F481908
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 812 | 366 | 796 | 154 |
Family's Representative Sequence
| Representative Sequence | 3300053119|Ga0500595_010229|Ga0500595_010229_1590_2111 |
| Length | 173 |
| Sequence | MKASALTGSALTEEKAYLMADRVDSKLAELGLTLPAPAAPVASYVPTVEAGGLLHVSGQLPFKDGAVMTGRLGADANLAYGQEAAQRCALMLVAQIKAALGGLHRVERIVKLGVFVNSAPGFTDQPKVANGASDLMFALFGDAGRHARSAVGVSALPLGAAVEVDAIIQIAMH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 3 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 4 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 5 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 6 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 7 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 8 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 9 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 10 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 11 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 12 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 13 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 14 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 15 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 16 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 17 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 18 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 19 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 20 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 21 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 22 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 23 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 24 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 25 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 26 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 27 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 28 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 115 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 175 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 176 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 177 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 178 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 191 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 192 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 201 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 202 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 203 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 204 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 205 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 206 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 210 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 211 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 212 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 213 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 214 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 215 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 218 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 219 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 220 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 221 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 222 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 223 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 224 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 225 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 226 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 227 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 228 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 229 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 230 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 231 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 232 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 233 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 234 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 235 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 236 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 237 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 238 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 239 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 240 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 241 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 242 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 243 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 244 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 245 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 246 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 247 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 248 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 249 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 250 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 286 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 289 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 290 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 291 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 292 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 293 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 294 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 295 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 296 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 297 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 298 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 299 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 300 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 301 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 302 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 303 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 304 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 317 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 318 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 319 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 320 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 321 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 325 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 326 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 327 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 328 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 332 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 335 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 336 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 337 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 338 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 339 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 340 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 341 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 342 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 343 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 344 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 345 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 347 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 348 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 349 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 350 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 351 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 352 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 353 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 354 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 355 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 356 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 357 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 358 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 360 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 361 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 362 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 363 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 364 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 365 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 366 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.66 |
| Metatranscriptomes | 0.37 |
| Isolates | 1.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.62 |
| Bulb | 0 |
| Endosphere | 12.19 |
| Nodule | 0 |
| Rhizoplane | 3.57 |
| Rhizosphere | 78.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2687397 | 2162886007 | Bacteria | 1122 |
| 2 | ARcpr5oldR_c001506 | 3300000041 | Bacteria | 2339 |
| 3 | JGI24752J21851_1001224 | 3300001976 | Bacteria | 3494 |
| 4 | JGI24740J21852_10025651 | 3300001979 | Bacteria | 1984 |
| 5 | JGI24739J22299_10000524 | 3300001989 | Bacteria | 13667 |
| 6 | JGI24739J22299_10002936 | 3300001989 | Bacteria | 6534 |
| 7 | JGI24739J22299_10013165 | 3300001989 | Bacteria | 3026 |
| 8 | JGI24737J22298_10007810 | 3300001990 | Bacteria | 3606 |
| 9 | JGI24735J21928_10003268 | 3300002067 | Bacteria | 5544 |
| 10 | JGI24735J21928_10019703 | 3300002067 | Bacteria | 2072 |
| 11 | JGI24735J21928_10109069 | 3300002067 | Bacteria | 796 |
| 12 | JGI24748J21848_1019863 | 3300002074 | Bacteria | 808 |
| 13 | JGI24738J21930_10003430 | 3300002075 | Bacteria | 3999 |
| 14 | JGI24738J21930_10003879 | 3300002075 | Bacteria | 3732 |
| 15 | JGI25151J46595_10088405 | 3300003187 | Bacteria | 871 |
| 16 | JGI25165J46597_1000010 | 3300003214 | Bacteria | 442113 |
| 17 | JGI25153J46596_10006448 | 3300003215 | Bacteria | 5922 |
| 18 | Ga0055537_1000460 | 3300003773 | Bacteria | 25614 |
| 19 | Ga0055524_1000155 | 3300003775 | Bacteria | 79672 |
| 20 | Ga0055536_1003969 | 3300003781 | Bacteria | 7746 |
| 21 | Ga0055536_1006424 | 3300003781 | Bacteria | 5495 |
| 22 | Ga0055536_1015396 | 3300003781 | Bacteria | 2621 |
| 23 | Ga0055534_1019585 | 3300003784 | Bacteria | 1158 |
| 24 | Ga0055530_10000115 | 3300003791 | Bacteria | 70229 |
| 25 | Ga0055530_10001208 | 3300003791 | Bacteria | 19993 |
| 26 | Ga0055530_10008781 | 3300003791 | Bacteria | 3991 |
| 27 | Ga0055531_10000792 | 3300003794 | Bacteria | 26275 |
| 28 | Ga0055531_10002671 | 3300003794 | Bacteria | 11762 |
| 29 | Ga0055531_10006063 | 3300003794 | Bacteria | 6926 |
| 30 | Ga0055531_10006683 | 3300003794 | Bacteria | 6467 |
| 31 | Ga0065165_1007583 | 3300005262 | Bacteria | 5287 |
| 32 | Ga0065165_1018077 | 3300005262 | Bacteria | 2569 |
| 33 | Ga0065165_1041615 | 3300005262 | Bacteria | 1363 |
| 34 | Ga0065704_10074901 | 3300005289 | Bacteria | 5927 |
| 35 | Ga0065707_10081882 | 3300005295 | Bacteria | 31785 |
