 | Bacteria | 5031 |
| 469 | Ga0307413_10012702 | 3300031824 | Bacteria | 4201 |
| 470 | Ga0307413_10028311 | 3300031824 | Bacteria | 3118 |
| 471 | Ga0307413_10029103 | 3300031824 | Bacteria | 3086 |
| 472 | Ga0307413_10051241 | 3300031824 | Bacteria | 2486 |
| 473 | Ga0307410_10000684 | 3300031852 | Bacteria | 14130 |
| 474 | Ga0307410_10002446 | 3300031852 | Bacteria | 8971 |
| 475 | Ga0307410_10003698 | 3300031852 | Bacteria | 7736 |
| 476 | Ga0307410_10004043 | 3300031852 | Bacteria | 7498 |
| 477 | Ga0307410_10014143 | 3300031852 | Bacteria | 4683 |
| 478 | Ga0307410_10019814 | 3300031852 | Bacteria | 4100 |
| 479 | Ga0307410_10021645 | 3300031852 | Bacteria | 3958 |
| 480 | Ga0307410_10033329 | 3300031852 | Bacteria | 3324 |
| 481 | Ga0307410_10037184 | 3300031852 | Bacteria | 3177 |
| 482 | Ga0307410_10074721 | 3300031852 | Bacteria | 2361 |
| 483 | Ga0307406_10019894 | 3300031901 | Bacteria | 3945 |
| 484 | Ga0307406_10021789 | 3300031901 | Bacteria | 3795 |
| 485 | Ga0307406_10036423 | 3300031901 | Bacteria | 3031 |
| 486 | Ga0307407_10004107 | 3300031903 | Bacteria | 6125 |
| 487 | Ga0307407_10019115 | 3300031903 | Bacteria | 3482 |
| 488 | Ga0307407_10040428 | 3300031903 | Bacteria | 2600 |
| 489 | Ga0307407_10051333 | 3300031903 | Bacteria | 2363 |
| 490 | Ga0307412_10007668 | 3300031911 | Bacteria | 6130 |
| 491 | Ga0307412_10008746 | 3300031911 | Bacteria | 5794 |
| 492 | Ga0307412_10010587 | 3300031911 | Bacteria | 5314 |
| 493 | Ga0307412_10045050 | 3300031911 | Bacteria | 2881 |
| 494 | Ga0307412_10078260 | 3300031911 | Bacteria | 2277 |
| 495 | Ga0307412_10090273 | 3300031911 | Bacteria | 2141 |
| 496 | Ga0307409_100023016 | 3300031995 | Bacteria | 4307 |
| 497 | Ga0307409_100036824 | 3300031995 | Bacteria | 3600 |
| 498 | Ga0307409_100064704 | 3300031995 | Bacteria | 2874 |
| 499 | Ga0307416_100037671 | 3300032002 | Bacteria | 3723 |
| 500 | Ga0307416_100043746 | 3300032002 | Bacteria | 3510 |
| 501 | Ga0307416_100080138 | 3300032002 | Bacteria | 2754 |
| 502 | Ga0307416_100103237 | 3300032002 | Bacteria | 2488 |
| 503 | Ga0307416_100139612 | 3300032002 | Bacteria | 2200 |
| 504 | Ga0307414_10000346 | 3300032004 | Bacteria | 26022 |
| 505 | Ga0307414_10002088 | 3300032004 | Bacteria | 10396 |
| 506 | Ga0307414_10002337 | 3300032004 | Bacteria | 9908 |
| 507 | Ga0307414_10009428 | 3300032004 | Bacteria | 5608 |
| 508 | Ga0307414_10014644 | 3300032004 | Bacteria | 4710 |
| 509 | Ga0307414_10016059 | 3300032004 | Bacteria | 4539 |
| 510 | Ga0307414_10019577 | 3300032004 | Bacteria | 4197 |
| 511 | Ga0307414_10022219 | 3300032004 | Bacteria | 3997 |
| 512 | Ga0307414_10028125 | 3300032004 | Bacteria | 3642 |
| 513 | Ga0307414_10046312 | 3300032004 | Bacteria | 2984 |
| 514 | Ga0307414_10050216 | 3300032004 | Bacteria | 2888 |
| 515 | Ga0307414_10114411 | 3300032004 | Bacteria | 2061 |
| 516 | Ga0307411_10004783 | 3300032005 | Bacteria | 6558 |
| 517 | Ga0307411_10005751 | 3300032005 | Bacteria | 6131 |
| 518 | Ga0307411_10024249 | 3300032005 | Bacteria | 3612 |
| 519 | Ga0307411_10034144 | 3300032005 | Bacteria | 3162 |
| 520 | Ga0307411_10062055 | 3300032005 | Bacteria | 2491 |
| 521 | Ga0307411_10104906 | 3300032005 | Bacteria | 2008 |
| 522 | Ga0307415_100009023 | 3300032126 | Bacteria | 5563 |
| 523 | Ga0307415_100012323 | 3300032126 | Bacteria | 4939 |
| 524 | Ga0307415_100035245 | 3300032126 | Bacteria | 3267 |
| 525 | Ga0307415_100055878 | 3300032126 | Bacteria | 2703 |
| 526 | Ga0307510_10016486 | 3300033180 | Bacteria | 8721 |
| 527 | Ga0307510_10092283 | 3300033180 | Bacteria | 2865 |
| 528 | Ga0373943_0033198 | 3300035170 | Bacteria | 2457 |
| 529 | Ga0373946_0020771 | 3300035171 | Bacteria | 2541 |
| 530 | Ga0373935_0028704 | 3300035692 | Bacteria | 3439 |
| 531 | Ga0395900_0000503 | 3300037418 | Bacteria | 54976 |
| 532 | Ga0395905_0007001 | 3300037471 | Bacteria | 11273 |
| 533 | Ga0395905_0094244 | 3300037471 | Bacteria | 2809 |
| 534 | Ga0395901_0000520 | 3300038443 | Bacteria | 44464 |
| 535 | Ga0395901_0023161 | 3300038443 | Bacteria | 6367 |
| 536 | Ga0436365_1132330 | 3300039437 | Bacteria | 76795 |
| 537 | Ga0436365_1277439 | 3300039437 | Bacteria | 2584 |
| 538 | Ga0436365_1921522 | 3300039437 | Bacteria | 4700 |
| 539 | Ga0436362_0875621 | 3300039453 | Bacteria | 35060 |
| 540 | Ga0439461_0000190 | 3300041410 | Bacteria | 8487 |
| 541 | Ga0439465_0000420 | 3300041413 | Bacteria | 12395 |
| 542 | Ga0439431_0000645 | 3300041997 | Bacteria | 7421 |
| 543 | Ga0439432_018266 | 3300042006 | Bacteria | 2344 |
| 544 | Ga0439449_0014110 | 3300042007 | Bacteria | 3006 |
| 545 | Ga0439462_0000249 | 3300042015 | Bacteria | 9622 |
| 546 | Ga0439462_0001856 | 3300042015 | Bacteria | 4796 |
| 547 | Ga0439434_0000823 | 3300042435 | Bacteria | 8928 |
| 548 | Ga0451576_0000023 | 3300045051 | Bacteria | 477965 |
| 549 | Ga0495627_000158 | 3300046453 | Bacteria | 77210 |
| 550 | Ga0495627_000636 | 3300046453 | Bacteria | 27717 |
| 551 | Ga0495627_001522 | 3300046453 | Bacteria | 13320 |
| 552 | Ga0495629_0033426 | 3300046459 | Bacteria | 3638 |
| 553 | Ga0495638_0002237 | 3300046460 | Bacteria | 16075 |
| 554 | Ga0495650_0000492 | 3300046471 | Bacteria | 59983 |
| 555 | Ga0495650_0008181 | 3300046471 | Bacteria | 6147 |
| 556 | Ga0495650_0012961 | 3300046471 | Bacteria | 4445 |
| 557 | Ga0495662_0027591 | 3300046476 | Bacteria | 2743 |
| 558 | Ga0495596_0000141 | 3300046500 | Bacteria | 49474 |
| 559 | Ga0495596_0007033 | 3300046500 | Bacteria | 5112 |
| 560 | Ga0495583_0002564 | 3300046506 | Bacteria | 15303 |
| 561 | Ga0495583_0010721 | 3300046506 | Bacteria | 5318 |
| 562 | Ga0495583_0016240 | 3300046506 | Bacteria | 4013 |
| 563 | Ga0495606_0000359 | 3300046507 | Bacteria | 77863 |
| 564 | Ga0495610_0000020 | 3300046512 | Bacteria | 344007 |
| 565 | Ga0495610_0000071 | 3300046512 | Bacteria | 121210 |
| 566 | Ga0495610_0002395 | 3300046512 | Bacteria | 15792 |
| 567 | Ga0495610_0005363 | 3300046512 | Bacteria | 9148 |
| 568 | Ga0495610_0021839 | 3300046512 | Bacteria | 3512 |
| 569 | Ga0495610_0031373 | 3300046512 | Bacteria | 2773 |
| 570 | Ga0495620_0031636 | 3300046515 | Bacteria | 2422 |
| 571 | Ga0495632_0000211 | 3300046519 | Bacteria | 59066 |
| 572 | Ga0495637_0014469 | 3300046520 | Bacteria | 3723 |
| 573 | Ga0495643_0000053 | 3300046522 | Bacteria | 202031 |
| 574 | Ga0495643_0000132 | 3300046522 | Bacteria | 121567 |
| 575 | Ga0495643_0004044 | 3300046522 | Bacteria | 10460 |
| 576 | Ga0495643_0004426 | 3300046522 | Bacteria | 9829 |
| 577 | Ga0495643_0019902 | 3300046522 | Bacteria | 3879 |
| 578 | Ga0495648_0000256 | 3300046524 | Bacteria | 60519 |
| 579 | Ga0495663_0000020 | 3300046525 | Bacteria | 124560 |
| 580 | Ga0495663_0001269 | 3300046525 | Bacteria | 8015 |
| 581 | Ga0495654_0001382 | 3300046530 | Bacteria | 16825 |
| 582 | Ga0495640_0027903 | 3300046533 | Bacteria | 4067 |
| 583 | Ga0495609_0005528 | 3300046538 | Bacteria | 6604 |
| 584 | Ga0495621_0005314 | 3300046539 | Bacteria | 3691 |
| 585 | Ga0495633_0000983 | 3300046558 | Bacteria | 23405 |
| 586 | Ga0495633_0001072 | 3300046558 | Bacteria | 22116 |
| 587 | Ga0495633_0002904 | 3300046558 | Bacteria | 11752 |
| 588 | Ga0495633_0020069 | 3300046558 | Bacteria | 3367 |
| 589 | Ga0495668_0000004 | 3300046616 | Bacteria | 574236 |
| 590 | Ga0495668_0000163 | 3300046616 | Bacteria | 99607 |
| 591 | Ga0495668_0002911 | 3300046616 | Bacteria | 13507 |
| 592 | Ga0495668_0015770 | 3300046616 | Bacteria | 4405 |
| 593 | Ga0495668_0061841 | 3300046616 | Bacteria | 2064 |
| 594 | Ga0495668_0067068 | 3300046616 | Bacteria | 1974 |
| 595 | Ga0495634_0031949 | 3300046642 | Bacteria | 3623 |
| 596 | Ga0495625_0000332 | 3300046660 | Bacteria | 71947 |
| 597 | Ga0495625_0000553 | 3300046660 | Bacteria | 54796 |
| 598 | Ga0495625_0000568 | 3300046660 | Bacteria | 54059 |
| 599 | Ga0495625_0043887 | 3300046660 | Bacteria | 3239 |
| 600 | Ga0495625_0055633 | 3300046660 | Bacteria | 2821 |
| 601 | Ga0495669_0000629 | 3300046684 | Bacteria | 15335 |
| 602 | Ga0495670_0000007 | 3300046691 | Bacteria | 247088 |
| 603 | Ga0495671_0000031 | 3300046692 | Bacteria | 202030 |
| 604 | Ga0495589_0008334 | 3300046794 | Bacteria | 5416 |
| 605 | Ga0495600_0000914 | 3300046809 | Bacteria | 15826 |
| 606 | Ga0495674_0068220 | 3300047319 | Bacteria | 3078 |
| 607 | Ga0495687_000511 | 3300047443 | Bacteria | 46733 |
| 608 | Ga0495687_001938 | 3300047443 | Bacteria | 17742 |
| 609 | Ga0495677_0000956 | 3300047445 | Bacteria | 11629 |
| 610 | Ga0495681_0000008 | 3300047470 | Bacteria | 215295 |
| 611 | Ga0495681_0000094 | 3300047470 | Bacteria | 77400 |
| 612 | Ga0495681_0003826 | 3300047470 | Bacteria | 10415 |
| 613 | Ga0495681_0025529 | 3300047470 | Bacteria | 3089 |
| 614 | Ga0495686_0000013 | 3300047472 | Bacteria | 489656 |
| 615 | Ga0495686_0005293 | 3300047472 | Bacteria | 10228 |
| 616 | Ga0495686_0006390 | 3300047472 | Bacteria | 9035 |
| 617 | Ga0495615_0000239 | 3300048090 | Bacteria | 11254 |
| 618 | Ga0495615_0002333 | 3300048090 | Bacteria | 3029 |
| 619 | Ga0496101_0001612 | 3300048904 | Bacteria | 13571 |
| 620 | Ga0496102_0000106 | 3300048905 | Bacteria | 118841 |
| 621 | Ga0496102_0000120 | 3300048905 | Bacteria | 112432 |
| 622 | Ga0496102_0002374 | 3300048905 | Bacteria | 16067 |
| 623 | Ga0496102_0008515 | 3300048905 | Bacteria | 8793 |
| 624 | Ga0496103_0000095 | 3300048906 | Bacteria | 98260 |
| 625 | Ga0496103_0000154 | 3300048906 | Bacteria | 72239 |
| 626 | Ga0496103_0000984 | 3300048906 | Bacteria | 20114 |
| 627 | Ga0496103_0001305 | 3300048906 | Bacteria | 16975 |
| 628 | Ga0496103_0024978 | 3300048906 | Bacteria | 3608 |
| 629 | Ga0496104_0000060 | 3300048907 | Bacteria | 117966 |
| 630 | Ga0496104_0083563 | 3300048907 | Bacteria | 3045 |
| 631 | Ga0496105_0000274 | 3300048908 | Bacteria | 34048 |
| 632 | Ga0496107_0004473 | 3300048910 | Bacteria | 9480 |
| 633 | Ga0496108_0019377 | 3300048911 | Bacteria | 5586 |
| 634 | Ga0496110_0002630 | 3300048913 | Bacteria | 13523 |
| 635 | Ga0496110_0008273 | 3300048913 | Bacteria | 8364 |
| 636 | Ga0496111_0023431 | 3300048914 | Bacteria | 4334 |
| 637 | Ga0496112_0074755 | 3300048915 | Bacteria | 3351 |
| 638 | Ga0496112_0121955 | 3300048915 | Bacteria | 2577 |
| 639 | Ga0496113_0003962 | 3300048916 | Bacteria | 8994 |
| 640 | Ga0496115_0000134 | 3300048918 | Bacteria | 67910 |
| 641 | Ga0496115_0000172 | 3300048918 | Bacteria | 59971 |
| 642 | Ga0496116_0000028 | 3300048919 | Bacteria | 424086 |
| 643 | Ga0496116_0004809 | 3300048919 | Bacteria | 12742 |
| 644 | Ga0496116_0014370 | 3300048919 | Bacteria | 6328 |
| 645 | Ga0496117_0000317 | 3300048920 | Bacteria | 84472 |
| 646 | Ga0496117_0000366 | 3300048920 | Bacteria | 78816 |
| 647 | Ga0496117_0000582 | 3300048920 | Bacteria | 60157 |
| 648 | Ga0496117_0003953 | 3300048920 | Bacteria | 16753 |
| 649 | Ga0496118_0000303 | 3300048921 | Bacteria | 85332 |
| 650 | Ga0496118_0000392 | 3300048921 | Bacteria | 74074 |
| 651 | Ga0496118_0003549 | 3300048921 | Bacteria | 19478 |
| 652 | Ga0496118_0033548 | 3300048921 | Bacteria | 4209 |
| 653 | Ga0496119_0001213 | 3300048922 | Bacteria | 32201 |
| 654 | Ga0496119_0047407 | 3300048922 | Bacteria | 2674 |
| 655 | Ga0496120_0001109 | 3300048923 | Bacteria | 35064 |
| 656 | Ga0496121_0004566 | 3300048924 | Bacteria | 18476 |
| 657 | Ga0496121_0005396 | 3300048924 | Bacteria | 16416 |
| 658 | Ga0496121_0013959 | 3300048924 | Bacteria | 8580 |
| 659 | Ga0496122_0001187 | 3300048925 | Bacteria | 44594 |
| 660 | Ga0496122_0002369 | 3300048925 | Bacteria | 26990 |
| 661 | Ga0496122_0004287 | 3300048925 | Bacteria | 17866 |
| 662 | Ga0496122_0009082 | 3300048925 | Bacteria | 10542 |
| 663 | Ga0496122_0017843 | 3300048925 | Bacteria | 6599 |
| 664 | Ga0496123_0000518 | 3300048926 | Bacteria | 67308 |
| 665 | Ga0496123_0001557 | 3300048926 | Bacteria | 31501 |
| 666 | Ga0496123_0007047 | 3300048926 | Bacteria | 10696 |
| 667 | Ga0496124_0000214 | 3300048927 | Bacteria | 113007 |
| 668 | Ga0496124_0000606 | 3300048927 | Bacteria | 60251 |
| 669 | Ga0496124_0001819 | 3300048927 | Bacteria | 29505 |
| 670 | Ga0496124_0007214 | 3300048927 | Bacteria | 11876 |
| 671 | Ga0496124_0009700 | 3300048927 | Bacteria | 9855 |
| 672 | Ga0496124_0037659 | 3300048927 | Bacteria | 4204 |
| 673 | Ga0496125_0000666 | 3300048928 | Bacteria | 57200 |
| 674 | Ga0496125_0091998 | 3300048928 | Bacteria | 2269 |
| 675 | Ga0496126_0000079 | 3300048929 | Bacteria | 222463 |
| 676 | Ga0496126_0000294 | 3300048929 | Bacteria | 106327 |
| 677 | Ga0496126_0004606 | 3300048929 | Bacteria | 16354 |
| 678 | Ga0501292_000172 | 3300049515 | Bacteria | 10490 |
| 679 | Ga0501294_000303 | 3300049517 | Bacteria | 6028 |
| 680 | Ga0501300_000548 | 3300049523 | Bacteria | 5631 |
| 681 | Ga0501032_0001272 | 3300049569 | Bacteria | 20206 |
| 682 | Ga0501037_0005776 | 3300049573 | Bacteria | 9035 |
| 683 | Ga0501047_0003383 | 3300049581 | Bacteria | 15102 |
| 684 | Ga0501047_0051581 | 3300049581 | Bacteria | 3976 |
| 685 | Ga0501047_0156997 | 3300049581 | Bacteria | 2148 |
| 686 | Ga0501047_0181061 | 3300049581 | Bacteria | 1974 |
| 687 | Ga0501067_0000227 | 3300049583 | Bacteria | 31300 |
| 688 | Ga0501073_0000004 | 3300049589 | Bacteria | 261794 |
| 689 | Ga0501077_0000008 | 3300049593 | Bacteria | 106496 |
| 690 | Ga0501223_000495 | 3300049663 | Bacteria | 9553 |
| 691 | Ga0501223_000734 | 3300049663 | Bacteria | 7804 |
| 692 | Ga0501224_000006 | 3300049664 | Bacteria | 149611 |
| 693 | Ga0501233_000165 | 3300049668 | Bacteria | 9518 |
| 694 | Ga0501249_001926 | 3300049679 | Bacteria | 4218 |
| 695 | Ga0501257_000031 | 3300049686 | Bacteria | 40822 |
| 696 | Ga0501259_002260 | 3300049688 | Bacteria | 3158 |
| 697 | Ga0501261_000301 | 3300049690 | Bacteria | 6784 |
| 698 | Ga0501225_0000845 | 3300049705 | Bacteria | 9521 |
| 699 | Ga0501080_0000654 | 3300049742 | Bacteria | 27505 |
| 700 | Ga0501279_000239 | 3300049775 | Bacteria | 7546 |
| 701 | Ga0501280_000005 | 3300049776 | Bacteria | 85174 |
| 702 | Ga0501280_000342 | 3300049776 | Bacteria | 11591 |
| 703 | Ga0501281_00513 | 3300049777 | Bacteria | 3598 |
| 704 | Ga0501282_000535 | 3300049778 | Bacteria | 4462 |
| 705 | Ga0501283_000937 | 3300049779 | Bacteria | 3872 |
| 706 | Ga0501035_0023615 | 3300049822 | Bacteria | 5641 |
| 707 | Ga0501044_0000868 | 3300049823 | Bacteria | 36400 |
| 708 | Ga0501044_0011325 | 3300049823 | Bacteria | 9664 |
| 709 | nmdc:mga00v17_1761_c1 | 3300050491 | Bacteria | 11247 |
| 710 | nmdc:mga00v17_2745_c1 | 3300050491 | Bacteria | 4132 |
| 711 | nmdc:mga0k408_4871_c1 | 3300050493 | Bacteria | 7118 |
| 712 | nmdc:mga06z11_26_c1 | 3300050494 | Bacteria | 64283 |
| 713 | nmdc:mga04h51_118_c1 | 3300050495 | Bacteria | 23239 |
| 714 | nmdc:mga04h51_22_c1 | 3300050495 | Bacteria | 64371 |
| 715 | nmdc:mga07m45_22923_c1 | 3300050496 | Bacteria | 3410 |
| 716 | nmdc:mga07m45_403_c1 | 3300050496 | Bacteria | 17870 |
| 717 | nmdc:mga07m45_43825_c1 | 3300050496 | Bacteria | 2509 |
| 718 | nmdc:mga0qj67_18352_c1 | 3300050509 | Bacteria | 5331 |
| 719 | nmdc:mga0sz30_1259_c1 | 3300050516 | Bacteria | 9051 |
| 720 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 721 | Ga0500643_000030 | 3300053087 | Bacteria | 206784 |
| 722 | Ga0500643_001071 | 3300053087 | Bacteria | 16543 |
| 723 | Ga0500643_001104 | 3300053087 | Bacteria | 16160 |
| 724 | Ga0500643_002047 | 3300053087 | Bacteria | 10799 |
| 725 | Ga0500643_002494 | 3300053087 | Bacteria | 9443 |
| 726 | Ga0500643_002878 | 3300053087 | Bacteria | 8571 |
| 727 | Ga0500643_003295 | 3300053087 | Bacteria | 7838 |
| 728 | Ga0500643_006377 | 3300053087 | Bacteria | 4935 |
| 729 | Ga0500643_009984 | 3300053087 | Bacteria | 3577 |
| 730 | Ga0500643_023246 | 3300053087 | Bacteria | 1982 |
| 731 | Ga0500643_023489 | 3300053087 | Bacteria | 1969 |
| 732 | Ga0500566_0003635 | 3300053094 | Bacteria | 9199 |
| 733 | Ga0500641_0019379 | 3300053096 | Bacteria | 2572 |
| 734 | Ga0500556_0000049 | 3300053104 | Bacteria | 122572 |
| 735 | Ga0500592_000270 | 3300053116 | Bacteria | 9225 |
| 736 | Ga0500592_000280 | 3300053116 | Bacteria | 9035 |
| 737 | Ga0500594_0002630 | 3300053118 | Bacteria | 3902 |
| 738 | Ga0500594_0003469 | 3300053118 | Bacteria | 3466 |
| 739 | Ga0500595_001337 | 3300053119 | Bacteria | 13334 |
| 740 | Ga0500595_022036 | 3300053119 | Bacteria | 2264 |
| 741 | Ga0500597_007055 | 3300053120 | Bacteria | 3779 |
| 742 | Ga0500607_001726 | 3300053121 | Bacteria | 18994 |
| 743 | Ga0500607_002875 | 3300053121 | Bacteria | 13266 |
| 744 | Ga0500608_002406 | 3300053122 | Bacteria | 6808 |
| 745 | Ga0500608_004409 | 3300053122 | Bacteria | 5446 |
| 746 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 747 | Ga0500658_0000108 | 3300053134 | Bacteria | 38564 |
| 748 | Ga0500658_0002704 | 3300053134 | Bacteria | 6820 |
| 749 | Ga0500559_0002377 | 3300053136 | Bacteria | 9801 |
| 750 | Ga0500559_0006954 | 3300053136 | Bacteria | 5059 |
| 751 | Ga0500568_0001734 | 3300053139 | Bacteria | 13523 |
| 752 | Ga0500573_0000034 | 3300053140 | Bacteria | 113547 |
| 753 | Ga0500616_0003384 | 3300053153 | Bacteria | 12243 |
| 754 | Ga0500622_0006524 | 3300053156 | Bacteria | 6747 |
| 755 | Ga0500624_000001 | 3300053157 | Bacteria | 284974 |
| 756 | Ga0500624_000024 | 3300053157 | Bacteria | 114404 |
| 757 | Ga0500624_000088 | 3300053157 | Bacteria | 47211 |
| 758 | Ga0500627_0000049 | 3300053158 | Bacteria | 58947 |
| 759 | Ga0500627_0000199 | 3300053158 | Bacteria | 17319 |
| 760 | Ga0500627_0000335 | 3300053158 | Bacteria | 12748 |
| 761 | Ga0500636_0006191 | 3300053177 | Bacteria | 6874 |
| 762 | Ga0500636_0008307 | 3300053177 | Bacteria | 6022 |
| 763 | Ga0500637_0000097 | 3300053178 | Bacteria | 31449 |
| 764 | Ga0500637_0007967 | 3300053178 | Bacteria | 5321 |
| 765 | Ga0500567_000103 | 3300053723 | Bacteria | 21300 |
| 766 | Ga0500625_000029 | 3300053729 | Bacteria | 54479 |
| 767 | Ga0500645_000173 | 3300053730 | Bacteria | 50903 |
| 768 | Ga0500645_000300 | 3300053730 | Bacteria | 35408 |
| 769 | Ga0500645_000452 | 3300053730 | Bacteria | 28126 |
| 770 | Ga0501082_0138497 | 3300060353 | Bacteria | 2112 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300010375 | Ga0105239_10113654 | Ga0105239_101136542 | 512 |
| 2 | 3300050496 | nmdc:mga07m45_43825_c1 | nmdc:mga07m45_43825_c1_854_2434 | 526 |
| 3 | 3300053096 | Ga0500641_0019379 | Ga0500641_0019379_45_1625 | 526 |
| 4 | 3300053120 | Ga0500597_007055 | Ga0500597_007055_2182_3762 | 526 |
| 5 | 3300047470 | Ga0495681_0003826 | Ga0495681_0003826_35_1648 | 537 |
| 6 | 3300031901 | Ga0307406_10021789 | Ga0307406_100217893 | 546 |
| 7 | 3300032004 | Ga0307414_10114411 | Ga0307414_101144112 | 546 |
| 8 | 3300046539 | Ga0495621_0005314 | Ga0495621_0005314_1769_3652 | 547 |
| 9 | 3300014326 | Ga0157380_10013463 | Ga0157380_100134637 | 548 |
| 10 | 3300017792 | Ga0163161_10103664 | Ga0163161_101036641 | 551 |
| 11 | 3300025972 | Ga0207668_10055215 | Ga0207668_100552152 | 551 |
| 12 | 3300031731 | Ga0307405_10054567 | Ga0307405_100545672 | 551 |
| 13 | 3300031903 | Ga0307407_10040428 | Ga0307407_100404282 | 551 |
| 14 | 3300032002 | Ga0307416_100080138 | Ga0307416_1000801382 | 551 |
| 15 | 3300032005 | Ga0307411_10062055 | Ga0307411_100620551 | 552 |
| 16 | 3300031731 | Ga0307405_10041028 | Ga0307405_100410281 | 553 |
| 17 | 3300027876 | Ga0209974_10003430 | Ga0209974_100034305 | 554 |
| 18 | 3300031548 | Ga0307408_100015727 | Ga0307408_1000157275 | 554 |
| 19 | 3300031548 | Ga0307408_100087906 | Ga0307408_1000879061 | 554 |
| 20 | 3300031824 | Ga0307413_10012702 | Ga0307413_100127022 | 554 |
| 21 | 3300031901 | Ga0307406_10019894 | Ga0307406_100198945 | 554 |
| 22 | 3300031911 | Ga0307412_10008746 | Ga0307412_100087462 | 554 |
| 23 | 3300032005 | Ga0307411_10104906 | Ga0307411_101049061 | 554 |
