F481908

General Info

Members Datasets Scaffolds Average Seq Length
812 366 796 154

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_010229|Ga0500595_010229_1590_2111
Length 173
Sequence MKASALTGSALTEEKAYLMADRVDSKLAELGLTLPAPAAPVASYVPTVEAGGLLHVSGQLPFKDGAVMTGRLGADANLAYGQEAAQRCALMLVAQIKAALGGLHRVERIVKLGVFVNSAPGFTDQPKVANGASDLMFALFGDAGRHARSAVGVSALPLGAAVEVDAIIQIAMH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
3 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
4 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
5 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
6 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
7 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
8 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
9 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
10 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
11 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
12 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
13 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
14 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
15 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
16 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
17 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
18 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
19 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
20 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
21 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
22 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
23 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
24 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
25 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
26 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
116 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
117 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
118 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
119 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
177 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
196 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
201 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
210 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
211 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
212 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
213 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
214 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
215 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
216 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
217 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
218 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
219 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
220 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
221 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
222 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
223 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
224 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
225 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
226 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
227 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
228 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
229 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
230 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
231 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
232 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
233 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
234 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
235 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
236 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
237 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
238 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
239 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
240 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
241 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
242 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
243 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
244 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
249 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
250 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
251 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
252 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
253 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
254 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
255 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
256 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
257 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
258 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
259 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
260 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
261 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
262 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
263 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
264 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
265 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
266 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
272 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
275 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
276 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
277 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
278 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
279 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
294 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
295 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
296 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
297 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
298 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
299 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
300 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
305 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
306 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
316 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
317 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
318 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
319 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
320 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
325 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
326 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
327 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
328 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
329 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
332 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
333 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
334 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
335 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
336 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
337 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
338 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
339 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
340 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
341 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
342 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
343 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
344 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
345 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
346 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
347 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
348 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
349 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
350 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
351 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
352 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
353 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
354 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
355 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
356 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
357 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
358 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
359 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
360 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
361 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
362 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
363 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
364 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
365 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
366 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 0.37
Isolates 1.97

Biome Distribution

Category Percentage (%)
Aerial Root 0.62
Bulb 0
Endosphere 12.19
Nodule 0
Rhizoplane 3.57
Rhizosphere 78.57
Stem 0
Stem Tuber 0
Unclassified 5.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2687397 2162886007 Bacteria 1122
2 ARcpr5oldR_c001506 3300000041 Bacteria 2339
3 JGI24752J21851_1001224 3300001976 Bacteria 3494
4 JGI24740J21852_10025651 3300001979 Bacteria 1984
5 JGI24739J22299_10000524 3300001989 Bacteria 13667
6 JGI24739J22299_10002936 3300001989 Bacteria 6534
7 JGI24739J22299_10013165 3300001989 Bacteria 3026
8 JGI24737J22298_10007810 3300001990 Bacteria 3606
9 JGI24735J21928_10003268 3300002067 Bacteria 5544
10 JGI24735J21928_10019703 3300002067 Bacteria 2072
11 JGI24735J21928_10109069 3300002067 Bacteria 796
12 JGI24748J21848_1019863 3300002074 Bacteria 808
13 JGI24738J21930_10003430 3300002075 Bacteria 3999
14 JGI24738J21930_10003879 3300002075 Bacteria 3732
15 JGI25151J46595_10088405 3300003187 Bacteria 871
16 JGI25165J46597_1000010 3300003214 Bacteria 442113
17 JGI25153J46596_10006448 3300003215 Bacteria 5922
18 Ga0055537_1000460 3300003773 Bacteria 25614
19 Ga0055524_1000155 3300003775 Bacteria 79672
20 Ga0055536_1003969 3300003781 Bacteria 7746
21 Ga0055536_1006424 3300003781 Bacteria 5495
22 Ga0055536_1015396 3300003781 Bacteria 2621
23 Ga0055534_1019585 3300003784 Bacteria 1158
24 Ga0055530_10000115 3300003791 Bacteria 70229
25 Ga0055530_10001208 3300003791 Bacteria 19993
26 Ga0055530_10008781 3300003791 Bacteria 3991
27 Ga0055531_10000792 3300003794 Bacteria 26275
28 Ga0055531_10002671 3300003794 Bacteria 11762
29 Ga0055531_10006063 3300003794 Bacteria 6926
30 Ga0055531_10006683 3300003794 Bacteria 6467
31 Ga0065165_1007583 3300005262 Bacteria 5287
32 Ga0065165_1018077 3300005262 Bacteria 2569
33 Ga0065165_1041615 3300005262 Bacteria 1363
34 Ga0065704_10074901 3300005289 Bacteria 5927
35 Ga0065707_10081882 3300005295 Bacteria 31785
36 Ga0070658_10000003 3300005327 Bacteria 465963
37 Ga0070658_10021495 3300005327 Bacteria 5171
38 Ga0070658_10030316 3300005327 Bacteria 4346
39 Ga0070658_10033779 3300005327 Bacteria 4116
40 Ga0070658_10054034 3300005327 Bacteria 3261
41 Ga0070658_10166424 3300005327 Bacteria 1851
42 Ga0070683_100559908 3300005329 Bacteria 1093
43 Ga0070670_100000030 3300005331 Bacteria 164211
44 Ga0070670_100746266 3300005331 Bacteria 882
45 Ga0070670_101154386 3300005331 Bacteria 707
46 Ga0070680_100025459 3300005336 Bacteria 4730
47 Ga0070680_100034426 3300005336 Bacteria 4083
48 Ga0070680_100104058 3300005336 Bacteria 2359
49 Ga0070680_100837885 3300005336 Bacteria 793
50 Ga0070682_100579292 3300005337 Bacteria 883
51 Ga0068868_100565982 3300005338 Bacteria 1003
52 Ga0070660_100057997 3300005339 Bacteria 3001
53 Ga0070660_100059329 3300005339 Bacteria 2967
54 Ga0070660_100088967 3300005339 Bacteria 2432
55 Ga0070660_100107890 3300005339 Bacteria 2213
56 Ga0070660_100397916 3300005339 Bacteria 1139
57 Ga0070660_100408703 3300005339 Bacteria 1123
58 Ga0070661_100139342 3300005344 Bacteria 1827
59 Ga0070661_100267307 3300005344 Bacteria 1323
60 Ga0070661_100585399 3300005344 Bacteria 901
61 Ga0070692_10000142 3300005345 Bacteria 17361
62 Ga0070692_10159865 3300005345 Bacteria 1290
63 Ga0070668_100000011 3300005347 Bacteria 123099
64 Ga0070671_100003480 3300005355 Bacteria 12284
65 Ga0070671_100093078 3300005355 Bacteria 2526
66 Ga0070671_100671018 3300005355 Bacteria 898
67 Ga0070673_100015570 3300005364 Bacteria 5348
68 Ga0070673_100828271 3300005364 Bacteria 856
69 Ga0070659_100003069 3300005366 Bacteria 11859
70 Ga0070659_100021627 3300005366 Bacteria 4902
71 Ga0070659_100090402 3300005366 Bacteria 2453
72 Ga0070659_100157669 3300005366 Bacteria 1854
73 Ga0070659_100202257 3300005366 Bacteria 1635
74 Ga0070667_100000161 3300005367 Bacteria 83551
75 Ga0070667_100383351 3300005367 Bacteria 1277
76 Ga0070714_100263657 3300005435 Bacteria 1596
77 Ga0070714_100556978 3300005435 Bacteria 1098
78 Ga0070708_100141656 3300005445 Bacteria 2230
79 Ga0070663_100003059 3300005455 Bacteria 9565
80 Ga0070663_100044176 3300005455 Bacteria 3140
81 Ga0070663_100050017 3300005455 Bacteria 2971
82 Ga0070662_100016573 3300005457 Bacteria 4949
83 Ga0070662_100065006 3300005457 Bacteria 2673
84 Ga0070662_100121909 3300005457 Bacteria 1999
85 Ga0070681_10029494 3300005458 Bacteria 5510
86 Ga0070681_10072402 3300005458 Bacteria 3409
87 Ga0070681_10105457 3300005458 Bacteria 2760
88 Ga0070681_10172151 3300005458 Bacteria 2087
89 Ga0070706_100028793 3300005467 Bacteria 5116
90 Ga0070679_100077764 3300005530 Bacteria 3307
91 Ga0070679_100095520 3300005530 Bacteria 2960
92 Ga0070679_100173758 3300005530 Bacteria 2127
93 Ga0070679_100191645 3300005530 Bacteria 2013
94 Ga0070679_100332936 3300005530 Bacteria 1467
95 Ga0070679_100340828 3300005530 Bacteria 1447
96 Ga0070679_100650877 3300005530 Bacteria 996
97 Ga0070679_100651978 3300005530 Bacteria 995
98 Ga0070684_100329502 3300005535 Bacteria 1403
99 Ga0068853_100012834 3300005539 Bacteria 6825
100 Ga0068853_100054892 3300005539 Bacteria 3433
101 Ga0068853_100067073 3300005539 Bacteria 3117
102 Ga0068853_100072366 3300005539 Bacteria 3004
103 Ga0068853_100220247 3300005539 Bacteria 1733
104 Ga0068853_100247300 3300005539 Bacteria 1636
105 Ga0068853_100642700 3300005539 Bacteria 1009
106 Ga0068853_101379521 3300005539 Bacteria 681
107 Ga0070695_100075268 3300005545 Bacteria 2220
108 Ga0070696_100021044 3300005546 Bacteria 4420
109 Ga0070696_100461594 3300005546 Bacteria 1004
110 Ga0070693_100148555 3300005547 Bacteria 1482
111 Ga0070693_100198996 3300005547 Bacteria 1300
112 Ga0070665_100044221 3300005548 Bacteria 4472
113 Ga0070665_100291629 3300005548 Bacteria 1634
114 Ga0070665_100359322 3300005548 Bacteria 1462
115 Ga0070704_100316459 3300005549 Bacteria 1306
116 Ga0068855_100048687 3300005563 Bacteria 5001
117 Ga0068855_100051070 3300005563 Bacteria 4871
118 Ga0068855_100129913 3300005563 Bacteria 2877
119 Ga0068855_100189877 3300005563 Bacteria 2318
120 Ga0068855_100289358 3300005563 Bacteria 1817
121 Ga0068855_100302634 3300005563 Bacteria 1770
122 Ga0068855_100315793 3300005563 Bacteria 1728
123 Ga0068855_100454337 3300005563 Bacteria 1397
124 Ga0068855_100619267 3300005563 Bacteria 1166
125 Ga0070664_100107856 3300005564 Bacteria 2428
126 Ga0070664_100183721 3300005564 Bacteria 1860
127 Ga0070664_100853026 3300005564 Bacteria 853
128 Ga0070664_101305074 3300005564 Bacteria 685
129 Ga0068857_100041693 3300005577 Bacteria 4070
130 Ga0068857_100094218 3300005577 Bacteria 2681
131 Ga0068857_100142446 3300005577 Bacteria 2167
132 Ga0068857_100276997 3300005577 Bacteria 1542
133 Ga0068854_100000559 3300005578 Bacteria 22307
134 Ga0068854_100026578 3300005578 Bacteria 3980
135 Ga0068854_100039382 3300005578 Bacteria 3329
136 Ga0068854_100055677 3300005578 Bacteria 2848
137 Ga0068854_100417427 3300005578 Bacteria 1114
138 Ga0068854_100527255 3300005578 Bacteria 998
139 Ga0068854_100764096 3300005578 Bacteria 839
140 Ga0068856_100027149 3300005614 Bacteria 5586
141 Ga0068856_100052866 3300005614 Bacteria 4006
142 Ga0068856_100072762 3300005614 Bacteria 3403
143 Ga0068856_100115596 3300005614 Bacteria 2683
144 Ga0068856_100427271 3300005614 Bacteria 1345
145 Ga0068856_101210619 3300005614 Bacteria 771
146 Ga0068852_100032215 3300005616 Bacteria 4337
147 Ga0068852_100047102 3300005616 Bacteria 3676
148 Ga0068852_100048090 3300005616 Bacteria 3643
149 Ga0068852_100058186 3300005616 Bacteria 3347
150 Ga0068852_100073666 3300005616 Bacteria 3005
151 Ga0068852_100814070 3300005616 Bacteria 948
152 Ga0068852_100922176 3300005616 Bacteria 891
153 Ga0068852_101108464 3300005616 Bacteria 812
154 Ga0068859_100032942 3300005617 Bacteria 5205
155 Ga0068859_100213296 3300005617 Bacteria 2017
156 Ga0068859_100481698 3300005617 Bacteria 1336
157 Ga0068864_100000041 3300005618 Bacteria 165878
158 Ga0068864_100018954 3300005618 Bacteria 5753
159 Ga0068861_100772769 3300005719 Bacteria 899
160 Ga0068851_10021086 3300005834 Bacteria 3161
161 Ga0068851_10022086 3300005834 Bacteria 3096
162 Ga0068863_100000035 3300005841 Bacteria 165877
163 Ga0068863_100000186 3300005841 Bacteria 65963
164 Ga0068863_100593238 3300005841 Bacteria 1096
165 Ga0068858_100000102 3300005842 Bacteria 88959
166 Ga0068858_100001966 3300005842 Bacteria 20993
167 Ga0068858_100309087 3300005842 Bacteria 1509
168 Ga0068858_100575641 3300005842 Bacteria 1091
169 Ga0068862_100000042 3300005844 Bacteria 165084
170 Ga0068862_100312956 3300005844 Bacteria 1447
171 Ga0081455_10000405 3300005937 Bacteria 56782
172 Ga0075368_10116970 3300006042 Bacteria 1102
173 Ga0075369_10165462 3300006186 Bacteria 1014
174 Ga0097621_100285331 3300006237 Bacteria 1454
175 Ga0068871_100005363 3300006358 Bacteria 8984
176 Ga0068871_100682245 3300006358 Bacteria 940
177 Ga0075428_100050761 3300006844 Bacteria 4548
178 Ga0075428_101653890 3300006844 Bacteria 669
179 Ga0075429_100424676 3300006880 Bacteria 1164
180 Ga0097620_100032942 3300006931 Bacteria 5205
181 Ga0097620_100213276 3300006931 Bacteria 2017
182 Ga0097620_100481677 3300006931 Bacteria 1336
183 Ga0105240_10008649 3300009093 Bacteria 14545
184 Ga0105240_10022129 3300009093 Bacteria 8435
185 Ga0105240_10186565 3300009093 Bacteria 2442
186 Ga0105240_10699040 3300009093 Bacteria 1107
187 Ga0105240_10929977 3300009093 Bacteria 934
188 Ga0111539_10016465 3300009094 Bacteria 9167
189 Ga0105245_10001046 3300009098 Bacteria 25053
190 Ga0105247_10038819 3300009101 Bacteria 2908
191 Ga0105247_10109991 3300009101 Bacteria 1772
192 Ga0114129_10170049 3300009147 Bacteria 2972
193 Ga0105243_10028129 3300009148 Bacteria 4313
194 Ga0105241_10194511 3300009174 Bacteria 1690
195 Ga0105241_10832781 3300009174 Bacteria 852
196 Ga0105248_10000045 3300009177 Bacteria 165909
197 Ga0105248_10003638 3300009177 Bacteria 17113
198 Ga0105248_10028673 3300009177 Bacteria 6203
199 Ga0105248_10032137 3300009177 Bacteria 5866
200 Ga0105248_10392213 3300009177 Bacteria 1563
201 Ga0105237_10104546 3300009545 Bacteria 2823
202 Ga0105237_10181775 3300009545 Bacteria 2103
203 Ga0105237_10216772 3300009545 Bacteria 1914
204 Ga0105237_11559915 3300009545 Bacteria 667
205 Ga0105238_10035938 3300009551 Bacteria 5036
206 Ga0105238_10036999 3300009551 Bacteria 4963
207 Ga0105238_10067960 3300009551 Bacteria 3564
208 Ga0105238_10092085 3300009551 Bacteria 3019
209 Ga0105238_10390045 3300009551 Bacteria 1385
210 Ga0105238_10402836 3300009551 Bacteria 1361
211 Ga0105238_10707038 3300009551 Bacteria 1020
212 Ga0105249_10000055 3300009553 Bacteria 161674
213 Ga0105249_10014831 3300009553 Bacteria 6890
214 Ga0105239_10089892 3300010375 Bacteria 3387
215 Ga0105239_12106981 3300010375 Bacteria 655
216 Ga0157373_10016847 3300013100 Bacteria 5328
217 Ga0157373_10040258 3300013100 Bacteria 3344
218 Ga0157373_10075053 3300013100 Bacteria 2385
219 Ga0157373_10242676 3300013100 Bacteria 1273
220 Ga0157373_10551089 3300013100 Bacteria 836
221 Ga0157371_10155848 3300013102 Bacteria 1630
222 Ga0157371_10172510 3300013102 Bacteria 1546
223 Ga0157371_10306500 3300013102 Bacteria 1150
224 Ga0157370_10036353 3300013104 Bacteria 4779
225 Ga0157370_10125312 3300013104 Bacteria 2398
226 Ga0157370_10131295 3300013104 Bacteria 2336
227 Ga0157370_10172340 3300013104 Bacteria 2011
228 Ga0157370_10724662 3300013104 Bacteria 907
229 Ga0157369_10002615 3300013105 Bacteria 21530
230 Ga0157369_10070306 3300013105 Bacteria 3761
231 Ga0157369_10121654 3300013105 Bacteria 2769
232 Ga0157369_10322135 3300013105 Bacteria 1607
233 Ga0157374_10155077 3300013296 Bacteria 2228
234 Ga0157378_10037607 3300013297 Bacteria 4288
235 Ga0157378_10048347 3300013297 Bacteria 3782
236 Ga0163162_10009164 3300013306 Bacteria 9631
237 Ga0163162_10009790 3300013306 Bacteria 9326
238 Ga0163162_10010728 3300013306 Bacteria 8913
239 Ga0163162_10639562 3300013306 Bacteria 1188
240 Ga0157372_10002970 3300013307 Bacteria 18265
241 Ga0157372_10319859 3300013307 Bacteria 1807
242 Ga0157372_10655508 3300013307 Bacteria 1222
243 Ga0157372_10935612 3300013307 Bacteria 1005
244 Ga0157372_11340683 3300013307 Bacteria 825
245 Ga0157372_11871339 3300013307 Bacteria 690
246 Ga0157375_12321886 3300013308 Bacteria 640
247 Ga0163163_10248751 3300014325 Bacteria 1828
248 Ga0163163_10257193 3300014325 Bacteria 1797
249 Ga0163163_10450992 3300014325 Bacteria 1346
250 Ga0157380_10007873 3300014326 Bacteria 7583
251 Ga0182008_10505366 3300014497 Bacteria 665
252 Ga0157379_10021517 3300014968 Bacteria 5710
253 Ga0206356_11202361 3300020070 Bacteria 1440
254 Ga0206354_10168296 3300020081 Bacteria 1820
255 Ga0206353_12012794 3300020082 Bacteria 1711
256 Ga0213875_10005097 3300021388 Bacteria 7109
257 Ga0209437_111975 3300025233 Bacteria 1280
258 Ga0207425_1007250 3300025245 Bacteria 2948
259 Ga0209646_1015807 3300025246 Bacteria 1124
260 Ga0209233_1000044 3300025261 Bacteria 489783
261 Ga0209565_1000011 3300025263 Bacteria 637062
262 Ga0209455_1000772 3300025272 Bacteria 17958
263 Ga0209455_1025746 3300025272 Bacteria 1065
264 Ga0209673_1002122 3300025273 Bacteria 14821
265 Ga0209675_1000104 3300025291 Bacteria 121249
266 Ga0209675_1013492 3300025291 Bacteria 2549
267 Ga0209676_1000807 3300025292 Bacteria 41068
268 Ga0209676_1001060 3300025292 Bacteria 31500
269 Ga0209676_1001199 3300025292 Bacteria 27715
270 Ga0209676_1044912 3300025292 Bacteria 1207
271 Ga0209025_1006362 3300025294 Bacteria 9192
272 Ga0209758_1008891 3300025297 Bacteria 6378
273 Ga0209050_1000071 3300025298 Bacteria 295478
274 Ga0209050_1000286 3300025298 Bacteria 106566
275 Ga0209050_1002140 3300025298 Bacteria 17979
276 Ga0209050_1004981 3300025298 Bacteria 8643
277 Ga0209050_1072435 3300025298 Bacteria 763
278 Ga0209256_1000016 3300025299 Bacteria 599092
279 Ga0209257_1000027 3300025304 Bacteria 703541
280 Ga0209257_1000245 3300025304 Bacteria 125987
281 Ga0209257_1000321 3300025304 Bacteria 100476
282 Ga0209257_1001354 3300025304 Bacteria 29627
283 Ga0209257_1001434 3300025304 Bacteria 28267
284 Ga0209257_1014820 3300025304 Bacteria 3308
285 Ga0207656_10025320 3300025321 Bacteria 2408
286 Ga0207656_10039366 3300025321 Bacteria 1999
287 Ga0207656_10066705 3300025321 Bacteria 1591
288 Ga0207710_10135767 3300025900 Bacteria 1184
289 Ga0207680_10719372 3300025903 Bacteria 716
290 Ga0207647_10007714 3300025904 Bacteria 7748
291 Ga0207647_10024741 3300025904 Bacteria 3957
292 Ga0207647_10028509 3300025904 Bacteria 3624
293 Ga0207705_10002705 3300025909 Bacteria 13560
294 Ga0207705_10009941 3300025909 Bacteria 6927
295 Ga0207705_10026902 3300025909 Bacteria 4099
296 Ga0207705_10033221 3300025909 Bacteria 3685
297 Ga0207705_10106802 3300025909 Bacteria 2065
298 Ga0207705_10427571 3300025909 Bacteria 1026
299 Ga0207684_10421321 3300025910 Bacteria 1147
300 Ga0207654_10517952 3300025911 Bacteria 844
301 Ga0207654_10792998 3300025911 Bacteria 684
302 Ga0207707_10044083 3300025912 Bacteria 3890
303 Ga0207707_10149531 3300025912 Bacteria 2042
304 Ga0207707_10191173 3300025912 Bacteria 1786
305 Ga0207695_10026017 3300025913 Bacteria 6537
306 Ga0207695_10199135 3300025913 Bacteria 1918
307 Ga0207695_10660640 3300025913 Bacteria 926
308 Ga0207695_11185612 3300025913 Bacteria 644
309 Ga0207671_10024252 3300025914 Bacteria 4564
310 Ga0207671_10081045 3300025914 Bacteria 2433
311 Ga0207671_10088723 3300025914 Bacteria 2327
312 Ga0207660_10000024 3300025917 Bacteria 71220
313 Ga0207660_10060824 3300025917 Bacteria 2717
314 Ga0207660_10225842 3300025917 Bacteria 1471
315 Ga0207660_10447300 3300025917 Bacteria 1044
316 Ga0207660_10490502 3300025917 Bacteria 996
317 Ga0207660_10731325 3300025917 Bacteria 807
318 Ga0207657_10007988 3300025919 Bacteria 10787
319 Ga0207657_10010415 3300025919 Bacteria 9281
320 Ga0207657_10046672 3300025919 Bacteria 3793
321 Ga0207657_10053077 3300025919 Bacteria 3514
322 Ga0207657_10103276 3300025919 Bacteria 2363
323 Ga0207657_10109325 3300025919 Bacteria 2285
324 Ga0207657_10112964 3300025919 Bacteria 2241
325 Ga0207657_10583406 3300025919 Bacteria 873
326 Ga0207657_11032159 3300025919 Bacteria 630
327 Ga0207649_10059417 3300025920 Bacteria 2398
328 Ga0207649_10089449 3300025920 Bacteria 2013
329 Ga0207649_10095289 3300025920 Bacteria 1958
330 Ga0207649_10597774 3300025920 Bacteria 848
331 Ga0207652_10073532 3300025921 Bacteria 2974
332 Ga0207652_10092414 3300025921 Bacteria 2662
333 Ga0207652_10148018 3300025921 Bacteria 2102
334 Ga0207652_10159255 3300025921 Bacteria 2023
335 Ga0207652_10293774 3300025921 Bacteria 1466
336 Ga0207652_10410785 3300025921 Bacteria 1221
337 Ga0207652_10480000 3300025921 Bacteria 1120
338 Ga0207652_11018435 3300025921 Bacteria 727
339 Ga0207681_10190284 3300025923 Bacteria 1570
340 Ga0207694_10020412 3300025924 Bacteria 5013
341 Ga0207694_10029168 3300025924 Bacteria 4208
342 Ga0207694_10062555 3300025924 Bacteria 2898
343 Ga0207694_11336831 3300025924 Bacteria 606
344 Ga0207650_10000111 3300025925 Bacteria 107416
345 Ga0207650_10018464 3300025925 Bacteria 4895
346 Ga0207687_10000562 3300025927 Bacteria 25050
347 Ga0207664_10066774 3300025929 Bacteria 2884
348 Ga0207664_10500508 3300025929 Bacteria 1088
349 Ga0207644_10000032 3300025931 Bacteria 133759
350 Ga0207644_10051599 3300025931 Bacteria 2953
351 Ga0207644_10102939 3300025931 Bacteria 2148
352 Ga0207644_10374951 3300025931 Bacteria 1159
353 Ga0207644_10521877 3300025931 Bacteria 981
354 Ga0207644_11753146 3300025931 Bacteria 520
355 Ga0207690_10018054 3300025932 Bacteria 4321
356 Ga0207690_10063579 3300025932 Bacteria 2517
357 Ga0207690_10078402 3300025932 Bacteria 2299
358 Ga0207690_10147247 3300025932 Bacteria 1742
359 Ga0207690_10182553 3300025932 Bacteria 1581
360 Ga0207690_10675176 3300025932 Bacteria 848
361 Ga0207706_10004718 3300025933 Bacteria 12764
362 Ga0207706_10015487 3300025933 Bacteria 6889
363 Ga0207706_10067824 3300025933 Bacteria 3140
364 Ga0207691_10068308 3300025940 Bacteria 3211
365 Ga0207711_10000027 3300025941 Bacteria 236548
366 Ga0207711_10002908 3300025941 Bacteria 15009
367 Ga0207711_10012212 3300025941 Bacteria 7142
368 Ga0207711_10468112 3300025941 Bacteria 1174
369 Ga0207661_10732046 3300025944 Bacteria 910
370 Ga0207679_10033400 3300025945 Bacteria 3620
371 Ga0207679_10228292 3300025945 Bacteria 1570
372 Ga0207679_11018164 3300025945 Bacteria 759
373 Ga0207667_10025172 3300025949 Bacteria 6520
374 Ga0207667_10041234 3300025949 Bacteria 4910
375 Ga0207667_10053956 3300025949 Bacteria 4228
376 Ga0207667_10070885 3300025949 Bacteria 3626
377 Ga0207667_10357924 3300025949 Bacteria 1488
378 Ga0207667_10497892 3300025949 Bacteria 1236
379 Ga0207651_10171341 3300025960 Bacteria 1712
380 Ga0207712_10000813 3300025961 Bacteria 23020
381 Ga0207712_10033349 3300025961 Bacteria 3481
382 Ga0207668_10000034 3300025972 Bacteria 119274
383 Ga0207640_10000202 3300025981 Bacteria 42596
384 Ga0207640_10026210 3300025981 Bacteria 3537
385 Ga0207640_10111478 3300025981 Bacteria 1940
386 Ga0207640_10156959 3300025981 Bacteria 1678
387 Ga0207640_10879216 3300025981 Bacteria 781
388 Ga0207658_10000839 3300025986 Bacteria 25661
389 Ga0207703_10000190 3300026035 Bacteria 72096
390 Ga0207703_10034927 3300026035 Bacteria 3993
391 Ga0207703_10282134 3300026035 Bacteria 1509
392 Ga0207639_10002119 3300026041 Bacteria 13364
393 Ga0207639_10004994 3300026041 Bacteria 8935
394 Ga0207639_10087630 3300026041 Bacteria 2482
395 Ga0207639_10094791 3300026041 Bacteria 2397
396 Ga0207639_10110813 3300026041 Bacteria 2236
397 Ga0207639_10559991 3300026041 Bacteria 1050
398 Ga0207639_10659466 3300026041 Bacteria 968
399 Ga0207639_10846312 3300026041 Bacteria 854
400 Ga0207678_10000455 3300026067 Bacteria 37036
401 Ga0207678_10002000 3300026067 Bacteria 18558
402 Ga0207678_10046585 3300026067 Bacteria 3749
403 Ga0207678_10092769 3300026067 Bacteria 2580
404 Ga0207702_10018713 3300026078 Bacteria 5729
405 Ga0207702_10052142 3300026078 Bacteria 3460
406 Ga0207702_10066422 3300026078 Bacteria 3091
407 Ga0207702_11621557 3300026078 Bacteria 640
408 Ga0207641_10000031 3300026088 Bacteria 224320
409 Ga0207641_10000041 3300026088 Bacteria 191595
410 Ga0207641_10686291 3300026088 Bacteria 1008
411 Ga0207648_10357096 3300026089 Bacteria 1318
412 Ga0207676_10000039 3300026095 Bacteria 171142
413 Ga0207676_10000072 3300026095 Bacteria 101978
414 Ga0207674_10003053 3300026116 Bacteria 20715
415 Ga0207674_10005772 3300026116 Bacteria 14686
416 Ga0207674_10006642 3300026116 Bacteria 13588
417 Ga0207674_10236171 3300026116 Bacteria 1776
418 Ga0207683_11160850 3300026121 Bacteria 716
419 Ga0207698_10025863 3300026142 Bacteria 4143
420 Ga0207698_10041296 3300026142 Bacteria 3436
421 Ga0268266_10056076 3300028379 Bacteria 3389
422 Ga0268266_10064839 3300028379 Bacteria 3157
423 Ga0268265_10000061 3300028380 Bacteria 148625
424 Ga0268265_10146257 3300028380 Bacteria 1986
425 Ga0268264_10000785 3300028381 Bacteria 34613
426 Ga0307517_10075608 3300028786 Bacteria 2952
427 Ga0307515_10325087 3300028794 Bacteria 1201
428 Ga0307512_10435641 3300030522 Bacteria 535
429 Ga0314311_1234836 3300030733 Bacteria 1559
430 Ga0307513_10206273 3300031456 Bacteria 1801
431 Ga0307408_100058897 3300031548 Bacteria 2794
432 Ga0307508_10000011 3300031616 Bacteria 248001
433 Ga0307405_10101755 3300031731 Bacteria 1928
434 Ga0307405_10109097 3300031731 Bacteria 1871
435 Ga0307405_11004197 3300031731 Bacteria 712
436 Ga0307413_10460217 3300031824 Bacteria 1012
437 Ga0307406_10025518 3300031901 Bacteria 3539
438 Ga0307406_10135661 3300031901 Bacteria 1734
439 Ga0307406_10189804 3300031901 Bacteria 1503
440 Ga0307406_10214331 3300031901 Bacteria 1427
441 Ga0307407_10113528 3300031903 Bacteria 1705
442 Ga0307412_10001328 3300031911 Bacteria 13834
443 Ga0307412_10002668 3300031911 Bacteria 9900
444 Ga0307412_10005336 3300031911 Bacteria 7213
445 Ga0307412_10026022 3300031911 Bacteria 3632
446 Ga0307412_10042785 3300031911 Bacteria 2946
447 Ga0307412_10095174 3300031911 Bacteria 2093
448 Ga0307412_11342480 3300031911 Bacteria 645
449 Ga0307409_100021228 3300031995 Bacteria 4448
450 Ga0307409_100277372 3300031995 Bacteria 1547
451 Ga0307416_100032603 3300032002 Bacteria 3939
452 Ga0307416_100273430 3300032002 Bacteria 1660
453 Ga0307416_100339873 3300032002 Bacteria 1513
454 Ga0307414_10001684 3300032004 Bacteria 11495
455 Ga0307414_10001894 3300032004 Bacteria 10813
456 Ga0307414_10002573 3300032004 Bacteria 9542
457 Ga0307414_10009988 3300032004 Bacteria 5481
458 Ga0307414_10046896 3300032004 Bacteria 2970
459 Ga0307414_10115705 3300032004 Bacteria 2051
460 Ga0307414_10133282 3300032004 Bacteria 1932
461 Ga0307414_10159311 3300032004 Bacteria 1791
462 Ga0307414_10365512 3300032004 Bacteria 1243
463 Ga0307414_10393190 3300032004 Bacteria 1202
464 Ga0307414_11189774 3300032004 Bacteria 705
465 Ga0307415_100044257 3300032126 Bacteria 2975
466 Ga0316583_10008044 3300032133 Bacteria 3799
467 Ga0307510_10066895 3300033180 Bacteria 3623
468 Ga0373954_0103957 3300035118 Bacteria 1371
469 Ga0373956_0348221 3300035119 Bacteria 706
470 Ga0373955_0007600 3300035172 Bacteria 4992
471 Ga0373961_0391148 3300035241 Bacteria 532
472 Ga0316574_0203301 3300035398 Bacteria 1272
473 Ga0373935_0578125 3300035692 Bacteria 820
474 Ga0373933_0013243 3300035724 Bacteria 4568
475 Ga0373937_0047729 3300036401 Bacteria 3919
476 Ga0373937_0102021 3300036401 Bacteria 2663
477 Ga0316582_0000490 3300036647 Bacteria 14883
478 Ga0316582_0578966 3300036647 Bacteria 773
479 Ga0316584_0167688 3300036712 Bacteria 1630
480 Ga0316584_0337297 3300036712 Bacteria 1084
481 Ga0395899_0002299 3300037312 Bacteria 15586
482 Ga0395899_0019311 3300037312 Bacteria 5178
483 Ga0395899_0037173 3300037312 Bacteria 3650
484 Ga0395899_0063584 3300037312 Bacteria 2714
485 Ga0395899_0174455 3300037312 Bacteria 1512
486 Ga0395899_0213365 3300037312 Bacteria 1340
487 Ga0395899_0256610 3300037312 Bacteria 1197
488 Ga0395900_0002548 3300037418 Bacteria 19966
489 Ga0395900_0044846 3300037418 Bacteria 4554
490 Ga0395900_0066250 3300037418 Bacteria 3711
491 Ga0395900_0096980 3300037418 Bacteria 3029
492 Ga0395900_0131864 3300037418 Bacteria 2560
493 Ga0395900_0192374 3300037418 Bacteria 2069
494 Ga0395900_0211241 3300037418 Bacteria 1959
495 Ga0395900_0245869 3300037418 Bacteria 1792
496 Ga0395900_0316383 3300037418 Bacteria 1542
497 Ga0395900_0333416 3300037418 Bacteria 1494
498 Ga0395900_0667608 3300037418 Bacteria 975
499 Ga0395900_1286347 3300037418 Bacteria 645
500 Ga0395898_0025707 3300037466 Bacteria 5929
501 Ga0395898_0093802 3300037466 Bacteria 2884
502 Ga0395898_0164557 3300037466 Bacteria 2121
503 Ga0395898_0233521 3300037466 Bacteria 1754
504 Ga0395898_0235873 3300037466 Bacteria 1744
505 Ga0395898_0652849 3300037466 Bacteria 994
506 Ga0395905_0000409 3300037471 Bacteria 60283
507 Ga0395905_0007919 3300037471 Bacteria 10511
508 Ga0395905_0029823 3300037471 Bacteria 5142
509 Ga0395905_0031015 3300037471 Bacteria 5034
510 Ga0395905_0053376 3300037471 Bacteria 3783
511 Ga0395905_0057214 3300037471 Bacteria 3647
512 Ga0395905_0193828 3300037471 Bacteria 1905
513 Ga0395905_0287733 3300037471 Bacteria 1530
514 Ga0395905_0294247 3300037471 Bacteria 1510
515 Ga0395905_0310813 3300037471 Bacteria 1464
516 Ga0395905_0396107 3300037471 Bacteria 1275
517 Ga0395905_0670827 3300037471 Bacteria 939
518 Ga0395905_0836201 3300037471 Bacteria 823
519 Ga0436364_1172297 3300037853 Bacteria 30221
520 Ga0395901_0010738 3300038443 Bacteria 9284
521 Ga0395901_0011872 3300038443 Bacteria 8833
522 Ga0395901_0173259 3300038443 Bacteria 2264
523 Ga0395901_0271979 3300038443 Bacteria 1762
524 Ga0395901_0300704 3300038443 Bacteria 1664
525 Ga0395901_0440581 3300038443 Bacteria 1333
526 Ga0395901_0468286 3300038443 Bacteria 1286
527 Ga0395901_0521168 3300038443 Bacteria 1207
528 Ga0395901_1006920 3300038443 Bacteria 809
529 Ga0436365_1054374 3300039437 Bacteria 1165
530 Ga0436365_1325832 3300039437 Bacteria 2552
531 Ga0439436_0003483 3300041404 Bacteria 4783
532 Ga0439436_0055151 3300041404 Bacteria 1117
533 Ga0439439_0006576 3300041406 Bacteria 2691
534 Ga0439447_019635 3300041407 Bacteria 1800
535 Ga0439461_0000178 3300041410 Bacteria 8637
536 Ga0439461_0014873 3300041410 Bacteria 1485
537 Ga0439466_0130849 3300041411 Bacteria 772
538 Ga0439465_0009623 3300041413 Bacteria 3044
539 Ga0439465_0030423 3300041413 Bacteria 1717
540 Ga0451800_1680169 3300041459 Bacteria 602
541 Ga0451802_0494763 3300041460 Bacteria 1032
542 Ga0451837_0848718 3300041494 Bacteria 599
543 Ga0451841_0580323 3300041498 Bacteria 679
544 Ga0439431_0000015 3300041997 Bacteria 27396
545 Ga0439431_0004975 3300041997 Bacteria 2929
546 Ga0439442_001570 3300042002 Bacteria 4481
547 Ga0439442_008630 3300042002 Bacteria 2057
548 Ga0439445_0003451 3300042004 Bacteria 3546
549 Ga0439445_0003697 3300042004 Bacteria 3433
550 Ga0439432_006574 3300042006 Bacteria 4143
551 Ga0439432_013379 3300042006 Bacteria 2792
552 Ga0439452_028811 3300042010 Bacteria 1382
553 Ga0439457_033383 3300042014 Bacteria 1142
554 Ga0439462_0010019 3300042015 Bacteria 2399
555 Ga0439462_0010888 3300042015 Bacteria 2309
556 Ga0450919_012947 3300042121 Bacteria 945
557 Ga0450920_035414 3300042122 Bacteria 989
558 Ga0450923_066810 3300042125 Bacteria 792
559 Ga0450894_030654 3300042131 Bacteria 750
560 Ga0450905_000807 3300042142 Bacteria 3880
561 Ga0450889_000518 3300042144 Bacteria 4304
562 Ga0450910_047813 3300042147 Bacteria 702
563 Ga0439446_0006326 3300042156 Bacteria 3083
564 Ga0450908_028476 3300042184 Bacteria 973
565 Ga0450909_005358 3300042185 Bacteria 1846
566 Ga0439434_0002354 3300042435 Bacteria 5498
567 Ga0439434_0005342 3300042435 Bacteria 3759
568 Ga0466969_0253822 3300044656 Bacteria 797
569 Ga0466972_0054673 3300044658 Bacteria 1920
570 Ga0466972_0054969 3300044658 Bacteria 1915
571 Ga0466972_0096323 3300044658 Bacteria 1402
572 Ga0466965_0202783 3300044683 Bacteria 1053
573 Ga0466965_0684844 3300044683 Bacteria 587
574 Ga0466966_0047420 3300044684 Bacteria 2739
575 Ga0466966_0490891 3300044684 Bacteria 738
576 Ga0466966_0538916 3300044684 Bacteria 702
577 Ga0466966_0910100 3300044684 Bacteria 530
578 Ga0466961_0353616 3300044693 Bacteria 894
579 Ga0466963_0062599 3300044694 Bacteria 2488
580 Ga0466963_0280400 3300044694 Bacteria 1171
581 Ga0466963_0461350 3300044694 Bacteria 896
582 Ga0466971_0025809 3300044719 Bacteria 2624
583 Ga0466971_0040567 3300044719 Bacteria 2091
584 Ga0466971_0209539 3300044719 Bacteria 921
585 Ga0466968_0239433 3300044735 Bacteria 859
586 Ga0466957_0002469 3300044842 Bacteria 9932
587 Ga0466957_0060558 3300044842 Bacteria 2321
588 Ga0466960_0021758 3300044901 Bacteria 2859
589 Ga0466959_0296613 3300045049 Bacteria 1107
590 Ga0466958_0000506 3300045836 Bacteria 16309
591 Ga0466958_0240527 3300045836 Bacteria 1157
592 Ga0466958_0588751 3300045836 Bacteria 723
593 Ga0466967_0021699 3300045976 Bacteria 5223
594 Ga0466967_0072671 3300045976 Bacteria 3083
595 Ga0466967_0118471 3300045976 Bacteria 2442
596 Ga0466967_0196153 3300045976 Bacteria 1910
597 Ga0466967_0359547 3300045976 Bacteria 1410
598 Ga0466967_0402299 3300045976 Bacteria 1332
599 Ga0466967_0449707 3300045976 Bacteria 1259
600 Ga0466967_1591370 3300045976 Bacteria 651
601 Ga0466967_1844498 3300045976 Bacteria 602
602 Ga0466967_2108633 3300045976 Bacteria 560
603 Ga0466967_2218823 3300045976 Bacteria 545
604 Ga0466967_2255187 3300045976 Bacteria 540
605 Ga0495617_011727 3300046452 Bacteria 2989
606 Ga0495627_025915 3300046453 Bacteria 1897
607 Ga0495638_0000012 3300046460 Bacteria 435577
608 Ga0495638_0000207 3300046460 Bacteria 83805
609 Ga0495638_0059419 3300046460 Bacteria 2367
610 Ga0495650_0023973 3300046471 Bacteria 2892
611 Ga0495605_0174557 3300046474 Bacteria 948
612 Ga0495585_0033580 3300046492 Bacteria 2904
613 Ga0495583_0000180 3300046506 Bacteria 108471
614 Ga0495583_0000643 3300046506 Bacteria 46051
615 Ga0495583_0004661 3300046506 Bacteria 9669
616 Ga0495606_0081466 3300046507 Bacteria 2012
617 Ga0495606_0455880 3300046507 Bacteria 654
618 Ga0495610_0263897 3300046512 Bacteria 677
619 Ga0495616_0000010 3300046513 Bacteria 224378
620 Ga0495632_0000248 3300046519 Bacteria 53538
621 Ga0495643_0039984 3300046522 Bacteria 2563
622 Ga0495643_0200499 3300046522 Bacteria 958
623 Ga0495648_0000151 3300046524 Bacteria 83011
624 Ga0495648_0026719 3300046524 Bacteria 3881
625 Ga0495663_0107436 3300046525 Bacteria 924
626 Ga0495652_0484320 3300046529 Bacteria 860
627 Ga0495654_0059377 3300046530 Bacteria 1842
628 Ga0495654_0077322 3300046530 Bacteria 1566
629 Ga0495654_0077426 3300046530 Bacteria 1565
630 Ga0495654_0096319 3300046530 Bacteria 1367
631 Ga0495633_0009411 3300046558 Bacteria 5401
632 Ga0495668_0000004 3300046616 Bacteria 574236
633 Ga0495668_0002391 3300046616 Bacteria 15550
634 Ga0495668_0006873 3300046616 Bacteria 7376
635 Ga0495668_0040848 3300046616 Bacteria 2586
636 Ga0495668_0176176 3300046616 Bacteria 1172
637 Ga0495625_0001182 3300046660 Bacteria 33512
638 Ga0495625_0003111 3300046660 Bacteria 16956
639 Ga0495625_0068441 3300046660 Bacteria 2496
640 Ga0495625_0164006 3300046660 Bacteria 1487
641 Ga0495625_0320073 3300046660 Bacteria 988
642 Ga0495623_0034060 3300046679 Bacteria 3267
643 Ga0495669_0002918 3300046684 Bacteria 7027
644 Ga0495669_0105850 3300046684 Bacteria 1310
645 Ga0495669_0211987 3300046684 Bacteria 927
646 Ga0495670_0006307 3300046691 Bacteria 5824
647 Ga0495670_0090704 3300046691 Bacteria 1564
648 Ga0495670_0260499 3300046691 Bacteria 925
649 Ga0495671_0000023 3300046692 Bacteria 252939
650 Ga0495671_0008914 3300046692 Bacteria 5634
651 Ga0495671_0220005 3300046692 Bacteria 919
652 Ga0495687_121374 3300047443 Bacteria 942
653 Ga0495677_0007182 3300047445 Bacteria 4169
654 Ga0495685_071854 3300047447 Bacteria 1158
655 Ga0495685_123399 3300047447 Bacteria 849
656 Ga0495673_0000054 3300047469 Bacteria 252207
657 Ga0495686_0006227 3300047472 Bacteria 9193
658 Ga0495686_0007366 3300047472 Bacteria 8255
659 Ga0495686_0018195 3300047472 Bacteria 4720
660 Ga0495686_0084881 3300047472 Bacteria 1929
661 Ga0495686_0211929 3300047472 Bacteria 1106
662 Ga0495602_0064575 3300048088 Bacteria 3164
663 Ga0495626_0193598 3300048091 Bacteria 837
664 Ga0496100_0648349 3300048903 Bacteria 822
665 Ga0496101_0075810 3300048904 Bacteria 2476
666 Ga0496101_0179780 3300048904 Bacteria 1629
667 Ga0496101_0679483 3300048904 Bacteria 813
668 Ga0496102_0000481 3300048905 Bacteria 44268
669 Ga0496103_0000347 3300048906 Bacteria 42198
670 Ga0496103_0141373 3300048906 Unclassified 1539
671 Ga0496103_0473379 3300048906 Bacteria 803
672 Ga0496106_0077572 3300048909 Bacteria 2548
673 Ga0496107_0024108 3300048910 Bacteria 4303
674 Ga0496107_0385240 3300048910 Bacteria 1043
675 Ga0496108_0264936 3300048911 Bacteria 1495
676 Ga0496109_0027277 3300048912 Bacteria 5097
677 Ga0496109_0793114 3300048912 Bacteria 885
678 Ga0496110_0078443 3300048913 Bacteria 2940
679 Ga0496110_1216993 3300048913 Bacteria 662
680 Ga0496111_0003794 3300048914 Bacteria 9425
681 Ga0496111_0556205 3300048914 Bacteria 842
682 Ga0496111_1301184 3300048914 Bacteria 512
683 Ga0496112_0009881 3300048915 Bacteria 8625
684 Ga0496112_0084606 3300048915 Bacteria 3137
685 Ga0496112_1108622 3300048915 Bacteria 709
686 Ga0496113_0008196 3300048916 Bacteria 6790
687 Ga0496113_0216587 3300048916 Bacteria 1525
688 Ga0496113_0508911 3300048916 Bacteria 967
689 Ga0496115_0000534 3300048918 Bacteria 29632
690 Ga0496116_0002244 3300048919 Bacteria 20540
691 Ga0496117_0001149 3300048920 Bacteria 39861
692 Ga0496117_0002571 3300048920 Bacteria 22586
693 Ga0496117_0094080 3300048920 Bacteria 1920
694 Ga0496118_0000493 3300048921 Bacteria 65468
695 Ga0496118_0001071 3300048921 Bacteria 42731
696 Ga0496119_0017078 3300048922 Bacteria 5485
697 Ga0496119_0150677 3300048922 Bacteria 1247
698 Ga0496120_0023307 3300048923 Bacteria 3877
699 Ga0496121_0046213 3300048924 Bacteria 3729
700 Ga0496121_0338970 3300048924 Bacteria 1005
701 Ga0496122_0126510 3300048925 Bacteria 1634
702 Ga0496122_0329098 3300048925 Bacteria 808
703 Ga0496122_0330217 3300048925 Bacteria 806
704 Ga0496123_0065252 3300048926 Bacteria 2315
705 Ga0496123_0077610 3300048926 Bacteria 2039
706 Ga0496124_0000889 3300048927 Bacteria 48520
707 Ga0496124_0000996 3300048927 Bacteria 44925
708 Ga0496124_0073812 3300048927 Bacteria 2821
709 Ga0496124_0325858 3300048927 Bacteria 1098
710 Ga0496125_0091212 3300048928 Bacteria 2284
711 Ga0496126_0140950 3300048929 Bacteria 2075
712 Ga0496126_0171090 3300048929 Bacteria 1851
713 Ga0495678_141173 3300049459 Bacteria 788
714 Ga0495682_0056187 3300049460 Bacteria 1427
715 Ga0501031_0020490 3300049568 Bacteria 4311
716 Ga0501032_0167496 3300049569 Bacteria 1441
717 Ga0501034_0051979 3300049571 Bacteria 4130
718 Ga0501034_0180614 3300049571 Bacteria 2075
719 Ga0501034_0255901 3300049571 Bacteria 1695
720 Ga0501034_1698074 3300049571 Bacteria 504
721 Ga0501036_0021382 3300049572 Bacteria 5438
722 Ga0501038_0275900 3300049574 Bacteria 1324
723 Ga0501043_0074501 3300049579 Bacteria 2666
724 Ga0501046_0248288 3300049580 Bacteria 1311
725 Ga0501046_0567953 3300049580 Bacteria 807
726 Ga0501047_0039638 3300049581 Bacteria 4555
727 Ga0501047_0072301 3300049581 Bacteria 3320
728 Ga0501048_0074744 3300049582 Bacteria 2391
729 Ga0501070_0076252 3300049586 Bacteria 2776
730 Ga0501224_000007 3300049664 Bacteria 127654
731 Ga0501233_000599 3300049668 Bacteria 5875
732 Ga0501225_0000055 3300049705 Bacteria 38821
733 Ga0501234_000955 3300049707 Bacteria 4571
734 Ga0501241_083320 3300049758 Bacteria 668
735 Ga0501035_0012295 3300049822 Bacteria 7913
736 Ga0501035_0278680 3300049822 Bacteria 1414
737 Ga0501044_0203278 3300049823 Bacteria 1938
738 Ga0501045_0866897 3300049824 Bacteria 664
739 Ga0501226_000025 3300049853 Bacteria 91197
740 nmdc:mga03683_34509_c1 3300050489 Bacteria 2047
741 nmdc:mga04h51_117222_c1 3300050495 Bacteria 988
742 nmdc:mga07m45_25838_c1 3300050496 Bacteria 3224
743 nmdc:mga05p37_243419_c1 3300050507 Bacteria 2161
744 nmdc:mga09592_922564_c1 3300050508 Bacteria 733
745 nmdc:mga08y16_61453_c1 3300050511 Bacteria 3923
746 nmdc:mga0sz30_65946_c1 3300050516 Bacteria 1552
747 Ga0495612_0056875 3300053078 Bacteria 1615
748 Ga0495619_0757630 3300053085 Bacteria 658
749 Ga0500643_000293 3300053087 Bacteria 42902
750 Ga0500643_000904 3300053087 Bacteria 18780
751 Ga0500646_0385219 3300053090 Bacteria 516
752 Ga0500647_0070056 3300053091 Bacteria 1686
753 Ga0500651_0220937 3300053093 Bacteria 1111
754 Ga0500566_0000285 3300053094 Bacteria 27164
755 Ga0500555_007751 3300053103 Bacteria 3053
756 Ga0500556_0008222 3300053104 Bacteria 3006
757 Ga0500592_000213 3300053116 Bacteria 10649
758 Ga0500592_031987 3300053116 Bacteria 849
759 Ga0500594_0001763 3300053118 Bacteria 4714
760 Ga0500595_004422 3300053119 Bacteria 6311
761 Ga0500595_010229 3300053119 Bacteria 3737
762 Ga0500608_000327 3300053122 Bacteria 18285
763 Ga0500608_033290 3300053122 Bacteria 2452
764 Ga0500618_014525 3300053125 Bacteria 2008
765 Ga0500618_156611 3300053125 Bacteria 520
766 Ga0500642_0000002 3300053130 Bacteria 795093
767 Ga0500655_012842 3300053133 Bacteria 1524
768 Ga0500658_0000662 3300053134 Bacteria 14169
769 Ga0500658_0033119 3300053134 Bacteria 2030
770 Ga0500559_0003325 3300053136 Bacteria 7963
771 Ga0500559_0007104 3300053136 Bacteria 4992
772 Ga0500559_0035376 3300053136 Bacteria 2157
773 Ga0500564_000959 3300053138 Bacteria 9360
774 Ga0500568_0004150 3300053139 Bacteria 7824
775 Ga0500573_0002298 3300053140 Bacteria 9502
776 Ga0500573_0177095 3300053140 Bacteria 1149
777 Ga0500573_0246625 3300053140 Bacteria 923
778 Ga0500577_0173313 3300053142 Bacteria 923
779 Ga0500588_0391161 3300053146 Bacteria 529
780 Ga0500604_0140797 3300053151 Bacteria 815
781 Ga0500622_0197561 3300053156 Bacteria 917
782 Ga0500624_000011 3300053157 Bacteria 168125
783 Ga0500627_0000009 3300053158 Bacteria 153203
784 Ga0500627_0001047 3300053158 Bacteria 7536
785 Ga0500627_0057845 3300053158 Bacteria 1701
786 Ga0500627_0094683 3300053158 Bacteria 1338
787 Ga0500627_0241872 3300053158 Bacteria 800
788 Ga0500636_0040341 3300053177 Bacteria 2761
789 Ga0500567_001496 3300053723 Bacteria 9477
790 Ga0500611_133902 3300053727 Bacteria 670
791 Ga0500625_000001 3300053729 Bacteria 395993
792 Ga0500645_000064 3300053730 Bacteria 84824
793 Ga0500645_000705 3300053730 Bacteria 20743
794 Ga0500645_071059 3300053730 Bacteria 999
795 Ga0500596_006952 3300053735 Bacteria 1881
796 Ga0466962_0038732 3300061719 Bacteria 2283

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053140 Ga0500573_0246625 Ga0500573_0246625_529_912 127
2 3300035241 Ga0373961_0391148 Ga0373961_0391148_30_431 133
3 3300037418 Ga0395900_1286347 Ga0395900_1286347_30_431 133
4 3300053090 Ga0500646_0385219 Ga0500646_0385219_10_432 140
5 iso_pu_bacteria 2675903059 2676486109 147
6 iso_pu_bacteria 2599185359 2600228428 150
7 iso_pu_bacteria 2818991466 2819715221 150
8 iso_pu_bacteria 2879163058 2879163412 150
9 iso_pu_bacteria 2928027323 2928031156 150
10 iso_pu_bacteria 2928526807 2928528039 150
11 iso_pu_bacteria 2928968154 2928971457 150
12 3300005262 Ga0065165_1041615 Ga0065165_10416152 151
13 3300006880 Ga0075429_100424676 Ga0075429_1004246762 151
14 3300025932 Ga0207690_10182553 Ga0207690_101825531 151
15 3300031911 Ga0307412_10005336 Ga0307412_100053367 151
16 3300032002 Ga0307416_100339873 Ga0307416_1003398732 151
17 3300032004 Ga0307414_10009988 Ga0307414_100099882 151
18 3300032133 Ga0316583_10008044 Ga0316583_100080446 151
19 3300035398 Ga0316574_0203301 Ga0316574_0203301_583_1044 151
20 3300036647 Ga0316582_0000490 Ga0316582_0000490_4464_4925 151
21 3300036647 Ga0316582_0578966 Ga0316582_0578966_191_652 151
22 3300036712 Ga0316584_0167688 Ga0316584_0167688_889_1350 151
23 3300036712 Ga0316584_0337297 Ga0316584_0337297_587_1048 151
24 3300046452 Ga0495617_011727 Ga0495617_011727_314_775 151
25 3300046460 Ga0495638_0000012 Ga0495638_0000012_372754_373215 151
26 3300046471 Ga0495650_0023973 Ga0495650_0023973_689_1150 151
27 3300046506 Ga0495583_0000180 Ga0495583_0000180_5427_5888 151
28 3300046513 Ga0495616_0000010 Ga0495616_0000010_56712_57173 151
29 3300046519 Ga0495632_0000248 Ga0495632_0000248_50780_51241 151
30 3300046524 Ga0495648_0000151 Ga0495648_0000151_20183_20644 151
31 3300046558 Ga0495633_0009411 Ga0495633_0009411_2289_2750 151
32 3300046616 Ga0495668_0002391 Ga0495668_0002391_5341_5802 151
33 3300046692 Ga0495671_0000023 Ga0495671_0000023_149163_149624 151
34 3300047469 Ga0495673_0000054 Ga0495673_0000054_149148_149609 151
35 3300050508 nmdc:mga09592_922564_c1 nmdc:mga09592_922564_c1_101_562 151
36 3300053085 Ga0495619_0757630 Ga0495619_0757630_44_505 151
37 3300053146 Ga0500588_0391161 Ga0500588_0391161_26_487 151
38 3300053158 Ga0500627_0001047 Ga0500627_0001047_3062_3523 151
39 iso_pu_bacteria 2739367664 2739648892 151
40 iso_pu_bacteria 2739367865 2740027365 151
41 iso_pu_bacteria 2885429604 2885430973 151
42 iso_pu_bacteria 8057101203 8057101428 151
43 3300001979 JGI24740J21852_10025651 JGI24740J21852_100256513 152
44 3300002067 JGI24735J21928_10003268 JGI24735J21928_100032681 152
45 3300002067 JGI24735J21928_10109069 JGI24735J21928_101090692 152
46 3300002075 JGI24738J21930_10003879 JGI24738J21930_100038793 152
47 3300005327 Ga0070658_10030316 Ga0070658_100303164 152
48 3300005327 Ga0070658_10054034 Ga0070658_100540343 152
49 3300005336 Ga0070680_100837885 Ga0070680_1008378852 152
50 3300005339 Ga0070660_100057997 Ga0070660_1000579976 152
51 3300005339 Ga0070660_100107890 Ga0070660_1001078901 152
52 3300005344 Ga0070661_100139342 Ga0070661_1001393422 152
53 3300005345 Ga0070692_10000142 Ga0070692_1000014219 152
54 3300005455 Ga0070663_100003059 Ga0070663_10000305915 152
55 3300005455 Ga0070663_100044176 Ga0070663_1000441766 152
56 3300005539 Ga0068853_100072366 Ga0068853_1000723664 152
57 3300005563 Ga0068855_100302634 Ga0068855_1003026344 152
58 3300005563 Ga0068855_100619267 Ga0068855_1006192672 152
59 3300005578 Ga0068854_100000559 Ga0068854_10000055917 152
60 3300005578 Ga0068854_100026578 Ga0068854_1000265788 152
61 3300005616 Ga0068852_100058186 Ga0068852_1000581866 152
62 3300006237 Ga0097621_100285331 Ga0097621_1002853313 152
63 3300006358 Ga0068871_100005363 Ga0068871_10000536311 152
64 3300009093 Ga0105240_10699040 Ga0105240_106990401 152
65 3300009545 Ga0105237_10181775 Ga0105237_101817752 152
66 3300010375 Ga0105239_10089892 Ga0105239_100898922 152
67 3300013104 Ga0157370_10724662 Ga0157370_107246622 152
68 3300013105 Ga0157369_10322135 Ga0157369_103221352 152
69 3300013307 Ga0157372_10935612 Ga0157372_109356122 152
70 3300013308 Ga0157375_12321886 Ga0157375_123218861 152
71 3300025246 Ga0209646_1015807 Ga0209646_10158072 152
72 3300025272 Ga0209455_1000772 Ga0209455_10007729 152
73 3300025321 Ga0207656_10066705 Ga0207656_100667052 152
74 3300025904 Ga0207647_10007714 Ga0207647_1000771413 152
75 3300025909 Ga0207705_10002705 Ga0207705_1000270518 152
76 3300025909 Ga0207705_10026902 Ga0207705_100269024 152
77 3300025909 Ga0207705_10106802 Ga0207705_101068022 152
78 3300025911 Ga0207654_10517952 Ga0207654_105179521 152
79 3300025914 Ga0207671_10024252 Ga0207671_100242527 152
80 3300025917 Ga0207660_10731325 Ga0207660_107313252 152
81 3300025919 Ga0207657_10010415 Ga0207657_100104159 152
82 3300025919 Ga0207657_10112964 Ga0207657_101129645 152
83 3300025920 Ga0207649_10095289 Ga0207649_100952892 152
84 3300025924 Ga0207694_10062555 Ga0207694_100625554 152
85 3300025932 Ga0207690_10018054 Ga0207690_100180545 152
86 3300025981 Ga0207640_10000202 Ga0207640_1000020236 152
87 3300025981 Ga0207640_10026210 Ga0207640_100262107 152
88 3300026041 Ga0207639_10004994 Ga0207639_100049941 152
89 3300026067 Ga0207678_10002000 Ga0207678_1000200011 152
90 3300026067 Ga0207678_10046585 Ga0207678_100465852 152
91 3300026116 Ga0207674_10236171 Ga0207674_102361713 152
92 3300026142 Ga0207698_10041296 Ga0207698_100412966 152
93 3300031456 Ga0307513_10206273 Ga0307513_102062732 152
94 3300031911 Ga0307412_10001328 Ga0307412_100013288 152
95 3300031911 Ga0307412_11342480 Ga0307412_113424801 152
96 3300046453 Ga0495627_025915 Ga0495627_025915_1174_1632 152
97 3300046460 Ga0495638_0059419 Ga0495638_0059419_445_903 152
98 3300046506 Ga0495583_0000643 Ga0495583_0000643_20949_21407 152
99 3300046524 Ga0495648_0026719 Ga0495648_0026719_1076_1555 152
100 3300046691 Ga0495670_0006307 Ga0495670_0006307_4577_5041 152
101 3300046691 Ga0495670_0260499 Ga0495670_0260499_183_641 152
102 3300046692 Ga0495671_0220005 Ga0495671_0220005_39_497 152
103 3300047472 Ga0495686_0006227 Ga0495686_0006227_1619_2077 152
104 3300047472 Ga0495686_0007366 Ga0495686_0007366_5328_5786 152
105 3300047472 Ga0495686_0018195 Ga0495686_0018195_3701_4159 152
106 3300047472 Ga0495686_0084881 Ga0495686_0084881_1380_1838 152
107 3300048906 Ga0496103_0473379 Ga0496103_0473379_288_752 152
108 3300048920 Ga0496117_0094080 Ga0496117_0094080_941_1405 152
109 3300048922 Ga0496119_0150677 Ga0496119_0150677_73_537 152
110 3300048925 Ga0496122_0126510 Ga0496122_0126510_967_1431 152
111 3300048925 Ga0496122_0329098 Ga0496122_0329098_311_775 152
112 3300048926 Ga0496123_0065252 Ga0496123_0065252_546_1010 152
113 3300048926 Ga0496123_0077610 Ga0496123_0077610_903_1367 152
114 3300048927 Ga0496124_0000889 Ga0496124_0000889_14763_15227 152
115 3300048927 Ga0496124_0073812 Ga0496124_0073812_965_1429 152
116 3300048927 Ga0496124_0325858 Ga0496124_0325858_305_763 152
117 3300048929 Ga0496126_0171090 Ga0496126_0171090_996_1460 152
118 3300049460 Ga0495682_0056187 Ga0495682_0056187_536_994 152
119 3300053103 Ga0500555_007751 Ga0500555_007751_280_738 152
120 3300053104 Ga0500556_0008222 Ga0500556_0008222_300_758 152
121 3300053125 Ga0500618_156611 Ga0500618_156611_49_507 152
122 3300053136 Ga0500559_0007104 Ga0500559_0007104_947_1405 152
123 3300053142 Ga0500577_0173313 Ga0500577_0173313_291_749 152
124 3300053157 Ga0500624_000011 Ga0500624_000011_67824_68282 152
125 3300053730 Ga0500645_000705 Ga0500645_000705_1099_1557 152
126 3300053730 Ga0500645_071059 Ga0500645_071059_261_725 152
127 iso_pu_bacteria 2984555340 2984556467 152
128 iso_pu_bacteria 2984564862 2984565359 152
129 iso_pu_bacteria 2990265787 2990268925 152
130 iso_pu_bacteria 2993356040 2993356435 152
131 iso_pu_bacteria 2993693658 2993697264 152
132 3300000041 ARcpr5oldR_c001506 ARcpr5oldR_0015063 153
133 3300001989 JGI24739J22299_10000524 JGI24739J22299_1000052415 153
134 3300001989 JGI24739J22299_10013165 JGI24739J22299_100131652 153
135 3300002067 JGI24735J21928_10019703 JGI24735J21928_100197032 153
136 3300002074 JGI24748J21848_1019863 JGI24748J21848_10198632 153
137 3300003214 JGI25165J46597_1000010 JGI25165J46597_1000010256 153
138 3300003215 JGI25153J46596_10006448 JGI25153J46596_100064488 153
139 3300003773 Ga0055537_1000460 Ga0055537_100046026 153
140 3300003775 Ga0055524_1000155 Ga0055524_100015531 153
141 3300003791 Ga0055530_10001208 Ga0055530_1000120820 153
142 3300003791 Ga0055530_10008781 Ga0055530_100087815 153
143 3300003794 Ga0055531_10000792 Ga0055531_1000079213 153
144 3300003794 Ga0055531_10002671 Ga0055531_100026715 153
145 3300005262 Ga0065165_1007583 Ga0065165_10075835 153
146 3300005262 Ga0065165_1018077 Ga0065165_10180771 153
147 3300005327 Ga0070658_10000003 Ga0070658_10000003118 153
148 3300005327 Ga0070658_10021495 Ga0070658_100214957 153
149 3300005327 Ga0070658_10033779 Ga0070658_100337792 153
150 3300005327 Ga0070658_10166424 Ga0070658_101664243 153
151 3300005329 Ga0070683_100559908 Ga0070683_1005599082 153
152 3300005331 Ga0070670_100746266 Ga0070670_1007462662 153
153 3300005331 Ga0070670_101154386 Ga0070670_1011543861 153
154 3300005336 Ga0070680_100025459 Ga0070680_1000254598 153
155 3300005336 Ga0070680_100034426 Ga0070680_1000344266 153
156 3300005336 Ga0070680_100104058 Ga0070680_1001040582 153
157 3300005337 Ga0070682_100579292 Ga0070682_1005792921 153
158 3300005338 Ga0068868_100565982 Ga0068868_1005659822 153
159 3300005339 Ga0070660_100059329 Ga0070660_1000593292 153
160 3300005339 Ga0070660_100088967 Ga0070660_1000889672 153
161 3300005339 Ga0070660_100397916 Ga0070660_1003979162 153
162 3300005339 Ga0070660_100408703 Ga0070660_1004087032 153
163 3300005344 Ga0070661_100267307 Ga0070661_1002673072 153
164 3300005344 Ga0070661_100585399 Ga0070661_1005853991 153
165 3300005345 Ga0070692_10159865 Ga0070692_101598652 153
166 3300005347 Ga0070668_100000011 Ga0070668_10000001158 153
167 3300005355 Ga0070671_100003480 Ga0070671_1000034809 153
168 3300005355 Ga0070671_100093078 Ga0070671_1000930782 153
169 3300005355 Ga0070671_100671018 Ga0070671_1006710182 153
170 3300005364 Ga0070673_100015570 Ga0070673_1000155703 153
171 3300005364 Ga0070673_100828271 Ga0070673_1008282712 153
172 3300005366 Ga0070659_100003069 Ga0070659_1000030693 153
173 3300005366 Ga0070659_100021627 Ga0070659_1000216276 153
174 3300005366 Ga0070659_100090402 Ga0070659_1000904023 153
175 3300005366 Ga0070659_100157669 Ga0070659_1001576692 153
176 3300005366 Ga0070659_100202257 Ga0070659_1002022572 153
177 3300005367 Ga0070667_100383351 Ga0070667_1003833512 153
178 3300005435 Ga0070714_100263657 Ga0070714_1002636572 153
179 3300005435 Ga0070714_100556978 Ga0070714_1005569782 153
180 3300005455 Ga0070663_100050017 Ga0070663_1000500174 153
181 3300005457 Ga0070662_100065006 Ga0070662_1000650063 153
182 3300005457 Ga0070662_100121909 Ga0070662_1001219092 153
183 3300005458 Ga0070681_10029494 Ga0070681_100294949 153
184 3300005458 Ga0070681_10072402 Ga0070681_100724026 153
185 3300005458 Ga0070681_10105457 Ga0070681_101054573 153
186 3300005458 Ga0070681_10172151 Ga0070681_101721512 153
187 3300005467 Ga0070706_100028793 Ga0070706_1000287932 153
188 3300005530 Ga0070679_100077764 Ga0070679_1000777645 153
189 3300005530 Ga0070679_100095520 Ga0070679_1000955202 153
190 3300005530 Ga0070679_100173758 Ga0070679_1001737582 153
191 3300005530 Ga0070679_100191645 Ga0070679_1001916452 153
192 3300005530 Ga0070679_100332936 Ga0070679_1003329362 153
193 3300005530 Ga0070679_100340828 Ga0070679_1003408282 153
194 3300005530 Ga0070679_100650877 Ga0070679_1006508772 153
195 3300005530 Ga0070679_100651978 Ga0070679_1006519782 153
196 3300005535 Ga0070684_100329502 Ga0070684_1003295022 153
197 3300005539 Ga0068853_100054892 Ga0068853_1000548925 153
198 3300005539 Ga0068853_100220247 Ga0068853_1002202472 153
199 3300005539 Ga0068853_100247300 Ga0068853_1002473002 153
200 3300005539 Ga0068853_100642700 Ga0068853_1006427002 153
201 3300005539 Ga0068853_101379521 Ga0068853_1013795211 153
202 3300005545 Ga0070695_100075268 Ga0070695_1000752685 153
203 3300005546 Ga0070696_100021044 Ga0070696_1000210447 153
204 3300005546 Ga0070696_100461594 Ga0070696_1004615942 153
205 3300005547 Ga0070693_100148555 Ga0070693_1001485552 153
206 3300005547 Ga0070693_100198996 Ga0070693_1001989962 153
207 3300005548 Ga0070665_100044221 Ga0070665_1000442213 153
208 3300005548 Ga0070665_100291629 Ga0070665_1002916294 153
209 3300005549 Ga0070704_100316459 Ga0070704_1003164592 153
210 3300005563 Ga0068855_100048687 Ga0068855_1000486873 153
211 3300005563 Ga0068855_100051070 Ga0068855_1000510705 153
212 3300005563 Ga0068855_100129913 Ga0068855_1001299135 153
213 3300005563 Ga0068855_100189877 Ga0068855_1001898772 153
214 3300005563 Ga0068855_100289358 Ga0068855_1002893582 153
215 3300005563 Ga0068855_100315793 Ga0068855_1003157932 153
216 3300005563 Ga0068855_100454337 Ga0068855_1004543372 153
217 3300005564 Ga0070664_100107856 Ga0070664_1001078563 153
218 3300005564 Ga0070664_100183721 Ga0070664_1001837212 153
219 3300005564 Ga0070664_100853026 Ga0070664_1008530261 153
220 3300005564 Ga0070664_101305074 Ga0070664_1013050741 153
221 3300005577 Ga0068857_100094218 Ga0068857_1000942185 153
222 3300005577 Ga0068857_100142446 Ga0068857_1001424462 153
223 3300005577 Ga0068857_100276997 Ga0068857_1002769972 153
224 3300005578 Ga0068854_100039382 Ga0068854_1000393826 153
225 3300005578 Ga0068854_100417427 Ga0068854_1004174272 153
226 3300005578 Ga0068854_100527255 Ga0068854_1005272552 153
227 3300005578 Ga0068854_100764096 Ga0068854_1007640962 153
228 3300005614 Ga0068856_100027149 Ga0068856_1000271493 153
229 3300005614 Ga0068856_100052866 Ga0068856_1000528663 153
230 3300005614 Ga0068856_100072762 Ga0068856_1000727626 153
231 3300005614 Ga0068856_100115596 Ga0068856_1001155963 153
232 3300005614 Ga0068856_100427271 Ga0068856_1004272712 153
233 3300005614 Ga0068856_101210619 Ga0068856_1012106192 153
234 3300005616 Ga0068852_100032215 Ga0068852_1000322158 153
235 3300005616 Ga0068852_100047102 Ga0068852_1000471022 153
236 3300005616 Ga0068852_100048090 Ga0068852_1000480904 153
237 3300005616 Ga0068852_100073666 Ga0068852_1000736663 153
238 3300005616 Ga0068852_100814070 Ga0068852_1008140702 153
239 3300005616 Ga0068852_100922176 Ga0068852_1009221762 153
240 3300005616 Ga0068852_101108464 Ga0068852_1011084641 153
241 3300005617 Ga0068859_100032942 Ga0068859_1000329423 153
242 3300005618 Ga0068864_100018954 Ga0068864_1000189543 153
243 3300005719 Ga0068861_100772769 Ga0068861_1007727692 153
244 3300005834 Ga0068851_10021086 Ga0068851_100210862 153
245 3300005834 Ga0068851_10022086 Ga0068851_100220864 153
246 3300005841 Ga0068863_100000186 Ga0068863_10000018659 153
247 3300005841 Ga0068863_100593238 Ga0068863_1005932382 153
248 3300005842 Ga0068858_100000102 Ga0068858_10000010241 153
249 3300005842 Ga0068858_100001966 Ga0068858_1000019663 153
250 3300005842 Ga0068858_100309087 Ga0068858_1003090873 153
251 3300005844 Ga0068862_100312956 Ga0068862_1003129562 153
252 3300006186 Ga0075369_10165462 Ga0075369_101654622 153
253 3300006358 Ga0068871_100682245 Ga0068871_1006822452 153
254 3300006844 Ga0075428_100050761 Ga0075428_1000507614 153
255 3300006844 Ga0075428_101653890 Ga0075428_1016538902 153
256 3300006931 Ga0097620_100032942 Ga0097620_1000329428 153
257 3300009093 Ga0105240_10008649 Ga0105240_1000864911 153
258 3300009093 Ga0105240_10022129 Ga0105240_1002212912 153
259 3300009093 Ga0105240_10186565 Ga0105240_101865652 153
260 3300009094 Ga0111539_10016465 Ga0111539_100164658 153
261 3300009098 Ga0105245_10001046 Ga0105245_1000104619 153
262 3300009101 Ga0105247_10109991 Ga0105247_101099912 153
263 3300009147 Ga0114129_10170049 Ga0114129_101700494 153
264 3300009148 Ga0105243_10028129 Ga0105243_100281299 153
265 3300009174 Ga0105241_10194511 Ga0105241_101945111 153
266 3300009174 Ga0105241_10832781 Ga0105241_108327812 153
267 3300009177 Ga0105248_10003638 Ga0105248_1000363811 153
268 3300009177 Ga0105248_10028673 Ga0105248_100286736 153
269 3300009177 Ga0105248_10032137 Ga0105248_100321375 153
270 3300009177 Ga0105248_10392213 Ga0105248_103922132 153
271 3300009545 Ga0105237_10104546 Ga0105237_101045463 153
272 3300009545 Ga0105237_11559915 Ga0105237_115599151 153
273 3300009551 Ga0105238_10036999 Ga0105238_100369992 153
274 3300009551 Ga0105238_10067960 Ga0105238_100679606 153
275 3300009551 Ga0105238_10092085 Ga0105238_100920852 153
276 3300009551 Ga0105238_10390045 Ga0105238_103900452 153
277 3300009551 Ga0105238_10402836 Ga0105238_104028362 153
278 3300009551 Ga0105238_10707038 Ga0105238_107070382 153
279 3300009553 Ga0105249_10014831 Ga0105249_100148313 153
280 3300010375 Ga0105239_12106981 Ga0105239_121069812 153
281 3300013100 Ga0157373_10016847 Ga0157373_100168478 153
282 3300013100 Ga0157373_10040258 Ga0157373_100402584 153
283 3300013100 Ga0157373_10075053 Ga0157373_100750533 153
284 3300013100 Ga0157373_10242676 Ga0157373_102426762 153
285 3300013100 Ga0157373_10551089 Ga0157373_105510891 153
286 3300013102 Ga0157371_10155848 Ga0157371_101558482 153
287 3300013102 Ga0157371_10172510 Ga0157371_101725102 153
288 3300013102 Ga0157371_10306500 Ga0157371_103065002 153
289 3300013104 Ga0157370_10036353 Ga0157370_100363532 153
290 3300013104 Ga0157370_10125312 Ga0157370_101253121 153
291 3300013104 Ga0157370_10131295 Ga0157370_101312952 153
292 3300013104 Ga0157370_10172340 Ga0157370_101723402 153
293 3300013105 Ga0157369_10002615 Ga0157369_100026153 153
294 3300013105 Ga0157369_10070306 Ga0157369_100703063 153
295 3300013105 Ga0157369_10121654 Ga0157369_101216543 153
296 3300013296 Ga0157374_10155077 Ga0157374_101550772 153
297 3300013297 Ga0157378_10048347 Ga0157378_100483472 153
298 3300013306 Ga0163162_10009164 Ga0163162_100091648 153
299 3300013306 Ga0163162_10009790 Ga0163162_100097906 153
300 3300013306 Ga0163162_10639562 Ga0163162_106395621 153
301 3300013307 Ga0157372_10002970 Ga0157372_1000297018 153
302 3300013307 Ga0157372_10319859 Ga0157372_103198591 153
303 3300013307 Ga0157372_10655508 Ga0157372_106555081 153
304 3300013307 Ga0157372_11340683 Ga0157372_113406832 153
305 3300014325 Ga0163163_10248751 Ga0163163_102487511 153
306 3300014325 Ga0163163_10450992 Ga0163163_104509922 153
307 3300014497 Ga0182008_10505366 Ga0182008_105053662 153
308 3300020070 Ga0206356_11202361 Ga0206356_112023612 153
309 3300020081 Ga0206354_10168296 Ga0206354_101682962 153
310 3300020082 Ga0206353_12012794 Ga0206353_120127942 153
311 3300025233 Ga0209437_111975 Ga0209437_1119752 153
312 3300025245 Ga0207425_1007250 Ga0207425_10072502 153
313 3300025261 Ga0209233_1000044 Ga0209233_1000044225 153
314 3300025263 Ga0209565_1000011 Ga0209565_100001179 153
315 3300025272 Ga0209455_1025746 Ga0209455_10257462 153
316 3300025273 Ga0209673_1002122 Ga0209673_10021226 153
317 3300025291 Ga0209675_1013492 Ga0209675_10134922 153
318 3300025297 Ga0209758_1008891 Ga0209758_10088916 153
319 3300025298 Ga0209050_1000071 Ga0209050_100007113 153
320 3300025298 Ga0209050_1002140 Ga0209050_10021405 153
321 3300025299 Ga0209256_1000016 Ga0209256_1000016520 153
322 3300025304 Ga0209257_1000027 Ga0209257_1000027290 153
323 3300025304 Ga0209257_1001434 Ga0209257_100143418 153
324 3300025321 Ga0207656_10025320 Ga0207656_100253202 153
325 3300025321 Ga0207656_10039366 Ga0207656_100393662 153
326 3300025903 Ga0207680_10719372 Ga0207680_107193721 153
327 3300025904 Ga0207647_10024741 Ga0207647_100247414 153
328 3300025909 Ga0207705_10009941 Ga0207705_100099416 153
329 3300025909 Ga0207705_10033221 Ga0207705_100332212 153
330 3300025909 Ga0207705_10427571 Ga0207705_104275712 153
331 3300025910 Ga0207684_10421321 Ga0207684_104213212 153
332 3300025911 Ga0207654_10792998 Ga0207654_107929981 153
333 3300025912 Ga0207707_10044083 Ga0207707_100440833 153
334 3300025912 Ga0207707_10149531 Ga0207707_101495314 153
335 3300025912 Ga0207707_10191173 Ga0207707_101911732 153
336 3300025913 Ga0207695_10026017 Ga0207695_1002601711 153
337 3300025913 Ga0207695_10199135 Ga0207695_101991352 153
338 3300025913 Ga0207695_11185612 Ga0207695_111856121 153
339 3300025914 Ga0207671_10088723 Ga0207671_100887233 153
340 3300025917 Ga0207660_10000024 Ga0207660_100000242 153
341 3300025917 Ga0207660_10060824 Ga0207660_100608244 153
342 3300025917 Ga0207660_10225842 Ga0207660_102258422 153
343 3300025917 Ga0207660_10447300 Ga0207660_104473002 153
344 3300025917 Ga0207660_10490502 Ga0207660_104905022 153
345 3300025919 Ga0207657_10007988 Ga0207657_1000798812 153
346 3300025919 Ga0207657_10046672 Ga0207657_100466724 153
347 3300025919 Ga0207657_10053077 Ga0207657_100530773 153
348 3300025919 Ga0207657_10103276 Ga0207657_101032765 153
349 3300025919 Ga0207657_10109325 Ga0207657_101093252 153
350 3300025919 Ga0207657_10583406 Ga0207657_105834062 153
351 3300025919 Ga0207657_11032159 Ga0207657_110321592 153
352 3300025920 Ga0207649_10059417 Ga0207649_100594172 153
353 3300025920 Ga0207649_10089449 Ga0207649_100894492 153
354 3300025920 Ga0207649_10597774 Ga0207649_105977742 153
355 3300025921 Ga0207652_10073532 Ga0207652_100735323 153
356 3300025921 Ga0207652_10092414 Ga0207652_100924142 153
357 3300025921 Ga0207652_10148018 Ga0207652_101480183 153
358 3300025921 Ga0207652_10159255 Ga0207652_101592552 153
359 3300025921 Ga0207652_10293774 Ga0207652_102937742 153
360 3300025921 Ga0207652_10410785 Ga0207652_104107852 153
361 3300025921 Ga0207652_10480000 Ga0207652_104800002 153
362 3300025921 Ga0207652_11018435 Ga0207652_110184352 153
363 3300025924 Ga0207694_10020412 Ga0207694_100204126 153
364 3300025924 Ga0207694_10029168 Ga0207694_100291682 153
365 3300025924 Ga0207694_11336831 Ga0207694_113368311 153
366 3300025925 Ga0207650_10018464 Ga0207650_100184643 153
367 3300025927 Ga0207687_10000562 Ga0207687_1000056218 153
368 3300025929 Ga0207664_10066774 Ga0207664_100667743 153
369 3300025929 Ga0207664_10500508 Ga0207664_105005082 153
370 3300025931 Ga0207644_10000032 Ga0207644_1000003262 153
371 3300025931 Ga0207644_10051599 Ga0207644_100515992 153
372 3300025931 Ga0207644_10102939 Ga0207644_101029392 153
373 3300025931 Ga0207644_10374951 Ga0207644_103749512 153
374 3300025931 Ga0207644_10521877 Ga0207644_105218771 153
375 3300025932 Ga0207690_10063579 Ga0207690_100635793 153
376 3300025932 Ga0207690_10078402 Ga0207690_100784023 153
377 3300025932 Ga0207690_10147247 Ga0207690_101472472 153
378 3300025932 Ga0207690_10675176 Ga0207690_106751762 153
379 3300025933 Ga0207706_10004718 Ga0207706_100047182 153
380 3300025933 Ga0207706_10067824 Ga0207706_100678245 153
381 3300025940 Ga0207691_10068308 Ga0207691_100683083 153
382 3300025941 Ga0207711_10002908 Ga0207711_1000290814 153
383 3300025941 Ga0207711_10012212 Ga0207711_100122125 153
384 3300025941 Ga0207711_10468112 Ga0207711_104681122 153
385 3300025944 Ga0207661_10732046 Ga0207661_107320462 153
386 3300025945 Ga0207679_10033400 Ga0207679_100334004 153
387 3300025945 Ga0207679_10228292 Ga0207679_102282922 153
388 3300025945 Ga0207679_11018164 Ga0207679_110181641 153
389 3300025949 Ga0207667_10025172 Ga0207667_100251729 153
390 3300025949 Ga0207667_10041234 Ga0207667_100412347 153
391 3300025949 Ga0207667_10053956 Ga0207667_100539562 153
392 3300025949 Ga0207667_10070885 Ga0207667_100708852 153
393 3300025949 Ga0207667_10357924 Ga0207667_103579242 153
394 3300025949 Ga0207667_10497892 Ga0207667_104978922 153
395 3300025960 Ga0207651_10171341 Ga0207651_101713413 153
396 3300025961 Ga0207712_10033349 Ga0207712_100333492 153
397 3300025972 Ga0207668_10000034 Ga0207668_1000003459 153
398 3300025981 Ga0207640_10156959 Ga0207640_101569592 153
399 3300025981 Ga0207640_10879216 Ga0207640_108792162 153
400 3300026035 Ga0207703_10000190 Ga0207703_1000019028 153
401 3300026035 Ga0207703_10034927 Ga0207703_100349275 153
402 3300026035 Ga0207703_10282134 Ga0207703_102821342 153
403 3300026041 Ga0207639_10002119 Ga0207639_100021192 153
404 3300026041 Ga0207639_10087630 Ga0207639_100876303 153
405 3300026041 Ga0207639_10094791 Ga0207639_100947913 153
406 3300026041 Ga0207639_10559991 Ga0207639_105599912 153
407 3300026041 Ga0207639_10659466 Ga0207639_106594662 153
408 3300026041 Ga0207639_10846312 Ga0207639_108463122 153
409 3300026067 Ga0207678_10000455 Ga0207678_1000045525 153
410 3300026067 Ga0207678_10092769 Ga0207678_100927692 153
411 3300026078 Ga0207702_10018713 Ga0207702_100187133 153
412 3300026078 Ga0207702_10052142 Ga0207702_100521423 153
413 3300026078 Ga0207702_10066422 Ga0207702_100664222 153
414 3300026078 Ga0207702_11621557 Ga0207702_116215571 153
415 3300026088 Ga0207641_10000031 Ga0207641_10000031170 153
416 3300026088 Ga0207641_10686291 Ga0207641_106862912 153
417 3300026089 Ga0207648_10357096 Ga0207648_103570961 153
418 3300026095 Ga0207676_10000072 Ga0207676_1000007229 153
419 3300026116 Ga0207674_10003053 Ga0207674_1000305311 153
420 3300026116 Ga0207674_10006642 Ga0207674_100066422 153
421 3300026121 Ga0207683_11160850 Ga0207683_111608502 153
422 3300026142 Ga0207698_10025863 Ga0207698_100258634 153
423 3300028379 Ga0268266_10056076 Ga0268266_100560763 153
424 3300028379 Ga0268266_10064839 Ga0268266_100648394 153
425 3300028380 Ga0268265_10146257 Ga0268265_101462572 153
426 3300028381 Ga0268264_10000785 Ga0268264_1000078537 153
427 3300028786 Ga0307517_10075608 Ga0307517_100756083 153
428 3300028794 Ga0307515_10325087 Ga0307515_103250872 153
429 3300030522 Ga0307512_10435641 Ga0307512_104356411 153
430 3300030733 Ga0314311_1234836 Ga0314311_12348362 153
431 3300031616 Ga0307508_10000011 Ga0307508_10000011170 153
432 3300031731 Ga0307405_10109097 Ga0307405_101090972 153
433 3300031903 Ga0307407_10113528 Ga0307407_101135284 153
434 3300031911 Ga0307412_10026022 Ga0307412_100260222 153
435 3300031995 Ga0307409_100021228 Ga0307409_1000212284 153
436 3300032002 Ga0307416_100273430 Ga0307416_1002734302 153
437 3300032004 Ga0307414_11189774 Ga0307414_111897741 153
438 3300032126 Ga0307415_100044257 Ga0307415_1000442576 153
439 3300033180 Ga0307510_10066895 Ga0307510_100668956 153
440 3300035118 Ga0373954_0103957 Ga0373954_0103957_717_1178 153
441 3300035119 Ga0373956_0348221 Ga0373956_0348221_169_630 153
442 3300035172 Ga0373955_0007600 Ga0373955_0007600_2445_2906 153
443 3300035692 Ga0373935_0578125 Ga0373935_0578125_228_689 153
444 3300035724 Ga0373933_0013243 Ga0373933_0013243_3361_3822 153
445 3300036401 Ga0373937_0047729 Ga0373937_0047729_1651_2133 153
446 3300036401 Ga0373937_0102021 Ga0373937_0102021_661_1122 153
447 3300037312 Ga0395899_0002299 Ga0395899_0002299_620_1081 153
448 3300037312 Ga0395899_0019311 Ga0395899_0019311_4005_4466 153
449 3300037312 Ga0395899_0037173 Ga0395899_0037173_1089_1550 153
450 3300037312 Ga0395899_0063584 Ga0395899_0063584_987_1448 153
451 3300037312 Ga0395899_0174455 Ga0395899_0174455_655_1116 153
452 3300037312 Ga0395899_0213365 Ga0395899_0213365_413_874 153
453 3300037312 Ga0395899_0256610 Ga0395899_0256610_542_1003 153
454 3300037418 Ga0395900_0002548 Ga0395900_0002548_1640_2101 153
455 3300037418 Ga0395900_0044846 Ga0395900_0044846_3678_4139 153
456 3300037418 Ga0395900_0066250 Ga0395900_0066250_1150_1611 153
457 3300037418 Ga0395900_0096980 Ga0395900_0096980_921_1382 153
458 3300037418 Ga0395900_0131864 Ga0395900_0131864_1419_1880 153
459 3300037418 Ga0395900_0192374 Ga0395900_0192374_1424_1885 153
460 3300037418 Ga0395900_0211241 Ga0395900_0211241_968_1429 153
461 3300037418 Ga0395900_0245869 Ga0395900_0245869_749_1210 153
462 3300037418 Ga0395900_0316383 Ga0395900_0316383_41_502 153
463 3300037418 Ga0395900_0333416 Ga0395900_0333416_13_474 153
464 3300037418 Ga0395900_0667608 Ga0395900_0667608_215_676 153
465 3300037466 Ga0395898_0025707 Ga0395898_0025707_2730_3191 153
466 3300037466 Ga0395898_0093802 Ga0395898_0093802_1044_1505 153
467 3300037466 Ga0395898_0164557 Ga0395898_0164557_644_1105 153
468 3300037466 Ga0395898_0233521 Ga0395898_0233521_1264_1725 153
469 3300037466 Ga0395898_0235873 Ga0395898_0235873_74_535 153
470 3300037466 Ga0395898_0652849 Ga0395898_0652849_137_598 153
471 3300037471 Ga0395905_0000409 Ga0395905_0000409_27026_27487 153
472 3300037471 Ga0395905_0007919 Ga0395905_0007919_7798_8259 153
473 3300037471 Ga0395905_0029823 Ga0395905_0029823_4557_5018 153
474 3300037471 Ga0395905_0031015 Ga0395905_0031015_1024_1485 153
475 3300037471 Ga0395905_0053376 Ga0395905_0053376_1850_2311 153
476 3300037471 Ga0395905_0057214 Ga0395905_0057214_690_1151 153
477 3300037471 Ga0395905_0193828 Ga0395905_0193828_755_1216 153
478 3300037471 Ga0395905_0287733 Ga0395905_0287733_791_1252 153
479 3300037471 Ga0395905_0294247 Ga0395905_0294247_653_1114 153
480 3300037471 Ga0395905_0310813 Ga0395905_0310813_96_557 153
481 3300037471 Ga0395905_0396107 Ga0395905_0396107_275_736 153
482 3300037471 Ga0395905_0670827 Ga0395905_0670827_62_523 153
483 3300037471 Ga0395905_0836201 Ga0395905_0836201_96_557 153
484 3300038443 Ga0395901_0010738 Ga0395901_0010738_1411_1872 153
485 3300038443 Ga0395901_0011872 Ga0395901_0011872_1668_2129 153
486 3300038443 Ga0395901_0173259 Ga0395901_0173259_1504_2001 153
487 3300038443 Ga0395901_0271979 Ga0395901_0271979_130_591 153
488 3300038443 Ga0395901_0300704 Ga0395901_0300704_511_972 153
489 3300038443 Ga0395901_0440581 Ga0395901_0440581_545_1006 153
490 3300038443 Ga0395901_0468286 Ga0395901_0468286_452_913 153
491 3300038443 Ga0395901_0521168 Ga0395901_0521168_66_527 153
492 3300038443 Ga0395901_1006920 Ga0395901_1006920_82_543 153
493 3300039437 Ga0436365_1054374 Ga0436365_1054374_645_1106 153
494 3300041404 Ga0439436_0003483 Ga0439436_0003483_1902_2369 153
495 3300041404 Ga0439436_0055151 Ga0439436_0055151_566_1033 153
496 3300041406 Ga0439439_0006576 Ga0439439_0006576_1447_1914 153
497 3300041407 Ga0439447_019635 Ga0439447_019635_801_1268 153
498 3300041410 Ga0439461_0000178 Ga0439461_0000178_4358_4825 153
499 3300041410 Ga0439461_0014873 Ga0439461_0014873_67_534 153
500 3300041411 Ga0439466_0130849 Ga0439466_0130849_80_547 153
501 3300041413 Ga0439465_0009623 Ga0439465_0009623_244_711 153
502 3300041413 Ga0439465_0030423 Ga0439465_0030423_58_525 153
503 3300041498 Ga0451841_0580323 Ga0451841_0580323_184_651 153
504 3300041997 Ga0439431_0000015 Ga0439431_0000015_15283_15750 153
505 3300041997 Ga0439431_0004975 Ga0439431_0004975_582_1049 153
506 3300042002 Ga0439442_001570 Ga0439442_001570_971_1438 153
507 3300042002 Ga0439442_008630 Ga0439442_008630_412_879 153
508 3300042004 Ga0439445_0003451 Ga0439445_0003451_741_1208 153
509 3300042004 Ga0439445_0003697 Ga0439445_0003697_1851_2318 153
510 3300042006 Ga0439432_006574 Ga0439432_006574_1466_1933 153
511 3300042006 Ga0439432_013379 Ga0439432_013379_1331_1798 153
512 3300042010 Ga0439452_028811 Ga0439452_028811_639_1106 153
513 3300042014 Ga0439457_033383 Ga0439457_033383_263_730 153
514 3300042015 Ga0439462_0010019 Ga0439462_0010019_1171_1638 153
515 3300042015 Ga0439462_0010888 Ga0439462_0010888_361_828 153
516 3300042121 Ga0450919_012947 Ga0450919_012947_163_630 153
517 3300042122 Ga0450920_035414 Ga0450920_035414_26_493 153
518 3300042125 Ga0450923_066810 Ga0450923_066810_192_653 153
519 3300042131 Ga0450894_030654 Ga0450894_030654_118_585 153
520 3300042142 Ga0450905_000807 Ga0450905_000807_589_1050 153
521 3300042144 Ga0450889_000518 Ga0450889_000518_3643_4104 153
522 3300042147 Ga0450910_047813 Ga0450910_047813_198_665 153
523 3300042156 Ga0439446_0006326 Ga0439446_0006326_99_566 153
524 3300042184 Ga0450908_028476 Ga0450908_028476_67_534 153
525 3300042185 Ga0450909_005358 Ga0450909_005358_668_1135 153
526 3300042435 Ga0439434_0002354 Ga0439434_0002354_4364_4831 153
527 3300042435 Ga0439434_0005342 Ga0439434_0005342_1567_2034 153
528 3300044656 Ga0466969_0253822 Ga0466969_0253822_34_495 153
529 3300044658 Ga0466972_0054673 Ga0466972_0054673_1298_1759 153
530 3300044658 Ga0466972_0054969 Ga0466972_0054969_686_1147 153
531 3300044658 Ga0466972_0096323 Ga0466972_0096323_847_1308 153
532 3300044683 Ga0466965_0202783 Ga0466965_0202783_322_783 153
533 3300044683 Ga0466965_0684844 Ga0466965_0684844_98_559 153
534 3300044684 Ga0466966_0047420 Ga0466966_0047420_1327_1788 153
535 3300044684 Ga0466966_0490891 Ga0466966_0490891_226_687 153
536 3300044684 Ga0466966_0538916 Ga0466966_0538916_18_479 153
537 3300044684 Ga0466966_0910100 Ga0466966_0910100_20_481 153
538 3300044693 Ga0466961_0353616 Ga0466961_0353616_23_484 153
539 3300044694 Ga0466963_0062599 Ga0466963_0062599_53_514 153
540 3300044694 Ga0466963_0280400 Ga0466963_0280400_146_607 153
541 3300044694 Ga0466963_0461350 Ga0466963_0461350_421_882 153
542 3300044719 Ga0466971_0025809 Ga0466971_0025809_1096_1557 153
543 3300044719 Ga0466971_0040567 Ga0466971_0040567_1516_1977 153
544 3300044719 Ga0466971_0209539 Ga0466971_0209539_73_534 153
545 3300044735 Ga0466968_0239433 Ga0466968_0239433_177_638 153
546 3300044842 Ga0466957_0002469 Ga0466957_0002469_2170_2631 153
547 3300044842 Ga0466957_0060558 Ga0466957_0060558_73_534 153
548 3300044901 Ga0466960_0021758 Ga0466960_0021758_1641_2102 153
549 3300045049 Ga0466959_0296613 Ga0466959_0296613_124_585 153
550 3300045836 Ga0466958_0000506 Ga0466958_0000506_9627_10088 153
551 3300045836 Ga0466958_0240527 Ga0466958_0240527_410_871 153
552 3300045836 Ga0466958_0588751 Ga0466958_0588751_92_553 153
553 3300045976 Ga0466967_0021699 Ga0466967_0021699_1044_1505 153
554 3300045976 Ga0466967_0072671 Ga0466967_0072671_1816_2277 153
555 3300045976 Ga0466967_0118471 Ga0466967_0118471_1211_1672 153
556 3300045976 Ga0466967_0196153 Ga0466967_0196153_1365_1826 153
557 3300045976 Ga0466967_0359547 Ga0466967_0359547_486_947 153
558 3300045976 Ga0466967_0402299 Ga0466967_0402299_264_725 153
559 3300045976 Ga0466967_0449707 Ga0466967_0449707_694_1155 153
560 3300045976 Ga0466967_1591370 Ga0466967_1591370_158_619 153
561 3300045976 Ga0466967_1844498 Ga0466967_1844498_62_523 153
562 3300045976 Ga0466967_2108633 Ga0466967_2108633_56_517 153
563 3300045976 Ga0466967_2218823 Ga0466967_2218823_14_475 153
564 3300045976 Ga0466967_2255187 Ga0466967_2255187_19_498 153
565 3300046460 Ga0495638_0000207 Ga0495638_0000207_68646_69113 153
566 3300046474 Ga0495605_0174557 Ga0495605_0174557_80_541 153
567 3300046492 Ga0495585_0033580 Ga0495585_0033580_2357_2824 153
568 3300046506 Ga0495583_0004661 Ga0495583_0004661_8331_8798 153
569 3300046507 Ga0495606_0081466 Ga0495606_0081466_332_799 153
570 3300046507 Ga0495606_0455880 Ga0495606_0455880_86_547 153
571 3300046512 Ga0495610_0263897 Ga0495610_0263897_28_489 153
572 3300046522 Ga0495643_0200499 Ga0495643_0200499_48_509 153
573 3300046529 Ga0495652_0484320 Ga0495652_0484320_335_802 153
574 3300046530 Ga0495654_0077426 Ga0495654_0077426_85_552 153
575 3300046616 Ga0495668_0176176 Ga0495668_0176176_188_670 153
576 3300046660 Ga0495625_0003111 Ga0495625_0003111_10748_11215 153
577 3300046660 Ga0495625_0164006 Ga0495625_0164006_425_892 153
578 3300046679 Ga0495623_0034060 Ga0495623_0034060_1918_2379 153
579 3300046684 Ga0495669_0002918 Ga0495669_0002918_5676_6137 153
580 3300046684 Ga0495669_0105850 Ga0495669_0105850_310_771 153
581 3300046684 Ga0495669_0211987 Ga0495669_0211987_378_839 153
582 3300046691 Ga0495670_0090704 Ga0495670_0090704_947_1408 153
583 3300046692 Ga0495671_0008914 Ga0495671_0008914_2544_3026 153
584 3300047443 Ga0495687_121374 Ga0495687_121374_140_607 153
585 3300047445 Ga0495677_0007182 Ga0495677_0007182_1738_2205 153
586 3300047447 Ga0495685_123399 Ga0495685_123399_92_553 153
587 3300047472 Ga0495686_0211929 Ga0495686_0211929_68_535 153
588 3300048088 Ga0495602_0064575 Ga0495602_0064575_2180_2641 153
589 3300048903 Ga0496100_0648349 Ga0496100_0648349_214_675 153
590 3300048904 Ga0496101_0179780 Ga0496101_0179780_992_1453 153
591 3300048904 Ga0496101_0679483 Ga0496101_0679483_119_580 153
592 3300048909 Ga0496106_0077572 Ga0496106_0077572_1892_2353 153
593 3300048910 Ga0496107_0024108 Ga0496107_0024108_1879_2340 153
594 3300048910 Ga0496107_0385240 Ga0496107_0385240_142_603 153
595 3300048911 Ga0496108_0264936 Ga0496108_0264936_860_1321 153
596 3300048912 Ga0496109_0027277 Ga0496109_0027277_186_647 153
597 3300048912 Ga0496109_0793114 Ga0496109_0793114_316_777 153
598 3300048913 Ga0496110_0078443 Ga0496110_0078443_237_698 153
599 3300048913 Ga0496110_1216993 Ga0496110_1216993_131_592 153
600 3300048914 Ga0496111_0003794 Ga0496111_0003794_5800_6261 153
601 3300048914 Ga0496111_0556205 Ga0496111_0556205_31_492 153
602 3300048914 Ga0496111_1301184 Ga0496111_1301184_25_486 153
603 3300048915 Ga0496112_0009881 Ga0496112_0009881_340_801 153
604 3300048915 Ga0496112_0084606 Ga0496112_0084606_1729_2190 153
605 3300048915 Ga0496112_1108622 Ga0496112_1108622_74_535 153
606 3300048916 Ga0496113_0008196 Ga0496113_0008196_2685_3146 153
607 3300048916 Ga0496113_0216587 Ga0496113_0216587_67_528 153
608 3300048916 Ga0496113_0508911 Ga0496113_0508911_302_763 153
609 3300048924 Ga0496121_0046213 Ga0496121_0046213_366_848 153
610 3300048925 Ga0496122_0330217 Ga0496122_0330217_109_576 153
611 3300049571 Ga0501034_0180614 Ga0501034_0180614_294_761 153
612 3300049580 Ga0501046_0567953 Ga0501046_0567953_249_716 153
613 3300049581 Ga0501047_0072301 Ga0501047_0072301_1743_2222 153
614 3300049586 Ga0501070_0076252 Ga0501070_0076252_1225_1686 153
615 3300049664 Ga0501224_000007 Ga0501224_000007_9293_9769 153
616 3300049668 Ga0501233_000599 Ga0501233_000599_616_1092 153
617 3300049705 Ga0501225_0000055 Ga0501225_0000055_29140_29616 153
618 3300049707 Ga0501234_000955 Ga0501234_000955_2848_3324 153
619 3300049758 Ga0501241_083320 Ga0501241_083320_175_657 153
620 3300049822 Ga0501035_0278680 Ga0501035_0278680_10_492 153
621 3300049853 Ga0501226_000025 Ga0501226_000025_81423_81899 153
622 3300050489 nmdc:mga03683_34509_c1 nmdc:mga03683_34509_c1_529_996 153
623 3300050496 nmdc:mga07m45_25838_c1 nmdc:mga07m45_25838_c1_2510_2971 153
624 3300050507 nmdc:mga05p37_243419_c1 nmdc:mga05p37_243419_c1_246_707 153
625 3300050511 nmdc:mga08y16_61453_c1 nmdc:mga08y16_61453_c1_1387_1848 153
626 3300050516 nmdc:mga0sz30_65946_c1 nmdc:mga0sz30_65946_c1_809_1276 153
627 3300053078 Ga0495612_0056875 Ga0495612_0056875_681_1142 153
628 3300053087 Ga0500643_000904 Ga0500643_000904_6094_6561 153
629 3300053094 Ga0500566_0000285 Ga0500566_0000285_23964_24455 153
630 3300053118 Ga0500594_0001763 Ga0500594_0001763_736_1203 153
631 3300053119 Ga0500595_010229 Ga0500595_010229_1590_2111 153
632 3300053122 Ga0500608_000327 Ga0500608_000327_4812_5279 153
633 3300053122 Ga0500608_033290 Ga0500608_033290_689_1153 153
634 3300053130 Ga0500642_0000002 Ga0500642_0000002_678833_679297 153
635 3300053134 Ga0500658_0000662 Ga0500658_0000662_3309_3776 153
636 3300053136 Ga0500559_0003325 Ga0500559_0003325_6914_7381 153
637 3300053136 Ga0500559_0035376 Ga0500559_0035376_1648_2115 153
638 3300053138 Ga0500564_000959 Ga0500564_000959_6309_6776 153
639 3300053140 Ga0500573_0002298 Ga0500573_0002298_2515_2982 153
640 3300053140 Ga0500573_0177095 Ga0500573_0177095_416_883 153
641 3300053151 Ga0500604_0140797 Ga0500604_0140797_190_651 153
642 3300053156 Ga0500622_0197561 Ga0500622_0197561_192_656 153
643 3300053723 Ga0500567_001496 Ga0500567_001496_8776_9243 153
644 3300053729 Ga0500625_000001 Ga0500625_000001_220811_221278 153
645 3300053730 Ga0500645_000064 Ga0500645_000064_75401_75883 153
646 3300061719 Ga0466962_0038732 Ga0466962_0038732_784_1245 153
647 3300003187 JGI25151J46595_10088405 JGI25151J46595_100884052 154
648 3300003781 Ga0055536_1003969 Ga0055536_10039696 154
649 3300003781 Ga0055536_1006424 Ga0055536_10064247 154
650 3300003781 Ga0055536_1015396 Ga0055536_10153962 154
651 3300003784 Ga0055534_1019585 Ga0055534_10195852 154
652 3300003791 Ga0055530_10000115 Ga0055530_1000011542 154
653 3300003794 Ga0055531_10006063 Ga0055531_100060632 154
654 3300003794 Ga0055531_10006683 Ga0055531_100066832 154
655 3300005445 Ga0070708_100141656 Ga0070708_1001416564 154
656 3300005617 Ga0068859_100481698 Ga0068859_1004816982 154
657 3300006042 Ga0075368_10116970 Ga0075368_101169701 154
658 3300006931 Ga0097620_100481677 Ga0097620_1004816772 154
659 3300009093 Ga0105240_10929977 Ga0105240_109299772 154
660 3300009545 Ga0105237_10216772 Ga0105237_102167722 154
661 3300013307 Ga0157372_11871339 Ga0157372_118713391 154
662 3300021388 Ga0213875_10005097 Ga0213875_100050973 154
663 3300025291 Ga0209675_1000104 Ga0209675_100010492 154
664 3300025292 Ga0209676_1000807 Ga0209676_10008079 154
665 3300025292 Ga0209676_1001060 Ga0209676_10010609 154
666 3300025292 Ga0209676_1001199 Ga0209676_100119912 154
667 3300025292 Ga0209676_1044912 Ga0209676_10449122 154
668 3300025294 Ga0209025_1006362 Ga0209025_10063622 154
669 3300025298 Ga0209050_1000286 Ga0209050_100028625 154
670 3300025298 Ga0209050_1004981 Ga0209050_10049814 154
671 3300025298 Ga0209050_1072435 Ga0209050_10724351 154
672 3300025304 Ga0209257_1000245 Ga0209257_100024521 154
673 3300025304 Ga0209257_1000321 Ga0209257_100032167 154
674 3300025304 Ga0209257_1001354 Ga0209257_100135421 154
675 3300025304 Ga0209257_1014820 Ga0209257_10148204 154
676 3300025913 Ga0207695_10660640 Ga0207695_106606402 154
677 3300025914 Ga0207671_10081045 Ga0207671_100810453 154
678 3300025923 Ga0207681_10190284 Ga0207681_101902843 154
679 3300025931 Ga0207644_11753146 Ga0207644_117531461 154
680 3300031731 Ga0307405_11004197 Ga0307405_110041972 154
681 3300031824 Ga0307413_10460217 Ga0307413_104602172 154
682 3300031901 Ga0307406_10025518 Ga0307406_100255185 154
683 3300031901 Ga0307406_10135661 Ga0307406_101356612 154
684 3300031901 Ga0307406_10214331 Ga0307406_102143312 154
685 3300031911 Ga0307412_10002668 Ga0307412_100026685 154
686 3300031911 Ga0307412_10042785 Ga0307412_100427853 154
687 3300031911 Ga0307412_10095174 Ga0307412_100951744 154
688 3300032004 Ga0307414_10001684 Ga0307414_100016847 154
689 3300032004 Ga0307414_10001894 Ga0307414_100018944 154
690 3300032004 Ga0307414_10002573 Ga0307414_100025732 154
691 3300032004 Ga0307414_10046896 Ga0307414_100468964 154
692 3300032004 Ga0307414_10115705 Ga0307414_101157052 154
693 3300032004 Ga0307414_10133282 Ga0307414_101332822 154
694 3300032004 Ga0307414_10159311 Ga0307414_101593112 154
695 3300032004 Ga0307414_10365512 Ga0307414_103655122 154
696 3300032004 Ga0307414_10393190 Ga0307414_103931902 154
697 3300037853 Ga0436364_1172297 Ga0436364_1172297_13431_13910 154
698 3300039437 Ga0436365_1325832 Ga0436365_1325832_720_1199 154
699 3300041460 Ga0451802_0494763 Ga0451802_0494763_390_875 154
700 3300041494 Ga0451837_0848718 Ga0451837_0848718_31_516 154
701 3300046522 Ga0495643_0039984 Ga0495643_0039984_2058_2522 154
702 3300046530 Ga0495654_0059377 Ga0495654_0059377_139_603 154
703 3300046616 Ga0495668_0000004 Ga0495668_0000004_36875_37339 154
704 3300046660 Ga0495625_0001182 Ga0495625_0001182_8933_9397 154
705 3300046660 Ga0495625_0068441 Ga0495625_0068441_930_1394 154
706 3300048905 Ga0496102_0000481 Ga0496102_0000481_10812_11276 154
707 3300048906 Ga0496103_0000347 Ga0496103_0000347_10584_11048 154
708 3300048918 Ga0496115_0000534 Ga0496115_0000534_11829_12308 154
709 3300048919 Ga0496116_0002244 Ga0496116_0002244_8448_8912 154
710 3300048920 Ga0496117_0001149 Ga0496117_0001149_29023_29487 154
711 3300048921 Ga0496118_0001071 Ga0496118_0001071_14020_14484 154
712 3300048922 Ga0496119_0017078 Ga0496119_0017078_2070_2534 154
713 3300048923 Ga0496120_0023307 Ga0496120_0023307_2657_3121 154
714 3300048927 Ga0496124_0000996 Ga0496124_0000996_33613_34077 154
715 3300048928 Ga0496125_0091212 Ga0496125_0091212_661_1125 154
716 3300048929 Ga0496126_0140950 Ga0496126_0140950_519_989 154
717 3300049568 Ga0501031_0020490 Ga0501031_0020490_3590_4057 154
718 3300049569 Ga0501032_0167496 Ga0501032_0167496_147_614 154
719 3300049571 Ga0501034_0051979 Ga0501034_0051979_3199_3666 154
720 3300049571 Ga0501034_0255901 Ga0501034_0255901_838_1302 154
721 3300049571 Ga0501034_1698074 Ga0501034_1698074_28_492 154
722 3300049572 Ga0501036_0021382 Ga0501036_0021382_228_695 154
723 3300049574 Ga0501038_0275900 Ga0501038_0275900_296_763 154
724 3300049579 Ga0501043_0074501 Ga0501043_0074501_1744_2211 154
725 3300049580 Ga0501046_0248288 Ga0501046_0248288_236_703 154
726 3300049581 Ga0501047_0039638 Ga0501047_0039638_3528_3995 154
727 3300049582 Ga0501048_0074744 Ga0501048_0074744_1687_2154 154
728 3300049822 Ga0501035_0012295 Ga0501035_0012295_5379_5846 154
729 3300049823 Ga0501044_0203278 Ga0501044_0203278_74_643 154
730 3300049824 Ga0501045_0866897 Ga0501045_0866897_53_520 154
731 3300050495 nmdc:mga04h51_117222_c1 nmdc:mga04h51_117222_c1_408_872 154
732 3300053091 Ga0500647_0070056 Ga0500647_0070056_396_860 154
733 3300053093 Ga0500651_0220937 Ga0500651_0220937_236_700 154
734 3300053119 Ga0500595_004422 Ga0500595_004422_1427_1897 154
735 3300053125 Ga0500618_014525 Ga0500618_014525_1241_1705 154
736 3300053133 Ga0500655_012842 Ga0500655_012842_537_1001 154
737 3300053134 Ga0500658_0033119 Ga0500658_0033119_1041_1505 154
738 3300053139 Ga0500568_0004150 Ga0500568_0004150_1449_1913 154
739 3300053158 Ga0500627_0000009 Ga0500627_0000009_109164_109628 154
740 3300053158 Ga0500627_0094683 Ga0500627_0094683_639_1103 154
741 3300053177 Ga0500636_0040341 Ga0500636_0040341_1234_1698 154
742 3300053735 Ga0500596_006952 Ga0500596_006952_1279_1743 154
743 2162886007 SwRhRL2b_contig_2687397 SwRhRL2b_0287.00007510 155
744 3300001976 JGI24752J21851_1001224 JGI24752J21851_10012243 155
745 3300001989 JGI24739J22299_10002936 JGI24739J22299_100029363 155
746 3300001990 JGI24737J22298_10007810 JGI24737J22298_100078102 155
747 3300002075 JGI24738J21930_10003430 JGI24738J21930_100034307 155
748 3300005289 Ga0065704_10074901 Ga0065704_100749017 155
749 3300005295 Ga0065707_10081882 Ga0065707_1008188232 155
750 3300005331 Ga0070670_100000030 Ga0070670_10000003073 155
751 3300005367 Ga0070667_100000161 Ga0070667_10000016185 155
752 3300005457 Ga0070662_100016573 Ga0070662_1000165732 155
753 3300005539 Ga0068853_100012834 Ga0068853_1000128343 155
754 3300005539 Ga0068853_100067073 Ga0068853_1000670732 155
755 3300005548 Ga0070665_100359322 Ga0070665_1003593222 155
756 3300005577 Ga0068857_100041693 Ga0068857_1000416938 155
757 3300005578 Ga0068854_100055677 Ga0068854_1000556773 155
758 3300005617 Ga0068859_100213296 Ga0068859_1002132963 155
759 3300005618 Ga0068864_100000041 Ga0068864_10000004173 155
760 3300005841 Ga0068863_100000035 Ga0068863_10000003573 155
761 3300005842 Ga0068858_100575641 Ga0068858_1005756412 155
762 3300005844 Ga0068862_100000042 Ga0068862_100000042102 155
763 3300005937 Ga0081455_10000405 Ga0081455_1000040510 155
764 3300006931 Ga0097620_100213276 Ga0097620_1002132763 155
765 3300009101 Ga0105247_10038819 Ga0105247_100388192 155
766 3300009177 Ga0105248_10000045 Ga0105248_1000004571 155
767 3300009551 Ga0105238_10035938 Ga0105238_100359382 155
768 3300009553 Ga0105249_10000055 Ga0105249_10000055101 155
769 3300013297 Ga0157378_10037607 Ga0157378_100376073 155
770 3300013306 Ga0163162_10010728 Ga0163162_1001072811 155
771 3300014325 Ga0163163_10257193 Ga0163163_102571932 155
772 3300014326 Ga0157380_10007873 Ga0157380_100078736 155
773 3300014968 Ga0157379_10021517 Ga0157379_100215173 155
774 3300025900 Ga0207710_10135767 Ga0207710_101357671 155
775 3300025904 Ga0207647_10028509 Ga0207647_100285095 155
776 3300025925 Ga0207650_10000111 Ga0207650_1000011113 155
777 3300025933 Ga0207706_10015487 Ga0207706_100154873 155
778 3300025941 Ga0207711_10000027 Ga0207711_10000027166 155
779 3300025961 Ga0207712_10000813 Ga0207712_1000081311 155
780 3300025981 Ga0207640_10111478 Ga0207640_101114783 155
781 3300025986 Ga0207658_10000839 Ga0207658_1000083910 155
782 3300026041 Ga0207639_10110813 Ga0207639_101108133 155
783 3300026088 Ga0207641_10000041 Ga0207641_1000004172 155
784 3300026095 Ga0207676_10000039 Ga0207676_10000039105 155
785 3300026116 Ga0207674_10005772 Ga0207674_100057729 155
786 3300028380 Ga0268265_10000061 Ga0268265_1000006180 155
787 3300031548 Ga0307408_100058897 Ga0307408_1000588973 155
788 3300031731 Ga0307405_10101755 Ga0307405_101017553 155
789 3300031901 Ga0307406_10189804 Ga0307406_101898042 155
790 3300031995 Ga0307409_100277372 Ga0307409_1002773722 155
791 3300032002 Ga0307416_100032603 Ga0307416_1000326032 155
792 3300041459 Ga0451800_1680169 Ga0451800_1680169_85_552 155
793 3300046525 Ga0495663_0107436 Ga0495663_0107436_113_580 155
794 3300046530 Ga0495654_0077322 Ga0495654_0077322_848_1315 155
795 3300046530 Ga0495654_0096319 Ga0495654_0096319_570_1037 155
796 3300046616 Ga0495668_0006873 Ga0495668_0006873_4375_4842 155
797 3300046616 Ga0495668_0040848 Ga0495668_0040848_818_1285 155
798 3300046660 Ga0495625_0320073 Ga0495625_0320073_131_598 155
799 3300047447 Ga0495685_071854 Ga0495685_071854_278_745 155
800 3300048091 Ga0495626_0193598 Ga0495626_0193598_22_489 155
801 3300048904 Ga0496101_0075810 Ga0496101_0075810_212_679 155
802 3300048906 Ga0496103_0141373 Ga0496103_0141373_1060_1527 155
803 3300048920 Ga0496117_0002571 Ga0496117_0002571_10241_10708 155
804 3300048921 Ga0496118_0000493 Ga0496118_0000493_7090_7557 155
805 3300048924 Ga0496121_0338970 Ga0496121_0338970_414_881 155
806 3300049459 Ga0495678_141173 Ga0495678_141173_64_531 155
807 3300053087 Ga0500643_000293 Ga0500643_000293_19541_20008 155
808 3300053116 Ga0500592_000213 Ga0500592_000213_5195_5662 155
809 3300053116 Ga0500592_031987 Ga0500592_031987_156_623 155
810 3300053158 Ga0500627_0057845 Ga0500627_0057845_819_1286 155
811 3300053158 Ga0500627_0241872 Ga0500627_0241872_322_789 155
812 3300053727 Ga0500611_133902 Ga0500611_133902_59_526 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14588

YjgF_endoribonc

YjgF/chorismate_mutase-like, putative endoribonuclease

24

169

0.95

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

10

170

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d01-assembly1.cif.gz_K error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9751 3 154
3d01-assembly2.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9723 3 153
3d01-assembly3.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9721 3 153
3d01-assembly4.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9656 3 154
3d01-assembly1.cif.gz_I error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9634 3 153
ID Description Score Start End Superfamily
af_A4I058_2_156_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.977 3 153 3.30.1330.40
3d01E00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9633 3 153 3.30.1330.40
af_I6YGW9_1_150_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9481 1 152 3.30.1330.40
af_I6YGW9_1_150_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9421 1 152 3.30.1330.40
2otmC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.936 1 152 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A4Q3I1J2-F1-model_v4 deleted 0.9971 58 153
AF-A0A4Q3AEF4-F1-model_v4 RidA family protein 0.9964 18 153
AF-A0A847ZXD2-F1-model_v4 RidA family protein 0.9963 58 153
AF-A0A2A4UHN9-F1-model_v4 Endoribonuclease L-PSP/chorismate mutase-like domain-containing protein 0.9963 65 153
AF-A0A6L8G997-F1-model_v4 RidA family protein 0.996 35 153

Feature Viewer

pLDDT pTM Quality
97.01 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map