| 36 | Ga0070658_10000003 | 3300005327 | Bacteria | 465963 |
| 37 | Ga0070658_10021495 | 3300005327 | Bacteria | 5171 |
| 38 | Ga0070658_10030316 | 3300005327 | Bacteria | 4346 |
| 39 | Ga0070658_10033779 | 3300005327 | Bacteria | 4116 |
| 40 | Ga0070658_10054034 | 3300005327 | Bacteria | 3261 |
| 41 | Ga0070658_10166424 | 3300005327 | Bacteria | 1851 |
| 42 | Ga0070683_100559908 | 3300005329 | Bacteria | 1093 |
| 43 | Ga0070670_100000030 | 3300005331 | Bacteria | 164211 |
| 44 | Ga0070670_100746266 | 3300005331 | Bacteria | 882 |
| 45 | Ga0070670_101154386 | 3300005331 | Bacteria | 707 |
| 46 | Ga0070680_100025459 | 3300005336 | Bacteria | 4730 |
| 47 | Ga0070680_100034426 | 3300005336 | Bacteria | 4083 |
| 48 | Ga0070680_100104058 | 3300005336 | Bacteria | 2359 |
| 49 | Ga0070680_100837885 | 3300005336 | Bacteria | 793 |
| 50 | Ga0070682_100579292 | 3300005337 | Bacteria | 883 |
| 51 | Ga0068868_100565982 | 3300005338 | Bacteria | 1003 |
| 52 | Ga0070660_100057997 | 3300005339 | Bacteria | 3001 |
| 53 | Ga0070660_100059329 | 3300005339 | Bacteria | 2967 |
| 54 | Ga0070660_100088967 | 3300005339 | Bacteria | 2432 |
| 55 | Ga0070660_100107890 | 3300005339 | Bacteria | 2213 |
| 56 | Ga0070660_100397916 | 3300005339 | Bacteria | 1139 |
| 57 | Ga0070660_100408703 | 3300005339 | Bacteria | 1123 |
| 58 | Ga0070661_100139342 | 3300005344 | Bacteria | 1827 |
| 59 | Ga0070661_100267307 | 3300005344 | Bacteria | 1323 |
| 60 | Ga0070661_100585399 | 3300005344 | Bacteria | 901 |
| 61 | Ga0070692_10000142 | 3300005345 | Bacteria | 17361 |
| 62 | Ga0070692_10159865 | 3300005345 | Bacteria | 1290 |
| 63 | Ga0070668_100000011 | 3300005347 | Bacteria | 123099 |
| 64 | Ga0070671_100003480 | 3300005355 | Bacteria | 12284 |
| 65 | Ga0070671_100093078 | 3300005355 | Bacteria | 2526 |
| 66 | Ga0070671_100671018 | 3300005355 | Bacteria | 898 |
| 67 | Ga0070673_100015570 | 3300005364 | Bacteria | 5348 |
| 68 | Ga0070673_100828271 | 3300005364 | Bacteria | 856 |
| 69 | Ga0070659_100003069 | 3300005366 | Bacteria | 11859 |
| 70 | Ga0070659_100021627 | 3300005366 | Bacteria | 4902 |
| 71 | Ga0070659_100090402 | 3300005366 | Bacteria | 2453 |
| 72 | Ga0070659_100157669 | 3300005366 | Bacteria | 1854 |
| 73 | Ga0070659_100202257 | 3300005366 | Bacteria | 1635 |
| 74 | Ga0070667_100000161 | 3300005367 | Bacteria | 83551 |
| 75 | Ga0070667_100383351 | 3300005367 | Bacteria | 1277 |
| 76 | Ga0070714_100263657 | 3300005435 | Bacteria | 1596 |
| 77 | Ga0070714_100556978 | 3300005435 | Bacteria | 1098 |
| 78 | Ga0070708_100141656 | 3300005445 | Bacteria | 2230 |
| 79 | Ga0070663_100003059 | 3300005455 | Bacteria | 9565 |
| 80 | Ga0070663_100044176 | 3300005455 | Bacteria | 3140 |
| 81 | Ga0070663_100050017 | 3300005455 | Bacteria | 2971 |
| 82 | Ga0070662_100016573 | 3300005457 | Bacteria | 4949 |
| 83 | Ga0070662_100065006 | 3300005457 | Bacteria | 2673 |
| 84 | Ga0070662_100121909 | 3300005457 | Bacteria | 1999 |
| 85 | Ga0070681_10029494 | 3300005458 | Bacteria | 5510 |
| 86 | Ga0070681_10072402 | 3300005458 | Bacteria | 3409 |
| 87 | Ga0070681_10105457 | 3300005458 | Bacteria | 2760 |
| 88 | Ga0070681_10172151 | 3300005458 | Bacteria | 2087 |
| 89 | Ga0070706_100028793 | 3300005467 | Bacteria | 5116 |
| 90 | Ga0070679_100077764 | 3300005530 | Bacteria | 3307 |
| 91 | Ga0070679_100095520 | 3300005530 | Bacteria | 2960 |
| 92 | Ga0070679_100173758 | 3300005530 | Bacteria | 2127 |
| 93 | Ga0070679_100191645 | 3300005530 | Bacteria | 2013 |
| 94 | Ga0070679_100332936 | 3300005530 | Bacteria | 1467 |
| 95 | Ga0070679_100340828 | 3300005530 | Bacteria | 1447 |
| 96 | Ga0070679_100650877 | 3300005530 | Bacteria | 996 |
| 97 | Ga0070679_100651978 | 3300005530 | Bacteria | 995 |
| 98 | Ga0070684_100329502 | 3300005535 | Bacteria | 1403 |
| 99 | Ga0068853_100012834 | 3300005539 | Bacteria | 6825 |
| 100 | Ga0068853_100054892 | 3300005539 | Bacteria | 3433 |
| 101 | Ga0068853_100067073 | 3300005539 | Bacteria | 3117 |
| 102 | Ga0068853_100072366 | 3300005539 | Bacteria | 3004 |
| 103 | Ga0068853_100220247 | 3300005539 | Bacteria | 1733 |
| 104 | Ga0068853_100247300 | 3300005539 | Bacteria | 1636 |
| 105 | Ga0068853_100642700 | 3300005539 | Bacteria | 1009 |
| 106 | Ga0068853_101379521 | 3300005539 | Bacteria | 681 |
| 107 | Ga0070695_100075268 | 3300005545 | Bacteria | 2220 |
| 108 | Ga0070696_100021044 | 3300005546 | Bacteria | 4420 |
| 109 | Ga0070696_100461594 | 3300005546 | Bacteria | 1004 |
| 110 | Ga0070693_100148555 | 3300005547 | Bacteria | 1482 |
| 111 | Ga0070693_100198996 | 3300005547 | Bacteria | 1300 |
| 112 | Ga0070665_100044221 | 3300005548 | Bacteria | 4472 |
| 113 | Ga0070665_100291629 | 3300005548 | Bacteria | 1634 |
| 114 | Ga0070665_100359322 | 3300005548 | Bacteria | 1462 |
| 115 | Ga0070704_100316459 | 3300005549 | Bacteria | 1306 |
| 116 | Ga0068855_100048687 | 3300005563 | Bacteria | 5001 |
| 117 | Ga0068855_100051070 | 3300005563 | Bacteria | 4871 |
| 118 | Ga0068855_100129913 | 3300005563 | Bacteria | 2877 |
| 119 | Ga0068855_100189877 | 3300005563 | Bacteria | 2318 |
| 120 | Ga0068855_100289358 | 3300005563 | Bacteria | 1817 |
| 121 | Ga0068855_100302634 | 3300005563 | Bacteria | 1770 |
| 122 | Ga0068855_100315793 | 3300005563 | Bacteria | 1728 |
| 123 | Ga0068855_100454337 | 3300005563 | Bacteria | 1397 |
| 124 | Ga0068855_100619267 | 3300005563 | Bacteria | 1166 |
| 125 | Ga0070664_100107856 | 3300005564 | Bacteria | 2428 |
| 126 | Ga0070664_100183721 | 3300005564 | Bacteria | 1860 |
| 127 | Ga0070664_100853026 | 3300005564 | Bacteria | 853 |
| 128 | Ga0070664_101305074 | 3300005564 | Bacteria | 685 |
| 129 | Ga0068857_100041693 | 3300005577 | Bacteria | 4070 |
| 130 | Ga0068857_100094218 | 3300005577 | Bacteria | 2681 |
| 131 | Ga0068857_100142446 | 3300005577 | Bacteria | 2167 |
| 132 | Ga0068857_100276997 | 3300005577 | Bacteria | 1542 |
| 133 | Ga0068854_100000559 | 3300005578 | Bacteria | 22307 |
| 134 | Ga0068854_100026578 | 3300005578 | Bacteria | 3980 |
| 135 | Ga0068854_100039382 | 3300005578 | Bacteria | 3329 |
| 136 | Ga0068854_100055677 | 3300005578 | Bacteria | 2848 |
| 137 | Ga0068854_100417427 | 3300005578 | Bacteria | 1114 |
| 138 | Ga0068854_100527255 | 3300005578 | Bacteria | 998 |
| 139 | Ga0068854_100764096 | 3300005578 | Bacteria | 839 |
| 140 | Ga0068856_100027149 | 3300005614 | Bacteria | 5586 |
| 141 | Ga0068856_100052866 | 3300005614 | Bacteria | 4006 |
| 142 | Ga0068856_100072762 | 3300005614 | Bacteria | 3403 |
| 143 | Ga0068856_100115596 | 3300005614 | Bacteria | 2683 |
| 144 | Ga0068856_100427271 | 3300005614 | Bacteria | 1345 |
| 145 | Ga0068856_101210619 | 3300005614 | Bacteria | 771 |
| 146 | Ga0068852_100032215 | 3300005616 | Bacteria | 4337 |
| 147 | Ga0068852_100047102 | 3300005616 | Bacteria | 3676 |
| 148 | Ga0068852_100048090 | 3300005616 | Bacteria | 3643 |
| 149 | Ga0068852_100058186 | 3300005616 | Bacteria | 3347 |
| 150 | Ga0068852_100073666 | 3300005616 | Bacteria | 3005 |
| 151 | Ga0068852_100814070 | 3300005616 | Bacteria | 948 |
| 152 | Ga0068852_100922176 | 3300005616 | Bacteria | 891 |
| 153 | Ga0068852_101108464 | 3300005616 | Bacteria | 812 |
| 154 | Ga0068859_100032942 | 3300005617 | Bacteria | 5205 |
| 155 | Ga0068859_100213296 | 3300005617 | Bacteria | 2017 |
| 156 | Ga0068859_100481698 | 3300005617 | Bacteria | 1336 |
| 157 | Ga0068864_100000041 | 3300005618 | Bacteria | 165878 |
| 158 | Ga0068864_100018954 | 3300005618 | Bacteria | 5753 |
| 159 | Ga0068861_100772769 | 3300005719 | Bacteria | 899 |
| 160 | Ga0068851_10021086 | 3300005834 | Bacteria | 3161 |
| 161 | Ga0068851_10022086 | 3300005834 | Bacteria | 3096 |
| 162 | Ga0068863_100000035 | 3300005841 | Bacteria | 165877 |
| 163 | Ga0068863_100000186 | 3300005841 | Bacteria | 65963 |
| 164 | Ga0068863_100593238 | 3300005841 | Bacteria | 1096 |
| 165 | Ga0068858_100000102 | 3300005842 | Bacteria | 88959 |
| 166 | Ga0068858_100001966 | 3300005842 | Bacteria | 20993 |
| 167 | Ga0068858_100309087 | 3300005842 | Bacteria | 1509 |
| 168 | Ga0068858_100575641 | 3300005842 | Bacteria | 1091 |
| 169 | Ga0068862_100000042 | 3300005844 | Bacteria | 165084 |
| 170 | Ga0068862_100312956 | 3300005844 | Bacteria | 1447 |
| 171 | Ga0081455_10000405 | 3300005937 | Bacteria | 56782 |
| 172 | Ga0075368_10116970 | 3300006042 | Bacteria | 1102 |
| 173 | Ga0075369_10165462 | 3300006186 | Bacteria | 1014 |
| 174 | Ga0097621_100285331 | 3300006237 | Bacteria | 1454 |
| 175 | Ga0068871_100005363 | 3300006358 | Bacteria | 8984 |
| 176 | Ga0068871_100682245 | 3300006358 | Bacteria | 940 |
| 177 | Ga0075428_100050761 | 3300006844 | Bacteria | 4548 |
| 178 | Ga0075428_101653890 | 3300006844 | Bacteria | 669 |
| 179 | Ga0075429_100424676 | 3300006880 | Bacteria | 1164 |
| 180 | Ga0097620_100032942 | 3300006931 | Bacteria | 5205 |
| 181 | Ga0097620_100213276 | 3300006931 | Bacteria | 2017 |
| 182 | Ga0097620_100481677 | 3300006931 | Bacteria | 1336 |
| 183 | Ga0105240_10008649 | 3300009093 | Bacteria | 14545 |
| 184 | Ga0105240_10022129 | 3300009093 | Bacteria | 8435 |
| 185 | Ga0105240_10186565 | 3300009093 | Bacteria | 2442 |
| 186 | Ga0105240_10699040 | 3300009093 | Bacteria | 1107 |
| 187 | Ga0105240_10929977 | 3300009093 | Bacteria | 934 |
| 188 | Ga0111539_10016465 | 3300009094 | Bacteria | 9167 |
| 189 | Ga0105245_10001046 | 3300009098 | Bacteria | 25053 |
| 190 | Ga0105247_10038819 | 3300009101 | Bacteria | 2908 |
| 191 | Ga0105247_10109991 | 3300009101 | Bacteria | 1772 |
| 192 | Ga0114129_10170049 | 3300009147 | Bacteria | 2972 |
| 193 | Ga0105243_10028129 | 3300009148 | Bacteria | 4313 |
| 194 | Ga0105241_10194511 | 3300009174 | Bacteria | 1690 |
| 195 | Ga0105241_10832781 | 3300009174 | Bacteria | 852 |
| 196 | Ga0105248_10000045 | 3300009177 | Bacteria | 165909 |
| 197 | Ga0105248_10003638 | 3300009177 | Bacteria | 17113 |
| 198 | Ga0105248_10028673 | 3300009177 | Bacteria | 6203 |
| 199 | Ga0105248_10032137 | 3300009177 | Bacteria | 5866 |
| 200 | Ga0105248_10392213 | 3300009177 | Bacteria | 1563 |
| 201 | Ga0105237_10104546 | 3300009545 | Bacteria | 2823 |
| 202 | Ga0105237_10181775 | 3300009545 | Bacteria | 2103 |
| 203 | Ga0105237_10216772 | 3300009545 | Bacteria | 1914 |
| 204 | Ga0105237_11559915 | 3300009545 | Bacteria | 667 |
| 205 | Ga0105238_10035938 | 3300009551 | Bacteria | 5036 |
| 206 | Ga0105238_10036999 | 3300009551 | Bacteria | 4963 |
| 207 | Ga0105238_10067960 | 3300009551 | Bacteria | 3564 |
| 208 | Ga0105238_10092085 | 3300009551 | Bacteria | 3019 |
| 209 | Ga0105238_10390045 | 3300009551 | Bacteria | 1385 |
| 210 | Ga0105238_10402836 | 3300009551 | Bacteria | 1361 |
| 211 | Ga0105238_10707038 | 3300009551 | Bacteria | 1020 |
| 212 | Ga0105249_10000055 | 3300009553 | Bacteria | 161674 |
| 213 | Ga0105249_10014831 | 3300009553 | Bacteria | 6890 |
| 214 | Ga0105239_10089892 | 3300010375 | Bacteria | 3387 |
| 215 | Ga0105239_12106981 | 3300010375 | Bacteria | 655 |
| 216 | Ga0157373_10016847 | 3300013100 | Bacteria | 5328 |
| 217 | Ga0157373_10040258 | 3300013100 | Bacteria | 3344 |
| 218 | Ga0157373_10075053 | 3300013100 | Bacteria | 2385 |
| 219 | Ga0157373_10242676 | 3300013100 | Bacteria | 1273 |
| 220 | Ga0157373_10551089 | 3300013100 | Bacteria | 836 |
| 221 | Ga0157371_10155848 | 3300013102 | Bacteria | 1630 |
| 222 | Ga0157371_10172510 | 3300013102 | Bacteria | 1546 |
| 223 | Ga0157371_10306500 | 3300013102 | Bacteria | 1150 |
| 224 | Ga0157370_10036353 | 3300013104 | Bacteria | 4779 |
| 225 | Ga0157370_10125312 | 3300013104 | Bacteria | 2398 |
| 226 | Ga0157370_10131295 | 3300013104 | Bacteria | 2336 |
| 227 | Ga0157370_10172340 | 3300013104 | Bacteria | 2011 |
| 228 | Ga0157370_10724662 | 3300013104 | Bacteria | 907 |
| 229 | Ga0157369_10002615 | 3300013105 | Bacteria | 21530 |
| 230 | Ga0157369_10070306 | 3300013105 | Bacteria | 3761 |
| 231 | Ga0157369_10121654 | 3300013105 | Bacteria | 2769 |
| 232 | Ga0157369_10322135 | 3300013105 | Bacteria | 1607 |
| 233 | Ga0157374_10155077 | 3300013296 | Bacteria | 2228 |
| 234 | Ga0157378_10037607 | 3300013297 | Bacteria | 4288 |
| 235 | Ga0157378_10048347 | 3300013297 | Bacteria | 3782 |
| 236 | Ga0163162_10009164 | 3300013306 | Bacteria | 9631 |
| 237 | Ga0163162_10009790 | 3300013306 | Bacteria | 9326 |
| 238 | Ga0163162_10010728 | 3300013306 | Bacteria | 8913 |
| 239 | Ga0163162_10639562 | 3300013306 | Bacteria | 1188 |
| 240 | Ga0157372_10002970 | 3300013307 | Bacteria | 18265 |
| 241 | Ga0157372_10319859 | 3300013307 | Bacteria | 1807 |
| 242 | Ga0157372_10655508 | 3300013307 | Bacteria | 1222 |
| 243 | Ga0157372_10935612 | 3300013307 | Bacteria | 1005 |
| 244 | Ga0157372_11340683 | 3300013307 | Bacteria | 825 |
| 245 | Ga0157372_11871339 | 3300013307 | Bacteria | 690 |
| 246 | Ga0157375_12321886 | 3300013308 | Bacteria | 640 |
| 247 | Ga0163163_10248751 | 3300014325 | Bacteria | 1828 |
| 248 | Ga0163163_10257193 | 3300014325 | Bacteria | 1797 |
| 249 | Ga0163163_10450992 | 3300014325 | Bacteria | 1346 |
| 250 | Ga0157380_10007873 | 3300014326 | Bacteria | 7583 |
| 251 | Ga0182008_10505366 | 3300014497 | Bacteria | 665 |
| 252 | Ga0157379_10021517 | 3300014968 | Bacteria | 5710 |
| 253 | Ga0206356_11202361 | 3300020070 | Bacteria | 1440 |
| 254 | Ga0206354_10168296 | 3300020081 | Bacteria | 1820 |
| 255 | Ga0206353_12012794 | 3300020082 | Bacteria | 1711 |
| 256 | Ga0213875_10005097 | 3300021388 | Bacteria | 7109 |
| 257 | Ga0209437_111975 | 3300025233 | Bacteria | 1280 |
| 258 | Ga0207425_1007250 | 3300025245 | Bacteria | 2948 |
| 259 | Ga0209646_1015807 | 3300025246 | Bacteria | 1124 |
| 260 | Ga0209233_1000044 | 3300025261 | Bacteria | 489783 |
| 261 | Ga0209565_1000011 | 3300025263 | Bacteria | 637062 |
| 262 | Ga0209455_1000772 | 3300025272 | Bacteria | 17958 |
| 263 | Ga0209455_1025746 | 3300025272 | Bacteria | 1065 |
| 264 | Ga0209673_1002122 | 3300025273 | Bacteria | 14821 |
| 265 | Ga0209675_1000104 | 3300025291 | Bacteria | 121249 |
| 266 | Ga0209675_1013492 | 3300025291 | Bacteria | 2549 |
| 267 | Ga0209676_1000807 | 3300025292 | Bacteria | 41068 |
| 268 | Ga0209676_1001060 | 3300025292 | Bacteria | 31500 |
| 269 | Ga0209676_1001199 | 3300025292 | Bacteria | 27715 |
| 270 | Ga0209676_1044912 | 3300025292 | Bacteria | 1207 |
| 271 | Ga0209025_1006362 | 3300025294 | Bacteria | 9192 |
| 272 | Ga0209758_1008891 | 3300025297 | Bacteria | 6378 |
| 273 | Ga0209050_1000071 | 3300025298 | Bacteria | 295478 |
| 274 | Ga0209050_1000286 | 3300025298 | Bacteria | 106566 |
| 275 | Ga0209050_1002140 | 3300025298 | Bacteria | 17979 |
| 276 | Ga0209050_1004981 | 3300025298 | Bacteria | 8643 |
| 277 | Ga0209050_1072435 | 3300025298 | Bacteria | 763 |
| 278 | Ga0209256_1000016 | 3300025299 | Bacteria | 599092 |
| 279 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 280 | Ga0209257_1000245 | 3300025304 | Bacteria | 125987 |
| 281 | Ga0209257_1000321 | 3300025304 | Bacteria | 100476 |
| 282 | Ga0209257_1001354 | 3300025304 | Bacteria | 29627 |
| 283 | Ga0209257_1001434 | 3300025304 | Bacteria | 28267 |
| 284 | Ga0209257_1014820 | 3300025304 | Bacteria | 3308 |
| 285 | Ga0207656_10025320 | 3300025321 | Bacteria | 2408 |
| 286 | Ga0207656_10039366 | 3300025321 | Bacteria | 1999 |
| 287 | Ga0207656_10066705 | 3300025321 | Bacteria | 1591 |
| 288 | Ga0207710_10135767 | 3300025900 | Bacteria | 1184 |
| 289 | Ga0207680_10719372 | 3300025903 | Bacteria | 716 |
| 290 | Ga0207647_10007714 | 3300025904 | Bacteria | 7748 |
| 291 | Ga0207647_10024741 | 3300025904 | Bacteria | 3957 |
| 292 | Ga0207647_10028509 | 3300025904 | Bacteria | 3624 |
| 293 | Ga0207705_10002705 | 3300025909 | Bacteria | 13560 |
| 294 | Ga0207705_10009941 | 3300025909 | Bacteria | 6927 |
| 295 | Ga0207705_10026902 | 3300025909 | Bacteria | 4099 |
| 296 | Ga0207705_10033221 | 3300025909 | Bacteria | 3685 |
| 297 | Ga0207705_10106802 | 3300025909 | Bacteria | 2065 |
| 298 | Ga0207705_10427571 | 3300025909 | Bacteria | 1026 |
| 299 | Ga0207684_10421321 | 3300025910 | Bacteria | 1147 |
| 300 | Ga0207654_10517952 | 3300025911 | Bacteria | 844 |
| 301 | Ga0207654_10792998 | 3300025911 | Bacteria | 684 |
| 302 | Ga0207707_10044083 | 3300025912 | Bacteria | 3890 |
| 303 | Ga0207707_10149531 | 3300025912 | Bacteria | 2042 |
| 304 | Ga0207707_10191173 | 3300025912 | Bacteria | 1786 |
| 305 | Ga0207695_10026017 | 3300025913 | Bacteria | 6537 |
| 306 | Ga0207695_10199135 | 3300025913 | Bacteria | 1918 |
| 307 | Ga0207695_10660640 | 3300025913 | Bacteria | 926 |
| 308 | Ga0207695_11185612 | 3300025913 | Bacteria | 644 |
| 309 | Ga0207671_10024252 | 3300025914 | Bacteria | 4564 |
| 310 | Ga0207671_10081045 | 3300025914 | Bacteria | 2433 |
| 311 | Ga0207671_10088723 | 3300025914 | Bacteria | 2327 |
| 312 | Ga0207660_10000024 | 3300025917 | Bacteria | 71220 |
| 313 | Ga0207660_10060824 | 3300025917 | Bacteria | 2717 |
| 314 | Ga0207660_10225842 | 3300025917 | Bacteria | 1471 |
| 315 | Ga0207660_10447300 | 3300025917 | Bacteria | 1044 |
| 316 | Ga0207660_10490502 | 3300025917 | Bacteria | 996 |
| 317 | Ga0207660_10731325 | 3300025917 | Bacteria | 807 |
| 318 | Ga0207657_10007988 | 3300025919 | Bacteria | 10787 |
| 319 | Ga0207657_10010415 | 3300025919 | Bacteria | 9281 |
| 320 | Ga0207657_10046672 | 3300025919 | Bacteria | 3793 |
| 321 | Ga0207657_10053077 | 3300025919 | Bacteria | 3514 |
| 322 | Ga0207657_10103276 | 3300025919 | Bacteria | 2363 |
| 323 | Ga0207657_10109325 | 3300025919 | Bacteria | 2285 |
| 324 | Ga0207657_10112964 | 3300025919 | Bacteria | 2241 |
| 325 | Ga0207657_10583406 | 3300025919 | Bacteria | 873 |
| 326 | Ga0207657_11032159 | 3300025919 | Bacteria | 630 |
| 327 | Ga0207649_10059417 | 3300025920 | Bacteria | 2398 |
| 328 | Ga0207649_10089449 | 3300025920 | Bacteria | 2013 |
| 329 | Ga0207649_10095289 | 3300025920 | Bacteria | 1958 |
| 330 | Ga0207649_10597774 | 3300025920 | Bacteria | 848 |
| 331 | Ga0207652_10073532 | 3300025921 | Bacteria | 2974 |
| 332 | Ga0207652_10092414 | 3300025921 | Bacteria | 2662 |
| 333 | Ga0207652_10148018 | 3300025921 | Bacteria | 2102 |
| 334 | Ga0207652_10159255 | 3300025921 | Bacteria | 2023 |
| 335 | Ga0207652_10293774 | 3300025921 | Bacteria | 1466 |
| 336 | Ga0207652_10410785 | 3300025921 | Bacteria | 1221 |
| 337 | Ga0207652_10480000 | 3300025921 | Bacteria | 1120 |
| 338 | Ga0207652_11018435 | 3300025921 | Bacteria | 727 |
| 339 | Ga0207681_10190284 | 3300025923 | Bacteria | 1570 |
| 340 | Ga0207694_10020412 | 3300025924 | Bacteria | 5013 |
| 341 | Ga0207694_10029168 | 3300025924 | Bacteria | 4208 |
| 342 | Ga0207694_10062555 | 3300025924 | Bacteria | 2898 |
| 343 | Ga0207694_11336831 | 3300025924 | Bacteria | 606 |
| 344 | Ga0207650_10000111 | 3300025925 | Bacteria | 107416 |
| 345 | Ga0207650_10018464 | 3300025925 | Bacteria | 4895 |
| 346 | Ga0207687_10000562 | 3300025927 | Bacteria | 25050 |
| 347 | Ga0207664_10066774 | 3300025929 | Bacteria | 2884 |
| 348 | Ga0207664_10500508 | 3300025929 | Bacteria | 1088 |
| 349 | Ga0207644_10000032 | 3300025931 | Bacteria | 133759 |
| 350 | Ga0207644_10051599 | 3300025931 | Bacteria | 2953 |
| 351 | Ga0207644_10102939 | 3300025931 | Bacteria | 2148 |
| 352 | Ga0207644_10374951 | 3300025931 | Bacteria | 1159 |
| 353 | Ga0207644_10521877 | 3300025931 | Bacteria | 981 |
| 354 | Ga0207644_11753146 | 3300025931 | Bacteria | 520 |
| 355 | Ga0207690_10018054 | 3300025932 | Bacteria | 4321 |
| 356 | Ga0207690_10063579 | 3300025932 | Bacteria | 2517 |
| 357 | Ga0207690_10078402 | 3300025932 | Bacteria | 2299 |
| 358 | Ga0207690_10147247 | 3300025932 | Bacteria | 1742 |
| 359 | Ga0207690_10182553 | 3300025932 | Bacteria | 1581 |
| 360 | Ga0207690_10675176 | 3300025932 | Bacteria | 848 |
| 361 | Ga0207706_10004718 | 3300025933 | Bacteria | 12764 |
| 362 | Ga0207706_10015487 | 3300025933 | Bacteria | 6889 |
| 363 | Ga0207706_10067824 | 3300025933 | Bacteria | 3140 |
| 364 | Ga0207691_10068308 | 3300025940 | Bacteria | 3211 |
| 365 | Ga0207711_10000027 | 3300025941 | Bacteria | 236548 |
| 366 | Ga0207711_10002908 | 3300025941 | Bacteria | 15009 |
| 367 | Ga0207711_10012212 | 3300025941 | Bacteria | 7142 |
| 368 | Ga0207711_10468112 | 3300025941 | Bacteria | 1174 |
| 369 | Ga0207661_10732046 | 3300025944 | Bacteria | 910 |
| 370 | Ga0207679_10033400 | 3300025945 | Bacteria | 3620 |
| 371 | Ga0207679_10228292 | 3300025945 | Bacteria | 1570 |
| 372 | Ga0207679_11018164 | 3300025945 | Bacteria | 759 |
| 373 | Ga0207667_10025172 | 3300025949 | Bacteria | 6520 |
| 374 | Ga0207667_10041234 | 3300025949 | Bacteria | 4910 |
| 375 | Ga0207667_10053956 | 3300025949 | Bacteria | 4228 |
| 376 | Ga0207667_10070885 | 3300025949 | Bacteria | 3626 |
| 377 | Ga0207667_10357924 | 3300025949 | Bacteria | 1488 |
| 378 | Ga0207667_10497892 | 3300025949 | Bacteria | 1236 |
| 379 | Ga0207651_10171341 | 3300025960 | Bacteria | 1712 |
| 380 | Ga0207712_10000813 | 3300025961 | Bacteria | 23020 |
| 381 | Ga0207712_10033349 | 3300025961 | Bacteria | 3481 |
| 382 | Ga0207668_10000034 | 3300025972 | Bacteria | 119274 |
| 383 | Ga0207640_10000202 | 3300025981 | Bacteria | 42596 |
| 384 | Ga0207640_10026210 | 3300025981 | Bacteria | 3537 |
| 385 | Ga0207640_10111478 | 3300025981 | Bacteria | 1940 |
| 386 | Ga0207640_10156959 | 3300025981 | Bacteria | 1678 |
| 387 | Ga0207640_10879216 | 3300025981 | Bacteria | 781 |
| 388 | Ga0207658_10000839 | 3300025986 | Bacteria | 25661 |
| 389 | Ga0207703_10000190 | 3300026035 | Bacteria | 72096 |
| 390 | Ga0207703_10034927 | 3300026035 | Bacteria | 3993 |
| 391 | Ga0207703_10282134 | 3300026035 | Bacteria | 1509 |
| 392 | Ga0207639_10002119 | 3300026041 | Bacteria | 13364 |
| 393 | Ga0207639_10004994 | 3300026041 | Bacteria | 8935 |
| 394 | Ga0207639_10087630 | 3300026041 | Bacteria | 2482 |
| 395 | Ga0207639_10094791 | 3300026041 | Bacteria | 2397 |
| 396 | Ga0207639_10110813 | 3300026041 | Bacteria | 2236 |
| 397 | Ga0207639_10559991 | 3300026041 | Bacteria | 1050 |
| 398 | Ga0207639_10659466 | 3300026041 | Bacteria | 968 |
| 399 | Ga0207639_10846312 | 3300026041 | Bacteria | 854 |
| 400 | Ga0207678_10000455 | 3300026067 | Bacteria | 37036 |
| 401 | Ga0207678_10002000 | 3300026067 | Bacteria | 18558 |
| 402 | Ga0207678_10046585 | 3300026067 | Bacteria | 3749 |
| 403 | Ga0207678_10092769 | 3300026067 | Bacteria | 2580 |
| 404 | Ga0207702_10018713 | 3300026078 | Bacteria | 5729 |
| 405 | Ga0207702_10052142 | 3300026078 | Bacteria | 3460 |
| 406 | Ga0207702_10066422 | 3300026078 | Bacteria | 3091 |
| 407 | Ga0207702_11621557 | 3300026078 | Bacteria | 640 |
| 408 | Ga0207641_10000031 | 3300026088 | Bacteria | 224320 |
| 409 | Ga0207641_10000041 | 3300026088 | Bacteria | 191595 |
| 410 | Ga0207641_10686291 | 3300026088 | Bacteria | 1008 |
| 411 | Ga0207648_10357096 | 3300026089 | Bacteria | 1318 |
| 412 | Ga0207676_10000039 | 3300026095 | Bacteria | 171142 |
| 413 | Ga0207676_10000072 | 3300026095 | Bacteria | 101978 |
| 414 | Ga0207674_10003053 | 3300026116 | Bacteria | 20715 |
| 415 | Ga0207674_10005772 | 3300026116 | Bacteria | 14686 |
| 416 | Ga0207674_10006642 | 3300026116 | Bacteria | 13588 |
| 417 | Ga0207674_10236171 | 3300026116 | Bacteria | 1776 |
| 418 | Ga0207683_11160850 | 3300026121 | Bacteria | 716 |
| 419 | Ga0207698_10025863 | 3300026142 | Bacteria | 4143 |
| 420 | Ga0207698_10041296 | 3300026142 | Bacteria | 3436 |
| 421 | Ga0268266_10056076 | 3300028379 | Bacteria | 3389 |
| 422 | Ga0268266_10064839 | 3300028379 | Bacteria | 3157 |
| 423 | Ga0268265_10000061 | 3300028380 | Bacteria | 148625 |
| 424 | Ga0268265_10146257 | 3300028380 | Bacteria | 1986 |
| 425 | Ga0268264_10000785 | 3300028381 | Bacteria | 34613 |
| 426 | Ga0307517_10075608 | 3300028786 | Bacteria | 2952 |
| 427 | Ga0307515_10325087 | 3300028794 | Bacteria | 1201 |
| 428 | Ga0307512_10435641 | 3300030522 | Bacteria | 535 |
| 429 | Ga0314311_1234836 | 3300030733 | Bacteria | 1559 |
| 430 | Ga0307513_10206273 | 3300031456 | Bacteria | 1801 |
| 431 | Ga0307408_100058897 | 3300031548 | Bacteria | 2794 |
| 432 | Ga0307508_10000011 | 3300031616 | Bacteria | 248001 |
| 433 | Ga0307405_10101755 | 3300031731 | Bacteria | 1928 |
| 434 | Ga0307405_10109097 | 3300031731 | Bacteria | 1871 |
| 435 | Ga0307405_11004197 | 3300031731 | Bacteria | 712 |
| 436 | Ga0307413_10460217 | 3300031824 | Bacteria | 1012 |
| 437 | Ga0307406_10025518 | 3300031901 | Bacteria | 3539 |
| 438 | Ga0307406_10135661 | 3300031901 | Bacteria | 1734 |
| 439 | Ga0307406_10189804 | 3300031901 | Bacteria | 1503 |
| 440 | Ga0307406_10214331 | 3300031901 | Bacteria | 1427 |
| 441 | Ga0307407_10113528 | 3300031903 | Bacteria | 1705 |
| 442 | Ga0307412_10001328 | 3300031911 | Bacteria | 13834 |
| 443 | Ga0307412_10002668 | 3300031911 | Bacteria | 9900 |
| 444 | Ga0307412_10005336 | 3300031911 | Bacteria | 7213 |
| 445 | Ga0307412_10026022 | 3300031911 | Bacteria | 3632 |
| 446 | Ga0307412_10042785 | 3300031911 | Bacteria | 2946 |
| 447 | Ga0307412_10095174 | 3300031911 | Bacteria | 2093 |
| 448 | Ga0307412_11342480 | 3300031911 | Bacteria | 645 |
| 449 | Ga0307409_100021228 | 3300031995 | Bacteria | 4448 |
| 450 | Ga0307409_100277372 | 3300031995 | Bacteria | 1547 |
| 451 | Ga0307416_100032603 | 3300032002 | Bacteria | 3939 |
| 452 | Ga0307416_100273430 | 3300032002 | Bacteria | 1660 |
| 453 | Ga0307416_100339873 | 3300032002 | Bacteria | 1513 |
| 454 | Ga0307414_10001684 | 3300032004 | Bacteria | 11495 |
| 455 | Ga0307414_10001894 | 3300032004 | Bacteria | 10813 |
| 456 | Ga0307414_10002573 | 3300032004 | Bacteria | 9542 |
| 457 | Ga0307414_10009988 | 3300032004 | Bacteria | 5481 |
| 458 | Ga0307414_10046896 | 3300032004 | Bacteria | 2970 |
| 459 | Ga0307414_10115705 | 3300032004 | Bacteria | 2051 |
| 460 | Ga0307414_10133282 | 3300032004 | Bacteria | 1932 |
| 461 | Ga0307414_10159311 | 3300032004 | Bacteria | 1791 |
| 462 | Ga0307414_10365512 | 3300032004 | Bacteria | 1243 |
| 463 | Ga0307414_10393190 | 3300032004 | Bacteria | 1202 |
| 464 | Ga0307414_11189774 | 3300032004 | Bacteria | 705 |
| 465 | Ga0307415_100044257 | 3300032126 | Bacteria | 2975 |
| 466 | Ga0316583_10008044 | 3300032133 | Bacteria | 3799 |
| 467 | Ga0307510_10066895 | 3300033180 | Bacteria | 3623 |
| 468 | Ga0373954_0103957 | 3300035118 | Bacteria | 1371 |
| 469 | Ga0373956_0348221 | 3300035119 | Bacteria | 706 |
| 470 | Ga0373955_0007600 | 3300035172 | Bacteria | 4992 |
| 471 | Ga0373961_0391148 | 3300035241 | Bacteria | 532 |
| 472 | Ga0316574_0203301 | 3300035398 | Bacteria | 1272 |
| 473 | Ga0373935_0578125 | 3300035692 | Bacteria | 820 |
| 474 | Ga0373933_0013243 | 3300035724 | Bacteria | 4568 |
| 475 | Ga0373937_0047729 | 3300036401 | Bacteria | 3919 |
| 476 | Ga0373937_0102021 | 3300036401 | Bacteria | 2663 |
| 477 | Ga0316582_0000490 | 3300036647 | Bacteria | 14883 |
| 478 | Ga0316582_0578966 | 3300036647 | Bacteria | 773 |
| 479 | Ga0316584_0167688 | 3300036712 | Bacteria | 1630 |
| 480 | Ga0316584_0337297 | 3300036712 | Bacteria | 1084 |
| 481 | Ga0395899_0002299 | 3300037312 | Bacteria | 15586 |
| 482 | Ga0395899_0019311 | 3300037312 | Bacteria | 5178 |
| 483 | Ga0395899_0037173 | 3300037312 | Bacteria | 3650 |
| 484 | Ga0395899_0063584 | 3300037312 | Bacteria | 2714 |
| 485 | Ga0395899_0174455 | 3300037312 | Bacteria | 1512 |
| 486 | Ga0395899_0213365 | 3300037312 | Bacteria | 1340 |
| 487 | Ga0395899_0256610 | 3300037312 | Bacteria | 1197 |
| 488 | Ga0395900_0002548 | 3300037418 | Bacteria | 19966 |
| 489 | Ga0395900_0044846 | 3300037418 | Bacteria | 4554 |
| 490 | Ga0395900_0066250 | 3300037418 | Bacteria | 3711 |
| 491 | Ga0395900_0096980 | 3300037418 | Bacteria | 3029 |
| 492 | Ga0395900_0131864 | 3300037418 | Bacteria | 2560 |
| 493 | Ga0395900_0192374 | 3300037418 | Bacteria | 2069 |
| 494 | Ga0395900_0211241 | 3300037418 | Bacteria | 1959 |
| 495 | Ga0395900_0245869 | 3300037418 | Bacteria | 1792 |
| 496 | Ga0395900_0316383 | 3300037418 | Bacteria | 1542 |
| 497 | Ga0395900_0333416 | 3300037418 | Bacteria | 1494 |
| 498 | Ga0395900_0667608 | 3300037418 | Bacteria | 975 |
| 499 | Ga0395900_1286347 | 3300037418 | Bacteria | 645 |
| 500 | Ga0395898_0025707 | 3300037466 | Bacteria | 5929 |
| 501 | Ga0395898_0093802 | 3300037466 | Bacteria | 2884 |
| 502 | Ga0395898_0164557 | 3300037466 | Bacteria | 2121 |
| 503 | Ga0395898_0233521 | 3300037466 | Bacteria | 1754 |
| 504 | Ga0395898_0235873 | 3300037466 | Bacteria | 1744 |
| 505 | Ga0395898_0652849 | 3300037466 | Bacteria | 994 |
| 506 | Ga0395905_0000409 | 3300037471 | Bacteria | 60283 |
| 507 | Ga0395905_0007919 | 3300037471 | Bacteria | 10511 |
| 508 | Ga0395905_0029823 | 3300037471 | Bacteria | 5142 |
| 509 | Ga0395905_0031015 | 3300037471 | Bacteria | 5034 |
| 510 | Ga0395905_0053376 | 3300037471 | Bacteria | 3783 |
| 511 | Ga0395905_0057214 | 3300037471 | Bacteria | 3647 |
| 512 | Ga0395905_0193828 | 3300037471 | Bacteria | 1905 |
| 513 | Ga0395905_0287733 | 3300037471 | Bacteria | 1530 |
| 514 | Ga0395905_0294247 | 3300037471 | Bacteria | 1510 |
| 515 | Ga0395905_0310813 | 3300037471 | Bacteria | 1464 |
| 516 | Ga0395905_0396107 | 3300037471 | Bacteria | 1275 |
| 517 | Ga0395905_0670827 | 3300037471 | Bacteria | 939 |
| 518 | Ga0395905_0836201 | 3300037471 | Bacteria | 823 |
| 519 | Ga0436364_1172297 | 3300037853 | Bacteria | 30221 |
| 520 | Ga0395901_0010738 | 3300038443 | Bacteria | 9284 |
| 521 | Ga0395901_0011872 | 3300038443 | Bacteria | 8833 |
| 522 | Ga0395901_0173259 | 3300038443 | Bacteria | 2264 |
| 523 | Ga0395901_0271979 | 3300038443 | Bacteria | 1762 |
| 524 | Ga0395901_0300704 | 3300038443 | Bacteria | 1664 |
| 525 | Ga0395901_0440581 | 3300038443 | Bacteria | 1333 |
| 526 | Ga0395901_0468286 | 3300038443 | Bacteria | 1286 |
| 527 | Ga0395901_0521168 | 3300038443 | Bacteria | 1207 |
| 528 | Ga0395901_1006920 | 3300038443 | Bacteria | 809 |
| 529 | Ga0436365_1054374 | 3300039437 | Bacteria | 1165 |
| 530 | Ga0436365_1325832 | 3300039437 | Bacteria | 2552 |
| 531 | Ga0439436_0003483 | 3300041404 | Bacteria | 4783 |
| 532 | Ga0439436_0055151 | 3300041404 | Bacteria | 1117 |
| 533 | Ga0439439_0006576 | 3300041406 | Bacteria | 2691 |
| 534 | Ga0439447_019635 | 3300041407 | Bacteria | 1800 |
| 535 | Ga0439461_0000178 | 3300041410 | Bacteria | 8637 |
| 536 | Ga0439461_0014873 | 3300041410 | Bacteria | 1485 |
| 537 | Ga0439466_0130849 | 3300041411 | Bacteria | 772 |
| 538 | Ga0439465_0009623 | 3300041413 | Bacteria | 3044 |
| 539 | Ga0439465_0030423 | 3300041413 | Bacteria | 1717 |
| 540 | Ga0451800_1680169 | 3300041459 | Bacteria | 602 |
| 541 | Ga0451802_0494763 | 3300041460 | Bacteria | 1032 |
| 542 | Ga0451837_0848718 | 3300041494 | Bacteria | 599 |
| 543 | Ga0451841_0580323 | 3300041498 | Bacteria | 679 |
| 544 | Ga0439431_0000015 | 3300041997 | Bacteria | 27396 |
| 545 | Ga0439431_0004975 | 3300041997 | Bacteria | 2929 |
| 546 | Ga0439442_001570 | 3300042002 | Bacteria | 4481 |
| 547 | Ga0439442_008630 | 3300042002 | Bacteria | 2057 |
| 548 | Ga0439445_0003451 | 3300042004 | Bacteria | 3546 |
| 549 | Ga0439445_0003697 | 3300042004 | Bacteria | 3433 |
| 550 | Ga0439432_006574 | 3300042006 | Bacteria | 4143 |
| 551 | Ga0439432_013379 | 3300042006 | Bacteria | 2792 |
| 552 | Ga0439452_028811 | 3300042010 | Bacteria | 1382 |
| 553 | Ga0439457_033383 | 3300042014 | Bacteria | 1142 |
| 554 | Ga0439462_0010019 | 3300042015 | Bacteria | 2399 |
| 555 | Ga0439462_0010888 | 3300042015 | Bacteria | 2309 |
| 556 | Ga0450919_012947 | 3300042121 | Bacteria | 945 |
| 557 | Ga0450920_035414 | 3300042122 | Bacteria | 989 |
| 558 | Ga0450923_066810 | 3300042125 | Bacteria | 792 |
| 559 | Ga0450894_030654 | 3300042131 | Bacteria | 750 |
| 560 | Ga0450905_000807 | 3300042142 | Bacteria | 3880 |
| 561 | Ga0450889_000518 | 3300042144 | Bacteria | 4304 |
| 562 | Ga0450910_047813 | 3300042147 | Bacteria | 702 |
| 563 | Ga0439446_0006326 | 3300042156 | Bacteria | 3083 |
| 564 | Ga0450908_028476 | 3300042184 | Bacteria | 973 |
| 565 | Ga0450909_005358 | 3300042185 | Bacteria | 1846 |
| 566 | Ga0439434_0002354 | 3300042435 | Bacteria | 5498 |
| 567 | Ga0439434_0005342 | 3300042435 | Bacteria | 3759 |
| 568 | Ga0466969_0253822 | 3300044656 | Bacteria | 797 |
| 569 | Ga0466972_0054673 | 3300044658 | Bacteria | 1920 |
| 570 | Ga0466972_0054969 | 3300044658 | Bacteria | 1915 |
| 571 | Ga0466972_0096323 | 3300044658 | Bacteria | 1402 |
| 572 | Ga0466965_0202783 | 3300044683 | Bacteria | 1053 |
| 573 | Ga0466965_0684844 | 3300044683 | Bacteria | 587 |
| 574 | Ga0466966_0047420 | 3300044684 | Bacteria | 2739 |
| 575 | Ga0466966_0490891 | 3300044684 | Bacteria | 738 |
| 576 | Ga0466966_0538916 | 3300044684 | Bacteria | 702 |
| 577 | Ga0466966_0910100 | 3300044684 | Bacteria | 530 |
| 578 | Ga0466961_0353616 | 3300044693 | Bacteria | 894 |
| 579 | Ga0466963_0062599 | 3300044694 | Bacteria | 2488 |
| 580 | Ga0466963_0280400 | 3300044694 | Bacteria | 1171 |
| 581 | Ga0466963_0461350 | 3300044694 | Bacteria | 896 |
| 582 | Ga0466971_0025809 | 3300044719 | Bacteria | 2624 |
| 583 | Ga0466971_0040567 | 3300044719 | Bacteria | 2091 |
| 584 | Ga0466971_0209539 | 3300044719 | Bacteria | 921 |
| 585 | Ga0466968_0239433 | 3300044735 | Bacteria | 859 |
| 586 | Ga0466957_0002469 | 3300044842 | Bacteria | 9932 |
| 587 | Ga0466957_0060558 | 3300044842 | Bacteria | 2321 |
| 588 | Ga0466960_0021758 | 3300044901 | Bacteria | 2859 |
| 589 | Ga0466959_0296613 | 3300045049 | Bacteria | 1107 |
| 590 | Ga0466958_0000506 | 3300045836 | Bacteria | 16309 |
| 591 | Ga0466958_0240527 | 3300045836 | Bacteria | 1157 |
| 592 | Ga0466958_0588751 | 3300045836 | Bacteria | 723 |
| 593 | Ga0466967_0021699 | 3300045976 | Bacteria | 5223 |
| 594 | Ga0466967_0072671 | 3300045976 | Bacteria | 3083 |
| 595 | Ga0466967_0118471 | 3300045976 | Bacteria | 2442 |
| 596 | Ga0466967_0196153 | 3300045976 | Bacteria | 1910 |
| 597 | Ga0466967_0359547 | 3300045976 | Bacteria | 1410 |
| 598 | Ga0466967_0402299 | 3300045976 | Bacteria | 1332 |
| 599 | Ga0466967_0449707 | 3300045976 | Bacteria | 1259 |
| 600 | Ga0466967_1591370 | 3300045976 | Bacteria | 651 |
| 601 | Ga0466967_1844498 | 3300045976 | Bacteria | 602 |
| 602 | Ga0466967_2108633 | 3300045976 | Bacteria | 560 |
| 603 | Ga0466967_2218823 | 3300045976 | Bacteria | 545 |
| 604 | Ga0466967_2255187 | 3300045976 | Bacteria | 540 |
| 605 | Ga0495617_011727 | 3300046452 | Bacteria | 2989 |
| 606 | Ga0495627_025915 | 3300046453 | Bacteria | 1897 |
| 607 | Ga0495638_0000012 | 3300046460 | Bacteria | 435577 |
| 608 | Ga0495638_0000207 | 3300046460 | Bacteria | 83805 |
| 609 | Ga0495638_0059419 | 3300046460 | Bacteria | 2367 |
| 610 | Ga0495650_0023973 | 3300046471 | Bacteria | 2892 |
| 611 | Ga0495605_0174557 | 3300046474 | Bacteria | 948 |
| 612 | Ga0495585_0033580 | 3300046492 | Bacteria | 2904 |
| 613 | Ga0495583_0000180 | 3300046506 | Bacteria | 108471 |
| 614 | Ga0495583_0000643 | 3300046506 | Bacteria | 46051 |
| 615 | Ga0495583_0004661 | 3300046506 | Bacteria | 9669 |
| 616 | Ga0495606_0081466 | 3300046507 | Bacteria | 2012 |
| 617 | Ga0495606_0455880 | 3300046507 | Bacteria | 654 |
| 618 | Ga0495610_0263897 | 3300046512 | Bacteria | 677 |
| 619 | Ga0495616_0000010 | 3300046513 | Bacteria | 224378 |
| 620 | Ga0495632_0000248 | 3300046519 | Bacteria | 53538 |
| 621 | Ga0495643_0039984 | 3300046522 | Bacteria | 2563 |
| 622 | Ga0495643_0200499 | 3300046522 | Bacteria | 958 |
| 623 | Ga0495648_0000151 | 3300046524 | Bacteria | 83011 |
| 624 | Ga0495648_0026719 | 3300046524 | Bacteria | 3881 |
| 625 | Ga0495663_0107436 | 3300046525 | Bacteria | 924 |
| 626 | Ga0495652_0484320 | 3300046529 | Bacteria | 860 |
| 627 | Ga0495654_0059377 | 3300046530 | Bacteria | 1842 |
| 628 | Ga0495654_0077322 | 3300046530 | Bacteria | 1566 |
| 629 | Ga0495654_0077426 | 3300046530 | Bacteria | 1565 |
| 630 | Ga0495654_0096319 | 3300046530 | Bacteria | 1367 |
| 631 | Ga0495633_0009411 | 3300046558 | Bacteria | 5401 |
| 632 | Ga0495668_0000004 | 3300046616 | Bacteria | 574236 |
| 633 | Ga0495668_0002391 | 3300046616 | Bacteria | 15550 |
| 634 | Ga0495668_0006873 | 3300046616 | Bacteria | 7376 |
| 635 | Ga0495668_0040848 | 3300046616 | Bacteria | 2586 |
| 636 | Ga0495668_0176176 | 3300046616 | Bacteria | 1172 |
| 637 | Ga0495625_0001182 | 3300046660 | Bacteria | 33512 |
| 638 | Ga0495625_0003111 | 3300046660 | Bacteria | 16956 |
| 639 | Ga0495625_0068441 | 3300046660 | Bacteria | 2496 |
| 640 | Ga0495625_0164006 | 3300046660 | Bacteria | 1487 |
| 641 | Ga0495625_0320073 | 3300046660 | Bacteria | 988 |
| 642 | Ga0495623_0034060 | 3300046679 | Bacteria | 3267 |
| 643 | Ga0495669_0002918 | 3300046684 | Bacteria | 7027 |
| 644 | Ga0495669_0105850 | 3300046684 | Bacteria | 1310 |
| 645 | Ga0495669_0211987 | 3300046684 | Bacteria | 927 |
| 646 | Ga0495670_0006307 | 3300046691 | Bacteria | 5824 |
| 647 | Ga0495670_0090704 | 3300046691 | Bacteria | 1564 |
| 648 | Ga0495670_0260499 | 3300046691 | Bacteria | 925 |
| 649 | Ga0495671_0000023 | 3300046692 | Bacteria | 252939 |
| 650 | Ga0495671_0008914 | 3300046692 | Bacteria | 5634 |
| 651 | Ga0495671_0220005 | 3300046692 | Bacteria | 919 |
| 652 | Ga0495687_121374 | 3300047443 | Bacteria | 942 |
| 653 | Ga0495677_0007182 | 3300047445 | Bacteria | 4169 |
| 654 | Ga0495685_071854 | 3300047447 | Bacteria | 1158 |
| 655 | Ga0495685_123399 | 3300047447 | Bacteria | 849 |
| 656 | Ga0495673_0000054 | 3300047469 | Bacteria | 252207 |
| 657 | Ga0495686_0006227 | 3300047472 | Bacteria | 9193 |
| 658 | Ga0495686_0007366 | 3300047472 | Bacteria | 8255 |
| 659 | Ga0495686_0018195 | 3300047472 | Bacteria | 4720 |
| 660 | Ga0495686_0084881 | 3300047472 | Bacteria | 1929 |
| 661 | Ga0495686_0211929 | 3300047472 | Bacteria | 1106 |
| 662 | Ga0495602_0064575 | 3300048088 | Bacteria | 3164 |
| 663 | Ga0495626_0193598 | 3300048091 | Bacteria | 837 |
| 664 | Ga0496100_0648349 | 3300048903 | Bacteria | 822 |
| 665 | Ga0496101_0075810 | 3300048904 | Bacteria | 2476 |
| 666 | Ga0496101_0179780 | 3300048904 | Bacteria | 1629 |
| 667 | Ga0496101_0679483 | 3300048904 | Bacteria | 813 |
| 668 | Ga0496102_0000481 | 3300048905 | Bacteria | 44268 |
| 669 | Ga0496103_0000347 | 3300048906 | Bacteria | 42198 |
| 670 | Ga0496103_0141373 | 3300048906 | Unclassified | 1539 |
| 671 | Ga0496103_0473379 | 3300048906 | Bacteria | 803 |
| 672 | Ga0496106_0077572 | 3300048909 | Bacteria | 2548 |
| 673 | Ga0496107_0024108 | 3300048910 | Bacteria | 4303 |
| 674 | Ga0496107_0385240 | 3300048910 | Bacteria | 1043 |
| 675 | Ga0496108_0264936 | 3300048911 | Bacteria | 1495 |
| 676 | Ga0496109_0027277 | 3300048912 | Bacteria | 5097 |
| 677 | Ga0496109_0793114 | 3300048912 | Bacteria | 885 |
| 678 | Ga0496110_0078443 | 3300048913 | Bacteria | 2940 |
| 679 | Ga0496110_1216993 | 3300048913 | Bacteria | 662 |
| 680 | Ga0496111_0003794 | 3300048914 | Bacteria | 9425 |
| 681 | Ga0496111_0556205 | 3300048914 | Bacteria | 842 |
| 682 | Ga0496111_1301184 | 3300048914 | Bacteria | 512 |
| 683 | Ga0496112_0009881 | 3300048915 | Bacteria | 8625 |
| 684 | Ga0496112_0084606 | 3300048915 | Bacteria | 3137 |
| 685 | Ga0496112_1108622 | 3300048915 | Bacteria | 709 |
| 686 | Ga0496113_0008196 | 3300048916 | Bacteria | 6790 |
| 687 | Ga0496113_0216587 | 3300048916 | Bacteria | 1525 |
| 688 | Ga0496113_0508911 | 3300048916 | Bacteria | 967 |
| 689 | Ga0496115_0000534 | 3300048918 | Bacteria | 29632 |
| 690 | Ga0496116_0002244 | 3300048919 | Bacteria | 20540 |
| 691 | Ga0496117_0001149 | 3300048920 | Bacteria | 39861 |
| 692 | Ga0496117_0002571 | 3300048920 | Bacteria | 22586 |
| 693 | Ga0496117_0094080 | 3300048920 | Bacteria | 1920 |
| 694 | Ga0496118_0000493 | 3300048921 | Bacteria | 65468 |
| 695 | Ga0496118_0001071 | 3300048921 | Bacteria | 42731 |
| 696 | Ga0496119_0017078 | 3300048922 | Bacteria | 5485 |
| 697 | Ga0496119_0150677 | 3300048922 | Bacteria | 1247 |
| 698 | Ga0496120_0023307 | 3300048923 | Bacteria | 3877 |
| 699 | Ga0496121_0046213 | 3300048924 | Bacteria | 3729 |
| 700 | Ga0496121_0338970 | 3300048924 | Bacteria | 1005 |
| 701 | Ga0496122_0126510 | 3300048925 | Bacteria | 1634 |
| 702 | Ga0496122_0329098 | 3300048925 | Bacteria | 808 |
| 703 | Ga0496122_0330217 | 3300048925 | Bacteria | 806 |
| 704 | Ga0496123_0065252 | 3300048926 | Bacteria | 2315 |
| 705 | Ga0496123_0077610 | 3300048926 | Bacteria | 2039 |
| 706 | Ga0496124_0000889 | 3300048927 | Bacteria | 48520 |
| 707 | Ga0496124_0000996 | 3300048927 | Bacteria | 44925 |
| 708 | Ga0496124_0073812 | 3300048927 | Bacteria | 2821 |
| 709 | Ga0496124_0325858 | 3300048927 | Bacteria | 1098 |
| 710 | Ga0496125_0091212 | 3300048928 | Bacteria | 2284 |
| 711 | Ga0496126_0140950 | 3300048929 | Bacteria | 2075 |
| 712 | Ga0496126_0171090 | 3300048929 | Bacteria | 1851 |
| 713 | Ga0495678_141173 | 3300049459 | Bacteria | 788 |
| 714 | Ga0495682_0056187 | 3300049460 | Bacteria | 1427 |
| 715 | Ga0501031_0020490 | 3300049568 | Bacteria | 4311 |
| 716 | Ga0501032_0167496 | 3300049569 | Bacteria | 1441 |
| 717 | Ga0501034_0051979 | 3300049571 | Bacteria | 4130 |
| 718 | Ga0501034_0180614 | 3300049571 | Bacteria | 2075 |
| 719 | Ga0501034_0255901 | 3300049571 | Bacteria | 1695 |
| 720 | Ga0501034_1698074 | 3300049571 | Bacteria | 504 |
| 721 | Ga0501036_0021382 | 3300049572 | Bacteria | 5438 |
| 722 | Ga0501038_0275900 | 3300049574 | Bacteria | 1324 |
| 723 | Ga0501043_0074501 | 3300049579 | Bacteria | 2666 |
| 724 | Ga0501046_0248288 | 3300049580 | Bacteria | 1311 |
| 725 | Ga0501046_0567953 | 3300049580 | Bacteria | 807 |
| 726 | Ga0501047_0039638 | 3300049581 | Bacteria | 4555 |
| 727 | Ga0501047_0072301 | 3300049581 | Bacteria | 3320 |
| 728 | Ga0501048_0074744 | 3300049582 | Bacteria | 2391 |
| 729 | Ga0501070_0076252 | 3300049586 | Bacteria | 2776 |
| 730 | Ga0501224_000007 | 3300049664 | Bacteria | 127654 |
| 731 | Ga0501233_000599 | 3300049668 | Bacteria | 5875 |
| 732 | Ga0501225_0000055 | 3300049705 | Bacteria | 38821 |
| 733 | Ga0501234_000955 | 3300049707 | Bacteria | 4571 |
| 734 | Ga0501241_083320 | 3300049758 | Bacteria | 668 |
| 735 | Ga0501035_0012295 | 3300049822 | Bacteria | 7913 |
| 736 | Ga0501035_0278680 | 3300049822 | Bacteria | 1414 |
| 737 | Ga0501044_0203278 | 3300049823 | Bacteria | 1938 |
| 738 | Ga0501045_0866897 | 3300049824 | Bacteria | 664 |
| 739 | Ga0501226_000025 | 3300049853 | Bacteria | 91197 |
| 740 | nmdc:mga03683_34509_c1 | 3300050489 | Bacteria | 2047 |
| 741 | nmdc:mga04h51_117222_c1 | 3300050495 | Bacteria | 988 |
| 742 | nmdc:mga07m45_25838_c1 | 3300050496 | Bacteria | 3224 |
| 743 | nmdc:mga05p37_243419_c1 | 3300050507 | Bacteria | 2161 |
| 744 | nmdc:mga09592_922564_c1 | 3300050508 | Bacteria | 733 |
| 745 | nmdc:mga08y16_61453_c1 | 3300050511 | Bacteria | 3923 |
| 746 | nmdc:mga0sz30_65946_c1 | 3300050516 | Bacteria | 1552 |
| 747 | Ga0495612_0056875 | 3300053078 | Bacteria | 1615 |
| 748 | Ga0495619_0757630 | 3300053085 | Bacteria | 658 |
| 749 | Ga0500643_000293 | 3300053087 | Bacteria | 42902 |
| 750 | Ga0500643_000904 | 3300053087 | Bacteria | 18780 |
| 751 | Ga0500646_0385219 | 3300053090 | Bacteria | 516 |
| 752 | Ga0500647_0070056 | 3300053091 | Bacteria | 1686 |
| 753 | Ga0500651_0220937 | 3300053093 | Bacteria | 1111 |
| 754 | Ga0500566_0000285 | 3300053094 | Bacteria | 27164 |
| 755 | Ga0500555_007751 | 3300053103 | Bacteria | 3053 |
| 756 | Ga0500556_0008222 | 3300053104 | Bacteria | 3006 |
| 757 | Ga0500592_000213 | 3300053116 | Bacteria | 10649 |
| 758 | Ga0500592_031987 | 3300053116 | Bacteria | 849 |
| 759 | Ga0500594_0001763 | 3300053118 | Bacteria | 4714 |
| 760 | Ga0500595_004422 | 3300053119 | Bacteria | 6311 |
| 761 | Ga0500595_010229 | 3300053119 | Bacteria | 3737 |
| 762 | Ga0500608_000327 | 3300053122 | Bacteria | 18285 |
| 763 | Ga0500608_033290 | 3300053122 | Bacteria | 2452 |
| 764 | Ga0500618_014525 | 3300053125 | Bacteria | 2008 |
| 765 | Ga0500618_156611 | 3300053125 | Bacteria | 520 |
| 766 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 767 | Ga0500655_012842 | 3300053133 | Bacteria | 1524 |
| 768 | Ga0500658_0000662 | 3300053134 | Bacteria | 14169 |
| 769 | Ga0500658_0033119 | 3300053134 | Bacteria | 2030 |
| 770 | Ga0500559_0003325 | 3300053136 | Bacteria | 7963 |
| 771 | Ga0500559_0007104 | 3300053136 | Bacteria | 4992 |
| 772 | Ga0500559_0035376 | 3300053136 | Bacteria | 2157 |
| 773 | Ga0500564_000959 | 3300053138 | Bacteria | 9360 |
| 774 | Ga0500568_0004150 | 3300053139 | Bacteria | 7824 |
| 775 | Ga0500573_0002298 | 3300053140 | Bacteria | 9502 |
| 776 | Ga0500573_0177095 | 3300053140 | Bacteria | 1149 |
| 777 | Ga0500573_0246625 | 3300053140 | Bacteria | 923 |
| 778 | Ga0500577_0173313 | 3300053142 | Bacteria | 923 |
| 779 | Ga0500588_0391161 | 3300053146 | Bacteria | 529 |
| 780 | Ga0500604_0140797 | 3300053151 | Bacteria | 815 |
| 781 | Ga0500622_0197561 | 3300053156 | Bacteria | 917 |
| 782 | Ga0500624_000011 | 3300053157 | Bacteria | 168125 |
| 783 | Ga0500627_0000009 | 3300053158 | Bacteria | 153203 |
| 784 | Ga0500627_0001047 | 3300053158 | Bacteria | 7536 |
| 785 | Ga0500627_0057845 | 3300053158 | Bacteria | 1701 |
| 786 | Ga0500627_0094683 | 3300053158 | Bacteria | 1338 |
| 787 | Ga0500627_0241872 | 3300053158 | Bacteria | 800 |
| 788 | Ga0500636_0040341 | 3300053177 | Bacteria | 2761 |
| 789 | Ga0500567_001496 | 3300053723 | Bacteria | 9477 |
| 790 | Ga0500611_133902 | 3300053727 | Bacteria | 670 |
| 791 | Ga0500625_000001 | 3300053729 | Bacteria | 395993 |
| 792 | Ga0500645_000064 | 3300053730 | Bacteria | 84824 |
| 793 | Ga0500645_000705 | 3300053730 | Bacteria | 20743 |
| 794 | Ga0500645_071059 | 3300053730 | Bacteria | 999 |
| 795 | Ga0500596_006952 | 3300053735 | Bacteria | 1881 |
| 796 | Ga0466962_0038732 | 3300061719 | Bacteria | 2283 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053140 | Ga0500573_0246625 | Ga0500573_0246625_529_912 | 127 |
| 2 | 3300035241 | Ga0373961_0391148 | Ga0373961_0391148_30_431 | 133 |
| 3 | 3300037418 | Ga0395900_1286347 | Ga0395900_1286347_30_431 | 133 |
| 4 | 3300053090 | Ga0500646_0385219 | Ga0500646_0385219_10_432 | 140 |
| 5 | iso_pu_bacteria | 2675903059 | 2676486109 | 147 |
| 6 | iso_pu_bacteria | 2599185359 | 2600228428 | 150 |
| 7 | iso_pu_bacteria | 2818991466 | 2819715221 | 150 |
| 8 | iso_pu_bacteria | 2879163058 | 2879163412 | 150 |
| 9 | iso_pu_bacteria | 2928027323 | 2928031156 | 150 |
| 10 | iso_pu_bacteria | 2928526807 | 2928528039 | 150 |
| 11 | iso_pu_bacteria | 2928968154 | 2928971457 | 150 |
| 12 | 3300005262 | Ga0065165_1041615 | Ga0065165_10416152 | 151 |
| 13 | 3300006880 | Ga0075429_100424676 | Ga0075429_1004246762 | 151 |
| 14 | 3300025932 | Ga0207690_10182553 | Ga0207690_101825531 | 151 |
| 15 | 3300031911 | Ga0307412_10005336 | Ga0307412_100053367 | 151 |
| 16 | 3300032002 | Ga0307416_100339873 | Ga0307416_1003398732 | 151 |
| 17 | 3300032004 | Ga0307414_10009988 | Ga0307414_100099882 | 151 |
| 18 | 3300032133 | Ga0316583_10008044 | Ga0316583_100080446 | 151 |
| 19 | 3300035398 | Ga0316574_0203301 | Ga0316574_0203301_583_1044 | 151 |
| 20 | 3300036647 | Ga0316582_0000490 | Ga0316582_0000490_4464_4925 | 151 |
| 21 | 3300036647 | Ga0316582_0578966 | Ga0316582_0578966_191_652 | 151 |
| 22 | 3300036712 | Ga0316584_0167688 | Ga0316584_0167688_889_1350 | 151 |
| 23 | 3300036712 | Ga0316584_0337297 | Ga0316584_0337297_587_1048 | 151 |
| 24 | 3300046452 | Ga0495617_011727 | Ga0495617_011727_314_775 | 151 |
| 25 | 3300046460 | Ga0495638_0000012 | Ga0495638_0000012_372754_373215 | 151 |
| 26 | 3300046471 | Ga0495650_0023973 | Ga0495650_0023973_689_1150 | 151 |
| 27 | 3300046506 | Ga0495583_0000180 | Ga0495583_0000180_5427_5888 | 151 |
| 28 | 3300046513 | Ga0495616_0000010 | Ga0495616_0000010_56712_57173 | 151 |
| 29 | 3300046519 | Ga0495632_0000248 | Ga0495632_0000248_50780_51241 | 151 |
| 30 | 3300046524 | Ga0495648_0000151 | Ga0495648_0000151_20183_20644 | 151 |
| 31 | 3300046558 | Ga0495633_0009411 | Ga0495633_0009411_2289_2750 | 151 |
| 32 | 3300046616 | Ga0495668_0002391 | Ga0495668_0002391_5341_5802 | 151 |
| 33 | 3300046692 | Ga0495671_0000023 | Ga0495671_0000023_149163_149624 | 151 |
| 34 | 3300047469 | Ga0495673_0000054 | Ga0495673_0000054_149148_149609 | 151 |
| 35 | 3300050508 | nmdc:mga09592_922564_c1 | nmdc:mga09592_922564_c1_101_562 | 151 |
| 36 | 3300053085 | Ga0495619_0757630 | Ga0495619_0757630_44_505 | 151 |
| 37 | 3300053146 | Ga0500588_0391161 | Ga0500588_0391161_26_487 | 151 |
| 38 | 3300053158 | Ga0500627_0001047 | Ga0500627_0001047_3062_3523 | 151 |
| 39 | iso_pu_bacteria | 2739367664 | 2739648892 | 151 |
| 40 | iso_pu_bacteria | 2739367865 | 2740027365 | 151 |
| 41 | iso_pu_bacteria | 2885429604 | 2885430973 | 151 |
| 42 | iso_pu_bacteria | 8057101203 | 8057101428 | 151 |
| 43 | 3300001979 | JGI24740J21852_10025651 | JGI24740J21852_100256513 | 152 |
| 44 | 3300002067 | JGI24735J21928_10003268 | JGI24735J21928_100032681 | 152 |
| 45 | 3300002067 | JGI24735J21928_10109069 | JGI24735J21928_101090692 | 152 |
| 46 | 3300002075 | JGI24738J21930_10003879 | JGI24738J21930_100038793 | 152 |
| 47 | 3300005327 | Ga0070658_10030316 | Ga0070658_100303164 | 152 |
| 48 | 3300005327 | Ga0070658_10054034 | Ga0070658_100540343 | 152 |
| 49 | 3300005336 | Ga0070680_100837885 | Ga0070680_1008378852 | 152 |
| 50 | 3300005339 | Ga0070660_100057997 | Ga0070660_1000579976 | 152 |
| 51 | 3300005339 | Ga0070660_100107890 | Ga0070660_1001078901 | 152 |
| 52 | 3300005344 | Ga0070661_100139342 | Ga0070661_1001393422 | 152 |
| 53 | 3300005345 | Ga0070692_10000142 | Ga0070692_1000014219 | 152 |
| 54 | 3300005455 | Ga0070663_100003059 | Ga0070663_10000305915 | 152 |
| 55 | 3300005455 | Ga0070663_100044176 | Ga0070663_1000441766 | 152 |
| 56 | 3300005539 | Ga0068853_100072366 | Ga0068853_1000723664 | 152 |
| 57 | 3300005563 | Ga0068855_100302634 | Ga0068855_1003026344 | 152 |
| 58 | 3300005563 | Ga0068855_100619267 | Ga0068855_1006192672 | 152 |
| 59 | 3300005578 | Ga0068854_100000559 | Ga0068854_10000055917 | 152 |
| 60 | 3300005578 | Ga0068854_100026578 | Ga0068854_1000265788 | 152 |
| 61 | 3300005616 | Ga0068852_100058186 | Ga0068852_1000581866 | 152 |
| 62 | 3300006237 | Ga0097621_100285331 | Ga0097621_1002853313 | 152 |
| 63 | 3300006358 | Ga0068871_100005363 | Ga0068871_10000536311 | 152 |
| 64 | 3300009093 | Ga0105240_10699040 | Ga0105240_106990401 | 152 |
| 65 | 3300009545 | Ga0105237_10181775 | Ga0105237_101817752 | 152 |
| 66 | 3300010375 | Ga0105239_10089892 | Ga0105239_100898922 | 152 |
| 67 | 3300013104 | Ga0157370_10724662 | Ga0157370_107246622 | 152 |
| 68 | 3300013105 | Ga0157369_10322135 | Ga0157369_103221352 | 152 |
| 69 | 3300013307 | Ga0157372_10935612 | Ga0157372_109356122 | 152 |
| 70 | 3300013308 | Ga0157375_12321886 | Ga0157375_123218861 | 152 |
| 71 | 3300025246 | Ga0209646_1015807 | Ga0209646_10158072 | 152 |
| 72 | 3300025272 | Ga0209455_1000772 | Ga0209455_10007729 | 152 |
| 73 | 3300025321 | Ga0207656_10066705 | Ga0207656_100667052 | 152 |
| 74 | 3300025904 | Ga0207647_10007714 | Ga0207647_1000771413 | 152 |
| 75 | 3300025909 | Ga0207705_10002705 | Ga0207705_1000270518 | 152 |
| 76 | 3300025909 | Ga0207705_10026902 | Ga0207705_100269024 | 152 |
| 77 | 3300025909 | Ga0207705_10106802 | Ga0207705_101068022 | 152 |
| 78 | 3300025911 | Ga0207654_10517952 | Ga0207654_105179521 | 152 |
| 79 | 3300025914 | Ga0207671_10024252 | Ga0207671_100242527 | 152 |
| 80 | 3300025917 | Ga0207660_10731325 | Ga0207660_107313252 | 152 |
| 81 | 3300025919 | Ga0207657_10010415 | Ga0207657_100104159 | 152 |
| 82 | 3300025919 | Ga0207657_10112964 | Ga0207657_101129645 | 152 |
| 83 | 3300025920 | Ga0207649_10095289 | Ga0207649_100952892 | 152 |
| 84 | 3300025924 | Ga0207694_10062555 | Ga0207694_100625554 | 152 |
| 85 | 3300025932 | Ga0207690_10018054 | Ga0207690_100180545 | 152 |
| 86 | 3300025981 | Ga0207640_10000202 | Ga0207640_1000020236 | 152 |
| 87 | 3300025981 | Ga0207640_10026210 | Ga0207640_100262107 | 152 |
| 88 | 3300026041 | Ga0207639_10004994 | Ga0207639_100049941 | 152 |
| 89 | 3300026067 | Ga0207678_10002000 | Ga0207678_1000200011 | 152 |
| 90 | 3300026067 | Ga0207678_10046585 | Ga0207678_100465852 | 152 |
| 91 | 3300026116 | Ga0207674_10236171 | Ga0207674_102361713 | 152 |
| 92 | 3300026142 | Ga0207698_10041296 | Ga0207698_100412966 | 152 |
| 93 | 3300031456 | Ga0307513_10206273 | Ga0307513_102062732 | 152 |
| 94 | 3300031911 | Ga0307412_10001328 | Ga0307412_100013288 | 152 |
| 95 | 3300031911 | Ga0307412_11342480 | Ga0307412_113424801 | 152 |
| 96 | 3300046453 | Ga0495627_025915 | Ga0495627_025915_1174_1632 | 152 |
| 97 | 3300046460 | Ga0495638_0059419 | Ga0495638_0059419_445_903 | 152 |
| 98 | 3300046506 | Ga0495583_0000643 | Ga0495583_0000643_20949_21407 | 152 |
| 99 | 3300046524 | Ga0495648_0026719 | Ga0495648_0026719_1076_1555 | 152 |
| 100 | 3300046691 | Ga0495670_0006307 | Ga0495670_0006307_4577_5041 | 152 |
| 101 | 3300046691 | Ga0495670_0260499 | Ga0495670_0260499_183_641 | 152 |
| 102 | 3300046692 | Ga0495671_0220005 | Ga0495671_0220005_39_497 | 152 |
| 103 | 3300047472 | Ga0495686_0006227 | Ga0495686_0006227_1619_2077 | 152 |
| 104 | 3300047472 | Ga0495686_0007366 | Ga0495686_0007366_5328_5786 | 152 |
| 105 | 3300047472 | Ga0495686_0018195 | Ga0495686_0018195_3701_4159 | 152 |
| 106 | 3300047472 | Ga0495686_0084881 | Ga0495686_0084881_1380_1838 | 152 |
| 107 | 3300048906 | Ga0496103_0473379 | Ga0496103_0473379_288_752 | 152 |
| 108 | 3300048920 | Ga0496117_0094080 | Ga0496117_0094080_941_1405 | 152 |
| 109 | 3300048922 | Ga0496119_0150677 | Ga0496119_0150677_73_537 | 152 |
| 110 | 3300048925 | Ga0496122_0126510 | Ga0496122_0126510_967_1431 | 152 |
| 111 | 3300048925 | Ga0496122_0329098 | Ga0496122_0329098_311_775 | 152 |
| 112 | 3300048926 | Ga0496123_0065252 | Ga0496123_0065252_546_1010 | 152 |
| 113 | 3300048926 | Ga0496123_0077610 | Ga0496123_0077610_903_1367 | 152 |
| 114 | 3300048927 | Ga0496124_0000889 | Ga0496124_0000889_14763_15227 | 152 |
| 115 | 3300048927 | Ga0496124_0073812 | Ga0496124_0073812_965_1429 | 152 |
| 116 | 3300048927 | Ga0496124_0325858 | Ga0496124_0325858_305_763 | 152 |
| 117 | 3300048929 | Ga0496126_0171090 | Ga0496126_0171090_996_1460 | 152 |
| 118 | 3300049460 | Ga0495682_0056187 | Ga0495682_0056187_536_994 | 152 |
| 119 | 3300053103 | Ga0500555_007751 | Ga0500555_007751_280_738 | 152 |
| 120 | 3300053104 | Ga0500556_0008222 | Ga0500556_0008222_300_758 | 152 |
| 121 | 3300053125 | Ga0500618_156611 | Ga0500618_156611_49_507 | 152 |
| 122 | 3300053136 | Ga0500559_0007104 | Ga0500559_0007104_947_1405 | 152 |
| 123 | 3300053142 | Ga0500577_0173313 | Ga0500577_0173313_291_749 | 152 |
| 124 | 3300053157 | Ga0500624_000011 | Ga0500624_000011_67824_68282 | 152 |
| 125 | 3300053730 | Ga0500645_000705 | Ga0500645_000705_1099_1557 | 152 |
| 126 | 3300053730 | Ga0500645_071059 | Ga0500645_071059_261_725 | 152 |
| 127 | iso_pu_bacteria | 2984555340 | 2984556467 | 152 |
| 128 | iso_pu_bacteria | 2984564862 | 2984565359 | 152 |
| 129 | iso_pu_bacteria | 2990265787 | 2990268925 | 152 |
| 130 | iso_pu_bacteria | 2993356040 | 2993356435 | 152 |
| 131 | iso_pu_bacteria | 2993693658 | 2993697264 | 152 |
| 132 | 3300000041 | ARcpr5oldR_c001506 | ARcpr5oldR_0015063 | 153 |
| 133 | 3300001989 | JGI24739J22299_10000524 | JGI24739J22299_1000052415 | 153 |
| 134 | 3300001989 | JGI24739J22299_10013165 | JGI24739J22299_100131652 | 153 |
| 135 | 3300002067 | JGI24735J21928_10019703 | JGI24735J21928_100197032 | 153 |
| 136 | 3300002074 | JGI24748J21848_1019863 | JGI24748J21848_10198632 | 153 |
| 137 | 3300003214 | JGI25165J46597_1000010 | JGI25165J46597_1000010256 | 153 |
| 138 | 3300003215 | JGI25153J46596_10006448 | JGI25153J46596_100064488 | 153 |
| 139 | 3300003773 | Ga0055537_1000460 | Ga0055537_100046026 | 153 |
| 140 | 3300003775 | Ga0055524_1000155 | Ga0055524_100015531 | 153 |
| 141 | 3300003791 | Ga0055530_10001208 | Ga0055530_1000120820 | 153 |
| 142 | 3300003791 | Ga0055530_10008781 | Ga0055530_100087815 | 153 |
| 143 | 3300003794 | Ga0055531_10000792 | Ga0055531_1000079213 | 153 |
| 144 | 3300003794 | Ga0055531_10002671 | Ga0055531_100026715 | 153 |
| 145 | 3300005262 | Ga0065165_1007583 | Ga0065165_10075835 | 153 |
| 146 | 3300005262 | Ga0065165_1018077 | Ga0065165_10180771 | 153 |
| 147 | 3300005327 | Ga0070658_10000003 | Ga0070658_10000003118 | 153 |
| 148 | 3300005327 | Ga0070658_10021495 | Ga0070658_100214957 | 153 |
| 149 | 3300005327 | Ga0070658_10033779 | Ga0070658_100337792 | 153 |
| 150 | 3300005327 | Ga0070658_10166424 | Ga0070658_101664243 | 153 |
| 151 | 3300005329 | Ga0070683_100559908 | Ga0070683_1005599082 | 153 |
| 152 | 3300005331 | Ga0070670_100746266 | Ga0070670_1007462662 | 153 |
| 153 | 3300005331 | Ga0070670_101154386 | Ga0070670_1011543861 | 153 |
| 154 | 3300005336 | Ga0070680_100025459 | Ga0070680_1000254598 | 153 |
| 155 | 3300005336 | Ga0070680_100034426 | Ga0070680_1000344266 | 153 |
| 156 | 3300005336 | Ga0070680_100104058 | Ga0070680_1001040582 | 153 |
| 157 | 3300005337 | Ga0070682_100579292 | Ga0070682_1005792921 | 153 |
| 158 | 3300005338 | Ga0068868_100565982 | Ga0068868_1005659822 | 153 |
| 159 | 3300005339 | Ga0070660_100059329 | Ga0070660_1000593292 | 153 |
| 160 | 3300005339 | Ga0070660_100088967 | Ga0070660_1000889672 | 153 |
| 161 | 3300005339 | Ga0070660_100397916 | Ga0070660_1003979162 | 153 |
| 162 | 3300005339 | Ga0070660_100408703 | Ga0070660_1004087032 | 153 |
| 163 | 3300005344 | Ga0070661_100267307 | Ga0070661_1002673072 | 153 |
| 164 | 3300005344 | Ga0070661_100585399 | Ga0070661_1005853991 | 153 |
| 165 | 3300005345 | Ga0070692_10159865 | Ga0070692_101598652 | 153 |
| 166 | 3300005347 | Ga0070668_100000011 | Ga0070668_10000001158 | 153 |
| 167 | 3300005355 | Ga0070671_100003480 | Ga0070671_1000034809 | 153 |
| 168 | 3300005355 | Ga0070671_100093078 | Ga0070671_1000930782 | 153 |
| 169 | 3300005355 | Ga0070671_100671018 | Ga0070671_1006710182 | 153 |
| 170 | 3300005364 | Ga0070673_100015570 | Ga0070673_1000155703 | 153 |
| 171 | 3300005364 | Ga0070673_100828271 | Ga0070673_1008282712 | 153 |
| 172 | 3300005366 | Ga0070659_100003069 | Ga0070659_1000030693 | 153 |
| 173 | 3300005366 | Ga0070659_100021627 | Ga0070659_1000216276 | 153 |
| 174 | 3300005366 | Ga0070659_100090402 | Ga0070659_1000904023 | 153 |
| 175 | 3300005366 | Ga0070659_100157669 | Ga0070659_1001576692 | 153 |
| 176 | 3300005366 | Ga0070659_100202257 | Ga0070659_1002022572 | 153 |
| 177 | 3300005367 | Ga0070667_100383351 | Ga0070667_1003833512 | 153 |
| 178 | 3300005435 | Ga0070714_100263657 | Ga0070714_1002636572 | 153 |
| 179 | 3300005435 | Ga0070714_100556978 | Ga0070714_1005569782 | 153 |
| 180 | 3300005455 | Ga0070663_100050017 | Ga0070663_1000500174 | 153 |
| 181 | 3300005457 | Ga0070662_100065006 | Ga0070662_1000650063 | 153 |
| 182 | 3300005457 | Ga0070662_100121909 | Ga0070662_1001219092 | 153 |
| 183 | 3300005458 | Ga0070681_10029494 | Ga0070681_100294949 | 153 |
| 184 | 3300005458 | Ga0070681_10072402 | Ga0070681_100724026 | 153 |
| 185 | 3300005458 | Ga0070681_10105457 | Ga0070681_101054573 | 153 |
| 186 | 3300005458 | Ga0070681_10172151 | Ga0070681_101721512 | 153 |
| 187 | 3300005467 | Ga0070706_100028793 | Ga0070706_1000287932 | 153 |
| 188 | 3300005530 | Ga0070679_100077764 | Ga0070679_1000777645 | 153 |
| 189 | 3300005530 | Ga0070679_100095520 | Ga0070679_1000955202 | 153 |
| 190 | 3300005530 | Ga0070679_100173758 | Ga0070679_1001737582 | 153 |
| 191 | 3300005530 | Ga0070679_100191645 | Ga0070679_1001916452 | 153 |
| 192 | 3300005530 | Ga0070679_100332936 | Ga0070679_1003329362 | 153 |
| 193 | 3300005530 | Ga0070679_100340828 | Ga0070679_1003408282 | 153 |
| 194 | 3300005530 | Ga0070679_100650877 | Ga0070679_1006508772 | 153 |
| 195 | 3300005530 | Ga0070679_100651978 | Ga0070679_1006519782 | 153 |
| 196 | 3300005535 | Ga0070684_100329502 | Ga0070684_1003295022 | 153 |
| 197 | 3300005539 | Ga0068853_100054892 | Ga0068853_1000548925 | 153 |
| 198 | 3300005539 | Ga0068853_100220247 | Ga0068853_1002202472 | 153 |
| 199 | 3300005539 | Ga0068853_100247300 | Ga0068853_1002473002 | 153 |
| 200 | 3300005539 | Ga0068853_100642700 | Ga0068853_1006427002 | 153 |
| 201 | 3300005539 | Ga0068853_101379521 | Ga0068853_1013795211 | 153 |
| 202 | 3300005545 | Ga0070695_100075268 | Ga0070695_1000752685 | 153 |
| 203 | 3300005546 | Ga0070696_100021044 | Ga0070696_1000210447 | 153 |
| 204 | 3300005546 | Ga0070696_100461594 | Ga0070696_1004615942 | 153 |
| 205 | 3300005547 | Ga0070693_100148555 | Ga0070693_1001485552 | 153 |
| 206 | 3300005547 | Ga0070693_100198996 | Ga0070693_1001989962 | 153 |
| 207 | 3300005548 | Ga0070665_100044221 | Ga0070665_1000442213 | 153 |
| 208 | 3300005548 | Ga0070665_100291629 | Ga0070665_1002916294 | 153 |
| 209 | 3300005549 | Ga0070704_100316459 | Ga0070704_1003164592 | 153 |
| 210 | 3300005563 | Ga0068855_100048687 | Ga0068855_1000486873 | 153 |
| 211 | 3300005563 | Ga0068855_100051070 | Ga0068855_1000510705 | 153 |
| 212 | 3300005563 | Ga0068855_100129913 | Ga0068855_1001299135 | 153 |
| 213 | 3300005563 | Ga0068855_100189877 | Ga0068855_1001898772 | 153 |
| 214 | 3300005563 | Ga0068855_100289358 | Ga0068855_1002893582 | 153 |
| 215 | 3300005563 | Ga0068855_100315793 | Ga0068855_1003157932 | 153 |
| 216 | 3300005563 | Ga0068855_100454337 | Ga0068855_1004543372 | 153 |
| 217 | 3300005564 | Ga0070664_100107856 | Ga0070664_1001078563 | 153 |
| 218 | 3300005564 | Ga0070664_100183721 | Ga0070664_1001837212 | 153 |
| 219 | 3300005564 | Ga0070664_100853026 | Ga0070664_1008530261 | 153 |
| 220 | 3300005564 | Ga0070664_101305074 | Ga0070664_1013050741 | 153 |
| 221 | 3300005577 | Ga0068857_100094218 | Ga0068857_1000942185 | 153 |
| 222 | 3300005577 | Ga0068857_100142446 | Ga0068857_1001424462 | 153 |
| 223 | 3300005577 | Ga0068857_100276997 | Ga0068857_1002769972 | 153 |
| 224 | 3300005578 | Ga0068854_100039382 | Ga0068854_1000393826 | 153 |
| 225 | 3300005578 | Ga0068854_100417427 | Ga0068854_1004174272 | 153 |
| 226 | 3300005578 | Ga0068854_100527255 | Ga0068854_1005272552 | 153 |
| 227 | 3300005578 | Ga0068854_100764096 | Ga0068854_1007640962 | 153 |
| 228 | 3300005614 | Ga0068856_100027149 | Ga0068856_1000271493 | 153 |
| 229 | 3300005614 | Ga0068856_100052866 | Ga0068856_1000528663 | 153 |
| 230 | 3300005614 | Ga0068856_100072762 | Ga0068856_1000727626 | 153 |
| 231 | 3300005614 | Ga0068856_100115596 | Ga0068856_1001155963 | 153 |
| 232 | 3300005614 | Ga0068856_100427271 | Ga0068856_1004272712 | 153 |
| 233 | 3300005614 | Ga0068856_101210619 | Ga0068856_1012106192 | 153 |
| 234 | 3300005616 | Ga0068852_100032215 | Ga0068852_1000322158 | 153 |
| 235 | 3300005616 | Ga0068852_100047102 | Ga0068852_1000471022 | 153 |
| 236 | 3300005616 | Ga0068852_100048090 | Ga0068852_1000480904 | 153 |
| 237 | 3300005616 | Ga0068852_100073666 | Ga0068852_1000736663 | 153 |
| 238 | 3300005616 | Ga0068852_100814070 | Ga0068852_1008140702 | 153 |
| 239 | 3300005616 | Ga0068852_100922176 | Ga0068852_1009221762 | 153 |
| 240 | 3300005616 | Ga0068852_101108464 | Ga0068852_1011084641 | 153 |
| 241 | 3300005617 | Ga0068859_100032942 | Ga0068859_1000329423 | 153 |
| 242 | 3300005618 | Ga0068864_100018954 | Ga0068864_1000189543 | 153 |
| 243 | 3300005719 | Ga0068861_100772769 | Ga0068861_1007727692 | 153 |
| 244 | 3300005834 | Ga0068851_10021086 | Ga0068851_100210862 | 153 |
| 245 | 3300005834 | Ga0068851_10022086 | Ga0068851_100220864 | 153 |
| 246 | 3300005841 | Ga0068863_100000186 | Ga0068863_10000018659 | 153 |
| 247 | 3300005841 | Ga0068863_100593238 | Ga0068863_1005932382 | 153 |
| 248 | 3300005842 | Ga0068858_100000102 | Ga0068858_10000010241 | 153 |
| 249 | 3300005842 | Ga0068858_100001966 | Ga0068858_1000019663 | 153 |
| 250 | 3300005842 | Ga0068858_100309087 | Ga0068858_1003090873 | 153 |
| 251 | 3300005844 | Ga0068862_100312956 | Ga0068862_1003129562 | 153 |
| 252 | 3300006186 | Ga0075369_10165462 | Ga0075369_101654622 | 153 |
| 253 | 3300006358 | Ga0068871_100682245 | Ga0068871_1006822452 | 153 |
| 254 | 3300006844 | Ga0075428_100050761 | Ga0075428_1000507614 | 153 |
| 255 | 3300006844 | Ga0075428_101653890 | Ga0075428_1016538902 | 153 |
| 256 | 3300006931 | Ga0097620_100032942 | Ga0097620_1000329428 | 153 |
| 257 | 3300009093 | Ga0105240_10008649 | Ga0105240_1000864911 | 153 |
| 258 | 3300009093 | Ga0105240_10022129 | Ga0105240_1002212912 | 153 |
| 259 | 3300009093 | Ga0105240_10186565 | Ga0105240_101865652 | 153 |
| 260 | 3300009094 | Ga0111539_10016465 | Ga0111539_100164658 | 153 |
| 261 | 3300009098 | Ga0105245_10001046 | Ga0105245_1000104619 | 153 |
| 262 | 3300009101 | Ga0105247_10109991 | Ga0105247_101099912 | 153 |
| 263 | 3300009147 | Ga0114129_10170049 | Ga0114129_101700494 | 153 |
| 264 | 3300009148 | Ga0105243_10028129 | Ga0105243_100281299 | 153 |
| 265 | 3300009174 | Ga0105241_10194511 | Ga0105241_101945111 | 153 |
| 266 | 3300009174 | Ga0105241_10832781 | Ga0105241_108327812 | 153 |
| 267 | 3300009177 | Ga0105248_10003638 | Ga0105248_1000363811 | 153 |
| 268 | 3300009177 | Ga0105248_10028673 | Ga0105248_100286736 | 153 |
| 269 | 3300009177 | Ga0105248_10032137 | Ga0105248_100321375 | 153 |
| 270 | 3300009177 | Ga0105248_10392213 | Ga0105248_103922132 | 153 |
| 271 | 3300009545 | Ga0105237_10104546 | Ga0105237_101045463 | 153 |
| 272 | 3300009545 | Ga0105237_11559915 | Ga0105237_115599151 | 153 |
| 273 | 3300009551 | Ga0105238_10036999 | Ga0105238_100369992 | 153 |
| 274 | 3300009551 | Ga0105238_10067960 | Ga0105238_100679606 | 153 |
| 275 | 3300009551 | Ga0105238_10092085 | Ga0105238_100920852 | 153 |
| 276 | 3300009551 | Ga0105238_10390045 | Ga0105238_103900452 | 153 |
| 277 | 3300009551 | Ga0105238_10402836 | Ga0105238_104028362 | 153 |
| 278 | 3300009551 | Ga0105238_10707038 | Ga0105238_107070382 | 153 |
| 279 | 3300009553 | Ga0105249_10014831 | Ga0105249_100148313 | 153 |
| 280 | 3300010375 | Ga0105239_12106981 | Ga0105239_121069812 | 153 |
| 281 | 3300013100 | Ga0157373_10016847 | Ga0157373_100168478 | 153 |
| 282 | 3300013100 | Ga0157373_10040258 | Ga0157373_100402584 | 153 |
| 283 | 3300013100 | Ga0157373_10075053 | Ga0157373_100750533 | 153 |
| 284 | 3300013100 | Ga0157373_10242676 | Ga0157373_102426762 | 153 |
| 285 | 3300013100 | Ga0157373_10551089 | Ga0157373_105510891 | 153 |
| 286 | 3300013102 | Ga0157371_10155848 | Ga0157371_101558482 | 153 |
| 287 | 3300013102 | Ga0157371_10172510 | Ga0157371_101725102 | 153 |
| 288 | 3300013102 | Ga0157371_10306500 | Ga0157371_103065002 | 153 |
| 289 | 3300013104 | Ga0157370_10036353 | Ga0157370_100363532 | 153 |
| 290 | 3300013104 | Ga0157370_10125312 | Ga0157370_101253121 | 153 |
| 291 | 3300013104 | Ga0157370_10131295 | Ga0157370_101312952 | 153 |
| 292 | 3300013104 | Ga0157370_10172340 | Ga0157370_101723402 | 153 |
| 293 | 3300013105 | Ga0157369_10002615 | Ga0157369_100026153 | 153 |
| 294 | 3300013105 | Ga0157369_10070306 | Ga0157369_100703063 | 153 |
| 295 | 3300013105 | Ga0157369_10121654 | Ga0157369_101216543 | 153 |
| 296 | 3300013296 | Ga0157374_10155077 | Ga0157374_101550772 | 153 |
| 297 | 3300013297 | Ga0157378_10048347 | Ga0157378_100483472 | 153 |
| 298 | 3300013306 | Ga0163162_10009164 | Ga0163162_100091648 | 153 |
| 299 | 3300013306 | Ga0163162_10009790 | Ga0163162_100097906 | 153 |
| 300 | 3300013306 | Ga0163162_10639562 | Ga0163162_106395621 | 153 |
| 301 | 3300013307 | Ga0157372_10002970 | Ga0157372_1000297018 | 153 |
| 302 | 3300013307 | Ga0157372_10319859 | Ga0157372_103198591 | 153 |
| 303 | 3300013307 | Ga0157372_10655508 | Ga0157372_106555081 | 153 |
| 304 | 3300013307 | Ga0157372_11340683 | Ga0157372_113406832 | 153 |
| 305 | 3300014325 | Ga0163163_10248751 | Ga0163163_102487511 | 153 |
| 306 | 3300014325 | Ga0163163_10450992 | Ga0163163_104509922 | 153 |
| 307 | 3300014497 | Ga0182008_10505366 | Ga0182008_105053662 | 153 |
| 308 | 3300020070 | Ga0206356_11202361 | Ga0206356_112023612 | 153 |
| 309 | 3300020081 | Ga0206354_10168296 | Ga0206354_101682962 | 153 |
| 310 | 3300020082 | Ga0206353_12012794 | Ga0206353_120127942 | 153 |
| 311 | 3300025233 | Ga0209437_111975 | Ga0209437_1119752 | 153 |
| 312 | 3300025245 | Ga0207425_1007250 | Ga0207425_10072502 | 153 |
| 313 | 3300025261 | Ga0209233_1000044 | Ga0209233_1000044225 | 153 |
| 314 | 3300025263 | Ga0209565_1000011 | Ga0209565_100001179 | 153 |
| 315 | 3300025272 | Ga0209455_1025746 | Ga0209455_10257462 | 153 |
| 316 | 3300025273 | Ga0209673_1002122 | Ga0209673_10021226 | 153 |
| 317 | 3300025291 | Ga0209675_1013492 | Ga0209675_10134922 | 153 |
| 318 | 3300025297 | Ga0209758_1008891 | Ga0209758_10088916 | 153 |
| 319 | 3300025298 | Ga0209050_1000071 | Ga0209050_100007113 | 153 |
| 320 | 3300025298 | Ga0209050_1002140 | Ga0209050_10021405 | 153 |
| 321 | 3300025299 | Ga0209256_1000016 | Ga0209256_1000016520 | 153 |
| 322 | 3300025304 | Ga0209257_1000027 | Ga0209257_1000027290 | 153 |
| 323 | 3300025304 | Ga0209257_1001434 | Ga0209257_100143418 | 153 |
| 324 | 3300025321 | Ga0207656_10025320 | Ga0207656_100253202 | 153 |
| 325 | 3300025321 | Ga0207656_10039366 | Ga0207656_100393662 | 153 |
| 326 | 3300025903 | Ga0207680_10719372 | Ga0207680_107193721 | 153 |
| 327 | 3300025904 | Ga0207647_10024741 | Ga0207647_100247414 | 153 |
| 328 | 3300025909 | Ga0207705_10009941 | Ga0207705_100099416 | 153 |
| 329 | 3300025909 | Ga0207705_10033221 | Ga0207705_100332212 | 153 |
| 330 | 3300025909 | Ga0207705_10427571 | Ga0207705_104275712 | 153 |
| 331 | 3300025910 | Ga0207684_10421321 | Ga0207684_104213212 | 153 |
| 332 | 3300025911 | Ga0207654_10792998 | Ga0207654_107929981 | 153 |
| 333 | 3300025912 | Ga0207707_10044083 | Ga0207707_100440833 | 153 |
| 334 | 3300025912 | Ga0207707_10149531 | Ga0207707_101495314 | 153 |
| 335 | 3300025912 | Ga0207707_10191173 | Ga0207707_101911732 | 153 |
| 336 | 3300025913 | Ga0207695_10026017 | Ga0207695_1002601711 | 153 |
| 337 | 3300025913 | Ga0207695_10199135 | Ga0207695_101991352 | 153 |
| 338 | 3300025913 | Ga0207695_11185612 | Ga0207695_111856121 | 153 |
| 339 | 3300025914 | Ga0207671_10088723 | Ga0207671_100887233 | 153 |
| 340 | 3300025917 | Ga0207660_10000024 | Ga0207660_100000242 | 153 |
| 341 | 3300025917 | Ga0207660_10060824 | Ga0207660_100608244 | 153 |
| 342 | 3300025917 | Ga0207660_10225842 | Ga0207660_102258422 | 153 |
| 343 | 3300025917 | Ga0207660_10447300 | Ga0207660_104473002 | 153 |
| 344 | 3300025917 | Ga0207660_10490502 | Ga0207660_104905022 | 153 |
| 345 | 3300025919 | Ga0207657_10007988 | Ga0207657_1000798812 | 153 |
| 346 | 3300025919 | Ga0207657_10046672 | Ga0207657_100466724 | 153 |
| 347 | 3300025919 | Ga0207657_10053077 | Ga0207657_100530773 | 153 |
| 348 | 3300025919 | Ga0207657_10103276 | Ga0207657_101032765 | 153 |
| 349 | 3300025919 | Ga0207657_10109325 | Ga0207657_101093252 | 153 |
| 350 | 3300025919 | Ga0207657_10583406 | Ga0207657_105834062 | 153 |
| 351 | 3300025919 | Ga0207657_11032159 | Ga0207657_110321592 | 153 |
| 352 | 3300025920 | Ga0207649_10059417 | Ga0207649_100594172 | 153 |
| 353 | 3300025920 | Ga0207649_10089449 | Ga0207649_100894492 | 153 |
| 354 | 3300025920 | Ga0207649_10597774 | Ga0207649_105977742 | 153 |
| 355 | 3300025921 | Ga0207652_10073532 | Ga0207652_100735323 | 153 |
| 356 | 3300025921 | Ga0207652_10092414 | Ga0207652_100924142 | 153 |
| 357 | 3300025921 | Ga0207652_10148018 | Ga0207652_101480183 | 153 |
| 358 | 3300025921 | Ga0207652_10159255 | Ga0207652_101592552 | 153 |
| 359 | 3300025921 | Ga0207652_10293774 | Ga0207652_102937742 | 153 |
| 360 | 3300025921 | Ga0207652_10410785 | Ga0207652_104107852 | 153 |
| 361 | 3300025921 | Ga0207652_10480000 | Ga0207652_104800002 | 153 |
| 362 | 3300025921 | Ga0207652_11018435 | Ga0207652_110184352 | 153 |
| 363 | 3300025924 | Ga0207694_10020412 | Ga0207694_100204126 | 153 |
| 364 | 3300025924 | Ga0207694_10029168 | Ga0207694_100291682 | 153 |
| 365 | 3300025924 | Ga0207694_11336831 | Ga0207694_113368311 | 153 |
| 366 | 3300025925 | Ga0207650_10018464 | Ga0207650_100184643 | 153 |
| 367 | 3300025927 | Ga0207687_10000562 | Ga0207687_1000056218 | 153 |
| 368 | 3300025929 | Ga0207664_10066774 | Ga0207664_100667743 | 153 |
| 369 | 3300025929 | Ga0207664_10500508 | Ga0207664_105005082 | 153 |
| 370 | 3300025931 | Ga0207644_10000032 | Ga0207644_1000003262 | 153 |
| 371 | 3300025931 | Ga0207644_10051599 | Ga0207644_100515992 | 153 |
| 372 | 3300025931 | Ga0207644_10102939 | Ga0207644_101029392 | 153 |
| 373 | 3300025931 | Ga0207644_10374951 | Ga0207644_103749512 | 153 |
| 374 | 3300025931 | Ga0207644_10521877 | Ga0207644_105218771 | 153 |
| 375 | 3300025932 | Ga0207690_10063579 | Ga0207690_100635793 | 153 |
| 376 | 3300025932 | Ga0207690_10078402 | Ga0207690_100784023 | 153 |
| 377 | 3300025932 | Ga0207690_10147247 | Ga0207690_101472472 | 153 |
| 378 | 3300025932 | Ga0207690_10675176 | Ga0207690_106751762 | 153 |
| 379 | 3300025933 | Ga0207706_10004718 | Ga0207706_100047182 | 153 |
| 380 | 3300025933 | Ga0207706_10067824 | Ga0207706_100678245 | 153 |
| 381 | 3300025940 | Ga0207691_10068308 | Ga0207691_100683083 | 153 |
| 382 | 3300025941 | Ga0207711_10002908 | Ga0207711_1000290814 | 153 |
| 383 | 3300025941 | Ga0207711_10012212 | Ga0207711_100122125 | 153 |
| 384 | 3300025941 | Ga0207711_10468112 | Ga0207711_104681122 | 153 |
| 385 | 3300025944 | Ga0207661_10732046 | Ga0207661_107320462 | 153 |
| 386 | 3300025945 | Ga0207679_10033400 | Ga0207679_100334004 | 153 |
| 387 | 3300025945 | Ga0207679_10228292 | Ga0207679_102282922 | 153 |
| 388 | 3300025945 | Ga0207679_11018164 | Ga0207679_110181641 | 153 |
| 389 | 3300025949 | Ga0207667_10025172 | Ga0207667_100251729 | 153 |
| 390 | 3300025949 | Ga0207667_10041234 | Ga0207667_100412347 | 153 |
| 391 | 3300025949 | Ga0207667_10053956 | Ga0207667_100539562 | 153 |
| 392 | 3300025949 | Ga0207667_10070885 | Ga0207667_100708852 | 153 |
| 393 | 3300025949 | Ga0207667_10357924 | Ga0207667_103579242 | 153 |
| 394 | 3300025949 | Ga0207667_10497892 | Ga0207667_104978922 | 153 |
| 395 | 3300025960 | Ga0207651_10171341 | Ga0207651_101713413 | 153 |
| 396 | 3300025961 | Ga0207712_10033349 | Ga0207712_100333492 | 153 |
| 397 | 3300025972 | Ga0207668_10000034 | Ga0207668_1000003459 | 153 |
| 398 | 3300025981 | Ga0207640_10156959 | Ga0207640_101569592 | 153 |
| 399 | 3300025981 | Ga0207640_10879216 | Ga0207640_108792162 | 153 |
| 400 | 3300026035 | Ga0207703_10000190 | Ga0207703_1000019028 | 153 |
| 401 | 3300026035 | Ga0207703_10034927 | Ga0207703_100349275 | 153 |
| 402 | 3300026035 | Ga0207703_10282134 | Ga0207703_102821342 | 153 |
| 403 | 3300026041 | Ga0207639_10002119 | Ga0207639_100021192 | 153 |
| 404 | 3300026041 | Ga0207639_10087630 | Ga0207639_100876303 | 153 |
| 405 | 3300026041 | Ga0207639_10094791 | Ga0207639_100947913 | 153 |
| 406 | 3300026041 | Ga0207639_10559991 | Ga0207639_105599912 | 153 |
| 407 | 3300026041 | Ga0207639_10659466 | Ga0207639_106594662 | 153 |
| 408 | 3300026041 | Ga0207639_10846312 | Ga0207639_108463122 | 153 |
| 409 | 3300026067 | Ga0207678_10000455 | Ga0207678_1000045525 | 153 |
| 410 | 3300026067 | