F482109

General Info

Members Datasets Scaffolds Average Seq Length
817 363 770 599

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0001187|Ga0496122_0001187_16293_18197
Length 634
Sequence MTITISRFALAAALAFGTAGGGIAHAEVAQASGAPTAAQAQAFVDAAEKESYDFSLDSSRVQWINATNITDDTDAVAAKFGAQYTEMSVRFAKEAAKYATVPGLSAELRRKLDMFRSGIVLPAPTTPGAAAELNQIATKLQSDYGKGMGKLDGKPINGSDIEAEMGALGHTPAQYQEMWTSWHDQVGKPMKADYARLVEIANQGAKELGFADTGAMWRSGYDMPPEQFAALTEKIWQEVKPLYDALHCYTRTKLNEKYGDAVQAKTGPIRADLLGNMWAQEWGNIYPLVAPKGAGDLGYDIGDLLVAKGFKQTTPAMFDTSDTPETQRRGYWEKQMFKIGEGFYSSLGFEPLPASFWERTQFIKPRDREVVCHASAWDLDNKNDIRVKMCTKVNSDDFITIHHELGHNYYQRAYQKQDPIYLNGANDGFHEAIGDFIALSITPQYLVDIKLLDPAKVPSADKDIGLLLRQAMDKVAFLPFGLLIDRWRWGVFDGSIKPADYNKAWTDMRLQYQGIVPPVDRPADAFDAGAKYHVPGNTPYTRYFLARVLQFQFYEAACKQAGWKGPLHRCSFYGNKDVGAKLNQMLEMGASKPWPDALQTFTGSREMSGKALIAYFAPLKKWLDQQNKGKACGW

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
4 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
5 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
6 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
7 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
8 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
9 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
10 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
11 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
12 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
13 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
14 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
15 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
16 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
17 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
18 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
19 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
20 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
21 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
22 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
23 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
24 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
25 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
26 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
27 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
28 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
29 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
30 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
31 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
32 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
33 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
34 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
35 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
36 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
37 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
38 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
39 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
40 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
41 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
42 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
43 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
44 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
45 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
46 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
47 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
48 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
49 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
50 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
51 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
52 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
53 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
54 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
55 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
56 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
57 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
58 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
59 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
60 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
61 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
62 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
63 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
64 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
65 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
66 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
67 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
68 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
69 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
70 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
71 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
72 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
73 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
74 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
75 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
76 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
77 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
78 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
79 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
80 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
81 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
82 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
83 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
84 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
85 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
86 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
87 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
88 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
89 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
90 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
91 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
92 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
93 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
94 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
95 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
96 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
97 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
98 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
99 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
100 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
101 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
104 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
105 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
106 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
107 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
108 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
114 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
115 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
116 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
134 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
135 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
146 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
147 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
150 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
151 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
153 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
154 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
213 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
221 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
222 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
223 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
224 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
225 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
230 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
231 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
232 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
241 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
242 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
243 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
244 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
245 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
246 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
247 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
248 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
249 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
252 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
253 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
254 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
255 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
258 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
259 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
260 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
261 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
262 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
263 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
264 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
265 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
266 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
267 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
268 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
269 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
270 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
273 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
274 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
275 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
279 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
280 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
281 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
282 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
292 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
298 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
299 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
303 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
307 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
308 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
309 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
313 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
314 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
315 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
316 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
317 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
318 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
319 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
320 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
321 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
322 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
323 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
324 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
325 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
326 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
327 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
328 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
329 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
331 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
332 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
335 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
336 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
337 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
338 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
339 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
340 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
341 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
342 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
343 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
344 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
345 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
346 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
347 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
348 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
349 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
350 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
351 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
352 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
353 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
354 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
355 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
356 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
357 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
358 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
359 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
360 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
361 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
362 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
363 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.25
Metatranscriptomes 0
Isolates 5.75

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0
Endosphere 15.91
Nodule 0
Rhizoplane 3.06
Rhizosphere 71.85
Stem 0
Stem Tuber 0.12
Unclassified 8.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3540226 2162886007 Bacteria 4193
2 SwRhRL2b_contig_3705000 2162886007 Bacteria 37959
3 JGI24736J21556_1000121 3300001904 Bacteria 13331
4 JGI24752J21851_1000155 3300001976 Bacteria 9311
5 JGI24752J21851_1000461 3300001976 Bacteria 5495
6 JGI24737J22298_10003404 3300001990 Bacteria 5622
7 JGI24735J21928_10000918 3300002067 Bacteria 10528
8 JGI24750J21931_1000359 3300002070 Bacteria 7796
9 JGI24748J21848_1000044 3300002074 Bacteria 59119
10 JGI24749J21850_1000330 3300002076 Bacteria 7176
11 JGI24749J21850_1000531 3300002076 Bacteria 5590
12 JGI24034J26672_10000020 3300002239 Bacteria 122643
13 JGI24742J22300_10001043 3300002244 Bacteria 4265
14 JGI24751J29686_10000052 3300002459 Bacteria 65492
15 JGI25150J39212_1000046 3300002774 Bacteria 78180
16 JGI25159J45721_1007784 3300002987 Bacteria 3024
17 JGI25151J46595_10001638 3300003187 Bacteria 14729
18 JGI25165J46597_1000073 3300003214 Bacteria 192140
19 JGI25153J46596_10000006 3300003215 Bacteria 447760
20 JGI25153J46596_10000124 3300003215 Bacteria 86430
21 Ga0055525_1000090 3300003759 Bacteria 141071
22 Ga0055542_1000046 3300003762 Bacteria 201922
23 Ga0055529_1000007 3300003763 Bacteria 403604
24 Ga0055529_1000109 3300003763 Bacteria 121019
25 Ga0055526_1007061 3300003771 Bacteria 5938
26 Ga0055524_1001907 3300003775 Bacteria 11300
27 Ga0055536_1003381 3300003781 Bacteria 8607
28 Ga0055536_1006713 3300003781 Bacteria 5289
29 Ga0055536_1008867 3300003781 Bacteria 4251
30 Ga0055530_10001655 3300003791 Bacteria 15864
31 Ga0055530_10002492 3300003791 Bacteria 11790
32 Ga0055530_10013862 3300003791 Bacteria 2724
33 Ga0055540_1003937 3300003792 Bacteria 6941
34 Ga0055531_10000008 3300003794 Bacteria 222269
35 Ga0055531_10001714 3300003794 Bacteria 15705
36 Ga0055531_10001722 3300003794 Bacteria 15672
37 Ga0055531_10009693 3300003794 Bacteria 4895
38 Ga0065165_1001443 3300005262 Bacteria 25758
39 Ga0065165_1002698 3300005262 Bacteria 14260
40 Ga0065704_10000191 3300005289 Bacteria 318191
41 Ga0065704_10070744 3300005289 Bacteria 16791
42 Ga0065704_10081289 3300005289 Bacteria 3786
43 Ga0065704_10100052 3300005289 Bacteria 2288
44 Ga0065715_10000978 3300005293 Bacteria 7475
45 Ga0065707_10081865 3300005295 Bacteria 32547
46 Ga0065707_10086251 3300005295 Bacteria 5572
47 Ga0070658_10000227 3300005327 Bacteria 50101
48 Ga0070658_10024952 3300005327 Bacteria 4793
49 Ga0070676_10007834 3300005328 Bacteria 5743
50 Ga0070690_100000180 3300005330 Bacteria 32463
51 Ga0070670_100000024 3300005331 Bacteria 189811
52 Ga0070670_100000792 3300005331 Bacteria 24611
53 Ga0070670_100003165 3300005331 Bacteria 13607
54 Ga0070670_100005522 3300005331 Bacteria 10672
55 Ga0070670_100032156 3300005331 Bacteria 4519
56 Ga0070670_100052533 3300005331 Bacteria 3499
57 Ga0070670_100087376 3300005331 Bacteria 2679
58 Ga0070677_10001757 3300005333 Bacteria 6845
59 Ga0070666_10000027 3300005335 Bacteria 151010
60 Ga0070666_10000352 3300005335 Bacteria 28924
61 Ga0070666_10010284 3300005335 Bacteria 5848
62 Ga0070666_10029018 3300005335 Bacteria 3635
63 Ga0070660_100004165 3300005339 Bacteria 9989
64 Ga0070689_100008132 3300005340 Bacteria 7372
65 Ga0070661_100000010 3300005344 Bacteria 175777
66 Ga0070661_100002364 3300005344 Bacteria 12951
67 Ga0070661_100015823 3300005344 Bacteria 5325
68 Ga0070661_100026844 3300005344 Bacteria 4144
69 Ga0070668_100000027 3300005347 Bacteria 89913
70 Ga0070668_100000068 3300005347 Bacteria 64209
71 Ga0070668_100000646 3300005347 Bacteria 23522
72 Ga0070668_100004087 3300005347 Bacteria 10803
73 Ga0070668_100019269 3300005347 Bacteria 5135
74 Ga0070668_100019894 3300005347 Bacteria 5058
75 Ga0070668_100066155 3300005347 Bacteria 2804
76 Ga0070669_100000018 3300005353 Bacteria 195789
77 Ga0070669_100000047 3300005353 Bacteria 118892
78 Ga0070669_100000099 3300005353 Bacteria 85328
79 Ga0070669_100001232 3300005353 Bacteria 18563
80 Ga0070669_100016595 3300005353 Bacteria 5257
81 Ga0070669_100021839 3300005353 Bacteria 4577
82 Ga0070675_100004161 3300005354 Bacteria 10987
83 Ga0070675_100012526 3300005354 Bacteria 6648
84 Ga0070675_100023281 3300005354 Bacteria 4951
85 Ga0070671_100000011 3300005355 Bacteria 202057
86 Ga0070671_100000353 3300005355 Bacteria 31530
87 Ga0070671_100001241 3300005355 Bacteria 19109
88 Ga0070671_100004632 3300005355 Bacteria 10905
89 Ga0070671_100008988 3300005355 Bacteria 8018
90 Ga0070673_100029291 3300005364 Bacteria 4105
91 Ga0070673_100032493 3300005364 Bacteria 3930
92 Ga0070688_100000293 3300005365 Bacteria 25617
93 Ga0070659_100013031 3300005366 Bacteria 6182
94 Ga0070667_100000017 3300005367 Bacteria 230531
95 Ga0070667_100000066 3300005367 Bacteria 134529
96 Ga0070667_100000067 3300005367 Bacteria 133023
97 Ga0070667_100000290 3300005367 Bacteria 56841
98 Ga0070667_100000459 3300005367 Bacteria 41954
99 Ga0070667_100000480 3300005367 Bacteria 40910
100 Ga0070667_100001292 3300005367 Bacteria 22636
101 Ga0070667_100011712 3300005367 Bacteria 7247
102 Ga0070667_100012620 3300005367 Bacteria 6988
103 Ga0070667_100019588 3300005367 Bacteria 5613
104 Ga0070678_100000076 3300005456 Bacteria 37213
105 Ga0070662_100005311 3300005457 Bacteria 8227
106 Ga0070662_100058572 3300005457 Bacteria 2804
107 Ga0070681_10089493 3300005458 Bacteria 3030
108 Ga0070685_10000238 3300005466 Bacteria 36209
109 Ga0070679_100000168 3300005530 Bacteria 52996
110 Ga0070679_100165301 3300005530 Bacteria 2186
111 Ga0068853_100002669 3300005539 Bacteria 13447
112 Ga0068853_100020182 3300005539 Bacteria 5539
113 Ga0070672_100003237 3300005543 Bacteria 10542
114 Ga0070686_100000010 3300005544 Bacteria 192116
115 Ga0070695_100075744 3300005545 Bacteria 2215
116 Ga0070665_100000086 3300005548 Bacteria 178229
117 Ga0070665_100000254 3300005548 Bacteria 88587
118 Ga0070665_100002933 3300005548 Bacteria 18422
119 Ga0070665_100013328 3300005548 Bacteria 8274
120 Ga0070665_100015010 3300005548 Bacteria 7774
121 Ga0070664_100009278 3300005564 Bacteria 7986
122 Ga0070664_100090692 3300005564 Bacteria 2645
123 Ga0068854_100013256 3300005578 Bacteria 5404
124 Ga0068852_100034615 3300005616 Bacteria 4205
125 Ga0068852_100156023 3300005616 Bacteria 2126
126 Ga0068859_100002363 3300005617 Bacteria 19203
127 Ga0068859_100004889 3300005617 Bacteria 13646
128 Ga0068859_100006146 3300005617 Bacteria 12204
129 Ga0068859_100013485 3300005617 Bacteria 8195
130 Ga0068859_100020790 3300005617 Bacteria 6588
131 Ga0068859_100027164 3300005617 Bacteria 5743
132 Ga0068859_100109660 3300005617 Bacteria 2821
133 Ga0068859_100169626 3300005617 Bacteria 2263
134 Ga0068864_100000036 3300005618 Bacteria 189811
135 Ga0068864_100000063 3300005618 Bacteria 119845
136 Ga0068864_100001646 3300005618 Bacteria 18401
137 Ga0068864_100003044 3300005618 Bacteria 13839
138 Ga0068861_100000005 3300005719 Bacteria 101677
139 Ga0068861_100002905 3300005719 Bacteria 11293
140 Ga0068861_100007125 3300005719 Bacteria 7655
141 Ga0068861_100013995 3300005719 Bacteria 5624
142 Ga0068863_100000001 3300005841 Bacteria 581116
143 Ga0068863_100000038 3300005841 Bacteria 161477
144 Ga0068863_100000062 3300005841 Bacteria 119845
145 Ga0068863_100000603 3300005841 Bacteria 36544
146 Ga0068863_100000775 3300005841 Bacteria 32088
147 Ga0068863_100003283 3300005841 Bacteria 15970
148 Ga0068863_100006015 3300005841 Bacteria 11900
149 Ga0068863_100006939 3300005841 Bacteria 11104
150 Ga0068863_100008950 3300005841 Bacteria 9776
151 Ga0068863_100010531 3300005841 Bacteria 8979
152 Ga0068863_100011823 3300005841 Bacteria 8440
153 Ga0068858_100000103 3300005842 Bacteria 88754
154 Ga0068858_100000530 3300005842 Bacteria 39968
155 Ga0068858_100000777 3300005842 Bacteria 33348
156 Ga0068858_100003512 3300005842 Bacteria 15537
157 Ga0068860_100000013 3300005843 Bacteria 323055
158 Ga0068860_100000056 3300005843 Bacteria 202751
159 Ga0068860_100000080 3300005843 Bacteria 170152
160 Ga0068860_100024655 3300005843 Bacteria 5808
161 Ga0068862_100000033 3300005844 Bacteria 176515
162 Ga0068862_100000069 3300005844 Bacteria 122535
163 Ga0068862_100000115 3300005844 Bacteria 94951
164 Ga0068862_100000485 3300005844 Bacteria 42458
165 Ga0068862_100004188 3300005844 Bacteria 12217
166 Ga0068862_100005376 3300005844 Bacteria 10718
167 Ga0068862_100005633 3300005844 Bacteria 10458
168 Ga0068862_100012106 3300005844 Bacteria 7128
169 Ga0068862_100018068 3300005844 Bacteria 5873
170 Ga0068862_100030185 3300005844 Bacteria 4568
171 Ga0068862_100032674 3300005844 Bacteria 4397
172 Ga0068862_100059599 3300005844 Bacteria 3278
173 Ga0081455_10002228 3300005937 Bacteria 23082
174 Ga0081539_10018190 3300005985 Bacteria 4891
175 Ga0081539_10019805 3300005985 Bacteria 4584
176 Ga0075368_10000704 3300006042 Bacteria 10189
177 Ga0075367_10000042 3300006178 Bacteria 28460
178 Ga0075366_10004887 3300006195 Bacteria 7230
179 Ga0075366_10012022 3300006195 Bacteria 4903
180 Ga0075370_10024116 3300006353 Bacteria 3357
181 Ga0075430_100018966 3300006846 Bacteria 5853
182 Ga0075431_100007563 3300006847 Bacteria 10816
183 Ga0097620_100002363 3300006931 Bacteria 19203
184 Ga0097620_100004889 3300006931 Bacteria 13646
185 Ga0097620_100006146 3300006931 Bacteria 12204
186 Ga0097620_100013486 3300006931 Bacteria 8195
187 Ga0097620_100020789 3300006931 Bacteria 6588
188 Ga0097620_100027165 3300006931 Bacteria 5743
189 Ga0097620_100109659 3300006931 Bacteria 2821
190 Ga0097620_100169630 3300006931 Bacteria 2263
191 Ga0105251_10001006 3300009011 Bacteria 24692
192 Ga0111539_10000017 3300009094 Bacteria 275456
193 Ga0111539_10029495 3300009094 Bacteria 6681
194 Ga0105245_10002260 3300009098 Bacteria 17440
195 Ga0105247_10004862 3300009101 Bacteria 8547
196 Ga0105247_10016928 3300009101 Bacteria 4372
197 Ga0105243_10000224 3300009148 Bacteria 65196
198 Ga0105241_10097937 3300009174 Bacteria 2326
199 Ga0105248_10000091 3300009177 Bacteria 101191
200 Ga0105248_10000536 3300009177 Bacteria 43208
201 Ga0105248_10003098 3300009177 Bacteria 18437
202 Ga0105248_10008150 3300009177 Bacteria 11507
203 Ga0105248_10009842 3300009177 Bacteria 10530
204 Ga0105248_10025435 3300009177 Bacteria 6582
205 Ga0105248_10036917 3300009177 Bacteria 5465
206 Ga0105237_10050794 3300009545 Bacteria 4166
207 Ga0105238_10047095 3300009551 Bacteria 4349
208 Ga0105238_10062799 3300009551 Bacteria 3715
209 Ga0105249_10000064 3300009553 Bacteria 151646
210 Ga0105249_10000160 3300009553 Bacteria 81883
211 Ga0105249_10000567 3300009553 Bacteria 33975
212 Ga0105249_10017175 3300009553 Bacteria 6423
213 Ga0105249_10025445 3300009553 Bacteria 5328
214 Ga0105249_10040062 3300009553 Bacteria 4255
215 Ga0105249_10064607 3300009553 Bacteria 3365
216 Ga0105239_10113654 3300010375 Bacteria 3002
217 Ga0157326_1000059 3300012513 Bacteria 10517
218 Ga0157373_10009216 3300013100 Bacteria 7299
219 Ga0157371_10000097 3300013102 Bacteria 134150
220 Ga0157369_10025937 3300013105 Bacteria 6504
221 Ga0157378_10003298 3300013297 Bacteria 14370
222 Ga0157378_10094681 3300013297 Bacteria 2720
223 Ga0163162_10035914 3300013306 Bacteria 4937
224 Ga0163162_10048106 3300013306 Bacteria 4273
225 Ga0163162_10085262 3300013306 Bacteria 3235
226 Ga0157372_10214297 3300013307 Bacteria 2232
227 Ga0163163_10000107 3300014325 Bacteria 87926
228 Ga0157380_10000086 3300014326 Bacteria 51604
229 Ga0157380_10000217 3300014326 Bacteria 34251
230 Ga0157380_10003002 3300014326 Bacteria 11489
231 Ga0157380_10003455 3300014326 Bacteria 10849
232 Ga0157380_10013463 3300014326 Bacteria 5963
233 Ga0157380_10051349 3300014326 Bacteria 3261
234 Ga0157379_10009125 3300014968 Bacteria 8637
235 Ga0157379_10065983 3300014968 Bacteria 3235
236 Ga0183363_1001 3300015690 Bacteria 611534
237 Ga0163161_10000110 3300017792 Bacteria 78102
238 Ga0163161_10103664 3300017792 Bacteria 2120
239 Ga0213873_10000015 3300021358 Bacteria 131343
240 Ga0213876_10000005 3300021384 Bacteria 727326
241 Ga0209147_100321 3300025229 Bacteria 36587
242 Ga0209563_100111 3300025230 Bacteria 141123
243 Ga0207425_1000020 3300025245 Bacteria 372623
244 Ga0209646_1004636 3300025246 Bacteria 2482
245 Ga0209148_1000026 3300025254 Bacteria 629213
246 Ga0209129_1000586 3300025258 Bacteria 25017
247 Ga0209233_1000142 3300025261 Bacteria 192193
248 Ga0209565_1000008 3300025263 Bacteria 774179
249 Ga0209565_1000210 3300025263 Bacteria 67800
250 Ga0209455_1000005 3300025272 Bacteria 1416756
251 Ga0209673_1000984 3300025273 Bacteria 34864
252 Ga0209130_1000512 3300025284 Bacteria 39134
253 Ga0209675_1000838 3300025291 Bacteria 20134
254 Ga0209676_1000518 3300025292 Bacteria 60512
255 Ga0209676_1000554 3300025292 Bacteria 56925
256 Ga0209676_1000929 3300025292 Bacteria 36184
257 Ga0209676_1008339 3300025292 Bacteria 4637
258 Ga0209025_1000114 3300025294 Bacteria 218921
259 Ga0209025_1000326 3300025294 Bacteria 106087
260 Ga0209564_1001114 3300025295 Bacteria 31654
261 Ga0209758_1000001 3300025297 Bacteria 1981790
262 Ga0209758_1000004 3300025297 Bacteria 1375322
263 Ga0209758_1001428 3300025297 Bacteria 28251
264 Ga0209758_1017781 3300025297 Bacteria 3517
265 Ga0209050_1000001 3300025298 Bacteria 3563507
266 Ga0209050_1000017 3300025298 Bacteria 728928
267 Ga0209050_1000026 3300025298 Bacteria 499134
268 Ga0209050_1002610 3300025298 Bacteria 14895
269 Ga0209050_1008085 3300025298 Bacteria 5710
270 Ga0209050_1014081 3300025298 Bacteria 3480
271 Ga0209256_1000009 3300025299 Bacteria 922071
272 Ga0209256_1000010 3300025299 Bacteria 912110
273 Ga0207426_1000181 3300025302 Bacteria 158308
274 Ga0209051_1000476 3300025303 Bacteria 51944
275 Ga0209257_1000009 3300025304 Bacteria 1205047
276 Ga0209257_1001405 3300025304 Bacteria 28723
277 Ga0209257_1002894 3300025304 Bacteria 15934
278 Ga0209257_1003790 3300025304 Bacteria 12457
279 Ga0209257_1005509 3300025304 Bacteria 8841
280 Ga0207697_10000211 3300025315 Bacteria 31108
281 Ga0207697_10003297 3300025315 Bacteria 8029
282 Ga0207713_1001151 3300025735 Bacteria 22391
283 Ga0207713_1002611 3300025735 Bacteria 12984
284 Ga0207682_10002080 3300025893 Bacteria 9063
285 Ga0207710_10002208 3300025900 Bacteria 9150
286 Ga0207710_10008695 3300025900 Bacteria 4281
287 Ga0207710_10034094 3300025900 Bacteria 2235
288 Ga0207680_10000009 3300025903 Bacteria 464571
289 Ga0207680_10023993 3300025903 Bacteria 3340
290 Ga0207680_10049495 3300025903 Bacteria 2501
291 Ga0207647_10031699 3300025904 Bacteria 3399
292 Ga0207645_10004405 3300025907 Bacteria 10428
293 Ga0207645_10012931 3300025907 Bacteria 5647
294 Ga0207705_10000450 3300025909 Bacteria 35404
295 Ga0207705_10051400 3300025909 Bacteria 2966
296 Ga0207654_10004079 3300025911 Bacteria 7359
297 Ga0207707_10075179 3300025912 Bacteria 2947
298 Ga0207707_10090256 3300025912 Bacteria 2678
299 Ga0207671_10006655 3300025914 Bacteria 10244
300 Ga0207671_10014738 3300025914 Bacteria 6164
301 Ga0207657_10009966 3300025919 Bacteria 9511
302 Ga0207657_10011805 3300025919 Bacteria 8648
303 Ga0207657_10022107 3300025919 Bacteria 5969
304 Ga0207649_10000178 3300025920 Bacteria 52146
305 Ga0207649_10002255 3300025920 Bacteria 10883
306 Ga0207652_10000282 3300025921 Bacteria 52954
307 Ga0207681_10000008 3300025923 Bacteria 414329
308 Ga0207681_10000014 3300025923 Bacteria 353422
309 Ga0207681_10000106 3300025923 Bacteria 71721
310 Ga0207681_10000259 3300025923 Bacteria 40452
311 Ga0207681_10027414 3300025923 Bacteria 3683
312 Ga0207681_10053593 3300025923 Bacteria 2739
313 Ga0207694_10020172 3300025924 Bacteria 5041
314 Ga0207694_10023064 3300025924 Bacteria 4724
315 Ga0207694_10025520 3300025924 Bacteria 4492
316 Ga0207650_10000015 3300025925 Bacteria 369173
317 Ga0207650_10015218 3300025925 Bacteria 5354
318 Ga0207650_10018925 3300025925 Bacteria 4839
319 Ga0207650_10020051 3300025925 Bacteria 4709
320 Ga0207650_10032859 3300025925 Bacteria 3755
321 Ga0207650_10035934 3300025925 Bacteria 3601
322 Ga0207659_10045306 3300025926 Bacteria 3100
323 Ga0207659_10054702 3300025926 Bacteria 2851
324 Ga0207644_10000006 3300025931 Bacteria 408793
325 Ga0207644_10000544 3300025931 Bacteria 24497
326 Ga0207644_10000574 3300025931 Bacteria 23595
327 Ga0207644_10003236 3300025931 Bacteria 10496
328 Ga0207644_10003746 3300025931 Bacteria 9848
329 Ga0207644_10008789 3300025931 Bacteria 6613
330 Ga0207644_10033072 3300025931 Bacteria 3611
331 Ga0207690_10004587 3300025932 Bacteria 8166
332 Ga0207706_10004467 3300025933 Bacteria 13136
333 Ga0207706_10006993 3300025933 Bacteria 10426
334 Ga0207706_10014593 3300025933 Bacteria 7116
335 Ga0207706_10031363 3300025933 Bacteria 4735
336 Ga0207706_10092745 3300025933 Bacteria 2655
337 Ga0207706_10120023 3300025933 Bacteria 2311
338 Ga0207709_10000519 3300025935 Bacteria 33581
339 Ga0207709_10011498 3300025935 Bacteria 4884
340 Ga0207670_10010660 3300025936 Bacteria 5303
341 Ga0207669_10000161 3300025937 Bacteria 32114
342 Ga0207669_10006712 3300025937 Bacteria 5278
343 Ga0207669_10083879 3300025937 Bacteria 2051
344 Ga0207691_10004823 3300025940 Bacteria 13043
345 Ga0207691_10005772 3300025940 Bacteria 11974
346 Ga0207711_10000017 3300025941 Bacteria 441730
347 Ga0207711_10000252 3300025941 Bacteria 57840
348 Ga0207711_10003251 3300025941 Bacteria 14161
349 Ga0207711_10003634 3300025941 Bacteria 13336
350 Ga0207711_10018314 3300025941 Bacteria 5820
351 Ga0207711_10023381 3300025941 Bacteria 5174
352 Ga0207711_10041275 3300025941 Bacteria 3929
353 Ga0207711_10074113 3300025941 Bacteria 2960
354 Ga0207711_10075264 3300025941 Bacteria 2938
355 Ga0207689_10093863 3300025942 Bacteria 2465
356 Ga0207661_10114574 3300025944 Bacteria 2286
357 Ga0207679_10004610 3300025945 Bacteria 8581
358 Ga0207667_10000010 3300025949 Bacteria 477432
359 Ga0207667_10014565 3300025949 Bacteria 8957
360 Ga0207667_10105697 3300025949 Bacteria 2904
361 Ga0207712_10000008 3300025961 Bacteria 527957
362 Ga0207712_10000044 3300025961 Bacteria 171240
363 Ga0207712_10000222 3300025961 Bacteria 56073
364 Ga0207712_10006379 3300025961 Bacteria 7441
365 Ga0207712_10009432 3300025961 Bacteria 6175
366 Ga0207712_10015834 3300025961 Bacteria 4872
367 Ga0207712_10038733 3300025961 Bacteria 3261
368 Ga0207668_10000012 3300025972 Bacteria 182541
369 Ga0207668_10000629 3300025972 Bacteria 21816
370 Ga0207668_10000860 3300025972 Bacteria 18295
371 Ga0207668_10001683 3300025972 Bacteria 12933
372 Ga0207668_10002528 3300025972 Bacteria 10677
373 Ga0207668_10003159 3300025972 Bacteria 9645
374 Ga0207668_10009770 3300025972 Bacteria 5763
375 Ga0207668_10041715 3300025972 Bacteria 3104
376 Ga0207668_10052374 3300025972 Bacteria 2823
377 Ga0207668_10055215 3300025972 Bacteria 2760
378 Ga0207668_10068228 3300025972 Bacteria 2527
379 Ga0207668_10074452 3300025972 Bacteria 2438
380 Ga0207668_10085580 3300025972 Bacteria 2301
381 Ga0207640_10009509 3300025981 Bacteria 5445
382 Ga0207640_10009819 3300025981 Bacteria 5369
383 Ga0207658_10000011 3300025986 Bacteria 239620
384 Ga0207658_10000089 3300025986 Bacteria 100308
385 Ga0207658_10000132 3300025986 Bacteria 80078
386 Ga0207658_10000133 3300025986 Bacteria 78402
387 Ga0207658_10000291 3300025986 Bacteria 52585
388 Ga0207658_10002473 3300025986 Bacteria 13492
389 Ga0207658_10002564 3300025986 Bacteria 13198
390 Ga0207658_10009504 3300025986 Bacteria 6600
391 Ga0207658_10012206 3300025986 Bacteria 5863
392 Ga0207658_10025815 3300025986 Bacteria 4114
393 Ga0207658_10026771 3300025986 Bacteria 4046
394 Ga0207658_10033271 3300025986 Bacteria 3676
395 Ga0207703_10000691 3300026035 Bacteria 33391
396 Ga0207703_10001013 3300026035 Bacteria 27010
397 Ga0207703_10003167 3300026035 Bacteria 13874
398 Ga0207639_10026227 3300026041 Bacteria 4234
399 Ga0207639_10026739 3300026041 Bacteria 4194
400 Ga0207678_10020460 3300026067 Bacteria 5803
401 Ga0207702_10007378 3300026078 Bacteria 9388
402 Ga0207702_10032064 3300026078 Bacteria 4383
403 Ga0207641_10000001 3300026088 Bacteria 1180841
404 Ga0207641_10000022 3300026088 Bacteria 279334
405 Ga0207641_10000047 3300026088 Bacteria 179977
406 Ga0207641_10000060 3300026088 Bacteria 161514
407 Ga0207641_10001074 3300026088 Bacteria 27484
408 Ga0207641_10002092 3300026088 Bacteria 18889
409 Ga0207641_10004584 3300026088 Bacteria 11938
410 Ga0207641_10006843 3300026088 Bacteria 9546
411 Ga0207641_10016494 3300026088 Bacteria 6049
412 Ga0207641_10018011 3300026088 Bacteria 5788
413 Ga0207676_10000021 3300026095 Bacteria 296572
414 Ga0207676_10000056 3300026095 Bacteria 124484
415 Ga0207676_10000827 3300026095 Bacteria 24173
416 Ga0207676_10000894 3300026095 Bacteria 23124
417 Ga0207676_10001517 3300026095 Bacteria 17145
418 Ga0207676_10002294 3300026095 Bacteria 13722
419 Ga0207674_10007137 3300026116 Bacteria 13050
420 Ga0207674_10069644 3300026116 Bacteria 3538
421 Ga0207674_10084252 3300026116 Bacteria 3177
422 Ga0207675_100000020 3300026118 Bacteria 117374
423 Ga0207675_100000207 3300026118 Bacteria 54791
424 Ga0207675_100002282 3300026118 Bacteria 19053
425 Ga0207675_100004785 3300026118 Bacteria 13038
426 Ga0207675_100084771 3300026118 Bacteria 2973
427 Ga0207675_100150282 3300026118 Bacteria 2216
428 Ga0207683_10000655 3300026121 Bacteria 31727
429 Ga0207683_10033010 3300026121 Bacteria 4496
430 Ga0207698_10051391 3300026142 Bacteria 3151
431 Ga0209813_10000042 3300027866 Bacteria 53213
432 Ga0209813_10000126 3300027866 Bacteria 27944
433 Ga0209974_10003218 3300027876 Bacteria 5903
434 Ga0209974_10003430 3300027876 Bacteria 5723
435 Ga0268266_10000002 3300028379 Bacteria 3059047
436 Ga0268266_10000069 3300028379 Bacteria 239714
437 Ga0268266_10004036 3300028379 Bacteria 14190
438 Ga0268266_10011818 3300028379 Bacteria 7568
439 Ga0268266_10016904 3300028379 Bacteria 6233
440 Ga0268265_10000013 3300028380 Bacteria 341536
441 Ga0268265_10000044 3300028380 Bacteria 182545
442 Ga0268265_10000082 3300028380 Bacteria 120835
443 Ga0268265_10000100 3300028380 Bacteria 108659
444 Ga0268265_10000958 3300028380 Bacteria 26520
445 Ga0268265_10006174 3300028380 Bacteria 8115
446 Ga0268265_10006969 3300028380 Bacteria 7645
447 Ga0268264_10000010 3300028381 Bacteria 596543
448 Ga0268264_10000039 3300028381 Bacteria 376641
449 Ga0268264_10000089 3300028381 Bacteria 234760
450 Ga0268264_10000131 3300028381 Bacteria 181459
451 Ga0268264_10000933 3300028381 Bacteria 30321
452 Ga0268264_10000935 3300028381 Bacteria 30301
453 Ga0268264_10021281 3300028381 Bacteria 5297
454 Ga0268264_10053953 3300028381 Bacteria 3355
455 Ga0307513_10075874 3300031456 Bacteria 3489
456 Ga0307509_10000115 3300031507 Bacteria 116444
457 Ga0307408_100015727 3300031548 Bacteria 5041
458 Ga0307408_100017748 3300031548 Bacteria 4768
459 Ga0307408_100019173 3300031548 Bacteria 4603
460 Ga0307408_100087906 3300031548 Bacteria 2340
461 Ga0307508_10025163 3300031616 Bacteria 5398
462 Ga0307405_10000391 3300031731 Bacteria 16410
463 Ga0307405_10010450 3300031731 Bacteria 4811
464 Ga0307405_10041028 3300031731 Bacteria 2807
465 Ga0307405_10054567 3300031731 Bacteria 2495
466 Ga0307413_10001504 3300031824 Bacteria 8914
467 Ga0307413_10007329 3300031824 Bacteria 5114
468 Ga0307413_10007679 3300031824 Bacteria 5031
469 Ga0307413_10012702 3300031824 Bacteria 4201
470 Ga0307413_10028311 3300031824 Bacteria 3118
471 Ga0307413_10029103 3300031824 Bacteria 3086
472 Ga0307413_10051241 3300031824 Bacteria 2486
473 Ga0307410_10000684 3300031852 Bacteria 14130
474 Ga0307410_10002446 3300031852 Bacteria 8971
475 Ga0307410_10003698 3300031852 Bacteria 7736
476 Ga0307410_10004043 3300031852 Bacteria 7498
477 Ga0307410_10014143 3300031852 Bacteria 4683
478 Ga0307410_10019814 3300031852 Bacteria 4100
479 Ga0307410_10021645 3300031852 Bacteria 3958
480 Ga0307410_10033329 3300031852 Bacteria 3324
481 Ga0307410_10037184 3300031852 Bacteria 3177
482 Ga0307410_10074721 3300031852 Bacteria 2361
483 Ga0307406_10019894 3300031901 Bacteria 3945
484 Ga0307406_10021789 3300031901 Bacteria 3795
485 Ga0307406_10036423 3300031901 Bacteria 3031
486 Ga0307407_10004107 3300031903 Bacteria 6125
487 Ga0307407_10019115 3300031903 Bacteria 3482
488 Ga0307407_10040428 3300031903 Bacteria 2600
489 Ga0307407_10051333 3300031903 Bacteria 2363
490 Ga0307412_10007668 3300031911 Bacteria 6130
491 Ga0307412_10008746 3300031911 Bacteria 5794
492 Ga0307412_10010587 3300031911 Bacteria 5314
493 Ga0307412_10045050 3300031911 Bacteria 2881
494 Ga0307412_10078260 3300031911 Bacteria 2277
495 Ga0307412_10090273 3300031911 Bacteria 2141
496 Ga0307409_100023016 3300031995 Bacteria 4307
497 Ga0307409_100036824 3300031995 Bacteria 3600
498 Ga0307409_100064704 3300031995 Bacteria 2874
499 Ga0307416_100037671 3300032002 Bacteria 3723
500 Ga0307416_100043746 3300032002 Bacteria 3510
501 Ga0307416_100080138 3300032002 Bacteria 2754
502 Ga0307416_100103237 3300032002 Bacteria 2488
503 Ga0307416_100139612 3300032002 Bacteria 2200
504 Ga0307414_10000346 3300032004 Bacteria 26022
505 Ga0307414_10002088 3300032004 Bacteria 10396
506 Ga0307414_10002337 3300032004 Bacteria 9908
507 Ga0307414_10009428 3300032004 Bacteria 5608
508 Ga0307414_10014644 3300032004 Bacteria 4710
509 Ga0307414_10016059 3300032004 Bacteria 4539
510 Ga0307414_10019577 3300032004 Bacteria 4197
511 Ga0307414_10022219 3300032004 Bacteria 3997
512 Ga0307414_10028125 3300032004 Bacteria 3642
513 Ga0307414_10046312 3300032004 Bacteria 2984
514 Ga0307414_10050216 3300032004 Bacteria 2888
515 Ga0307414_10114411 3300032004 Bacteria 2061
516 Ga0307411_10004783 3300032005 Bacteria 6558
517 Ga0307411_10005751 3300032005 Bacteria 6131
518 Ga0307411_10024249 3300032005 Bacteria 3612
519 Ga0307411_10034144 3300032005 Bacteria 3162
520 Ga0307411_10062055 3300032005 Bacteria 2491
521 Ga0307411_10104906 3300032005 Bacteria 2008
522 Ga0307415_100009023 3300032126 Bacteria 5563
523 Ga0307415_100012323 3300032126 Bacteria 4939
524 Ga0307415_100035245 3300032126 Bacteria 3267
525 Ga0307415_100055878 3300032126 Bacteria 2703
526 Ga0307510_10016486 3300033180 Bacteria 8721
527 Ga0307510_10092283 3300033180 Bacteria 2865
528 Ga0373943_0033198 3300035170 Bacteria 2457
529 Ga0373946_0020771 3300035171 Bacteria 2541
530 Ga0373935_0028704 3300035692 Bacteria 3439
531 Ga0395900_0000503 3300037418 Bacteria 54976
532 Ga0395905_0007001 3300037471 Bacteria 11273
533 Ga0395905_0094244 3300037471 Bacteria 2809
534 Ga0395901_0000520 3300038443 Bacteria 44464
535 Ga0395901_0023161 3300038443 Bacteria 6367
536 Ga0436365_1132330 3300039437 Bacteria 76795
537 Ga0436365_1277439 3300039437 Bacteria 2584
538 Ga0436365_1921522 3300039437 Bacteria 4700
539 Ga0436362_0875621 3300039453 Bacteria 35060
540 Ga0439461_0000190 3300041410 Bacteria 8487
541 Ga0439465_0000420 3300041413 Bacteria 12395
542 Ga0439431_0000645 3300041997 Bacteria 7421
543 Ga0439432_018266 3300042006 Bacteria 2344
544 Ga0439449_0014110 3300042007 Bacteria 3006
545 Ga0439462_0000249 3300042015 Bacteria 9622
546 Ga0439462_0001856 3300042015 Bacteria 4796
547 Ga0439434_0000823 3300042435 Bacteria 8928
548 Ga0451576_0000023 3300045051 Bacteria 477965
549 Ga0495627_000158 3300046453 Bacteria 77210
550 Ga0495627_000636 3300046453 Bacteria 27717
551 Ga0495627_001522 3300046453 Bacteria 13320
552 Ga0495629_0033426 3300046459 Bacteria 3638
553 Ga0495638_0002237 3300046460 Bacteria 16075
554 Ga0495650_0000492 3300046471 Bacteria 59983
555 Ga0495650_0008181 3300046471 Bacteria 6147
556 Ga0495650_0012961 3300046471 Bacteria 4445
557 Ga0495662_0027591 3300046476 Bacteria 2743
558 Ga0495596_0000141 3300046500 Bacteria 49474
559 Ga0495596_0007033 3300046500 Bacteria 5112
560 Ga0495583_0002564 3300046506 Bacteria 15303
561 Ga0495583_0010721 3300046506 Bacteria 5318
562 Ga0495583_0016240 3300046506 Bacteria 4013
563 Ga0495606_0000359 3300046507 Bacteria 77863
564 Ga0495610_0000020 3300046512 Bacteria 344007
565 Ga0495610_0000071 3300046512 Bacteria 121210
566 Ga0495610_0002395 3300046512 Bacteria 15792
567 Ga0495610_0005363 3300046512 Bacteria 9148
568 Ga0495610_0021839 3300046512 Bacteria 3512
569 Ga0495610_0031373 3300046512 Bacteria 2773
570 Ga0495620_0031636 3300046515 Bacteria 2422
571 Ga0495632_0000211 3300046519 Bacteria 59066
572 Ga0495637_0014469 3300046520 Bacteria 3723
573 Ga0495643_0000053 3300046522 Bacteria 202031
574 Ga0495643_0000132 3300046522 Bacteria 121567
575 Ga0495643_0004044 3300046522 Bacteria 10460
576 Ga0495643_0004426 3300046522 Bacteria 9829
577 Ga0495643_0019902 3300046522 Bacteria 3879
578 Ga0495648_0000256 3300046524 Bacteria 60519
579 Ga0495663_0000020 3300046525 Bacteria 124560
580 Ga0495663_0001269 3300046525 Bacteria 8015
581 Ga0495654_0001382 3300046530 Bacteria 16825
582 Ga0495640_0027903 3300046533 Bacteria 4067
583 Ga0495609_0005528 3300046538 Bacteria 6604
584 Ga0495621_0005314 3300046539 Bacteria 3691
585 Ga0495633_0000983 3300046558 Bacteria 23405
586 Ga0495633_0001072 3300046558 Bacteria 22116
587 Ga0495633_0002904 3300046558 Bacteria 11752
588 Ga0495633_0020069 3300046558 Bacteria 3367
589 Ga0495668_0000004 3300046616 Bacteria 574236
590 Ga0495668_0000163 3300046616 Bacteria 99607
591 Ga0495668_0002911 3300046616 Bacteria 13507
592 Ga0495668_0015770 3300046616 Bacteria 4405
593 Ga0495668_0061841 3300046616 Bacteria 2064
594 Ga0495668_0067068 3300046616 Bacteria 1974
595 Ga0495634_0031949 3300046642 Bacteria 3623
596 Ga0495625_0000332 3300046660 Bacteria 71947
597 Ga0495625_0000553 3300046660 Bacteria 54796
598 Ga0495625_0000568 3300046660 Bacteria 54059
599 Ga0495625_0043887 3300046660 Bacteria 3239
600 Ga0495625_0055633 3300046660 Bacteria 2821
601 Ga0495669_0000629 3300046684 Bacteria 15335
602 Ga0495670_0000007 3300046691 Bacteria 247088
603 Ga0495671_0000031 3300046692 Bacteria 202030
604 Ga0495589_0008334 3300046794 Bacteria 5416
605 Ga0495600_0000914 3300046809 Bacteria 15826
606 Ga0495674_0068220 3300047319 Bacteria 3078
607 Ga0495687_000511 3300047443 Bacteria 46733
608 Ga0495687_001938 3300047443 Bacteria 17742
609 Ga0495677_0000956 3300047445 Bacteria 11629
610 Ga0495681_0000008 3300047470 Bacteria 215295
611 Ga0495681_0000094 3300047470 Bacteria 77400
612 Ga0495681_0003826 3300047470 Bacteria 10415
613 Ga0495681_0025529 3300047470 Bacteria 3089
614 Ga0495686_0000013 3300047472 Bacteria 489656
615 Ga0495686_0005293 3300047472 Bacteria 10228
616 Ga0495686_0006390 3300047472 Bacteria 9035
617 Ga0495615_0000239 3300048090 Bacteria 11254
618 Ga0495615_0002333 3300048090 Bacteria 3029
619 Ga0496101_0001612 3300048904 Bacteria 13571
620 Ga0496102_0000106 3300048905 Bacteria 118841
621 Ga0496102_0000120 3300048905 Bacteria 112432
622 Ga0496102_0002374 3300048905 Bacteria 16067
623 Ga0496102_0008515 3300048905 Bacteria 8793
624 Ga0496103_0000095 3300048906 Bacteria 98260
625 Ga0496103_0000154 3300048906 Bacteria 72239
626 Ga0496103_0000984 3300048906 Bacteria 20114
627 Ga0496103_0001305 3300048906 Bacteria 16975
628 Ga0496103_0024978 3300048906 Bacteria 3608
629 Ga0496104_0000060 3300048907 Bacteria 117966
630 Ga0496104_0083563 3300048907 Bacteria 3045
631 Ga0496105_0000274 3300048908 Bacteria 34048
632 Ga0496107_0004473 3300048910 Bacteria 9480
633 Ga0496108_0019377 3300048911 Bacteria 5586
634 Ga0496110_0002630 3300048913 Bacteria 13523
635 Ga0496110_0008273 3300048913 Bacteria 8364
636 Ga0496111_0023431 3300048914 Bacteria 4334
637 Ga0496112_0074755 3300048915 Bacteria 3351
638 Ga0496112_0121955 3300048915 Bacteria 2577
639 Ga0496113_0003962 3300048916 Bacteria 8994
640 Ga0496115_0000134 3300048918 Bacteria 67910
641 Ga0496115_0000172 3300048918 Bacteria 59971
642 Ga0496116_0000028 3300048919 Bacteria 424086
643 Ga0496116_0004809 3300048919 Bacteria 12742
644 Ga0496116_0014370 3300048919 Bacteria 6328
645 Ga0496117_0000317 3300048920 Bacteria 84472
646 Ga0496117_0000366 3300048920 Bacteria 78816
647 Ga0496117_0000582 3300048920 Bacteria 60157
648 Ga0496117_0003953 3300048920 Bacteria 16753
649 Ga0496118_0000303 3300048921 Bacteria 85332
650 Ga0496118_0000392 3300048921 Bacteria 74074
651 Ga0496118_0003549 3300048921 Bacteria 19478
652 Ga0496118_0033548 3300048921 Bacteria 4209
653 Ga0496119_0001213 3300048922 Bacteria 32201
654 Ga0496119_0047407 3300048922 Bacteria 2674
655 Ga0496120_0001109 3300048923 Bacteria 35064
656 Ga0496121_0004566 3300048924 Bacteria 18476
657 Ga0496121_0005396 3300048924 Bacteria 16416
658 Ga0496121_0013959 3300048924 Bacteria 8580
659 Ga0496122_0001187 3300048925 Bacteria 44594
660 Ga0496122_0002369 3300048925 Bacteria 26990
661 Ga0496122_0004287 3300048925 Bacteria 17866
662 Ga0496122_0009082 3300048925 Bacteria 10542
663 Ga0496122_0017843 3300048925 Bacteria 6599
664 Ga0496123_0000518 3300048926 Bacteria 67308
665 Ga0496123_0001557 3300048926 Bacteria 31501
666 Ga0496123_0007047 3300048926 Bacteria 10696
667 Ga0496124_0000214 3300048927 Bacteria 113007
668 Ga0496124_0000606 3300048927 Bacteria 60251
669 Ga0496124_0001819 3300048927 Bacteria 29505
670 Ga0496124_0007214 3300048927 Bacteria 11876
671 Ga0496124_0009700 3300048927 Bacteria 9855
672 Ga0496124_0037659 3300048927 Bacteria 4204
673 Ga0496125_0000666 3300048928 Bacteria 57200
674 Ga0496125_0091998 3300048928 Bacteria 2269
675 Ga0496126_0000079 3300048929 Bacteria 222463
676 Ga0496126_0000294 3300048929 Bacteria 106327
677 Ga0496126_0004606 3300048929 Bacteria 16354
678 Ga0501292_000172 3300049515 Bacteria 10490
679 Ga0501294_000303 3300049517 Bacteria 6028
680 Ga0501300_000548 3300049523 Bacteria 5631
681 Ga0501032_0001272 3300049569 Bacteria 20206
682 Ga0501037_0005776 3300049573 Bacteria 9035
683 Ga0501047_0003383 3300049581 Bacteria 15102
684 Ga0501047_0051581 3300049581 Bacteria 3976
685 Ga0501047_0156997 3300049581 Bacteria 2148
686 Ga0501047_0181061 3300049581 Bacteria 1974
687 Ga0501067_0000227 3300049583 Bacteria 31300
688 Ga0501073_0000004 3300049589 Bacteria 261794
689 Ga0501077_0000008 3300049593 Bacteria 106496
690 Ga0501223_000495 3300049663 Bacteria 9553
691 Ga0501223_000734 3300049663 Bacteria 7804
692 Ga0501224_000006 3300049664 Bacteria 149611
693 Ga0501233_000165 3300049668 Bacteria 9518
694 Ga0501249_001926 3300049679 Bacteria 4218
695 Ga0501257_000031 3300049686 Bacteria 40822
696 Ga0501259_002260 3300049688 Bacteria 3158
697 Ga0501261_000301 3300049690 Bacteria 6784
698 Ga0501225_0000845 3300049705 Bacteria 9521
699 Ga0501080_0000654 3300049742 Bacteria 27505
700 Ga0501279_000239 3300049775 Bacteria 7546
701 Ga0501280_000005 3300049776 Bacteria 85174
702 Ga0501280_000342 3300049776 Bacteria 11591
703 Ga0501281_00513 3300049777 Bacteria 3598
704 Ga0501282_000535 3300049778 Bacteria 4462
705 Ga0501283_000937 3300049779 Bacteria 3872
706 Ga0501035_0023615 3300049822 Bacteria 5641
707 Ga0501044_0000868 3300049823 Bacteria 36400
708 Ga0501044_0011325 3300049823 Bacteria 9664
709 nmdc:mga00v17_1761_c1 3300050491 Bacteria 11247
710 nmdc:mga00v17_2745_c1 3300050491 Bacteria 4132
711 nmdc:mga0k408_4871_c1 3300050493 Bacteria 7118
712 nmdc:mga06z11_26_c1 3300050494 Bacteria 64283
713 nmdc:mga04h51_118_c1 3300050495 Bacteria 23239
714 nmdc:mga04h51_22_c1 3300050495 Bacteria 64371
715 nmdc:mga07m45_22923_c1 3300050496 Bacteria 3410
716 nmdc:mga07m45_403_c1 3300050496 Bacteria 17870
717 nmdc:mga07m45_43825_c1 3300050496 Bacteria 2509
718 nmdc:mga0qj67_18352_c1 3300050509 Bacteria 5331
719 nmdc:mga0sz30_1259_c1 3300050516 Bacteria 9051
720 Ga0500643_000001 3300053087 Bacteria 1440111
721 Ga0500643_000030 3300053087 Bacteria 206784
722 Ga0500643_001071 3300053087 Bacteria 16543
723 Ga0500643_001104 3300053087 Bacteria 16160
724 Ga0500643_002047 3300053087 Bacteria 10799
725 Ga0500643_002494 3300053087 Bacteria 9443
726 Ga0500643_002878 3300053087 Bacteria 8571
727 Ga0500643_003295 3300053087 Bacteria 7838
728 Ga0500643_006377 3300053087 Bacteria 4935
729 Ga0500643_009984 3300053087 Bacteria 3577
730 Ga0500643_023246 3300053087 Bacteria 1982
731 Ga0500643_023489 3300053087 Bacteria 1969
732 Ga0500566_0003635 3300053094 Bacteria 9199
733 Ga0500641_0019379 3300053096 Bacteria 2572
734 Ga0500556_0000049 3300053104 Bacteria 122572
735 Ga0500592_000270 3300053116 Bacteria 9225
736 Ga0500592_000280 3300053116 Bacteria 9035
737 Ga0500594_0002630 3300053118 Bacteria 3902
738 Ga0500594_0003469 3300053118 Bacteria 3466
739 Ga0500595_001337 3300053119 Bacteria 13334
740 Ga0500595_022036 3300053119 Bacteria 2264
741 Ga0500597_007055 3300053120 Bacteria 3779
742 Ga0500607_001726 3300053121 Bacteria 18994
743 Ga0500607_002875 3300053121 Bacteria 13266
744 Ga0500608_002406 3300053122 Bacteria 6808
745 Ga0500608_004409 3300053122 Bacteria 5446
746 Ga0500642_0000002 3300053130 Bacteria 795093
747 Ga0500658_0000108 3300053134 Bacteria 38564
748 Ga0500658_0002704 3300053134 Bacteria 6820
749 Ga0500559_0002377 3300053136 Bacteria 9801
750 Ga0500559_0006954 3300053136 Bacteria 5059
751 Ga0500568_0001734 3300053139 Bacteria 13523
752 Ga0500573_0000034 3300053140 Bacteria 113547
753 Ga0500616_0003384 3300053153 Bacteria 12243
754 Ga0500622_0006524 3300053156 Bacteria 6747
755 Ga0500624_000001 3300053157 Bacteria 284974
756 Ga0500624_000024 3300053157 Bacteria 114404
757 Ga0500624_000088 3300053157 Bacteria 47211
758 Ga0500627_0000049 3300053158 Bacteria 58947
759 Ga0500627_0000199 3300053158 Bacteria 17319
760 Ga0500627_0000335 3300053158 Bacteria 12748
761 Ga0500636_0006191 3300053177 Bacteria 6874
762 Ga0500636_0008307 3300053177 Bacteria 6022
763 Ga0500637_0000097 3300053178 Bacteria 31449
764 Ga0500637_0007967 3300053178 Bacteria 5321
765 Ga0500567_000103 3300053723 Bacteria 21300
766 Ga0500625_000029 3300053729 Bacteria 54479
767 Ga0500645_000173 3300053730 Bacteria 50903
768 Ga0500645_000300 3300053730 Bacteria 35408
769 Ga0500645_000452 3300053730 Bacteria 28126
770 Ga0501082_0138497 3300060353 Bacteria 2112

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10113654 Ga0105239_101136542 512
2 3300050496 nmdc:mga07m45_43825_c1 nmdc:mga07m45_43825_c1_854_2434 526
3 3300053096 Ga0500641_0019379 Ga0500641_0019379_45_1625 526
4 3300053120 Ga0500597_007055 Ga0500597_007055_2182_3762 526
5 3300047470 Ga0495681_0003826 Ga0495681_0003826_35_1648 537
6 3300031901 Ga0307406_10021789 Ga0307406_100217893 546
7 3300032004 Ga0307414_10114411 Ga0307414_101144112 546
8 3300046539 Ga0495621_0005314 Ga0495621_0005314_1769_3652 547
9 3300014326 Ga0157380_10013463 Ga0157380_100134637 548
10 3300017792 Ga0163161_10103664 Ga0163161_101036641 551
11 3300025972 Ga0207668_10055215 Ga0207668_100552152 551
12 3300031731 Ga0307405_10054567 Ga0307405_100545672 551
13 3300031903 Ga0307407_10040428 Ga0307407_100404282 551
14 3300032002 Ga0307416_100080138 Ga0307416_1000801382 551
15 3300032005 Ga0307411_10062055 Ga0307411_100620551 552
16 3300031731 Ga0307405_10041028 Ga0307405_100410281 553
17 3300027876 Ga0209974_10003430 Ga0209974_100034305 554
18 3300031548 Ga0307408_100015727 Ga0307408_1000157275 554
19 3300031548 Ga0307408_100087906 Ga0307408_1000879061 554
20 3300031824 Ga0307413_10012702 Ga0307413_100127022 554
21 3300031901 Ga0307406_10019894 Ga0307406_100198945 554
22 3300031911 Ga0307412_10008746 Ga0307412_100087462 554
23 3300032005 Ga0307411_10104906 Ga0307411_101049061 554
24 3300032126 Ga0307415_100009023 Ga0307415_1000090234 554
25 3300005331 Ga0070670_100005522 Ga0070670_10000552211 555
26 3300005548 Ga0070665_100013328 Ga0070665_1000133282 555
27 3300025925 Ga0207650_10018925 Ga0207650_100189252 555
28 3300047472 Ga0495686_0006390 Ga0495686_0006390_3106_4899 555
29 3300005293 Ga0065715_10000978 Ga0065715_100009783 556
30 3300005328 Ga0070676_10007834 Ga0070676_100078346 556
31 3300005354 Ga0070675_100004161 Ga0070675_1000041618 556
32 3300005364 Ga0070673_100032493 Ga0070673_1000324932 556
33 3300005545 Ga0070695_100075744 Ga0070695_1000757442 556
34 3300005844 Ga0068862_100012106 Ga0068862_1000121063 556
35 3300009094 Ga0111539_10029495 Ga0111539_100294956 556
36 3300014326 Ga0157380_10003002 Ga0157380_100030027 556
37 3300025315 Ga0207697_10003297 Ga0207697_100032975 556
38 3300025907 Ga0207645_10012931 Ga0207645_100129312 556
39 3300025933 Ga0207706_10014593 Ga0207706_100145933 556
40 3300025940 Ga0207691_10005772 Ga0207691_1000577212 556
41 3300025972 Ga0207668_10002528 Ga0207668_100025288 556
42 3300026118 Ga0207675_100150282 Ga0207675_1001502821 556
43 3300026121 Ga0207683_10033010 Ga0207683_100330104 556
44 3300037471 Ga0395905_0094244 Ga0395905_0094244_728_2605 556
45 3300005331 Ga0070670_100087376 Ga0070670_1000873762 557
46 3300031852 Ga0307410_10014143 Ga0307410_100141433 559
47 3300032004 Ga0307414_10000346 Ga0307414_100003469 559
48 3300025972 Ga0207668_10041715 Ga0207668_100417152 560
49 3300046512 Ga0495610_0031373 Ga0495610_0031373_690_2510 560
50 3300032126 Ga0307415_100035245 Ga0307415_1000352451 561
51 3300031852 Ga0307410_10000684 Ga0307410_100006845 562
52 3300032002 Ga0307416_100043746 Ga0307416_1000437462 562
53 3300032004 Ga0307414_10014644 Ga0307414_100146443 562
54 3300032005 Ga0307411_10024249 Ga0307411_100242492 562
55 3300048915 Ga0496112_0074755 Ga0496112_0074755_1197_3011 562
56 3300046519 Ga0495632_0000211 Ga0495632_0000211_1983_3797 563
57 3300046520 Ga0495637_0014469 Ga0495637_0014469_406_2220 563
58 3300046522 Ga0495643_0000053 Ga0495643_0000053_133117_134931 563
59 3300046525 Ga0495663_0000020 Ga0495663_0000020_67477_69291 563
60 3300046558 Ga0495633_0000983 Ga0495633_0000983_13129_14943 563
61 3300046692 Ga0495671_0000031 Ga0495671_0000031_67100_68914 563
62 3300047470 Ga0495681_0025529 Ga0495681_0025529_1202_3016 563
63 3300031824 Ga0307413_10028311 Ga0307413_100283111 564
64 3300031852 Ga0307410_10033329 Ga0307410_100333291 564
65 3300031903 Ga0307407_10051333 Ga0307407_100513331 564
66 3300031911 Ga0307412_10090273 Ga0307412_100902731 564
67 3300031995 Ga0307409_100036824 Ga0307409_1000368244 564
68 3300032002 Ga0307416_100103237 Ga0307416_1001032372 564
69 3300032004 Ga0307414_10016059 Ga0307414_100160591 564
70 3300003794 Ga0055531_10001714 Ga0055531_100017144 565
71 3300025298 Ga0209050_1008085 Ga0209050_10080855 565
72 3300025304 Ga0209257_1001405 Ga0209257_100140516 565
73 3300053139 Ga0500568_0001734 Ga0500568_0001734_7585_9399 565
74 3300046558 Ga0495633_0001072 Ga0495633_0001072_7253_9085 566
75 3300053158 Ga0500627_0000049 Ga0500627_0000049_52177_54024 566
76 3300005366 Ga0070659_100013031 Ga0070659_1000130313 567
77 3300005457 Ga0070662_100005311 Ga0070662_1000053112 567
78 3300005458 Ga0070681_10089493 Ga0070681_100894932 567
79 3300006195 Ga0075366_10012022 Ga0075366_100120223 567
80 3300025912 Ga0207707_10090256 Ga0207707_100902562 567
81 3300025933 Ga0207706_10004467 Ga0207706_100044676 567
82 3300050493 nmdc:mga0k408_4871_c1 nmdc:mga0k408_4871_c1_1529_3355 567
83 3300025229 Ga0209147_100321 Ga0209147_10032110 569
84 3300047472 Ga0495686_0005293 Ga0495686_0005293_5486_7315 569
85 3300005985 Ga0081539_10019805 Ga0081539_100198052 570
86 3300031548 Ga0307408_100019173 Ga0307408_1000191733 570
87 3300031824 Ga0307413_10007679 Ga0307413_100076794 570
88 3300031901 Ga0307406_10036423 Ga0307406_100364232 570
89 3300031995 Ga0307409_100064704 Ga0307409_1000647042 570
90 3300032002 Ga0307416_100037671 Ga0307416_1000376713 570
91 3300032126 Ga0307415_100055878 Ga0307415_1000558782 570
92 3300046522 Ga0495643_0019902 Ga0495643_0019902_719_2533 570
93 3300005844 Ga0068862_100018068 Ga0068862_1000180682 571
94 3300025972 Ga0207668_10085580 Ga0207668_100855802 571
95 3300046660 Ga0495625_0055633 Ga0495625_0055633_404_2239 571
96 iso_pu_bacteria 2821443989 2821449023 571
97 3300006195 Ga0075366_10004887 Ga0075366_100048874 572
98 3300027866 Ga0209813_10000126 Ga0209813_1000012624 572
99 3300013105 Ga0157369_10025937 Ga0157369_100259371 573
100 3300013306 Ga0163162_10035914 Ga0163162_100359145 573
101 3300028380 Ga0268265_10006969 Ga0268265_100069698 573
102 3300046616 Ga0495668_0000004 Ga0495668_0000004_451935_453782 573
103 3300049581 Ga0501047_0181061 Ga0501047_0181061_51_1853 573
104 3300053087 Ga0500643_023246 Ga0500643_023246_44_1780 573
105 3300003215 JGI25153J46596_10000006 JGI25153J46596_10000006348 574
106 3300012513 Ga0157326_1000059 Ga0157326_10000592 574
107 3300025297 Ga0209758_1000001 Ga0209758_10000011478 574
108 3300009177 Ga0105248_10008150 Ga0105248_100081501 575
109 3300025941 Ga0207711_10075264 Ga0207711_100752641 575
110 3300049679 Ga0501249_001926 Ga0501249_001926_2469_4205 575
111 3300053087 Ga0500643_002494 Ga0500643_002494_1074_2930 575
112 3300005335 Ga0070666_10010284 Ga0070666_100102846 576
113 3300005347 Ga0070668_100000027 Ga0070668_10000002732 576
114 3300005355 Ga0070671_100001241 Ga0070671_1000012412 576
115 3300005367 Ga0070667_100000017 Ga0070667_100000017211 576
116 3300005539 Ga0068853_100002669 Ga0068853_10000266911 576
117 3300005616 Ga0068852_100034615 Ga0068852_1000346151 576
118 3300005617 Ga0068859_100027164 Ga0068859_1000271642 576
119 3300005841 Ga0068863_100006015 Ga0068863_1000060152 576
120 3300005842 Ga0068858_100000103 Ga0068858_10000010358 576
121 3300005843 Ga0068860_100000056 Ga0068860_10000005633 576
122 3300005844 Ga0068862_100005376 Ga0068862_1000053766 576
123 3300006931 Ga0097620_100027165 Ga0097620_1000271652 576
124 3300009098 Ga0105245_10002260 Ga0105245_1000226013 576
125 3300013297 Ga0157378_10094681 Ga0157378_100946812 576
126 3300025903 Ga0207680_10049495 Ga0207680_100494952 576
127 3300025931 Ga0207644_10000574 Ga0207644_1000057413 576
128 3300025941 Ga0207711_10041275 Ga0207711_100412753 576
129 3300025972 Ga0207668_10000012 Ga0207668_1000001231 576
130 3300025986 Ga0207658_10000011 Ga0207658_1000001132 576
131 3300026035 Ga0207703_10000691 Ga0207703_100006917 576
132 3300026088 Ga0207641_10002092 Ga0207641_100020929 576
133 3300026116 Ga0207674_10069644 Ga0207674_100696443 576
134 3300028380 Ga0268265_10000958 Ga0268265_100009588 576
135 3300028381 Ga0268264_10000089 Ga0268264_10000089218 576
136 3300053087 Ga0500643_001071 Ga0500643_001071_10780_12549 576
137 3300053157 Ga0500624_000024 Ga0500624_000024_29435_31270 576
138 3300003781 Ga0055536_1006713 Ga0055536_10067131 577
139 3300005842 Ga0068858_100000777 Ga0068858_10000077714 577
140 3300006042 Ga0075368_10000704 Ga0075368_100007045 577
141 3300006178 Ga0075367_10000042 Ga0075367_100000427 577
142 3300006847 Ga0075431_100007563 Ga0075431_1000075639 577
143 3300009094 Ga0111539_10000017 Ga0111539_10000017127 577
144 3300009177 Ga0105248_10003098 Ga0105248_100030986 577
145 3300025292 Ga0209676_1000929 Ga0209676_100092913 577
146 3300025941 Ga0207711_10003251 Ga0207711_1000325111 577
147 3300026035 Ga0207703_10001013 Ga0207703_100010139 577
148 3300026095 Ga0207676_10000894 Ga0207676_100008945 577
149 3300027866 Ga0209813_10000042 Ga0209813_1000004231 577
150 3300041410 Ga0439461_0000190 Ga0439461_0000190_5842_7671 577
151 3300041413 Ga0439465_0000420 Ga0439465_0000420_5024_6853 577
152 3300041997 Ga0439431_0000645 Ga0439431_0000645_1748_3577 577
153 3300042015 Ga0439462_0001856 Ga0439462_0001856_348_2177 577
154 3300042435 Ga0439434_0000823 Ga0439434_0000823_4175_6004 577
155 3300046515 Ga0495620_0031636 Ga0495620_0031636_437_2338 577
156 3300050494 nmdc:mga06z11_26_c1 nmdc:mga06z11_26_c1_42101_43924 577
157 3300050495 nmdc:mga04h51_22_c1 nmdc:mga04h51_22_c1_20490_22313 577
158 3300053087 Ga0500643_001104 Ga0500643_001104_3591_5414 577
159 3300053087 Ga0500643_002878 Ga0500643_002878_2205_4130 577
160 3300013307 Ga0157372_10214297 Ga0157372_102142972 578
161 3300025298 Ga0209050_1002610 Ga0209050_10026106 578
162 3300042007 Ga0439449_0014110 Ga0439449_0014110_970_2823 578
163 3300042015 Ga0439462_0000249 Ga0439462_0000249_74_1903 578
164 3300049581 Ga0501047_0003383 Ga0501047_0003383_5760_7622 578
165 3300053087 Ga0500643_000030 Ga0500643_000030_13054_14898 578
166 iso_pu_bacteria 2844533157 2844536020 578
167 3300005344 Ga0070661_100000010 Ga0070661_100000010159 579
168 3300005530 Ga0070679_100165301 Ga0070679_1001653011 579
169 3300005548 Ga0070665_100000086 Ga0070665_100000086177 579
170 3300005616 Ga0068852_100156023 Ga0068852_1001560232 579
171 3300009553 Ga0105249_10040062 Ga0105249_100400622 579
172 3300025920 Ga0207649_10000178 Ga0207649_100001786 579
173 3300025933 Ga0207706_10031363 Ga0207706_100313633 579
174 3300025961 Ga0207712_10009432 Ga0207712_100094322 579
175 3300026067 Ga0207678_10020460 Ga0207678_100204603 579
176 3300026116 Ga0207674_10084252 Ga0207674_100842523 579
177 3300028379 Ga0268266_10000002 Ga0268266_100000022383 579
178 3300033180 Ga0307510_10092283 Ga0307510_100922832 579
179 3300039437 Ga0436365_1921522 Ga0436365_1921522_1158_3035 579
180 3300048918 Ga0496115_0000134 Ga0496115_0000134_9506_11320 579
181 3300049822 Ga0501035_0023615 Ga0501035_0023615_3404_5242 579
182 3300053116 Ga0500592_000280 Ga0500592_000280_1958_3799 579
183 3300053158 Ga0500627_0000199 Ga0500627_0000199_6665_8506 579
184 3300005327 Ga0070658_10024952 Ga0070658_100249525 580
185 3300005331 Ga0070670_100003165 Ga0070670_10000316513 580
186 3300005344 Ga0070661_100015823 Ga0070661_1000158232 580
187 3300005353 Ga0070669_100016595 Ga0070669_1000165952 580
188 3300005354 Ga0070675_100012526 Ga0070675_1000125265 580
189 3300005355 Ga0070671_100000353 Ga0070671_1000003534 580
190 3300005367 Ga0070667_100011712 Ga0070667_1000117123 580
191 3300005543 Ga0070672_100003237 Ga0070672_1000032378 580
192 3300005548 Ga0070665_100015010 Ga0070665_10001501013 580
193 3300005564 Ga0070664_100009278 Ga0070664_1000092788 580
194 3300009101 Ga0105247_10016928 Ga0105247_100169283 580
195 3300009545 Ga0105237_10050794 Ga0105237_100507943 580
196 3300009553 Ga0105249_10000567 Ga0105249_1000056712 580
197 3300025914 Ga0207671_10014738 Ga0207671_100147383 580
198 3300025923 Ga0207681_10053593 Ga0207681_100535931 580
199 3300025925 Ga0207650_10035934 Ga0207650_100359342 580
200 3300025926 Ga0207659_10045306 Ga0207659_100453062 580
201 3300025931 Ga0207644_10033072 Ga0207644_100330722 580
202 3300025937 Ga0207669_10083879 Ga0207669_100838791 580
203 3300025940 Ga0207691_10004823 Ga0207691_100048238 580
204 3300025945 Ga0207679_10004610 Ga0207679_100046108 580
205 3300025986 Ga0207658_10033271 Ga0207658_100332713 580
206 3300032004 Ga0307414_10009428 Ga0307414_100094283 580
207 3300032005 Ga0307411_10004783 Ga0307411_100047836 580
208 3300035170 Ga0373943_0033198 Ga0373943_0033198_209_2035 580
209 3300035171 Ga0373946_0020771 Ga0373946_0020771_285_2111 580
210 3300035692 Ga0373935_0028704 Ga0373935_0028704_1115_2941 580
211 3300042006 Ga0439432_018266 Ga0439432_018266_82_1935 580
212 3300046459 Ga0495629_0033426 Ga0495629_0033426_707_2533 580
213 3300046476 Ga0495662_0027591 Ga0495662_0027591_495_2321 580
214 3300046533 Ga0495640_0027903 Ga0495640_0027903_1143_2969 580
215 3300046642 Ga0495634_0031949 Ga0495634_0031949_682_2508 580
216 3300047319 Ga0495674_0068220 Ga0495674_0068220_1034_2860 580
217 3300048913 Ga0496110_0002630 Ga0496110_0002630_2776_4629 580
218 3300048914 Ga0496111_0023431 Ga0496111_0023431_783_2636 580
219 3300049581 Ga0501047_0156997 Ga0501047_0156997_192_2030 580
220 3300053087 Ga0500643_009984 Ga0500643_009984_1633_3459 580
221 3300053157 Ga0500624_000088 Ga0500624_000088_35954_37780 580
222 3300053177 Ga0500636_0006191 Ga0500636_0006191_4529_6355 580
223 iso_pu_bacteria 2510917021 2511130117 580
224 iso_pu_bacteria 2818991438 2819553163 580
225 iso_pu_bacteria 2882806704 2882808374 580
226 iso_pu_bacteria 2896429255 2896430231 580
227 iso_pu_bacteria 8054302542 8054304792 580
228 3300005339 Ga0070660_100004165 Ga0070660_1000041659 581
229 3300005367 Ga0070667_100000066 Ga0070667_10000006698 581
230 3300005843 Ga0068860_100000013 Ga0068860_100000013217 581
231 3300021358 Ga0213873_10000015 Ga0213873_1000001529 581
232 3300021384 Ga0213876_10000005 Ga0213876_10000005706 581
233 3300025919 Ga0207657_10022107 Ga0207657_100221074 581
234 3300025942 Ga0207689_10093863 Ga0207689_100938632 581
235 3300025986 Ga0207658_10000132 Ga0207658_1000013211 581
236 3300026118 Ga0207675_100084771 Ga0207675_1000847713 581
237 3300028381 Ga0268264_10000039 Ga0268264_10000039215 581
238 3300039437 Ga0436365_1132330 Ga0436365_1132330_47583_49409 581
239 3300039453 Ga0436362_0875621 Ga0436362_0875621_30373_32199 581
240 3300049569 Ga0501032_0001272 Ga0501032_0001272_2230_4077 581
241 3300049573 Ga0501037_0005776 Ga0501037_0005776_4581_6401 581
242 3300049583 Ga0501067_0000227 Ga0501067_0000227_12823_14643 581
243 3300049589 Ga0501073_0000004 Ga0501073_0000004_109303_111123 581
244 3300049593 Ga0501077_0000008 Ga0501077_0000008_90488_92308 581
245 3300049742 Ga0501080_0000654 Ga0501080_0000654_16933_18753 581
246 3300049823 Ga0501044_0000868 Ga0501044_0000868_25607_27427 581
247 3300050491 nmdc:mga00v17_2745_c1 nmdc:mga00v17_2745_c1_1507_3339 581
248 3300050495 nmdc:mga04h51_118_c1 nmdc:mga04h51_118_c1_20860_22692 581
249 3300050496 nmdc:mga07m45_403_c1 nmdc:mga07m45_403_c1_13525_15357 581
250 3300050516 nmdc:mga0sz30_1259_c1 nmdc:mga0sz30_1259_c1_4603_6435 581
251 3300060353 Ga0501082_0138497 Ga0501082_0138497_140_1990 581
252 iso_pu_bacteria 2739367664 2739650373 581
253 iso_pu_bacteria 2739367865 2740028846 581
254 iso_pu_bacteria 2895880812 2895882645 581
255 3300002987 JGI25159J45721_1007784 JGI25159J45721_10077841 582
256 3300003187 JGI25151J46595_10001638 JGI25151J46595_100016389 582
257 3300003791 Ga0055530_10002492 Ga0055530_100024925 582
258 3300003794 Ga0055531_10000008 Ga0055531_10000008125 582
259 3300005262 Ga0065165_1001443 Ga0065165_100144315 582
260 3300005347 Ga0070668_100019269 Ga0070668_1000192692 582
261 3300005367 Ga0070667_100000067 Ga0070667_10000006779 582
262 3300005367 Ga0070667_100019588 Ga0070667_1000195884 582
263 3300005841 Ga0068863_100000038 Ga0068863_10000003877 582
264 3300005844 Ga0068862_100004188 Ga0068862_1000041887 582
265 3300005985 Ga0081539_10018190 Ga0081539_100181902 582
266 3300014326 Ga0157380_10051349 Ga0157380_100513492 582
267 3300025284 Ga0209130_1000512 Ga0209130_10005128 582
268 3300025294 Ga0209025_1000114 Ga0209025_1000114101 582
269 3300025297 Ga0209758_1001428 Ga0209758_100142816 582
270 3300025298 Ga0209050_1000026 Ga0209050_100002658 582
271 3300025302 Ga0207426_1000181 Ga0207426_100018171 582
272 3300025304 Ga0209257_1000009 Ga0209257_100000958 582
273 3300025907 Ga0207645_10004405 Ga0207645_100044055 582
274 3300025919 Ga0207657_10009966 Ga0207657_1000996611 582
275 3300025972 Ga0207668_10000629 Ga0207668_1000062912 582
276 3300025986 Ga0207658_10000089 Ga0207658_1000008954 582
277 3300025986 Ga0207658_10009504 Ga0207658_100095045 582
278 3300026088 Ga0207641_10000060 Ga0207641_1000006084 582
279 3300028380 Ga0268265_10006174 Ga0268265_100061743 582
280 3300031507 Ga0307509_10000115 Ga0307509_1000011541 582
281 3300031911 Ga0307412_10007668 Ga0307412_100076686 582
282 3300032004 Ga0307414_10022219 Ga0307414_100222191 582
283 3300039437 Ga0436365_1277439 Ga0436365_1277439_575_2401 582
284 3300046500 Ga0495596_0007033 Ga0495596_0007033_1868_3703 582
285 3300046512 Ga0495610_0021839 Ga0495610_0021839_293_2107 582
286 3300047472 Ga0495686_0000013 Ga0495686_0000013_25539_27374 582
287 3300048927 Ga0496124_0007214 Ga0496124_0007214_7142_8962 582
288 3300049823 Ga0501044_0011325 Ga0501044_0011325_129_1934 582
289 3300053134 Ga0500658_0002704 Ga0500658_0002704_3259_5091 582
290 3300053156 Ga0500622_0006524 Ga0500622_0006524_2276_4099 582
291 3300053157 Ga0500624_000001 Ga0500624_000001_59276_61090 582
292 3300053178 Ga0500637_0000097 Ga0500637_0000097_3718_5532 582
293 iso_pu_bacteria 2643221560 2643820085 582
294 iso_pu_bacteria 2643221563 2643836386 582
295 iso_pu_bacteria 2643221608 2644052862 582
296 iso_pu_bacteria 2852653556 2852653986 582
297 iso_pu_bacteria 2852680915 2852683260 582
298 3300005333 Ga0070677_10001757 Ga0070677_100017575 583
299 3300005353 Ga0070669_100021839 Ga0070669_1000218394 583
300 3300005354 Ga0070675_100023281 Ga0070675_1000232815 583
301 3300005841 Ga0068863_100006939 Ga0068863_1000069399 583
302 3300005843 Ga0068860_100024655 Ga0068860_1000246553 583
303 3300005844 Ga0068862_100000485 Ga0068862_10000048517 583
304 3300013100 Ga0157373_10009216 Ga0157373_100092166 583
305 3300025893 Ga0207682_10002080 Ga0207682_100020805 583
306 3300025900 Ga0207710_10008695 Ga0207710_100086952 583
307 3300025909 Ga0207705_10051400 Ga0207705_100514002 583
308 3300025923 Ga0207681_10027414 Ga0207681_100274142 583
309 3300025925 Ga0207650_10020051 Ga0207650_100200513 583
310 3300025926 Ga0207659_10054702 Ga0207659_100547022 583
311 3300025933 Ga0207706_10120023 Ga0207706_101200232 583
312 3300025941 Ga0207711_10074113 Ga0207711_100741133 583
313 3300025961 Ga0207712_10000008 Ga0207712_1000000811 583
314 3300026088 Ga0207641_10004584 Ga0207641_100045847 583
315 3300027876 Ga0209974_10003218 Ga0209974_100032185 583
316 3300028380 Ga0268265_10000082 Ga0268265_1000008281 583
317 3300028381 Ga0268264_10000933 Ga0268264_1000093312 583
318 3300028381 Ga0268264_10000935 Ga0268264_1000093513 583
319 3300031548 Ga0307408_100017748 Ga0307408_1000177484 583
320 3300031731 Ga0307405_10010450 Ga0307405_100104502 583
321 3300031824 Ga0307413_10001504 Ga0307413_100015045 583
322 3300031824 Ga0307413_10007329 Ga0307413_100073295 583
323 3300031824 Ga0307413_10029103 Ga0307413_100291033 583
324 3300031852 Ga0307410_10002446 Ga0307410_1000244611 583
325 3300031852 Ga0307410_10003698 Ga0307410_100036985 583
326 3300031852 Ga0307410_10004043 Ga0307410_100040435 583
327 3300031852 Ga0307410_10019814 Ga0307410_100198142 583
328 3300031852 Ga0307410_10021645 Ga0307410_100216454 583
329 3300031852 Ga0307410_10074721 Ga0307410_100747212 583
330 3300031903 Ga0307407_10004107 Ga0307407_100041073 583
331 3300031903 Ga0307407_10019115 Ga0307407_100191153 583
332 3300031911 Ga0307412_10045050 Ga0307412_100450502 583
333 3300031995 Ga0307409_100023016 Ga0307409_1000230162 583
334 3300032004 Ga0307414_10002088 Ga0307414_100020882 583
335 3300032004 Ga0307414_10002337 Ga0307414_100023372 583
336 3300032004 Ga0307414_10019577 Ga0307414_100195774 583
337 3300032004 Ga0307414_10028125 Ga0307414_100281254 583
338 3300032004 Ga0307414_10050216 Ga0307414_100502162 583
339 3300032005 Ga0307411_10005751 Ga0307411_100057512 583
340 3300032005 Ga0307411_10034144 Ga0307411_100341442 583
341 3300032126 Ga0307415_100012323 Ga0307415_1000123235 583
342 3300037418 Ga0395900_0000503 Ga0395900_0000503_14630_16513 583
343 3300037471 Ga0395905_0007001 Ga0395905_0007001_4485_6368 583
344 3300038443 Ga0395901_0000520 Ga0395901_0000520_7331_9214 583
345 3300045051 Ga0451576_0000023 Ga0451576_0000023_186816_188678 583
346 3300046616 Ga0495668_0061841 Ga0495668_0061841_84_1919 583
347 3300048090 Ga0495615_0002333 Ga0495615_0002333_331_2178 583
348 3300053087 Ga0500643_023489 Ga0500643_023489_46_1878 583
349 3300053134 Ga0500658_0000108 Ga0500658_0000108_28834_30669 583
350 3300053153 Ga0500616_0003384 Ga0500616_0003384_5858_7678 583
351 iso_pu_bacteria 2512564014 2512642122 583
352 iso_pu_bacteria 2808606401 2809063651 583
353 iso_pu_bacteria 2808606404 2809079731 583
354 iso_pu_bacteria 2808606405 2809084096 583
355 iso_pu_bacteria 2830075706 2830077115 583
356 iso_pu_bacteria 2880518877 2880519420 583
357 iso_pu_bacteria 2919709256 2919711158 583
358 iso_pu_bacteria 2946787523 2946788831 583
359 iso_pu_bacteria 2984564862 2984567767 583
360 2162886007 SwRhRL2b_contig_3705000 SwRhRL2b_0172.00002390 584
361 3300005262 Ga0065165_1002698 Ga0065165_10026988 584
362 3300005289 Ga0065704_10000191 Ga0065704_10000191162 584
363 3300005364 Ga0070673_100029291 Ga0070673_1000292913 584
364 3300005367 Ga0070667_100000459 Ga0070667_10000045925 584
365 3300005841 Ga0068863_100011823 Ga0068863_1000118235 584
366 3300009177 Ga0105248_10025435 Ga0105248_100254356 584
367 3300009553 Ga0105249_10000064 Ga0105249_1000006453 584
368 3300014325 Ga0163163_10000107 Ga0163163_1000010745 584
369 3300014326 Ga0157380_10003455 Ga0157380_1000345510 584
370 3300014968 Ga0157379_10065983 Ga0157379_100659832 584
371 3300025298 Ga0209050_1014081 Ga0209050_10140812 584
372 3300025986 Ga0207658_10000291 Ga0207658_1000029126 584
373 3300026088 Ga0207641_10018011 Ga0207641_100180114 584
374 3300031731 Ga0307405_10000391 Ga0307405_100003915 584
375 3300031824 Ga0307413_10051241 Ga0307413_100512412 584
376 3300031911 Ga0307412_10010587 Ga0307412_100105874 584
377 3300032002 Ga0307416_100139612 Ga0307416_1001396121 584
378 3300046453 Ga0495627_000158 Ga0495627_000158_50956_52779 584
379 3300046453 Ga0495627_001522 Ga0495627_001522_835_2655 584
380 3300046471 Ga0495650_0008181 Ga0495650_0008181_1627_3450 584
381 3300046500 Ga0495596_0000141 Ga0495596_0000141_40428_42260 584
382 3300046512 Ga0495610_0000020 Ga0495610_0000020_308132_309955 584
383 3300046512 Ga0495610_0000071 Ga0495610_0000071_33774_35594 584
384 3300046512 Ga0495610_0002395 Ga0495610_0002395_12373_14199 584
385 3300046512 Ga0495610_0005363 Ga0495610_0005363_4063_5898 584
386 3300046522 Ga0495643_0000132 Ga0495643_0000132_98056_99882 584
387 3300046538 Ga0495609_0005528 Ga0495609_0005528_4323_6155 584
388 3300046616 Ga0495668_0015770 Ga0495668_0015770_1746_3551 584
389 3300046660 Ga0495625_0043887 Ga0495625_0043887_639_2471 584
390 3300047470 Ga0495681_0000008 Ga0495681_0000008_4729_6549 584
391 3300047470 Ga0495681_0000094 Ga0495681_0000094_51146_52969 584
392 3300048090 Ga0495615_0000239 Ga0495615_0000239_6538_8361 584
393 3300048905 Ga0496102_0008515 Ga0496102_0008515_3389_5194 584
394 3300048906 Ga0496103_0000984 Ga0496103_0000984_13323_15128 584
395 3300048907 Ga0496104_0083563 Ga0496104_0083563_530_2335 584
396 3300048911 Ga0496108_0019377 Ga0496108_0019377_3638_5509 584
397 3300048919 Ga0496116_0000028 Ga0496116_0000028_207777_209612 584
398 3300048924 Ga0496121_0004566 Ga0496121_0004566_14423_16258 584
399 3300048925 Ga0496122_0002369 Ga0496122_0002369_10364_12199 584
400 3300048925 Ga0496122_0009082 Ga0496122_0009082_2852_4675 584
401 3300048926 Ga0496123_0001557 Ga0496123_0001557_18921_20756 584
402 3300048926 Ga0496123_0007047 Ga0496123_0007047_3026_4849 584
403 3300048927 Ga0496124_0037659 Ga0496124_0037659_2187_4022 584
404 3300048929 Ga0496126_0000079 Ga0496126_0000079_33207_35042 584
405 3300049663 Ga0501223_000495 Ga0501223_000495_7609_9477 584
406 3300049664 Ga0501224_000006 Ga0501224_000006_140172_142040 584
407 3300049668 Ga0501233_000165 Ga0501233_000165_82_1950 584
408 3300049705 Ga0501225_0000845 Ga0501225_0000845_7577_9445 584
409 iso_pu_bacteria 2599185354 2600202669 584
410 iso_pu_bacteria 2599185359 2600226475 584
411 iso_pu_bacteria 2643221622 2644128894 584
412 iso_pu_bacteria 2738541275 2738712570 584
413 iso_pu_bacteria 2738541301 2738850994 584
414 iso_pu_bacteria 2738541304 2738866724 584
415 iso_pu_bacteria 2738543022 2739299241 584
416 iso_pu_bacteria 2738543033 2739360920 584
417 iso_pu_bacteria 2751185897 2753764454 584
418 iso_pu_bacteria 2818991466 2819712544 584
419 iso_pu_bacteria 2879163058 2879166644 584
420 iso_pu_bacteria 2928027323 2928030895 584
421 iso_pu_bacteria 2928100450 2928103878 584
422 iso_pu_bacteria 2928526807 2928527137 584
423 iso_pu_bacteria 2928959182 2928961807 584
424 iso_pu_bacteria 2928968154 2928969377 584
425 iso_pu_bacteria 2984555340 2984557867 584
426 iso_pu_bacteria 2993356040 2993358819 584
427 3300001904 JGI24736J21556_1000121 JGI24736J21556_10001213 585
428 3300002067 JGI24735J21928_10000918 JGI24735J21928_100009181 585
429 3300005289 Ga0065704_10100052 Ga0065704_101000522 585
430 3300005335 Ga0070666_10029018 Ga0070666_100290183 585
431 3300005344 Ga0070661_100026844 Ga0070661_1000268442 585
432 3300005347 Ga0070668_100004087 Ga0070668_1000040875 585
433 3300005539 Ga0068853_100020182 Ga0068853_1000201825 585
434 3300005548 Ga0070665_100002933 Ga0070665_1000029338 585
435 3300005564 Ga0070664_100090692 Ga0070664_1000906922 585
436 3300005841 Ga0068863_100008950 Ga0068863_1000089505 585
437 3300005844 Ga0068862_100030185 Ga0068862_1000301852 585
438 3300005844 Ga0068862_100059599 Ga0068862_1000595993 585
439 3300015690 Ga0183363_1001 Ga0183363_100176 585
440 3300025735 Ga0207713_1002611 Ga0207713_10026116 585
441 3300025903 Ga0207680_10023993 Ga0207680_100239933 585
442 3300025904 Ga0207647_10031699 Ga0207647_100316991 585
443 3300025931 Ga0207644_10003746 Ga0207644_100037462 585
444 3300025941 Ga0207711_10018314 Ga0207711_100183144 585
445 3300025949 Ga0207667_10014565 Ga0207667_100145658 585
446 3300025972 Ga0207668_10068228 Ga0207668_100682282 585
447 3300025986 Ga0207658_10012206 Ga0207658_100122064 585
448 3300026041 Ga0207639_10026227 Ga0207639_100262272 585
449 3300028379 Ga0268266_10004036 Ga0268266_100040369 585
450 3300031852 Ga0307410_10037184 Ga0307410_100371842 585
451 3300046506 Ga0495583_0010721 Ga0495583_0010721_1480_3312 585
452 3300046616 Ga0495668_0067068 Ga0495668_0067068_61_1893 585
453 3300048906 Ga0496103_0024978 Ga0496103_0024978_1722_3536 585
454 3300048921 Ga0496118_0033548 Ga0496118_0033548_625_2439 585
455 3300048927 Ga0496124_0009700 Ga0496124_0009700_3534_5360 585
456 3300053087 Ga0500643_000001 Ga0500643_000001_1144660_1146540 585
457 3300053121 Ga0500607_002875 Ga0500607_002875_8800_10620 585
458 3300053122 Ga0500608_004409 Ga0500608_004409_1712_3526 585
459 3300053723 Ga0500567_000103 Ga0500567_000103_17393_19207 585
460 3300053729 Ga0500625_000029 Ga0500625_000029_7426_9240 585
461 3300003781 Ga0055536_1003381 Ga0055536_10033811 586
462 3300003791 Ga0055530_10001655 Ga0055530_100016558 586
463 3300003794 Ga0055531_10001722 Ga0055531_1000172213 586
464 3300005578 Ga0068854_100013256 Ga0068854_1000132562 586
465 3300025291 Ga0209675_1000838 Ga0209675_10008382 586
466 3300025292 Ga0209676_1000518 Ga0209676_100051813 586
467 3300025292 Ga0209676_1000554 Ga0209676_100055456 586
468 3300025298 Ga0209050_1000017 Ga0209050_100001787 586
469 3300025304 Ga0209257_1002894 Ga0209257_100289413 586
470 3300025304 Ga0209257_1005509 Ga0209257_10055096 586
471 3300025941 Ga0207711_10003634 Ga0207711_100036349 586
472 3300025981 Ga0207640_10009509 Ga0207640_100095095 586
473 3300031911 Ga0307412_10078260 Ga0307412_100782602 586
474 3300033180 Ga0307510_10016486 Ga0307510_100164867 586
475 3300046660 Ga0495625_0000553 Ga0495625_0000553_16219_18033 586
476 3300048905 Ga0496102_0000120 Ga0496102_0000120_65792_67609 586
477 3300048906 Ga0496103_0000154 Ga0496103_0000154_10924_12741 586
478 3300048919 Ga0496116_0004809 Ga0496116_0004809_600_2417 586
479 3300048920 Ga0496117_0000317 Ga0496117_0000317_17127_18944 586
480 3300048921 Ga0496118_0000303 Ga0496118_0000303_17131_18948 586
481 3300048922 Ga0496119_0047407 Ga0496119_0047407_210_2027 586
482 3300048927 Ga0496124_0000214 Ga0496124_0000214_44824_46641 586
483 iso_pu_bacteria 2885427238 2885428352 586
484 3300001976 JGI24752J21851_1000155 JGI24752J21851_10001558 587
485 3300001976 JGI24752J21851_1000461 JGI24752J21851_10004617 587
486 3300001990 JGI24737J22298_10003404 JGI24737J22298_100034042 587
487 3300002070 JGI24750J21931_1000359 JGI24750J21931_10003595 587
488 3300002074 JGI24748J21848_1000044 JGI24748J21848_100004438 587
489 3300002076 JGI24749J21850_1000330 JGI24749J21850_10003306 587
490 3300002076 JGI24749J21850_1000531 JGI24749J21850_10005312 587
491 3300002239 JGI24034J26672_10000020 JGI24034J26672_1000002017 587
492 3300002244 JGI24742J22300_10001043 JGI24742J22300_100010434 587
493 3300002459 JGI24751J29686_10000052 JGI24751J29686_1000005225 587
494 3300002774 JGI25150J39212_1000046 JGI25150J39212_10000464 587
495 3300003214 JGI25165J46597_1000073 JGI25165J46597_100007360 587
496 3300003215 JGI25153J46596_10000124 JGI25153J46596_1000012467 587
497 3300003759 Ga0055525_1000090 Ga0055525_1000090143 587
498 3300003762 Ga0055542_1000046 Ga0055542_1000046188 587
499 3300003763 Ga0055529_1000007 Ga0055529_100000741 587
500 3300003763 Ga0055529_1000109 Ga0055529_100010930 587
501 3300003771 Ga0055526_1007061 Ga0055526_10070616 587
502 3300003775 Ga0055524_1001907 Ga0055524_10019079 587
503 3300003781 Ga0055536_1008867 Ga0055536_10088673 587
504 3300003791 Ga0055530_10013862 Ga0055530_100138621 587
505 3300003792 Ga0055540_1003937 Ga0055540_10039374 587
506 3300003794 Ga0055531_10009693 Ga0055531_100096933 587
507 3300005289 Ga0065704_10081289 Ga0065704_100812892 587
508 3300005295 Ga0065707_10081865 Ga0065707_1008186538 587
509 3300005295 Ga0065707_10086251 Ga0065707_100862515 587
510 3300005327 Ga0070658_10000227 Ga0070658_1000022715 587
511 3300005330 Ga0070690_100000180 Ga0070690_1000001802 587
512 3300005331 Ga0070670_100000024 Ga0070670_10000002487 587
513 3300005331 Ga0070670_100000792 Ga0070670_10000079231 587
514 3300005331 Ga0070670_100032156 Ga0070670_1000321564 587
515 3300005331 Ga0070670_100052533 Ga0070670_1000525332 587
516 3300005335 Ga0070666_10000027 Ga0070666_1000002751 587
517 3300005335 Ga0070666_10000352 Ga0070666_1000035227 587
518 3300005340 Ga0070689_100008132 Ga0070689_1000081328 587
519 3300005344 Ga0070661_100002364 Ga0070661_1000023646 587
520 3300005347 Ga0070668_100000068 Ga0070668_10000006836 587
521 3300005347 Ga0070668_100019894 Ga0070668_1000198943 587
522 3300005347 Ga0070668_100066155 Ga0070668_1000661552 587
523 3300005353 Ga0070669_100000018 Ga0070669_10000001813 587
524 3300005353 Ga0070669_100000047 Ga0070669_10000004791 587
525 3300005353 Ga0070669_100000099 Ga0070669_10000009940 587
526 3300005353 Ga0070669_100001232 Ga0070669_10000123213 587
527 3300005355 Ga0070671_100000011 Ga0070671_100000011183 587
528 3300005355 Ga0070671_100004632 Ga0070671_1000046326 587
529 3300005355 Ga0070671_100008988 Ga0070671_1000089882 587
530 3300005365 Ga0070688_100000293 Ga0070688_10000029317 587
531 3300005367 Ga0070667_100000290 Ga0070667_1000002906 587
532 3300005367 Ga0070667_100000480 Ga0070667_10000048016 587
533 3300005367 Ga0070667_100012620 Ga0070667_1000126206 587
534 3300005456 Ga0070678_100000076 Ga0070678_10000007625 587
535 3300005457 Ga0070662_100058572 Ga0070662_1000585722 587
536 3300005466 Ga0070685_10000238 Ga0070685_1000023835 587
537 3300005530 Ga0070679_100000168 Ga0070679_10000016825 587
538 3300005544 Ga0070686_100000010 Ga0070686_100000010119 587
539 3300005548 Ga0070665_100000254 Ga0070665_10000025459 587
540 3300005617 Ga0068859_100002363 Ga0068859_10000236311 587
541 3300005617 Ga0068859_100004889 Ga0068859_1000048896 587
542 3300005617 Ga0068859_100006146 Ga0068859_1000061469 587
543 3300005617 Ga0068859_100013485 Ga0068859_1000134859 587
544 3300005617 Ga0068859_100020790 Ga0068859_1000207905 587
545 3300005617 Ga0068859_100109660 Ga0068859_1001096602 587
546 3300005618 Ga0068864_100000036 Ga0068864_10000003688 587
547 3300005618 Ga0068864_100000063 Ga0068864_10000006346 587
548 3300005618 Ga0068864_100001646 Ga0068864_10000164611 587
549 3300005618 Ga0068864_100003044 Ga0068864_10000304413 587
550 3300005719 Ga0068861_100000005 Ga0068861_10000000522 587
551 3300005719 Ga0068861_100002905 Ga0068861_1000029059 587
552 3300005719 Ga0068861_100007125 Ga0068861_1000071255 587
553 3300005719 Ga0068861_100013995 Ga0068861_1000139955 587
554 3300005841 Ga0068863_100000001 Ga0068863_100000001198 587
555 3300005841 Ga0068863_100000062 Ga0068863_10000006246 587
556 3300005841 Ga0068863_100000603 Ga0068863_10000060320 587
557 3300005841 Ga0068863_100000775 Ga0068863_1000007759 587
558 3300005841 Ga0068863_100003283 Ga0068863_1000032831 587
559 3300005841 Ga0068863_100010531 Ga0068863_1000105315 587
560 3300005842 Ga0068858_100000530 Ga0068858_10000053038 587
561 3300005842 Ga0068858_100003512 Ga0068858_10000351211 587
562 3300005843 Ga0068860_100000080 Ga0068860_100000080118 587
563 3300005844 Ga0068862_100000033 Ga0068862_10000003317 587
564 3300005844 Ga0068862_100000069 Ga0068862_10000006949 587
565 3300005844 Ga0068862_100000115 Ga0068862_10000011548 587
566 3300005844 Ga0068862_100005633 Ga0068862_1000056339 587
567 3300005844 Ga0068862_100032674 Ga0068862_1000326742 587
568 3300005937 Ga0081455_10002228 Ga0081455_1000222828 587
569 3300006353 Ga0075370_10024116 Ga0075370_100241163 587
570 3300006846 Ga0075430_100018966 Ga0075430_1000189665 587
571 3300006931 Ga0097620_100002363 Ga0097620_10000236311 587
572 3300006931 Ga0097620_100004889 Ga0097620_1000048896 587
573 3300006931 Ga0097620_100006146 Ga0097620_1000061463 587
574 3300006931 Ga0097620_100013486 Ga0097620_1000134869 587
575 3300006931 Ga0097620_100020789 Ga0097620_1000207895 587
576 3300006931 Ga0097620_100109659 Ga0097620_1001096592 587
577 3300009011 Ga0105251_10001006 Ga0105251_1000100622 587
578 3300009101 Ga0105247_10004862 Ga0105247_100048626 587
579 3300009148 Ga0105243_10000224 Ga0105243_1000022412 587
580 3300009174 Ga0105241_10097937 Ga0105241_100979371 587
581 3300009177 Ga0105248_10000091 Ga0105248_1000009187 587
582 3300009177 Ga0105248_10000536 Ga0105248_1000053623 587
583 3300009177 Ga0105248_10009842 Ga0105248_100098429 587
584 3300009177 Ga0105248_10036917 Ga0105248_100369175 587
585 3300009551 Ga0105238_10047095 Ga0105238_100470953 587
586 3300009551 Ga0105238_10062799 Ga0105238_100627994 587
587 3300009553 Ga0105249_10000160 Ga0105249_1000016064 587
588 3300009553 Ga0105249_10017175 Ga0105249_100171755 587
589 3300009553 Ga0105249_10025445 Ga0105249_100254455 587
590 3300009553 Ga0105249_10064607 Ga0105249_100646073 587
591 3300013102 Ga0157371_10000097 Ga0157371_10000097102 587
592 3300013297 Ga0157378_10003298 Ga0157378_1000329811 587
593 3300013306 Ga0163162_10048106 Ga0163162_100481064 587
594 3300014326 Ga0157380_10000086 Ga0157380_1000008641 587
595 3300014326 Ga0157380_10000217 Ga0157380_1000021716 587
596 3300014968 Ga0157379_10009125 Ga0157379_100091256 587
597 3300017792 Ga0163161_10000110 Ga0163161_1000011051 587
598 3300025230 Ga0209563_100111 Ga0209563_10011113 587
599 3300025245 Ga0207425_1000020 Ga0207425_1000020347 587
600 3300025246 Ga0209646_1004636 Ga0209646_10046362 587
601 3300025254 Ga0209148_1000026 Ga0209148_1000026344 587
602 3300025258 Ga0209129_1000586 Ga0209129_100058625 587
603 3300025261 Ga0209233_1000142 Ga0209233_1000142121 587
604 3300025263 Ga0209565_1000008 Ga0209565_1000008184 587
605 3300025263 Ga0209565_1000210 Ga0209565_100021010 587
606 3300025272 Ga0209455_1000005 Ga0209455_10000051091 587
607 3300025273 Ga0209673_1000984 Ga0209673_10009849 587
608 3300025292 Ga0209676_1008339 Ga0209676_10083394 587
609 3300025294 Ga0209025_1000326 Ga0209025_100032669 587
610 3300025295 Ga0209564_1001114 Ga0209564_100111430 587
611 3300025297 Ga0209758_1000004 Ga0209758_1000004611 587
612 3300025297 Ga0209758_1017781 Ga0209758_10177812 587
613 3300025298 Ga0209050_1000001 Ga0209050_10000012574 587
614 3300025299 Ga0209256_1000009 Ga0209256_1000009686 587
615 3300025299 Ga0209256_1000010 Ga0209256_1000010610 587
616 3300025303 Ga0209051_1000476 Ga0209051_100047657 587
617 3300025304 Ga0209257_1003790 Ga0209257_10037903 587
618 3300025315 Ga0207697_10000211 Ga0207697_1000021113 587
619 3300025735 Ga0207713_1001151 Ga0207713_100115121 587
620 3300025900 Ga0207710_10002208 Ga0207710_100022082 587
621 3300025900 Ga0207710_10034094 Ga0207710_100340942 587
622 3300025903 Ga0207680_10000009 Ga0207680_10000009121 587
623 3300025909 Ga0207705_10000450 Ga0207705_1000045016 587
624 3300025911 Ga0207654_10004079 Ga0207654_100040798 587
625 3300025912 Ga0207707_10075179 Ga0207707_100751792 587
626 3300025914 Ga0207671_10006655 Ga0207671_100066558 587
627 3300025919 Ga0207657_10011805 Ga0207657_100118055 587
628 3300025920 Ga0207649_10002255 Ga0207649_100022557 587
629 3300025921 Ga0207652_10000282 Ga0207652_1000028224 587
630 3300025923 Ga0207681_10000008 Ga0207681_10000008240 587
631 3300025923 Ga0207681_10000014 Ga0207681_10000014173 587
632 3300025923 Ga0207681_10000106 Ga0207681_1000010646 587
633 3300025923 Ga0207681_10000259 Ga0207681_100002598 587
634 3300025924 Ga0207694_10020172 Ga0207694_100201724 587
635 3300025924 Ga0207694_10023064 Ga0207694_100230642 587
636 3300025924 Ga0207694_10025520 Ga0207694_100255203 587
637 3300025925 Ga0207650_10000015 Ga0207650_10000015188 587
638 3300025925 Ga0207650_10015218 Ga0207650_100152182 587
639 3300025925 Ga0207650_10032859 Ga0207650_100328594 587
640 3300025931 Ga0207644_10000006 Ga0207644_10000006230 587
641 3300025931 Ga0207644_10000544 Ga0207644_100005445 587
642 3300025931 Ga0207644_10003236 Ga0207644_100032369 587
643 3300025932 Ga0207690_10004587 Ga0207690_100045873 587
644 3300025933 Ga0207706_10006993 Ga0207706_1000699310 587
645 3300025933 Ga0207706_10092745 Ga0207706_100927452 587
646 3300025935 Ga0207709_10000519 Ga0207709_1000051911 587
647 3300025935 Ga0207709_10011498 Ga0207709_100114985 587
648 3300025936 Ga0207670_10010660 Ga0207670_100106604 587
649 3300025937 Ga0207669_10000161 Ga0207669_1000016126 587
650 3300025937 Ga0207669_10006712 Ga0207669_100067123 587
651 3300025941 Ga0207711_10000017 Ga0207711_10000017434 587
652 3300025941 Ga0207711_10000252 Ga0207711_1000025235 587
653 3300025941 Ga0207711_10023381 Ga0207711_100233814 587
654 3300025944 Ga0207661_10114574 Ga0207661_101145742 587
655 3300025949 Ga0207667_10000010 Ga0207667_10000010349 587
656 3300025949 Ga0207667_10105697 Ga0207667_101056972 587
657 3300025961 Ga0207712_10000044 Ga0207712_10000044118 587
658 3300025961 Ga0207712_10000222 Ga0207712_1000022247 587
659 3300025961 Ga0207712_10006379 Ga0207712_100063796 587
660 3300025961 Ga0207712_10015834 Ga0207712_100158343 587
661 3300025961 Ga0207712_10038733 Ga0207712_100387333 587
662 3300025972 Ga0207668_10000860 Ga0207668_1000086014 587
663 3300025972 Ga0207668_10001683 Ga0207668_1000168310 587
664 3300025972 Ga0207668_10009770 Ga0207668_100097703 587
665 3300025972 Ga0207668_10052374 Ga0207668_100523742 587
666 3300025972 Ga0207668_10074452 Ga0207668_100744522 587
667 3300025981 Ga0207640_10009819 Ga0207640_100098193 587
668 3300025986 Ga0207658_10000133 Ga0207658_1000013324 587
669 3300025986 Ga0207658_10002473 Ga0207658_100024739 587
670 3300025986 Ga0207658_10025815 Ga0207658_100258152 587
671 3300025986 Ga0207658_10026771 Ga0207658_100267712 587
672 3300026035 Ga0207703_10003167 Ga0207703_100031675 587
673 3300026041 Ga0207639_10026739 Ga0207639_100267391 587
674 3300026078 Ga0207702_10007378 Ga0207702_100073789 587
675 3300026078 Ga0207702_10032064 Ga0207702_100320642 587
676 3300026088 Ga0207641_10000001 Ga0207641_10000001535 587
677 3300026088 Ga0207641_10000022 Ga0207641_10000022181 587
678 3300026088 Ga0207641_10000047 Ga0207641_10000047170 587
679 3300026088 Ga0207641_10001074 Ga0207641_1000107411 587
680 3300026088 Ga0207641_10006843 Ga0207641_100068434 587
681 3300026088 Ga0207641_10016494 Ga0207641_100164942 587
682 3300026095 Ga0207676_10000021 Ga0207676_10000021214 587
683 3300026095 Ga0207676_10000056 Ga0207676_1000005696 587
684 3300026095 Ga0207676_10000827 Ga0207676_1000082712 587
685 3300026095 Ga0207676_10001517 Ga0207676_1000151711 587
686 3300026095 Ga0207676_10002294 Ga0207676_100022947 587
687 3300026116 Ga0207674_10007137 Ga0207674_1000713710 587
688 3300026118 Ga0207675_100000020 Ga0207675_10000002042 587
689 3300026118 Ga0207675_100000207 Ga0207675_10000020732 587
690 3300026118 Ga0207675_100002282 Ga0207675_10000228213 587
691 3300026118 Ga0207675_100004785 Ga0207675_10000478510 587
692 3300026121 Ga0207683_10000655 Ga0207683_1000065525 587
693 3300026142 Ga0207698_10051391 Ga0207698_100513912 587
694 3300028379 Ga0268266_10000069 Ga0268266_10000069121 587
695 3300028379 Ga0268266_10016904 Ga0268266_100169045 587
696 3300028380 Ga0268265_10000013 Ga0268265_10000013185 587
697 3300028380 Ga0268265_10000044 Ga0268265_10000044164 587
698 3300028380 Ga0268265_10000100 Ga0268265_100001003 587
699 3300028381 Ga0268264_10000010 Ga0268264_1000001024 587
700 3300028381 Ga0268264_10000131 Ga0268264_10000131118 587
701 3300028381 Ga0268264_10053953 Ga0268264_100539532 587
702 3300031456 Ga0307513_10075874 Ga0307513_100758743 587
703 3300031616 Ga0307508_10025163 Ga0307508_100251636 587
704 3300032004 Ga0307414_10046312 Ga0307414_100463122 587
705 3300038443 Ga0395901_0023161 Ga0395901_0023161_2655_4481 587
706 3300046453 Ga0495627_000636 Ga0495627_000636_20976_22799 587
707 3300046460 Ga0495638_0002237 Ga0495638_0002237_8476_10287 587
708 3300046471 Ga0495650_0000492 Ga0495650_0000492_3111_4940 587
709 3300046471 Ga0495650_0012961 Ga0495650_0012961_1249_3075 587
710 3300046506 Ga0495583_0002564 Ga0495583_0002564_6707_8536 587
711 3300046506 Ga0495583_0016240 Ga0495583_0016240_1344_3173 587
712 3300046507 Ga0495606_0000359 Ga0495606_0000359_61836_63665 587
713 3300046522 Ga0495643_0004044 Ga0495643_0004044_5417_7246 587
714 3300046522 Ga0495643_0004426 Ga0495643_0004426_2929_4758 587
715 3300046524 Ga0495648_0000256 Ga0495648_0000256_3272_5101 587
716 3300046525 Ga0495663_0001269 Ga0495663_0001269_3532_5361 587
717 3300046530 Ga0495654_0001382 Ga0495654_0001382_6025_7890 587
718 3300046558 Ga0495633_0002904 Ga0495633_0002904_572_2401 587
719 3300046558 Ga0495633_0020069 Ga0495633_0020069_900_2729 587
720 3300046616 Ga0495668_0000163 Ga0495668_0000163_84996_86825 587
721 3300046616 Ga0495668_0002911 Ga0495668_0002911_5160_7025 587
722 3300046660 Ga0495625_0000332 Ga0495625_0000332_63485_65320 587
723 3300046660 Ga0495625_0000568 Ga0495625_0000568_3603_5432 587
724 3300046684 Ga0495669_0000629 Ga0495669_0000629_7001_8830 587
725 3300046691 Ga0495670_0000007 Ga0495670_0000007_50084_51898 587
726 3300046794 Ga0495589_0008334 Ga0495589_0008334_2146_4011 587
727 3300046809 Ga0495600_0000914 Ga0495600_0000914_7236_9065 587
728 3300047443 Ga0495687_000511 Ga0495687_000511_18076_19905 587
729 3300047443 Ga0495687_001938 Ga0495687_001938_9421_11250 587
730 3300047445 Ga0495677_0000956 Ga0495677_0000956_475_2304 587
731 3300048905 Ga0496102_0000106 Ga0496102_0000106_63482_65299 587
732 3300048905 Ga0496102_0002374 Ga0496102_0002374_7703_9532 587
733 3300048906 Ga0496103_0000095 Ga0496103_0000095_38730_40547 587
734 3300048906 Ga0496103_0001305 Ga0496103_0001305_8796_10625 587
735 3300048913 Ga0496110_0008273 Ga0496110_0008273_3519_5348 587
736 3300048918 Ga0496115_0000172 Ga0496115_0000172_6389_8218 587
737 3300048919 Ga0496116_0014370 Ga0496116_0014370_1934_3763 587
738 3300048920 Ga0496117_0000366 Ga0496117_0000366_55676_57493 587
739 3300048920 Ga0496117_0000582 Ga0496117_0000582_6546_8375 587
740 3300048920 Ga0496117_0003953 Ga0496117_0003953_160_1974 587
741 3300048921 Ga0496118_0000392 Ga0496118_0000392_29120_30949 587
742 3300048921 Ga0496118_0003549 Ga0496118_0003549_4506_6320 587
743 3300048924 Ga0496121_0005396 Ga0496121_0005396_6627_8456 587
744 3300048925 Ga0496122_0001187 Ga0496122_0001187_16293_18197 587
745 3300048925 Ga0496122_0017843 Ga0496122_0017843_3721_5550 587
746 3300048926 Ga0496123_0000518 Ga0496123_0000518_3670_5574 587
747 3300048927 Ga0496124_0000606 Ga0496124_0000606_51831_53660 587
748 3300048928 Ga0496125_0000666 Ga0496125_0000666_6767_8596 587
749 3300048929 Ga0496126_0004606 Ga0496126_0004606_6549_8378 587
750 3300049515 Ga0501292_000172 Ga0501292_000172_6907_8736 587
751 3300049517 Ga0501294_000303 Ga0501294_000303_3692_5521 587
752 3300049523 Ga0501300_000548 Ga0501300_000548_2870_4699 587
753 3300049581 Ga0501047_0051581 Ga0501047_0051581_688_2538 587
754 3300049663 Ga0501223_000734 Ga0501223_000734_3350_5179 587
755 3300049686 Ga0501257_000031 Ga0501257_000031_1424_3265 587
756 3300049688 Ga0501259_002260 Ga0501259_002260_472_2301 587
757 3300049690 Ga0501261_000301 Ga0501261_000301_2112_3941 587
758 3300049775 Ga0501279_000239 Ga0501279_000239_3593_5422 587
759 3300049776 Ga0501280_000005 Ga0501280_000005_82883_84712 587
760 3300049776 Ga0501280_000342 Ga0501280_000342_7976_9817 587
761 3300049777 Ga0501281_00513 Ga0501281_00513_1637_3466 587
762 3300049778 Ga0501282_000535 Ga0501282_000535_1658_3487 587
763 3300049779 Ga0501283_000937 Ga0501283_000937_426_2255 587
764 3300050491 nmdc:mga00v17_1761_c1 nmdc:mga00v17_1761_c1_6292_8106 587
765 3300050496 nmdc:mga07m45_22923_c1 nmdc:mga07m45_22923_c1_1380_3185 587
766 3300050509 nmdc:mga0qj67_18352_c1 nmdc:mga0qj67_18352_c1_126_1937 587
767 3300053087 Ga0500643_002047 Ga0500643_002047_2701_4533 587
768 3300053087 Ga0500643_003295 Ga0500643_003295_5754_7577 587
769 3300053087 Ga0500643_006377 Ga0500643_006377_1738_3543 587
770 3300053094 Ga0500566_0003635 Ga0500566_0003635_6853_8676 587
771 3300053104 Ga0500556_0000049 Ga0500556_0000049_35834_37657 587
772 3300053116 Ga0500592_000270 Ga0500592_000270_1128_2990 587
773 3300053118 Ga0500594_0002630 Ga0500594_0002630_1235_3055 587
774 3300053118 Ga0500594_0003469 Ga0500594_0003469_992_2863 587
775 3300053119 Ga0500595_001337 Ga0500595_001337_4926_6755 587
776 3300053119 Ga0500595_022036 Ga0500595_022036_48_1859 587
777 3300053121 Ga0500607_001726 Ga0500607_001726_14178_15983 587
778 3300053122 Ga0500608_002406 Ga0500608_002406_1933_3756 587
779 3300053130 Ga0500642_0000002 Ga0500642_0000002_91054_92877 587
780 3300053136 Ga0500559_0002377 Ga0500559_0002377_1958_3763 587
781 3300053136 Ga0500559_0006954 Ga0500559_0006954_1305_3110 587
782 3300053140 Ga0500573_0000034 Ga0500573_0000034_17253_19076 587
783 3300053158 Ga0500627_0000335 Ga0500627_0000335_5928_7793 587
784 3300053177 Ga0500636_0008307 Ga0500636_0008307_1413_3242 587
785 3300053178 Ga0500637_0007967 Ga0500637_0007967_3367_5172 587
786 3300053730 Ga0500645_000173 Ga0500645_000173_35470_37293 587
787 3300053730 Ga0500645_000300 Ga0500645_000300_6404_8233 587
788 3300053730 Ga0500645_000452 Ga0500645_000452_9939_11774 587
789 iso_pu_bacteria 2643221541 2643726851 587
790 iso_pu_bacteria 2643221605 2644040865 587
791 iso_pu_bacteria 2643221606 2644046108 587
792 iso_pu_bacteria 2643221671 2644393081 587
793 2162886007 SwRhRL2b_contig_3540226 SwRhRL2b_0218.00007640 588
794 3300005289 Ga0065704_10070744 Ga0065704_1007074420 588
795 3300005347 Ga0070668_100000646 Ga0070668_1000006467 588
796 3300005367 Ga0070667_100001292 Ga0070667_1000012923 588
797 3300005617 Ga0068859_100169626 Ga0068859_1001696262 588
798 3300006931 Ga0097620_100169630 Ga0097620_1001696302 588
799 3300013306 Ga0163162_10085262 Ga0163162_100852622 588
800 3300025931 Ga0207644_10008789 Ga0207644_100087892 588
801 3300025972 Ga0207668_10003159 Ga0207668_100031594 588
802 3300025986 Ga0207658_10002564 Ga0207658_1000256414 588
803 3300028379 Ga0268266_10011818 Ga0268266_100118183 588
804 3300028381 Ga0268264_10021281 Ga0268264_100212814 588
805 3300048904 Ga0496101_0001612 Ga0496101_0001612_1992_3809 588
806 3300048907 Ga0496104_0000060 Ga0496104_0000060_23648_25465 588
807 3300048908 Ga0496105_0000274 Ga0496105_0000274_17853_19670 588
808 3300048910 Ga0496107_0004473 Ga0496107_0004473_2679_4496 588
809 3300048915 Ga0496112_0121955 Ga0496112_0121955_497_2314 588
810 3300048916 Ga0496113_0003962 Ga0496113_0003962_6273_8090 588
811 3300048922 Ga0496119_0001213 Ga0496119_0001213_10913_12730 588
812 3300048923 Ga0496120_0001109 Ga0496120_0001109_18869_20686 588
813 3300048924 Ga0496121_0013959 Ga0496121_0013959_4414_6231 588
814 3300048925 Ga0496122_0004287 Ga0496122_0004287_14455_16272 588
815 3300048927 Ga0496124_0001819 Ga0496124_0001819_23188_25005 588
816 3300048928 Ga0496125_0091998 Ga0496125_0091998_187_2004 588
817 3300048929 Ga0496126_0000294 Ga0496126_0000294_51912_53729 588

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01401

Peptidase_M2

Angiotensin-converting enzyme

34

634

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ydm-assembly1.cif.gz_A structural characterization of angiotensin-i converting enzyme in complex with a selenium analogue of captopril 0.9533 11 588
3bkl-assembly1.cif.gz_A testis ace co-crystal structure with ketone ace inhibitor kaw 0.9531 11 588
2iux-assembly1.cif.gz_A human tace mutant g1234 0.953 11 588
2oc2-assembly1.cif.gz_A structure of testis ace with rxpa380 0.9526 13 588
4bzr-assembly1.cif.gz_A human testis angiotensin converting enzyme in complex with k-26 0.9521 11 588
ID Description Score Start End Superfamily
af_P09470_45_628_1.10.1370.30 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; 0.9489 11 588 1.10.1370.30
af_Q10714_28_605_1.10.1370.30 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; 0.9481 19 587 1.10.1370.30
af_P09470_45_628_1.10.1370.30 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; 0.9377 11 588 1.10.1370.30
af_Q10714_28_605_1.10.1370.30 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; 0.9321 19 587 1.10.1370.30
af_Q8SXX2_207_793_1.10.1370.30 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; 0.8694 13 588 1.10.1370.30
ID Description Score Start End GO Terms
AF-A0A4Q2XDG7-F1-model_v4 deleted 0.9973 118 547
AF-A0A2R7PLK0-F1-model_v4 deleted 0.9965 195 546
AF-A0A3D2LH96-F1-model_v4 deleted 0.9943 176 495
AF-A0A4Q2YYI3-F1-model_v4 Peptidase M2 family protein 0.9941 11 588 GO:0006508
GO:0008237
GO:0008241
GO:0016020
AF-A0A520JBP9-F1-model_v4 Peptidase M2 family protein 0.9937 252 588 GO:0006508
GO:0008237
GO:0008241
GO:0016020

Feature Viewer

pLDDT pTM Quality
95.75 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map