| 24 | 3300032126 | Ga0307415_100009023 | Ga0307415_1000090234 | 554 |
| 25 | 3300005331 | Ga0070670_100005522 | Ga0070670_10000552211 | 555 |
| 26 | 3300005548 | Ga0070665_100013328 | Ga0070665_1000133282 | 555 |
| 27 | 3300025925 | Ga0207650_10018925 | Ga0207650_100189252 | 555 |
| 28 | 3300047472 | Ga0495686_0006390 | Ga0495686_0006390_3106_4899 | 555 |
| 29 | 3300005293 | Ga0065715_10000978 | Ga0065715_100009783 | 556 |
| 30 | 3300005328 | Ga0070676_10007834 | Ga0070676_100078346 | 556 |
| 31 | 3300005354 | Ga0070675_100004161 | Ga0070675_1000041618 | 556 |
| 32 | 3300005364 | Ga0070673_100032493 | Ga0070673_1000324932 | 556 |
| 33 | 3300005545 | Ga0070695_100075744 | Ga0070695_1000757442 | 556 |
| 34 | 3300005844 | Ga0068862_100012106 | Ga0068862_1000121063 | 556 |
| 35 | 3300009094 | Ga0111539_10029495 | Ga0111539_100294956 | 556 |
| 36 | 3300014326 | Ga0157380_10003002 | Ga0157380_100030027 | 556 |
| 37 | 3300025315 | Ga0207697_10003297 | Ga0207697_100032975 | 556 |
| 38 | 3300025907 | Ga0207645_10012931 | Ga0207645_100129312 | 556 |
| 39 | 3300025933 | Ga0207706_10014593 | Ga0207706_100145933 | 556 |
| 40 | 3300025940 | Ga0207691_10005772 | Ga0207691_1000577212 | 556 |
| 41 | 3300025972 | Ga0207668_10002528 | Ga0207668_100025288 | 556 |
| 42 | 3300026118 | Ga0207675_100150282 | Ga0207675_1001502821 | 556 |
| 43 | 3300026121 | Ga0207683_10033010 | Ga0207683_100330104 | 556 |
| 44 | 3300037471 | Ga0395905_0094244 | Ga0395905_0094244_728_2605 | 556 |
| 45 | 3300005331 | Ga0070670_100087376 | Ga0070670_1000873762 | 557 |
| 46 | 3300031852 | Ga0307410_10014143 | Ga0307410_100141433 | 559 |
| 47 | 3300032004 | Ga0307414_10000346 | Ga0307414_100003469 | 559 |
| 48 | 3300025972 | Ga0207668_10041715 | Ga0207668_100417152 | 560 |
| 49 | 3300046512 | Ga0495610_0031373 | Ga0495610_0031373_690_2510 | 560 |
| 50 | 3300032126 | Ga0307415_100035245 | Ga0307415_1000352451 | 561 |
| 51 | 3300031852 | Ga0307410_10000684 | Ga0307410_100006845 | 562 |
| 52 | 3300032002 | Ga0307416_100043746 | Ga0307416_1000437462 | 562 |
| 53 | 3300032004 | Ga0307414_10014644 | Ga0307414_100146443 | 562 |
| 54 | 3300032005 | Ga0307411_10024249 | Ga0307411_100242492 | 562 |
| 55 | 3300048915 | Ga0496112_0074755 | Ga0496112_0074755_1197_3011 | 562 |
| 56 | 3300046519 | Ga0495632_0000211 | Ga0495632_0000211_1983_3797 | 563 |
| 57 | 3300046520 | Ga0495637_0014469 | Ga0495637_0014469_406_2220 | 563 |
| 58 | 3300046522 | Ga0495643_0000053 | Ga0495643_0000053_133117_134931 | 563 |
| 59 | 3300046525 | Ga0495663_0000020 | Ga0495663_0000020_67477_69291 | 563 |
| 60 | 3300046558 | Ga0495633_0000983 | Ga0495633_0000983_13129_14943 | 563 |
| 61 | 3300046692 | Ga0495671_0000031 | Ga0495671_0000031_67100_68914 | 563 |
| 62 | 3300047470 | Ga0495681_0025529 | Ga0495681_0025529_1202_3016 | 563 |
| 63 | 3300031824 | Ga0307413_10028311 | Ga0307413_100283111 | 564 |
| 64 | 3300031852 | Ga0307410_10033329 | Ga0307410_100333291 | 564 |
| 65 | 3300031903 | Ga0307407_10051333 | Ga0307407_100513331 | 564 |
| 66 | 3300031911 | Ga0307412_10090273 | Ga0307412_100902731 | 564 |
| 67 | 3300031995 | Ga0307409_100036824 | Ga0307409_1000368244 | 564 |
| 68 | 3300032002 | Ga0307416_100103237 | Ga0307416_1001032372 | 564 |
| 69 | 3300032004 | Ga0307414_10016059 | Ga0307414_100160591 | 564 |
| 70 | 3300003794 | Ga0055531_10001714 | Ga0055531_100017144 | 565 |
| 71 | 3300025298 | Ga0209050_1008085 | Ga0209050_10080855 | 565 |
| 72 | 3300025304 | Ga0209257_1001405 | Ga0209257_100140516 | 565 |
| 73 | 3300053139 | Ga0500568_0001734 | Ga0500568_0001734_7585_9399 | 565 |
| 74 | 3300046558 | Ga0495633_0001072 | Ga0495633_0001072_7253_9085 | 566 |
| 75 | 3300053158 | Ga0500627_0000049 | Ga0500627_0000049_52177_54024 | 566 |
| 76 | 3300005366 | Ga0070659_100013031 | Ga0070659_1000130313 | 567 |
| 77 | 3300005457 | Ga0070662_100005311 | Ga0070662_1000053112 | 567 |
| 78 | 3300005458 | Ga0070681_10089493 | Ga0070681_100894932 | 567 |
| 79 | 3300006195 | Ga0075366_10012022 | Ga0075366_100120223 | 567 |
| 80 | 3300025912 | Ga0207707_10090256 | Ga0207707_100902562 | 567 |
| 81 | 3300025933 | Ga0207706_10004467 | Ga0207706_100044676 | 567 |
| 82 | 3300050493 | nmdc:mga0k408_4871_c1 | nmdc:mga0k408_4871_c1_1529_3355 | 567 |
| 83 | 3300025229 | Ga0209147_100321 | Ga0209147_10032110 | 569 |
| 84 | 3300047472 | Ga0495686_0005293 | Ga0495686_0005293_5486_7315 | 569 |
| 85 | 3300005985 | Ga0081539_10019805 | Ga0081539_100198052 | 570 |
| 86 | 3300031548 | Ga0307408_100019173 | Ga0307408_1000191733 | 570 |
| 87 | 3300031824 | Ga0307413_10007679 | Ga0307413_100076794 | 570 |
| 88 | 3300031901 | Ga0307406_10036423 | Ga0307406_100364232 | 570 |
| 89 | 3300031995 | Ga0307409_100064704 | Ga0307409_1000647042 | 570 |
| 90 | 3300032002 | Ga0307416_100037671 | Ga0307416_1000376713 | 570 |
| 91 | 3300032126 | Ga0307415_100055878 | Ga0307415_1000558782 | 570 |
| 92 | 3300046522 | Ga0495643_0019902 | Ga0495643_0019902_719_2533 | 570 |
| 93 | 3300005844 | Ga0068862_100018068 | Ga0068862_1000180682 | 571 |
| 94 | 3300025972 | Ga0207668_10085580 | Ga0207668_100855802 | 571 |
| 95 | 3300046660 | Ga0495625_0055633 | Ga0495625_0055633_404_2239 | 571 |
| 96 | iso_pu_bacteria | 2821443989 | 2821449023 | 571 |
| 97 | 3300006195 | Ga0075366_10004887 | Ga0075366_100048874 | 572 |
| 98 | 3300027866 | Ga0209813_10000126 | Ga0209813_1000012624 | 572 |
| 99 | 3300013105 | Ga0157369_10025937 | Ga0157369_100259371 | 573 |
| 100 | 3300013306 | Ga0163162_10035914 | Ga0163162_100359145 | 573 |
| 101 | 3300028380 | Ga0268265_10006969 | Ga0268265_100069698 | 573 |
| 102 | 3300046616 | Ga0495668_0000004 | Ga0495668_0000004_451935_453782 | 573 |
| 103 | 3300049581 | Ga0501047_0181061 | Ga0501047_0181061_51_1853 | 573 |
| 104 | 3300053087 | Ga0500643_023246 | Ga0500643_023246_44_1780 | 573 |
| 105 | 3300003215 | JGI25153J46596_10000006 | JGI25153J46596_10000006348 | 574 |
| 106 | 3300012513 | Ga0157326_1000059 | Ga0157326_10000592 | 574 |
| 107 | 3300025297 | Ga0209758_1000001 | Ga0209758_10000011478 | 574 |
| 108 | 3300009177 | Ga0105248_10008150 | Ga0105248_100081501 | 575 |
| 109 | 3300025941 | Ga0207711_10075264 | Ga0207711_100752641 | 575 |
| 110 | 3300049679 | Ga0501249_001926 | Ga0501249_001926_2469_4205 | 575 |
| 111 | 3300053087 | Ga0500643_002494 | Ga0500643_002494_1074_2930 | 575 |
| 112 | 3300005335 | Ga0070666_10010284 | Ga0070666_100102846 | 576 |
| 113 | 3300005347 | Ga0070668_100000027 | Ga0070668_10000002732 | 576 |
| 114 | 3300005355 | Ga0070671_100001241 | Ga0070671_1000012412 | 576 |
| 115 | 3300005367 | Ga0070667_100000017 | Ga0070667_100000017211 | 576 |
| 116 | 3300005539 | Ga0068853_100002669 | Ga0068853_10000266911 | 576 |
| 117 | 3300005616 | Ga0068852_100034615 | Ga0068852_1000346151 | 576 |
| 118 | 3300005617 | Ga0068859_100027164 | Ga0068859_1000271642 | 576 |
| 119 | 3300005841 | Ga0068863_100006015 | Ga0068863_1000060152 | 576 |
| 120 | 3300005842 | Ga0068858_100000103 | Ga0068858_10000010358 | 576 |
| 121 | 3300005843 | Ga0068860_100000056 | Ga0068860_10000005633 | 576 |
| 122 | 3300005844 | Ga0068862_100005376 | Ga0068862_1000053766 | 576 |
| 123 | 3300006931 | Ga0097620_100027165 | Ga0097620_1000271652 | 576 |
| 124 | 3300009098 | Ga0105245_10002260 | Ga0105245_1000226013 | 576 |
| 125 | 3300013297 | Ga0157378_10094681 | Ga0157378_100946812 | 576 |
| 126 | 3300025903 | Ga0207680_10049495 | Ga0207680_100494952 | 576 |
| 127 | 3300025931 | Ga0207644_10000574 | Ga0207644_1000057413 | 576 |
| 128 | 3300025941 | Ga0207711_10041275 | Ga0207711_100412753 | 576 |
| 129 | 3300025972 | Ga0207668_10000012 | Ga0207668_1000001231 | 576 |
| 130 | 3300025986 | Ga0207658_10000011 | Ga0207658_1000001132 | 576 |
| 131 | 3300026035 | Ga0207703_10000691 | Ga0207703_100006917 | 576 |
| 132 | 3300026088 | Ga0207641_10002092 | Ga0207641_100020929 | 576 |
| 133 | 3300026116 | Ga0207674_10069644 | Ga0207674_100696443 | 576 |
| 134 | 3300028380 | Ga0268265_10000958 | Ga0268265_100009588 | 576 |
| 135 | 3300028381 | Ga0268264_10000089 | Ga0268264_10000089218 | 576 |
| 136 | 3300053087 | Ga0500643_001071 | Ga0500643_001071_10780_12549 | 576 |
| 137 | 3300053157 | Ga0500624_000024 | Ga0500624_000024_29435_31270 | 576 |
| 138 | 3300003781 | Ga0055536_1006713 | Ga0055536_10067131 | 577 |
| 139 | 3300005842 | Ga0068858_100000777 | Ga0068858_10000077714 | 577 |
| 140 | 3300006042 | Ga0075368_10000704 | Ga0075368_100007045 | 577 |
| 141 | 3300006178 | Ga0075367_10000042 | Ga0075367_100000427 | 577 |
| 142 | 3300006847 | Ga0075431_100007563 | Ga0075431_1000075639 | 577 |
| 143 | 3300009094 | Ga0111539_10000017 | Ga0111539_10000017127 | 577 |
| 144 | 3300009177 | Ga0105248_10003098 | Ga0105248_100030986 | 577 |
| 145 | 3300025292 | Ga0209676_1000929 | Ga0209676_100092913 | 577 |
| 146 | 3300025941 | Ga0207711_10003251 | Ga0207711_1000325111 | 577 |
| 147 | 3300026035 | Ga0207703_10001013 | Ga0207703_100010139 | 577 |
| 148 | 3300026095 | Ga0207676_10000894 | Ga0207676_100008945 | 577 |
| 149 | 3300027866 | Ga0209813_10000042 | Ga0209813_1000004231 | 577 |
| 150 | 3300041410 | Ga0439461_0000190 | Ga0439461_0000190_5842_7671 | 577 |
| 151 | 3300041413 | Ga0439465_0000420 | Ga0439465_0000420_5024_6853 | 577 |
| 152 | 3300041997 | Ga0439431_0000645 | Ga0439431_0000645_1748_3577 | 577 |
| 153 | 3300042015 | Ga0439462_0001856 | Ga0439462_0001856_348_2177 | 577 |
| 154 | 3300042435 | Ga0439434_0000823 | Ga0439434_0000823_4175_6004 | 577 |
| 155 | 3300046515 | Ga0495620_0031636 | Ga0495620_0031636_437_2338 | 577 |
| 156 | 3300050494 | nmdc:mga06z11_26_c1 | nmdc:mga06z11_26_c1_42101_43924 | 577 |
| 157 | 3300050495 | nmdc:mga04h51_22_c1 | nmdc:mga04h51_22_c1_20490_22313 | 577 |
| 158 | 3300053087 | Ga0500643_001104 | Ga0500643_001104_3591_5414 | 577 |
| 159 | 3300053087 | Ga0500643_002878 | Ga0500643_002878_2205_4130 | 577 |
| 160 | 3300013307 | Ga0157372_10214297 | Ga0157372_102142972 | 578 |
| 161 | 3300025298 | Ga0209050_1002610 | Ga0209050_10026106 | 578 |
| 162 | 3300042007 | Ga0439449_0014110 | Ga0439449_0014110_970_2823 | 578 |
| 163 | 3300042015 | Ga0439462_0000249 | Ga0439462_0000249_74_1903 | 578 |
| 164 | 3300049581 | Ga0501047_0003383 | Ga0501047_0003383_5760_7622 | 578 |
| 165 | 3300053087 | Ga0500643_000030 | Ga0500643_000030_13054_14898 | 578 |
| 166 | iso_pu_bacteria | 2844533157 | 2844536020 | 578 |
| 167 | 3300005344 | Ga0070661_100000010 | Ga0070661_100000010159 | 579 |
| 168 | 3300005530 | Ga0070679_100165301 | Ga0070679_1001653011 | 579 |
| 169 | 3300005548 | Ga0070665_100000086 | Ga0070665_100000086177 | 579 |
| 170 | 3300005616 | Ga0068852_100156023 | Ga0068852_1001560232 | 579 |
| 171 | 3300009553 | Ga0105249_10040062 | Ga0105249_100400622 | 579 |
| 172 | 3300025920 | Ga0207649_10000178 | Ga0207649_100001786 | 579 |
| 173 | 3300025933 | Ga0207706_10031363 | Ga0207706_100313633 | 579 |
| 174 | 3300025961 | Ga0207712_10009432 | Ga0207712_100094322 | 579 |
| 175 | 3300026067 | Ga0207678_10020460 | Ga0207678_100204603 | 579 |
| 176 | 3300026116 | Ga0207674_10084252 | Ga0207674_100842523 | 579 |
| 177 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000022383 | 579 |
| 178 | 3300033180 | Ga0307510_10092283 | Ga0307510_100922832 | 579 |
| 179 | 3300039437 | Ga0436365_1921522 | Ga0436365_1921522_1158_3035 | 579 |
| 180 | 3300048918 | Ga0496115_0000134 | Ga0496115_0000134_9506_11320 | 579 |
| 181 | 3300049822 | Ga0501035_0023615 | Ga0501035_0023615_3404_5242 | 579 |
| 182 | 3300053116 | Ga0500592_000280 | Ga0500592_000280_1958_3799 | 579 |
| 183 | 3300053158 | Ga0500627_0000199 | Ga0500627_0000199_6665_8506 | 579 |
| 184 | 3300005327 | Ga0070658_10024952 | Ga0070658_100249525 | 580 |
| 185 | 3300005331 | Ga0070670_100003165 | Ga0070670_10000316513 | 580 |
| 186 | 3300005344 | Ga0070661_100015823 | Ga0070661_1000158232 | 580 |
| 187 | 3300005353 | Ga0070669_100016595 | Ga0070669_1000165952 | 580 |
| 188 | 3300005354 | Ga0070675_100012526 | Ga0070675_1000125265 | 580 |
| 189 | 3300005355 | Ga0070671_100000353 | Ga0070671_1000003534 | 580 |
| 190 | 3300005367 | Ga0070667_100011712 | Ga0070667_1000117123 | 580 |
| 191 | 3300005543 | Ga0070672_100003237 | Ga0070672_1000032378 | 580 |
| 192 | 3300005548 | Ga0070665_100015010 | Ga0070665_10001501013 | 580 |
| 193 | 3300005564 | Ga0070664_100009278 | Ga0070664_1000092788 | 580 |
| 194 | 3300009101 | Ga0105247_10016928 | Ga0105247_100169283 | 580 |
| 195 | 3300009545 | Ga0105237_10050794 | Ga0105237_100507943 | 580 |
| 196 | 3300009553 | Ga0105249_10000567 | Ga0105249_1000056712 | 580 |
| 197 | 3300025914 | Ga0207671_10014738 | Ga0207671_100147383 | 580 |
| 198 | 3300025923 | Ga0207681_10053593 | Ga0207681_100535931 | 580 |
| 199 | 3300025925 | Ga0207650_10035934 | Ga0207650_100359342 | 580 |
| 200 | 3300025926 | Ga0207659_10045306 | Ga0207659_100453062 | 580 |
| 201 | 3300025931 | Ga0207644_10033072 | Ga0207644_100330722 | 580 |
| 202 | 3300025937 | Ga0207669_10083879 | Ga0207669_100838791 | 580 |
| 203 | 3300025940 | Ga0207691_10004823 | Ga0207691_100048238 | 580 |
| 204 | 3300025945 | Ga0207679_10004610 | Ga0207679_100046108 | 580 |
| 205 | 3300025986 | Ga0207658_10033271 | Ga0207658_100332713 | 580 |
| 206 | 3300032004 | Ga0307414_10009428 | Ga0307414_100094283 | 580 |
| 207 | 3300032005 | Ga0307411_10004783 | Ga0307411_100047836 | 580 |
| 208 | 3300035170 | Ga0373943_0033198 | Ga0373943_0033198_209_2035 | 580 |
| 209 | 3300035171 | Ga0373946_0020771 | Ga0373946_0020771_285_2111 | 580 |
| 210 | 3300035692 | Ga0373935_0028704 | Ga0373935_0028704_1115_2941 | 580 |
| 211 | 3300042006 | Ga0439432_018266 | Ga0439432_018266_82_1935 | 580 |
| 212 | 3300046459 | Ga0495629_0033426 | Ga0495629_0033426_707_2533 | 580 |
| 213 | 3300046476 | Ga0495662_0027591 | Ga0495662_0027591_495_2321 | 580 |
| 214 | 3300046533 | Ga0495640_0027903 | Ga0495640_0027903_1143_2969 | 580 |
| 215 | 3300046642 | Ga0495634_0031949 | Ga0495634_0031949_682_2508 | 580 |
| 216 | 3300047319 | Ga0495674_0068220 | Ga0495674_0068220_1034_2860 | 580 |
| 217 | 3300048913 | Ga0496110_0002630 | Ga0496110_0002630_2776_4629 | 580 |
| 218 | 3300048914 | Ga0496111_0023431 | Ga0496111_0023431_783_2636 | 580 |
| 219 | 3300049581 | Ga0501047_0156997 | Ga0501047_0156997_192_2030 | 580 |
| 220 | 3300053087 | Ga0500643_009984 | Ga0500643_009984_1633_3459 | 580 |
| 221 | 3300053157 | Ga0500624_000088 | Ga0500624_000088_35954_37780 | 580 |
| 222 | 3300053177 | Ga0500636_0006191 | Ga0500636_0006191_4529_6355 | 580 |
| 223 | iso_pu_bacteria | 2510917021 | 2511130117 | 580 |
| 224 | iso_pu_bacteria | 2818991438 | 2819553163 | 580 |
| 225 | iso_pu_bacteria | 2882806704 | 2882808374 | 580 |
| 226 | iso_pu_bacteria | 2896429255 | 2896430231 | 580 |
| 227 | iso_pu_bacteria | 8054302542 | 8054304792 | 580 |
| 228 | 3300005339 | Ga0070660_100004165 | Ga0070660_1000041659 | 581 |
| 229 | 3300005367 | Ga0070667_100000066 | Ga0070667_10000006698 | 581 |
| 230 | 3300005843 | Ga0068860_100000013 | Ga0068860_100000013217 | 581 |
| 231 | 3300021358 | Ga0213873_10000015 | Ga0213873_1000001529 | 581 |
| 232 | 3300021384 | Ga0213876_10000005 | Ga0213876_10000005706 | 581 |
| 233 | 3300025919 | Ga0207657_10022107 | Ga0207657_100221074 | 581 |
| 234 | 3300025942 | Ga0207689_10093863 | Ga0207689_100938632 | 581 |
| 235 | 3300025986 | Ga0207658_10000132 | Ga0207658_1000013211 | 581 |
| 236 | 3300026118 | Ga0207675_100084771 | Ga0207675_1000847713 | 581 |
| 237 | 3300028381 | Ga0268264_10000039 | Ga0268264_10000039215 | 581 |
| 238 | 3300039437 | Ga0436365_1132330 | Ga0436365_1132330_47583_49409 | 581 |
| 239 | 3300039453 | Ga0436362_0875621 | Ga0436362_0875621_30373_32199 | 581 |
| 240 | 3300049569 | Ga0501032_0001272 | Ga0501032_0001272_2230_4077 | 581 |
| 241 | 3300049573 | Ga0501037_0005776 | Ga0501037_0005776_4581_6401 | 581 |
| 242 | 3300049583 | Ga0501067_0000227 | Ga0501067_0000227_12823_14643 | 581 |
| 243 | 3300049589 | Ga0501073_0000004 | Ga0501073_0000004_109303_111123 | 581 |
| 244 | 3300049593 | Ga0501077_0000008 | Ga0501077_0000008_90488_92308 | 581 |
| 245 | 3300049742 | Ga0501080_0000654 | Ga0501080_0000654_16933_18753 | 581 |
| 246 | 3300049823 | Ga0501044_0000868 | Ga0501044_0000868_25607_27427 | 581 |
| 247 | 3300050491 | nmdc:mga00v17_2745_c1 | nmdc:mga00v17_2745_c1_1507_3339 | 581 |
| 248 | 3300050495 | nmdc:mga04h51_118_c1 | nmdc:mga04h51_118_c1_20860_22692 | 581 |
| 249 | 3300050496 | nmdc:mga07m45_403_c1 | nmdc:mga07m45_403_c1_13525_15357 | 581 |
| 250 | 3300050516 | nmdc:mga0sz30_1259_c1 | nmdc:mga0sz30_1259_c1_4603_6435 | 581 |
| 251 | 3300060353 | Ga0501082_0138497 | Ga0501082_0138497_140_1990 | 581 |
| 252 | iso_pu_bacteria | 2739367664 | 2739650373 | 581 |
| 253 | iso_pu_bacteria | 2739367865 | 2740028846 | 581 |
| 254 | iso_pu_bacteria | 2895880812 | 2895882645 | 581 |
| 255 | 3300002987 | JGI25159J45721_1007784 | JGI25159J45721_10077841 | 582 |
| 256 | 3300003187 | JGI25151J46595_10001638 | JGI25151J46595_100016389 | 582 |
| 257 | 3300003791 | Ga0055530_10002492 | Ga0055530_100024925 | 582 |
| 258 | 3300003794 | Ga0055531_10000008 | Ga0055531_10000008125 | 582 |
| 259 | 3300005262 | Ga0065165_1001443 | Ga0065165_100144315 | 582 |
| 260 | 3300005347 | Ga0070668_100019269 | Ga0070668_1000192692 | 582 |
| 261 | 3300005367 | Ga0070667_100000067 | Ga0070667_10000006779 | 582 |
| 262 | 3300005367 | Ga0070667_100019588 | Ga0070667_1000195884 | 582 |
| 263 | 3300005841 | Ga0068863_100000038 | Ga0068863_10000003877 | 582 |
| 264 | 3300005844 | Ga0068862_100004188 | Ga0068862_1000041887 | 582 |
| 265 | 3300005985 | Ga0081539_10018190 | Ga0081539_100181902 | 582 |
| 266 | 3300014326 | Ga0157380_10051349 | Ga0157380_100513492 | 582 |
| 267 | 3300025284 | Ga0209130_1000512 | Ga0209130_10005128 | 582 |
| 268 | 3300025294 | Ga0209025_1000114 | Ga0209025_1000114101 | 582 |
| 269 | 3300025297 | Ga0209758_1001428 | Ga0209758_100142816 | 582 |
| 270 | 3300025298 | Ga0209050_1000026 | Ga0209050_100002658 | 582 |
| 271 | 3300025302 | Ga0207426_1000181 | Ga0207426_100018171 | 582 |
| 272 | 3300025304 | Ga0209257_1000009 | Ga0209257_100000958 | 582 |
| 273 | 3300025907 | Ga0207645_10004405 | Ga0207645_100044055 | 582 |
| 274 | 3300025919 | Ga0207657_10009966 | Ga0207657_1000996611 | 582 |
| 275 | 3300025972 | Ga0207668_10000629 | Ga0207668_1000062912 | 582 |
| 276 | 3300025986 | Ga0207658_10000089 | Ga0207658_1000008954 | 582 |
| 277 | 3300025986 | Ga0207658_10009504 | Ga0207658_100095045 | 582 |
| 278 | 3300026088 | Ga0207641_10000060 | Ga0207641_1000006084 | 582 |
| 279 | 3300028380 | Ga0268265_10006174 | Ga0268265_100061743 | 582 |
| 280 | 3300031507 | Ga0307509_10000115 | Ga0307509_1000011541 | 582 |
| 281 | 3300031911 | Ga0307412_10007668 | Ga0307412_100076686 | 582 |
| 282 | 3300032004 | Ga0307414_10022219 | Ga0307414_100222191 | 582 |
| 283 | 3300039437 | Ga0436365_1277439 | Ga0436365_1277439_575_2401 | 582 |
| 284 | 3300046500 | Ga0495596_0007033 | Ga0495596_0007033_1868_3703 | 582 |
| 285 | 3300046512 | Ga0495610_0021839 | Ga0495610_0021839_293_2107 | 582 |
| 286 | 3300047472 | Ga0495686_0000013 | Ga0495686_0000013_25539_27374 | 582 |
| 287 | 3300048927 | Ga0496124_0007214 | Ga0496124_0007214_7142_8962 | 582 |
| 288 | 3300049823 | Ga0501044_0011325 | Ga0501044_0011325_129_1934 | 582 |
| 289 | 3300053134 | Ga0500658_0002704 | Ga0500658_0002704_3259_5091 | 582 |
| 290 | 3300053156 | Ga0500622_0006524 | Ga0500622_0006524_2276_4099 | 582 |
| 291 | 3300053157 | Ga0500624_000001 | Ga0500624_000001_59276_61090 | 582 |
| 292 | 3300053178 | Ga0500637_0000097 | Ga0500637_0000097_3718_5532 | 582 |
| 293 | iso_pu_bacteria | 2643221560 | 2643820085 | 582 |
| 294 | iso_pu_bacteria | 2643221563 | 2643836386 | 582 |
| 295 | iso_pu_bacteria | 2643221608 | 2644052862 | 582 |
| 296 | iso_pu_bacteria | 2852653556 | 2852653986 | 582 |
| 297 | iso_pu_bacteria | 2852680915 | 2852683260 | 582 |
| 298 | 3300005333 | Ga0070677_10001757 | Ga0070677_100017575 | 583 |
| 299 | 3300005353 | Ga0070669_100021839 | Ga0070669_1000218394 | 583 |
| 300 | 3300005354 | Ga0070675_100023281 | Ga0070675_1000232815 | 583 |
| 301 | 3300005841 | Ga0068863_100006939 | Ga0068863_1000069399 | 583 |
| 302 | 3300005843 | Ga0068860_100024655 | Ga0068860_1000246553 | 583 |
| 303 | 3300005844 | Ga0068862_100000485 | Ga0068862_10000048517 | 583 |
| 304 | 3300013100 | Ga0157373_10009216 | Ga0157373_100092166 | 583 |
| 305 | 3300025893 | Ga0207682_10002080 | Ga0207682_100020805 | 583 |
| 306 | 3300025900 | Ga0207710_10008695 | Ga0207710_100086952 | 583 |
| 307 | 3300025909 | Ga0207705_10051400 | Ga0207705_100514002 | 583 |
| 308 | 3300025923 | Ga0207681_10027414 | Ga0207681_100274142 | 583 |
| 309 | 3300025925 | Ga0207650_10020051 | Ga0207650_100200513 | 583 |
| 310 | 3300025926 | Ga0207659_10054702 | Ga0207659_100547022 | 583 |
| 311 | 3300025933 | Ga0207706_10120023 | Ga0207706_101200232 | 583 |
| 312 | 3300025941 | Ga0207711_10074113 | Ga0207711_100741133 | 583 |
| 313 | 3300025961 | Ga0207712_10000008 | Ga0207712_1000000811 | 583 |
| 314 | 3300026088 | Ga0207641_10004584 | Ga0207641_100045847 | 583 |
| 315 | 3300027876 | Ga0209974_10003218 | Ga0209974_100032185 | 583 |
| 316 | 3300028380 | Ga0268265_10000082 | Ga0268265_1000008281 | 583 |
| 317 | 3300028381 | Ga0268264_10000933 | Ga0268264_1000093312 | 583 |
| 318 | 3300028381 | Ga0268264_10000935 | Ga0268264_1000093513 | 583 |
| 319 | 3300031548 | Ga0307408_100017748 | Ga0307408_1000177484 | 583 |
| 320 | 3300031731 | Ga0307405_10010450 | Ga0307405_100104502 | 583 |
| 321 | 3300031824 | Ga0307413_10001504 | Ga0307413_100015045 | 583 |
| 322 | 3300031824 | Ga0307413_10007329 | Ga0307413_100073295 | 583 |
| 323 | 3300031824 | Ga0307413_10029103 | Ga0307413_100291033 | 583 |
| 324 | 3300031852 | Ga0307410_10002446 | Ga0307410_1000244611 | 583 |
| 325 | 3300031852 | Ga0307410_10003698 | Ga0307410_100036985 | 583 |
| 326 | 3300031852 | Ga0307410_10004043 | Ga0307410_100040435 | 583 |
| 327 | 3300031852 | Ga0307410_10019814 | Ga0307410_100198142 | 583 |
| 328 | 3300031852 | Ga0307410_10021645 | Ga0307410_100216454 | 583 |
| 329 | 3300031852 | Ga0307410_10074721 | Ga0307410_100747212 | 583 |
| 330 | 3300031903 | Ga0307407_10004107 | Ga0307407_100041073 | 583 |
| 331 | 3300031903 | Ga0307407_10019115 | Ga0307407_100191153 | 583 |
| 332 | 3300031911 | Ga0307412_10045050 | Ga0307412_100450502 | 583 |
| 333 | 3300031995 | Ga0307409_100023016 | Ga0307409_1000230162 | 583 |
| 334 | 3300032004 | Ga0307414_10002088 | Ga0307414_100020882 | 583 |
| 335 | 3300032004 | Ga0307414_10002337 | Ga0307414_100023372 | 583 |
| 336 | 3300032004 | Ga0307414_10019577 | Ga0307414_100195774 | 583 |
| 337 | 3300032004 | Ga0307414_10028125 | Ga0307414_100281254 | 583 |
| 338 | 3300032004 | Ga0307414_10050216 | Ga0307414_100502162 | 583 |
| 339 | 3300032005 | Ga0307411_10005751 | Ga0307411_100057512 | 583 |
| 340 | 3300032005 | Ga0307411_10034144 | Ga0307411_100341442 | 583 |
| 341 | 3300032126 | Ga0307415_100012323 | Ga0307415_1000123235 | 583 |
| 342 | 3300037418 | Ga0395900_0000503 | Ga0395900_0000503_14630_16513 | 583 |
| 343 | 3300037471 | Ga0395905_0007001 | Ga0395905_0007001_4485_6368 | 583 |
| 344 | 3300038443 | Ga0395901_0000520 | Ga0395901_0000520_7331_9214 | 583 |
| 345 | 3300045051 | Ga0451576_0000023 | Ga0451576_0000023_186816_188678 | 583 |
| 346 | 3300046616 | Ga0495668_0061841 | Ga0495668_0061841_84_1919 | 583 |
| 347 | 3300048090 | Ga0495615_0002333 | Ga0495615_0002333_331_2178 | 583 |
| 348 | 3300053087 | Ga0500643_023489 | Ga0500643_023489_46_1878 | 583 |
| 349 | 3300053134 | Ga0500658_0000108 | Ga0500658_0000108_28834_30669 | 583 |
| 350 | 3300053153 | Ga0500616_0003384 | Ga0500616_0003384_5858_7678 | 583 |
| 351 | iso_pu_bacteria | 2512564014 | 2512642122 | 583 |
| 352 | iso_pu_bacteria | 2808606401 | 2809063651 | 583 |
| 353 | iso_pu_bacteria | 2808606404 | 2809079731 | 583 |
| 354 | iso_pu_bacteria | 2808606405 | 2809084096 | 583 |
| 355 | iso_pu_bacteria | 2830075706 | 2830077115 | 583 |
| 356 | iso_pu_bacteria | 2880518877 | 2880519420 | 583 |
| 357 | iso_pu_bacteria | 2919709256 | 2919711158 | 583 |
| 358 | iso_pu_bacteria | 2946787523 | 2946788831 | 583 |
| 359 | iso_pu_bacteria | 2984564862 | 2984567767 | 583 |
| 360 | 2162886007 | SwRhRL2b_contig_3705000 | SwRhRL2b_0172.00002390 | 584 |
| 361 | 3300005262 | Ga0065165_1002698 | Ga0065165_10026988 | 584 |
| 362 | 3300005289 | Ga0065704_10000191 | Ga0065704_10000191162 | 584 |
| 363 | 3300005364 | Ga0070673_100029291 | Ga0070673_1000292913 | 584 |
| 364 | 3300005367 | Ga0070667_100000459 | Ga0070667_10000045925 | 584 |
| 365 | 3300005841 | Ga0068863_100011823 | Ga0068863_1000118235 | 584 |
| 366 | 3300009177 | Ga0105248_10025435 | Ga0105248_100254356 | 584 |
| 367 | 3300009553 | Ga0105249_10000064 | Ga0105249_1000006453 | 584 |
| 368 | 3300014325 | Ga0163163_10000107 | Ga0163163_1000010745 | 584 |
| 369 | 3300014326 | Ga0157380_10003455 | Ga0157380_1000345510 | 584 |
| 370 | 3300014968 | Ga0157379_10065983 | Ga0157379_100659832 | 584 |
| 371 | 3300025298 | Ga0209050_1014081 | Ga0209050_10140812 | 584 |
| 372 | 3300025986 | Ga0207658_10000291 | Ga0207658_1000029126 | 584 |
| 373 | 3300026088 | Ga0207641_10018011 | Ga0207641_100180114 | 584 |
| 374 | 3300031731 | Ga0307405_10000391 | Ga0307405_100003915 | 584 |
| 375 | 3300031824 | Ga0307413_10051241 | Ga0307413_100512412 | 584 |
| 376 | 3300031911 | Ga0307412_10010587 | Ga0307412_100105874 | 584 |
| 377 | 3300032002 | Ga0307416_100139612 | Ga0307416_1001396121 | 584 |
| 378 | 3300046453 | Ga0495627_000158 | Ga0495627_000158_50956_52779 | 584 |
| 379 | 3300046453 | Ga0495627_001522 | Ga0495627_001522_835_2655 | 584 |
| 380 | 3300046471 | Ga0495650_0008181 | Ga0495650_0008181_1627_3450 | 584 |
| 381 | 3300046500 | Ga0495596_0000141 | Ga0495596_0000141_40428_42260 | 584 |
| 382 | 3300046512 | Ga0495610_0000020 | Ga0495610_0000020_308132_309955 | 584 |
| 383 | 3300046512 | Ga0495610_0000071 | Ga0495610_0000071_33774_35594 | 584 |
| 384 | 3300046512 | Ga0495610_0002395 | Ga0495610_0002395_12373_14199 | 584 |
| 385 | 3300046512 | Ga0495610_0005363 | Ga0495610_0005363_4063_5898 | 584 |
| 386 | 3300046522 | Ga0495643_0000132 | Ga0495643_0000132_98056_99882 | 584 |
| 387 | 3300046538 | Ga0495609_0005528 | Ga0495609_0005528_4323_6155 | 584 |
| 388 | 3300046616 | Ga0495668_0015770 | Ga0495668_0015770_1746_3551 | 584 |
| 389 | 3300046660 | Ga0495625_0043887 | Ga0495625_0043887_639_2471 | 584 |
| 390 | 3300047470 | Ga0495681_0000008 | Ga0495681_0000008_4729_6549 | 584 |
| 391 | 3300047470 | Ga0495681_0000094 | Ga0495681_0000094_51146_52969 | 584 |
| 392 | 3300048090 | Ga0495615_0000239 | Ga0495615_0000239_6538_8361 | 584 |
| 393 | 3300048905 | Ga0496102_0008515 | Ga0496102_0008515_3389_5194 | 584 |
| 394 | 3300048906 | Ga0496103_0000984 | Ga0496103_0000984_13323_15128 | 584 |
| 395 | 3300048907 | Ga0496104_0083563 | Ga0496104_0083563_530_2335 | 584 |
| 396 | 3300048911 | Ga0496108_0019377 | Ga0496108_0019377_3638_5509 | 584 |
| 397 | 3300048919 | Ga0496116_0000028 | Ga0496116_0000028_207777_209612 | 584 |
| 398 | 3300048924 | Ga0496121_0004566 | Ga0496121_0004566_14423_16258 | 584 |
| 399 | 3300048925 | Ga0496122_0002369 | Ga0496122_0002369_10364_12199 | 584 |
| 400 | 3300048925 | Ga0496122_0009082 | Ga0496122_0009082_2852_4675 | 584 |
| 401 | 3300048926 | Ga0496123_0001557 | Ga0496123_0001557_18921_20756 | 584 |
| 402 | 3300048926 | Ga0496123_0007047 | Ga0496123_0007047_3026_4849 | 584 |
| 403 | 3300048927 | Ga0496124_0037659 | Ga0496124_0037659_2187_4022 | 584 |
| 404 | 3300048929 | Ga0496126_0000079 | Ga0496126_0000079_33207_35042 | 584 |
| 405 | 3300049663 | Ga0501223_000495 | Ga0501223_000495_7609_9477 | 584 |
| 406 | 3300049664 | Ga0501224_000006 | Ga0501224_000006_140172_142040 | 584 |
| 407 | 3300049668 | Ga0501233_000165 | Ga0501233_000165_82_1950 | 584 |
| 408 | 3300049705 | Ga0501225_0000845 | Ga0501225_0000845_7577_9445 | 584 |
| 409 | iso_pu_bacteria | 2599185354 | 2600202669 | 584 |
| 410 | iso_pu_bacteria | 2599185359 | 2600226475 | 584 |
| 411 | iso_pu_bacteria | 2643221622 | 2644128894 | 584 |
| 412 | iso_pu_bacteria | 2738541275 | 2738712570 | 584 |
| 413 | iso_pu_bacteria | 2738541301 | 2738850994 | 584 |
| 414 | iso_pu_bacteria | 2738541304 | 2738866724 | 584 |
| 415 | iso_pu_bacteria | 2738543022 | 2739299241 | 584 |
| 416 | iso_pu_bacteria | 2738543033 | 2739360920 | 584 |
| 417 | iso_pu_bacteria | 2751185897 | 2753764454 | 584 |
| 418 | iso_pu_bacteria | 2818991466 | 2819712544 | 584 |
| 419 | iso_pu_bacteria | 2879163058 | 2879166644 | 584 |
| 420 | iso_pu_bacteria | 2928027323 | 2928030895 | 584 |
| 421 | iso_pu_bacteria | 2928100450 | 2928103878 | 584 |
| 422 | iso_pu_bacteria | 2928526807 | 2928527137 | 584 |
| 423 | iso_pu_bacteria | 2928959182 | 2928961807 | 584 |
| 424 | iso_pu_bacteria | 2928968154 | 2928969377 | 584 |
| 425 | iso_pu_bacteria | 2984555340 | 2984557867 | 584 |
| 426 | iso_pu_bacteria | 2993356040 | 2993358819 | 584 |
| 427 | 3300001904 | JGI24736J21556_1000121 | JGI24736J21556_10001213 | 585 |
| 428 | 3300002067 | JGI24735J21928_10000918 | JGI24735J21928_100009181 | 585 |
| 429 | 3300005289 | Ga0065704_10100052 | Ga0065704_101000522 | 585 |
| 430 | 3300005335 | Ga0070666_10029018 | Ga0070666_100290183 | 585 |
| 431 | 3300005344 | Ga0070661_100026844 | Ga0070661_1000268442 | 585 |
| 432 | 3300005347 | Ga0070668_100004087 | Ga0070668_1000040875 | 585 |
| 433 | 3300005539 | Ga0068853_100020182 | Ga0068853_1000201825 | 585 |
| 434 | 3300005548 | Ga0070665_100002933 | Ga0070665_1000029338 | 585 |
| 435 | 3300005564 | Ga0070664_100090692 | Ga0070664_1000906922 | 585 |
| 436 | 3300005841 | Ga0068863_100008950 | Ga0068863_1000089505 | 585 |
| 437 | 3300005844 | Ga0068862_100030185 | Ga0068862_1000301852 | 585 |
| 438 | 3300005844 | Ga0068862_100059599 | Ga0068862_1000595993 | 585 |
| 439 | 3300015690 | Ga0183363_1001 | Ga0183363_100176 | 585 |
| 440 | 3300025735 | Ga0207713_1002611 | Ga0207713_10026116 | 585 |
| 441 | 3300025903 | Ga0207680_10023993 | Ga0207680_100239933 | 585 |
| 442 | 3300025904 | Ga0207647_10031699 | Ga0207647_100316991 | 585 |
| 443 | 3300025931 | Ga0207644_10003746 | Ga0207644_100037462 | 585 |
| 444 | 3300025941 | Ga0207711_10018314 | Ga0207711_100183144 | 585 |
| 445 | 3300025949 | Ga0207667_10014565 | Ga0207667_100145658 | 585 |
| 446 | 3300025972 | Ga0207668_10068228 | Ga0207668_100682282 | 585 |
| 447 | 3300025986 | Ga0207658_10012206 | Ga0207658_100122064 | 585 |
| 448 | 3300026041 | Ga0207639_10026227 | Ga0207639_100262272 | 585 |
| 449 | 3300028379 | Ga0268266_10004036 | Ga0268266_100040369 | 585 |
| 450 | 3300031852 | Ga0307410_10037184 | Ga0307410_100371842 | 585 |
| 451 | 3300046506 | Ga0495583_0010721 | Ga0495583_0010721_1480_3312 | 585 |
| 452 | 3300046616 | Ga0495668_0067068 | Ga0495668_0067068_61_1893 | 585 |
| 453 | 3300048906 | Ga0496103_0024978 | Ga0496103_0024978_1722_3536 | 585 |
| 454 | 3300048921 | Ga0496118_0033548 | Ga0496118_0033548_625_2439 | 585 |
| 455 | 3300048927 | Ga0496124_0009700 | Ga0496124_0009700_3534_5360 | 585 |
| 456 | 3300053087 | Ga0500643_000001 | Ga0500643_000001_1144660_1146540 | 585 |
| 457 | 3300053121 | Ga0500607_002875 | Ga0500607_002875_8800_10620 | 585 |
| 458 | 3300053122 | Ga0500608_004409 | Ga0500608_004409_1712_3526 | 585 |
| 459 | 3300053723 | Ga0500567_000103 | Ga0500567_000103_17393_19207 | 585 |
| 460 | 3300053729 | Ga0500625_000029 | Ga0500625_000029_7426_9240 | 585 |
| 461 | 3300003781 | Ga0055536_1003381 | Ga0055536_10033811 | 586 |
| 462 | 3300003791 | Ga0055530_10001655 | Ga0055530_100016558 | 586 |
| 463 | 3300003794 | Ga0055531_10001722 | Ga0055531_1000172213 | 586 |
| 464 | 3300005578 | Ga0068854_100013256 | Ga0068854_1000132562 | 586 |
| 465 | 3300025291 | Ga0209675_1000838 | Ga0209675_10008382 | 586 |
| 466 | 3300025292 | Ga0209676_1000518 | Ga0209676_100051813 | 586 |
| 467 | 3300025292 | Ga0209676_1000554 | Ga0209676_100055456 | 586 |
| 468 | 3300025298 | Ga0209050_1000017 | Ga0209050_100001787 | 586 |
| 469 | 3300025304 | Ga0209257_1002894 | Ga0209257_100289413 | 586 |
| 470 | 3300025304 | Ga0209257_1005509 | Ga0209257_10055096 | 586 |
| 471 | 3300025941 | Ga0207711_10003634 | Ga0207711_100036349 | 586 |
| 472 | 3300025981 | Ga0207640_10009509 | Ga0207640_100095095 | 586 |
| 473 | 3300031911 | Ga0307412_10078260 | Ga0307412_100782602 | 586 |
| 474 | 3300033180 | Ga0307510_10016486 | Ga0307510_100164867 | 586 |
| 475 | 3300046660 | Ga0495625_0000553 | Ga0495625_0000553_16219_18033 | 586 |
| 476 | 3300048905 | Ga0496102_0000120 | Ga0496102_0000120_65792_67609 | 586 |
| 477 | 3300048906 | Ga0496103_0000154 | Ga0496103_0000154_10924_12741 | 586 |
| 478 | 3300048919 | Ga0496116_0004809 | Ga0496116_0004809_600_2417 | 586 |
| 479 | 3300048920 | Ga0496117_0000317 | Ga0496117_0000317_17127_18944 | 586 |
| 480 | 3300048921 | Ga0496118_0000303 | Ga0496118_0000303_17131_18948 | 586 |
| 481 | 3300048922 | Ga0496119_0047407 | Ga0496119_0047407_210_2027 | 586 |
| 482 | 3300048927 | Ga0496124_0000214 | Ga0496124_0000214_44824_46641 | 586 |
| 483 | iso_pu_bacteria | 2885427238 | 2885428352 | 586 |
| 484 | 3300001976 | JGI24752J21851_1000155 | JGI24752J21851_10001558 | 587 |
| 485 | 3300001976 | JGI24752J21851_1000461 | JGI24752J21851_10004617 | 587 |
| 486 | 3300001990 | JGI24737J22298_10003404 | JGI24737J22298_100034042 | 587 |
| 487 | 3300002070 | JGI24750J21931_1000359 | JGI24750J21931_10003595 | 587 |
| 488 | 3300002074 | JGI24748J21848_1000044 | JGI24748J21848_100004438 | 587 |
| 489 | 3300002076 | JGI24749J21850_1000330 | JGI24749J21850_10003306 | 587 |
| 490 | 3300002076 | JGI24749J21850_1000531 | JGI24749J21850_10005312 | 587 |
| 491 | 3300002239 | JGI24034J26672_10000020 | JGI24034J26672_1000002017 | 587 |
| 492 | 3300002244 | JGI24742J22300_10001043 | JGI24742J22300_100010434 | 587 |
| 493 | 3300002459 | JGI24751J29686_10000052 | JGI24751J29686_1000005225 | 587 |
| 494 | 3300002774 | JGI25150J39212_1000046 | JGI25150J39212_10000464 | 587 |
| 495 | 3300003214 | JGI25165J46597_1000073 | JGI25165J46597_100007360 | 587 |
| 496 | 3300003215 | JGI25153J46596_10000124 | JGI25153J46596_1000012467 | 587 |
| 497 | 3300003759 | Ga0055525_1000090 | Ga0055525_1000090143 | 587 |
| 498 | 3300003762 | Ga0055542_1000046 | Ga0055542_1000046188 | 587 |
| 499 | 3300003763 | Ga0055529_1000007 | Ga0055529_100000741 | 587 |
| 500 | 3300003763 | Ga0055529_1000109 | Ga0055529_100010930 | 587 |
| 501 | 3300003771 | Ga0055526_1007061 | Ga0055526_10070616 | 587 |
| 502 | 3300003775 | Ga0055524_1001907 | Ga0055524_10019079 | 587 |
| 503 | 3300003781 | Ga0055536_1008867 | Ga0055536_10088673 | 587 |
| 504 | 3300003791 | Ga0055530_10013862 | Ga0055530_100138621 | 587 |
| 505 | 3300003792 | Ga0055540_1003937 | Ga0055540_10039374 | 587 |
| 506 | 3300003794 | Ga0055531_10009693 | Ga0055531_100096933 | 587 |
| 507 | 3300005289 | Ga0065704_10081289 | Ga0065704_100812892 | 587 |
| 508 | 3300005295 | Ga0065707_10081865 | Ga0065707_1008186538 | 587 |
| 509 | 3300005295 | Ga0065707_10086251 | Ga0065707_100862515 | 587 |
| 510 | 3300005327 | Ga0070658_10000227 | Ga0070658_1000022715 | 587 |
| 511 | 3300005330 | Ga0070690_100000180 | Ga0070690_1000001802 | 587 |
| 512 | 3300005331 | Ga0070670_100000024 | Ga0070670_10000002487 | 587 |
| 513 | 3300005331 | Ga0070670_100000792 | Ga0070670_10000079231 | 587 |
| 514 | 3300005331 | Ga0070670_100032156 | Ga0070670_1000321564 | 587 |
| 515 | 3300005331 | Ga0070670_100052533 | Ga0070670_1000525332 | 587 |
| 516 | 3300005335 | Ga0070666_10000027 | Ga0070666_1000002751 | 587 |
| 517 | 3300005335 | Ga0070666_10000352 | Ga0070666_1000035227 | 587 |
| 518 | 3300005340 | Ga0070689_100008132 | Ga0070689_1000081328 | 587 |
| 519 | 3300005344 | Ga0070661_100002364 | Ga0070661_1000023646 | 587 |
| 520 | 3300005347 | Ga0070668_100000068 | Ga0070668_10000006836 | 587 |
| 521 | 3300005347 | Ga0070668_100019894 | Ga0070668_1000198943 | 587 |
| 522 | 3300005347 | Ga0070668_100066155 | Ga0070668_1000661552 | 587 |
| 523 | 3300005353 | Ga0070669_100000018 | Ga0070669_10000001813 | 587 |
| 524 | 3300005353 | Ga0070669_100000047 | Ga0070669_10000004791 | 587 |
| 525 | 3300005353 | Ga0070669_100000099 | Ga0070669_10000009940 | 587 |
| 526 | 3300005353 | Ga0070669_100001232 | Ga0070669_10000123213 | 587 |
| 527 | 3300005355 | Ga0070671_100000011 | Ga0070671_100000011183 | 587 |
| 528 | 3300005355 | Ga0070671_100004632 | Ga0070671_1000046326 | 587 |
| 529 | 3300005355 | Ga0070671_100008988 | Ga0070671_1000089882 | 587 |
| 530 | 3300005365 | Ga0070688_100000293 | Ga0070688_10000029317 | 587 |
| 531 | 3300005367 | Ga0070667_100000290 | Ga0070667_1000002906 | 587 |
| 532 | 3300005367 | Ga0070667_100000480 | Ga0070667_10000048016 | 587 |
| 533 | 3300005367 | Ga0070667_100012620 | Ga0070667_1000126206 | 587 |
| 534 | 3300005456 | Ga0070678_100000076 | Ga0070678_10000007625 | 587 |
| 535 | 3300005457 | Ga0070662_100058572 | Ga0070662_1000585722 | 587 |
| 536 | 3300005466 | Ga0070685_10000238 | Ga0070685_1000023835 | 587 |
| 537 | 3300005530 | Ga0070679_100000168 | Ga0070679_10000016825 | 587 |
| 538 | 3300005544 | Ga0070686_100000010 | Ga0070686_100000010119 | 587 |
| 539 | 3300005548 | Ga0070665_100000254 | Ga0070665_10000025459 | 587 |
| 540 | 3300005617 | Ga0068859_100002363 | Ga0068859_10000236311 | 587 |
| 541 | 3300005617 | Ga0068859_100004889 | Ga0068859_1000048896 | 587 |
| 542 | 3300005617 | Ga0068859_100006146 | Ga0068859_1000061469 | 587 |
| 543 | 3300005617 | Ga0068859_100013485 | Ga0068859_1000134859 | 587 |
| 544 | 3300005617 | Ga0068859_100020790 | Ga0068859_1000207905 | 587 |
| 545 | 3300005617 | Ga0068859_100109660 | Ga0068859_1001096602 | 587 |
| 546 | 3300005618 | Ga0068864_100000036 | Ga0068864_10000003688 | 587 |
| 547 | 3300005618 | Ga0068864_100000063 | Ga0068864_10000006346 | 587 |
| 548 | 3300005618 | Ga0068864_100001646 | Ga0068864_10000164611 | 587 |
| 549 | 3300005618 | Ga0068864_100003044 | Ga0068864_10000304413 | 587 |
| 550 | 3300005719 | Ga0068861_100000005 | Ga0068861_10000000522 | 587 |
| 551 | 3300005719 | Ga0068861_100002905 | Ga0068861_1000029059 | 587 |
| 552 | 3300005719 | Ga0068861_100007125 | Ga0068861_1000071255 | 587 |
| 553 | 3300005719 | Ga0068861_100013995 | Ga0068861_1000139955 | 587 |
| 554 | 3300005841 | Ga0068863_100000001 | Ga0068863_100000001198 | 587 |
| 555 | 3300005841 | Ga0068863_100000062 | Ga0068863_10000006246 | 587 |
| 556 | 3300005841 | Ga0068863_100000603 | Ga0068863_10000060320 | 587 |
| 557 | 3300005841 | Ga0068863_100000775 | Ga0068863_1000007759 | 587 |
| 558 | 3300005841 | Ga0068863_100003283 | Ga0068863_1000032831 | 587 |
| 559 | 3300005841 | Ga0068863_100010531 | Ga0068863_1000105315 | 587 |
| 560 | 3300005842 | Ga0068858_100000530 | Ga0068858_10000053038 | 587 |
| 561 | 3300005842 | Ga0068858_100003512 | Ga0068858_10000351211 | 587 |
| 562 | 3300005843 | Ga0068860_100000080 | Ga0068860_100000080118 | 587 |
| 563 | 3300005844 | Ga0068862_100000033 | Ga0068862_10000003317 | 587 |
| 564 | 3300005844 | Ga0068862_100000069 | Ga0068862_10000006949 | 587 |
| 565 | 3300005844 | Ga0068862_100000115 | Ga0068862_10000011548 | 587 |
| 566 | 3300005844 | Ga0068862_100005633 | Ga0068862_1000056339 | 587 |
| 567 | 3300005844 | Ga0068862_100032674 | Ga0068862_1000326742 | 587 |
| 568 | 3300005937 | Ga0081455_10002228 | Ga0081455_1000222828 | 587 |
| 569 | 3300006353 | Ga0075370_10024116 | Ga0075370_100241163 | 587 |
| 570 | 3300006846 | Ga0075430_100018966 | Ga0075430_1000189665 | 587 |
| 571 | 3300006931 | Ga0097620_100002363 | Ga0097620_10000236311 | 587 |
| 572 | 3300006931 | Ga0097620_100004889 | Ga0097620_1000048896 | 587 |
| 573 | 3300006931 | Ga0097620_100006146 | Ga0097620_1000061463 | 587 |
| 574 | 3300006931 | Ga0097620_100013486 | Ga0097620_1000134869 | 587 |
| 575 | 3300006931 | Ga0097620_100020789 | Ga0097620_1000207895 | 587 |
| 576 | 3300006931 | Ga0097620_100109659 | Ga0097620_1001096592 | 587 |
| 577 | 3300009011 | Ga0105251_10001006 | Ga0105251_1000100622 | 587 |
| 578 | 3300009101 | Ga0105247_10004862 | Ga0105247_100048626 | 587 |
| 579 | 3300009148 | Ga0105243_10000224 | Ga0105243_1000022412 | 587 |
| 580 | 3300009174 | Ga0105241_10097937 | Ga0105241_100979371 | 587 |
| 581 | 3300009177 | Ga0105248_10000091 | Ga0105248_1000009187 | 587 |
| 582 | 3300009177 | Ga0105248_10000536 | Ga0105248_1000053623 | 587 |
| 583 | 3300009177 | Ga0105248_10009842 | Ga0105248_100098429 | 587 |
| 584 | 3300009177 | Ga0105248_10036917 | Ga0105248_100369175 | 587 |
| 585 | 3300009551 | Ga0105238_10047095 | Ga0105238_100470953 | 587 |
| 586 | 3300009551 | Ga0105238_10062799 | Ga0105238_100627994 | 587 |
| 587 | 3300009553 | Ga0105249_10000160 | Ga0105249_1000016064 | 587 |
| 588 | 3300009553 | Ga0105249_10017175 | Ga0105249_100171755 | 587 |
| 589 | 3300009553 | Ga0105249_10025445 | Ga0105249_100254455 | 587 |
| 590 | 3300009553 | Ga0105249_10064607 | Ga0105249_100646073 | 587 |
| 591 | 3300013102 | Ga0157371_10000097 | Ga0157371_10000097102 | 587 |
| 592 | 3300013297 | Ga0157378_10003298 | Ga0157378_1000329811 | 587 |
| 593 | 3300013306 | Ga0163162_10048106 | Ga0163162_100481064 | 587 |
| 594 | 3300014326 | Ga0157380_10000086 | Ga0157380_1000008641 | 587 |
| 595 | 3300014326 | Ga0157380_10000217 | Ga0157380_1000021716 | 587 |
| 596 | 3300014968 | Ga0157379_10009125 | Ga0157379_100091256 | 587 |
| 597 | 3300017792 | Ga0163161_10000110 | Ga0163161_1000011051 | 587 |
| 598 | 3300025230 | Ga0209563_100111 | Ga0209563_10011113 | 587 |
| 599 | 3300025245 | Ga0207425_1000020 | Ga0207425_1000020347 | 587 |
| 600 | 3300025246 | Ga0209646_1004636 | Ga0209646_10046362 | 587 |
| 601 | 3300025254 | Ga0209148_1000026 | Ga0209148_1000026344 | 587 |
| 602 | 3300025258 | Ga0209129_1000586 | Ga0209129_100058625 | 587 |
| 603 | 3300025261 | Ga0209233_1000142 | Ga0209233_1000142121 | 587 |
| 604 | 3300025263 | Ga0209565_1000008 | Ga0209565_1000008184 | 587 |
| 605 | 3300025263 | Ga0209565_1000210 | Ga0209565_100021010 | 587 |
| 606 | 3300025272 | Ga0209455_1000005 | Ga0209455_10000051091 | 587 |
| 607 | 3300025273 | Ga0209673_1000984 | Ga0209673_10009849 | 587 |
| 608 | 3300025292 | Ga0209676_1008339 | Ga0209676_10083394 | 587 |
| 609 | 3300025294 | Ga0209025_1000326 | Ga0209025_100032669 | 587 |
| 610 | 3300025295 | Ga0209564_1001114 | Ga0209564_100111430 | 587 |
| 611 | 3300025297 | Ga0209758_1000004 | Ga0209758_1000004611 | 587 |
| 612 | 3300025297 | Ga0209758_1017781 | Ga0209758_10177812 | 587 |
| 613 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000012574 | 587 |
| 614 | 3300025299 | Ga0209256_1000009 | Ga0209256_1000009686 | 587 |
| 615 | 3300025299 | Ga0209256_1000010 | Ga0209256_1000010610 | 587 |
| 616 | 3300025303 | Ga0209051_1000476 | Ga0209051_100047657 | 587 |
| 617 | 3300025304 | Ga0209257_1003790 | Ga0209257_10037903 | 587 |
| 618 | 3300025315 | Ga0207697_10000211 | Ga0207697_1000021113 | 587 |
| 619 | 3300025735 | Ga0207713_1001151 | Ga0207713_100115121 | 587 |
| 620 | 3300025900 | Ga0207710_10002208 | Ga0207710_100022082 | 587 |
| 621 | 3300025900 | Ga0207710_10034094 | Ga0207710_100340942 | 587 |
| 622 | 3300025903 | Ga0207680_10000009 | Ga0207680_10000009121 | 587 |
| 623 | 3300025909 | Ga0207705_10000450 | Ga0207705_1000045016 | 587 |
| 624 | 3300025911 | Ga0207654_10004079 | Ga0207654_100040798 | 587 |
| 625 | 3300025912 | Ga0207707_10075179 | Ga0207707_100751792 | 587 |
| 626 | 3300025914 | Ga0207671_10006655 | Ga0207671_100066558 | 587 |
| 627 | 3300025919 | Ga0207657_10011805 | Ga0207657_100118055 | 587 |
| 628 | 3300025920 | Ga0207649_10002255 | Ga0207649_100022557 | 587 |
| 629 | 3300025921 | Ga0207652_10000282 | Ga0207652_1000028224 | 587 |
| 630 | 3300025923 | Ga0207681_10000008 | Ga0207681_10000008240 | 587 |
| 631 | 3300025923 | Ga0207681_10000014 | Ga0207681_10000014173 | 587 |
| 632 | 3300025923 | Ga0207681_10000106 | Ga0207681_1000010646 | 587 |
| 633 | 3300025923 | Ga0207681_10000259 | Ga0207681_100002598 | 587 |
| 634 | 3300025924 | Ga0207694_10020172 | Ga0207694_100201724 | 587 |
| 635 | 3300025924 | Ga0207694_10023064 | Ga0207694_100230642 | 587 |
| 636 | 3300025924 | Ga0207694_10025520 | Ga0207694_100255203 | 587 |
| 637 | 3300025925 | Ga0207650_10000015 | Ga0207650_10000015188 | 587 |
| 638 | 3300025925 | Ga0207650_10015218 | Ga0207650_100152182 | 587 |
| 639 | 3300025925 | Ga0207650_10032859 | Ga0207650_100328594 | 587 |
| 640 | 3300025931 | Ga0207644_10000006 | Ga0207644_10000006230 | 587 |
| 641 | 3300025931 | Ga0207644_10000544 | Ga0207644_100005445 | 587 |
| 642 | 3300025931 | Ga0207644_10003236 | Ga0207644_100032369 | 587 |
| 643 | 3300025932 | Ga0207690_10004587 | Ga0207690_100045873 | 587 |
| 644 | 3300025933 | Ga0207706_10006993 | Ga0207706_1000699310 | 587 |
| 645 | 3300025933 | Ga0207706_10092745 | Ga0207706_100927452 | 587 |
| 646 | 3300025935 | Ga0207709_10000519 | Ga0207709_1000051911 | 587 |
| 647 | 3300025935 | Ga0207709_10011498 | Ga0207709_100114985 | 587 |
| 648 | 3300025936 | Ga0207670_10010660 | Ga0207670_100106604 | 587 |
| 649 | 3300025937 | Ga0207669_10000161 | Ga0207669_1000016126 | 587 |
| 650 | 3300025937 | Ga0207669_10006712 | Ga0207669_100067123 | 587 |
| 651 | 3300025941 | Ga0207711_10000017 | Ga0207711_10000017434 | 587 |
| 652 | 3300025941 | Ga0207711_10000252 | Ga0207711_1000025235 | 587 |
| 653 | 3300025941 | Ga0207711_10023381 | Ga0207711_100233814 | 587 |
| 654 | 3300025944 | Ga0207661_10114574 | Ga0207661_101145742 | 587 |
| 655 | 3300025949 | Ga0207667_10000010 | Ga0207667_10000010349 | 587 |
| 656 | 3300025949 | Ga0207667_10105697 | Ga0207667_101056972 | 587 |
| 657 | 3300025961 | Ga0207712_10000044 | Ga0207712_10000044118 | 587 |
| 658 | 3300025961 | Ga0207712_10000222 | Ga0207712_1000022247 | 587 |
| 659 | 3300025961 | Ga0207712_10006379 | Ga0207712_100063796 | 587 |
| 660 | 3300025961 | Ga0207712_10015834 | Ga0207712_100158343 | 587 |
| 661 | 3300025961 | Ga0207712_10038733 | Ga0207712_100387333 | 587 |
| 662 | 3300025972 | Ga0207668_10000860 | Ga0207668_1000086014 | 587 |
| 663 | 3300025972 | Ga0207668_10001683 | Ga0207668_1000168310 | 587 |
| 664 | 3300025972 | Ga0207668_10009770 | Ga0207668_100097703 | 587 |
| 665 | 3300025972 | Ga0207668_10052374 | Ga0207668_100523742 | 587 |
| 666 | 3300025972 | Ga0207668_10074452 | Ga0207668_100744522 | 587 |
| 667 | 3300025981 | Ga0207640_10009819 | Ga0207640_100098193 | 587 |
| 668 | 3300025986 | Ga0207658_10000133 | Ga0207658_1000013324 | 587 |
| 669 | 3300025986 | Ga0207658_10002473 | Ga0207658_100024739 | 587 |
| 670 | 3300025986 | Ga0207658_10025815 | Ga0207658_100258152 | 587 |
| 671 | 3300025986 | Ga0207658_10026771 | Ga0207658_100267712 | 587 |
| 672 | 3300026035 | Ga0207703_10003167 | Ga0207703_100031675 | 587 |
| 673 | 3300026041 | Ga0207639_10026739 | Ga0207639_100267391 | 587 |
| 674 | 3300026078 | Ga0207702_10007378 | Ga0207702_100073789 | 587 |
| 675 | 3300026078 | Ga0207702_10032064 | Ga0207702_100320642 | 587 |
| 676 | 3300026088 | Ga0207641_10000001 | Ga0207641_10000001535 | 587 |
| 677 | 3300026088 | Ga0207641_10000022 | Ga0207641_10000022181 | 587 |
| 678 | 3300026088 | Ga0207641_10000047 | Ga0207641_10000047170 | 587 |
| 679 | 3300026088 | Ga0207641_10001074 | Ga0207641_1000107411 | 587 |
| 680 | 3300026088 | Ga0207641_10006843 | Ga0207641_100068434 | 587 |
| 681 | 3300026088 | Ga0207641_10016494 | Ga0207641_100164942 | 587 |
| 682 | 3300026095 | Ga0207676_10000021 | Ga0207676_10000021214 | 587 |
| 683 | 3300026095 | Ga0207676_10000056 | Ga0207676_1000005696 | 587 |
| 684 | 3300026095 | Ga0207676_10000827 | Ga0207676_1000082712 | 587 |
| 685 | 3300026095 | Ga0207676_10001517 | Ga0207676_1000151711 | 587 |
| 686 | 3300026095 | Ga0207676_10002294 | Ga0207676_100022947 | 587 |
| 687 | 3300026116 | Ga0207674_10007137 | Ga0207674_1000713710 | 587 |
| 688 | 3300026118 | Ga0207675_100000020 | Ga0207675_10000002042 | 587 |
| 689 | 3300026118 | Ga0207675_100000207 | Ga0207675_10000020732 | 587 |
| 690 | 3300026118 | Ga0207675_100002282 | Ga0207675_10000228213 | 587 |
| 691 | 3300026118 | Ga0207675_100004785 | Ga0207675_10000478510 | 587 |
| 692 | 3300026121 | Ga0207683_10000655 | Ga0207683_1000065525 | 587 |
| 693 | 3300026142 | Ga0207698_10051391 | Ga0207698_100513912 | 587 |
| 694 | 3300028379 | Ga0268266_10000069 | Ga0268266_10000069121 | 587 |
| 695 | 3300028379 | Ga0268266_10016904 | Ga0268266_100169045 | 587 |
| 696 | 3300028380 | Ga0268265_10000013 | Ga0268265_10000013185 | 587 |
| 697 | 3300028380 | Ga0268265_10000044 | Ga0268265_10000044164 | 587 |
| 698 | 3300028380 | Ga0268265_10000100 | Ga0268265_100001003 | 587 |
| 699 | 3300028381 | Ga0268264_10000010 | Ga0268264_1000001024 | 587 |
| 700 | 3300028381 | Ga0268264_10000131 | Ga0268264_10000131118 | 587 |
| 701 | 3300028381 | Ga0268264_10053953 | Ga0268264_100539532 | 587 |
| 702 | 3300031456 | Ga0307513_10075874 | Ga0307513_100758743 | 587 |
| 703 | 3300031616 | Ga0307508_10025163 | Ga0307508_100251636 | 587 |
| 704 | 3300032004 | Ga0307414_10046312 | Ga0307414_100463122 | 587 |
| 705 | 3300038443 | Ga0395901_0023161 | Ga0395901_0023161_2655_4481 | 587 |
| 706 | 3300046453 | Ga0495627_000636 | Ga0495627_000636_20976_22799 | 587 |
| 707 | 3300046460 | Ga0495638_0002237 | Ga0495638_0002237_8476_10287 | 587 |
| 708 | 3300046471 | Ga0495650_0000492 | Ga0495650_0000492_3111_4940 | 587 |
| 709 | 3300046471 | Ga0495650_0012961 | Ga0495650_0012961_1249_3075 | 587 |
| 710 | 3300046506 | Ga0495583_0002564 | Ga0495583_0002564_6707_8536 | 587 |
| 711 | 3300046506 | Ga0495583_0016240 | Ga0495583_0016240_1344_3173 | 587 |
| 712 | 3300046507 | Ga0495606_0000359 | Ga0495606_0000359_61836_63665 | 587 |
| 713 | 3300046522 | Ga0495643_0004044 | Ga0495643_0004044_5417_7246 | 587 |
| 714 | 3300046522 | Ga0495643_0004426 | Ga0495643_0004426_2929_4758 | 587 |
| 715 | 3300046524 | Ga0495648_0000256 | Ga0495648_0000256_3272_5101 | 587 |
| 716 | 3300046525 | Ga0495663_0001269 | Ga0495663_0001269_3532_5361 | 587 |
| 717 | 3300046530 | Ga0495654_0001382 | Ga0495654_0001382_6025_7890 | 587 |
| 718 | 3300046558 | Ga0495633_0002904 | Ga0495633_0002904_572_2401 | 587 |
| 719 | 3300046558 | Ga0495633_0020069 | Ga0495633_0020069_900_2729 | 587 |
| 720 | 3300046616 | Ga0495668_0000163 | Ga0495668_0000163_84996_86825 | 587 |
| 721 | 3300046616 | Ga0495668_0002911 | Ga0495668_0002911_5160_7025 | 587 |
| 722 | 3300046660 | Ga0495625_0000332 | Ga0495625_0000332_63485_65320 | 587 |
| 723 | 3300046660 | Ga0495625_0000568 | Ga0495625_0000568_3603_5432 | 587 |
| 724 | 3300046684 | Ga0495669_0000629 | Ga0495669_0000629_7001_8830 | 587 |
| 725 | 3300046691 | Ga0495670_0000007 | Ga0495670_0000007_50084_51898 | 587 |
| 726 | 3300046794 | Ga0495589_0008334 | Ga0495589_0008334_2146_4011 | 587 |
| 727 | 3300046809 | Ga0495600_0000914 | Ga0495600_0000914_7236_9065 | 587 |
| 728 | 3300047443 | Ga0495687_000511 | Ga0495687_000511_18076_19905 | 587 |
| 729 | 3300047443 | Ga0495687_001938 | Ga0495687_001938_9421_11250 | 587 |
| 730 | 3300047445 | Ga0495677_0000956 | Ga0495677_0000956_475_2304 | 587 |
| 731 | 3300048905 | Ga0496102_0000106 | Ga0496102_0000106_63482_65299 | 587 |
| 732 | 3300048905 | Ga0496102_0002374 | Ga0496102_0002374_7703_9532 | 587 |
| 733 | 3300048906 | Ga0496103_0000095 | Ga0496103_0000095_38730_40547 | 587 |
| 734 | 3300048906 | Ga0496103_0001305 | Ga0496103_0001305_8796_10625 | 587 |
| 735 | 3300048913 | Ga0496110_0008273 | Ga0496110_0008273_3519_5348 | 587 |
| 736 | 3300048918 | Ga0496115_0000172 | Ga0496115_0000172_6389_8218 | 587 |
| 737 | 3300048919 | Ga0496116_0014370 | Ga0496116_0014370_1934_3763 | 587 |
| 738 | 3300048920 | Ga0496117_0000366 | Ga0496117_0000366_55676_57493 | 587 |
| 739 | 3300048920 | Ga0496117_0000582 | Ga0496117_0000582_6546_8375 | 587 |
| 740 | 3300048920 | Ga0496117_0003953 | Ga0496117_0003953_160_1974 | 587 |
| 741 | 3300048921 | Ga0496118_0000392 | Ga0496118_0000392_29120_30949 | 587 |
| 742 | 3300048921 | Ga0496118_0003549 | Ga0496118_0003549_4506_6320 | 587 |
| 743 | 3300048924 | Ga0496121_0005396 | Ga0496121_0005396_6627_8456 | 587 |
| 744 | 3300048925 | Ga0496122_0001187 | Ga0496122_0001187_16293_18197 | 587 |
| 745 | 3300048925 | Ga0496122_0017843 | Ga0496122_0017843_3721_5550 | 587 |
| 746 | 3300048926 | Ga0496123_0000518 | Ga0496123_0000518_3670_5574 | 587 |
| 747 | 3300048927 | Ga0496124_0000606 | Ga0496124_0000606_51831_53660 | 587 |
| 748 | 3300048928 | Ga0496125_0000666 | Ga0496125_0000666_6767_8596 | 587 |
| 749 | 3300048929 | Ga0496126_0004606 | Ga0496126_0004606_6549_8378 | 587 |
| 750 | 3300049515 | Ga0501292_000172 | Ga0501292_000172_6907_8736 | 587 |
| 751 | 3300049517 | Ga0501294_000303 | Ga0501294_000303_3692_5521 | 587 |
| 752 | 3300049523 | Ga0501300_000548 | Ga0501300_000548_2870_4699 | 587 |
| 753 | 3300049581 | Ga0501047_0051581 | Ga0501047_0051581_688_2538 | 587 |
| 754 | 3300049663 | Ga0501223_000734 | Ga0501223_000734_3350_5179 | 587 |
| 755 | 3300049686 | Ga0501257_000031 | Ga0501257_000031_1424_3265 | 587 |
| 756 | 3300049688 | Ga0501259_002260 | Ga0501259_002260_472_2301 | 587 |
| 757 | 3300049690 | Ga0501261_000301 | Ga0501261_000301_2112_3941 | 587 |
| 758 | 3300049775 | Ga0501279_000239 | Ga0501279_000239_3593_5422 | 587 |
| 759 | 3300049776 | Ga0501280_000005 | Ga0501280_000005_82883_84712 | 587 |
| 760 | 3300049776 | Ga0501280_000342 | Ga0501280_000342_7976_9817 | 587 |
| 761 | 3300049777 | Ga0501281_00513 | Ga0501281_00513_1637_3466 | 587 |
| 762 | 3300049778 | Ga0501282_000535 | Ga0501282_000535_1658_3487 | 587 |
| 763 | 3300049779 | Ga0501283_000937 | Ga0501283_000937_426_2255 | 587 |
| 764 | 3300050491 | nmdc:mga00v17_1761_c1 | nmdc:mga00v17_1761_c1_6292_8106 | 587 |
| 765 | 3300050496 | nmdc:mga07m45_22923_c1 | nmdc:mga07m45_22923_c1_1380_3185 | 587 |
| 766 | 3300050509 | nmdc:mga0qj67_18352_c1 | nmdc:mga0qj67_18352_c1_126_1937 | 587 |
| 767 | 3300053087 | Ga0500643_002047 | Ga0500643_002047_2701_4533 | 587 |
| 768 | 3300053087 | Ga0500643_003295 | Ga0500643_003295_5754_7577 | 587 |
| 769 | 3300053087 | Ga0500643_006377 | Ga0500643_006377_1738_3543 | 587 |
| 770 | 3300053094 | Ga0500566_0003635 | Ga0500566_0003635_6853_8676 | 587 |
| 771 | 3300053104 | Ga0500556_0000049 | Ga0500556_0000049_35834_37657 | 587 |
| 772 | 3300053116 | Ga0500592_000270 | Ga0500592_000270_1128_2990 | 587 |
| 773 | 3300053118 | Ga0500594_0002630 | Ga0500594_0002630_1235_3055 | 587 |
| 774 | 3300053118 | Ga0500594_0003469 | Ga0500594_0003469_992_2863 | 587 |
| 775 | 3300053119 | Ga0500595_001337 | Ga0500595_001337_4926_6755 | 587 |
| 776 | 3300053119 | Ga0500595_022036 | Ga0500595_022036_48_1859 | 587 |
| 777 | 3300053121 | Ga0500607_001726 | Ga0500607_001726_14178_15983 | 587 |
| 778 | 3300053122 | Ga0500608_002406 | Ga0500608_002406_1933_3756 | 587 |
| 779 | 3300053130 | Ga0500642_0000002 | Ga0500642_0000002_91054_92877 | 587 |
| 780 | 3300053136 | Ga0500559_0002377 | Ga0500559_0002377_1958_3763 | 587 |
| 781 | 3300053136 | Ga0500559_0006954 | Ga0500559_0006954_1305_3110 | 587 |
| 782 | 3300053140 | Ga0500573_0000034 | Ga0500573_0000034_17253_19076 | 587 |
| 783 | 3300053158 | Ga0500627_0000335 | Ga0500627_0000335_5928_7793 | 587 |
| 784 | 3300053177 | Ga0500636_0008307 | Ga0500636_0008307_1413_3242 | 587 |
| 785 | 3300053178 | Ga0500637_0007967 | Ga0500637_0007967_3367_5172 | 587 |
| 786 | 3300053730 | Ga0500645_000173 | Ga0500645_000173_35470_37293 | 587 |
| 787 | 3300053730 | Ga0500645_000300 | Ga0500645_000300_6404_8233 | 587 |
| 788 | 3300053730 | Ga0500645_000452 | Ga0500645_000452_9939_11774 | 587 |
| 789 | iso_pu_bacteria | 2643221541 | 2643726851 | 587 |
| 790 | iso_pu_bacteria | 2643221605 | 2644040865 | 587 |
| 791 | iso_pu_bacteria | 2643221606 | 2644046108 | 587 |
| 792 | iso_pu_bacteria | 2643221671 | 2644393081 | 587 |
| 793 | 2162886007 | SwRhRL2b_contig_3540226 | SwRhRL2b_0218.00007640 | 588 |
| 794 | 3300005289 | Ga0065704_10070744 | Ga0065704_1007074420 | 588 |
| 795 | 3300005347 | Ga0070668_100000646 | Ga0070668_1000006467 | 588 |
| 796 | 3300005367 | Ga0070667_100001292 | Ga0070667_1000012923 | 588 |
| 797 | 3300005617 | Ga0068859_100169626 | Ga0068859_1001696262 | 588 |
| 798 | 3300006931 | Ga0097620_100169630 | Ga0097620_1001696302 | 588 |
| 799 | 3300013306 | Ga0163162_10085262 | Ga0163162_100852622 | 588 |
| 800 | 3300025931 | Ga0207644_10008789 | Ga0207644_100087892 | 588 |
| 801 | 3300025972 | Ga0207668_10003159 | Ga0207668_100031594 | 588 |
| 802 | 3300025986 | Ga0207658_10002564 | Ga0207658_1000256414 | 588 |
| 803 | 3300028379 | Ga0268266_10011818 | Ga0268266_100118183 | 588 |
| 804 | 3300028381 | Ga0268264_10021281 | Ga0268264_100212814 | 588 |
| 805 | 3300048904 | Ga0496101_0001612 | Ga0496101_0001612_1992_3809 | 588 |
| 806 | 3300048907 | Ga0496104_0000060 | Ga0496104_0000060_23648_25465 | 588 |
| 807 | 3300048908 | Ga0496105_0000274 | Ga0496105_0000274_17853_19670 | 588 |
| 808 | 3300048910 | Ga0496107_0004473 | Ga0496107_0004473_2679_4496 | 588 |
| 809 | 3300048915 | Ga0496112_0121955 | Ga0496112_0121955_497_2314 | 588 |
| 810 | 3300048916 | Ga0496113_0003962 | Ga0496113_0003962_6273_8090 | 588 |
| 811 | 3300048922 | Ga0496119_0001213 | Ga0496119_0001213_10913_12730 | 588 |
| 812 | 3300048923 | Ga0496120_0001109 | Ga0496120_0001109_18869_20686 | 588 |
| 813 | 3300048924 | Ga0496121_0013959 | Ga0496121_0013959_4414_6231 | 588 |
| 814 | 3300048925 | Ga0496122_0004287 | Ga0496122_0004287_14455_16272 | 588 |
| 815 | 3300048927 | Ga0496124_0001819 | Ga0496124_0001819_23188_25005 | 588 |
| 816 | 3300048928 | Ga0496125_0091998 | Ga0496125_0091998_187_2004 | 588 |
| 817 | 3300048929 | Ga0496126_0000294 | Ga0496126_0000294_51912_53729 | 588 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ydm-assembly1.cif.gz_A | structural characterization of angiotensin-i converting enzyme in complex with a selenium analogue of captopril | 0.9533 | 11 | 588 |
| 3bkl-assembly1.cif.gz_A | testis ace co-crystal structure with ketone ace inhibitor kaw | 0.9531 | 11 | 588 |
| 2iux-assembly1.cif.gz_A | human tace mutant g1234 | 0.953 | 11 | 588 |
| 2oc2-assembly1.cif.gz_A | structure of testis ace with rxpa380 | 0.9526 | 13 | 588 |
| 4bzr-assembly1.cif.gz_A | human testis angiotensin converting enzyme in complex with k-26 | 0.9521 | 11 | 588 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P09470_45_628_1.10.1370.30 | Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; | 0.9489 | 11 | 588 | 1.10.1370.30 |
| af_Q10714_28_605_1.10.1370.30 | Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; | 0.9481 | 19 | 587 | 1.10.1370.30 |
| af_P09470_45_628_1.10.1370.30 | Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; | 0.9377 | 11 | 588 | 1.10.1370.30 |
| af_Q10714_28_605_1.10.1370.30 | Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; | 0.9321 | 19 | 587 | 1.10.1370.30 |
| af_Q8SXX2_207_793_1.10.1370.30 | Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; | 0.8694 | 13 | 588 | 1.10.1370.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q2XDG7-F1-model_v4 | deleted | 0.9973 | 118 | 547 |
|
| AF-A0A2R7PLK0-F1-model_v4 | deleted | 0.9965 | 195 | 546 |
|
| AF-A0A3D2LH96-F1-model_v4 | deleted | 0.9943 | 176 | 495 |
|
| AF-A0A4Q2YYI3-F1-model_v4 | Peptidase M2 family protein | 0.9941 | 11 | 588 |
GO:0006508
GO:0008237 GO:0008241 GO:0016020 |
| AF-A0A520JBP9-F1-model_v4 | Peptidase M2 family protein | 0.9937 | 252 | 588 |
GO:0006508
GO:0008237 GO:0008241 GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar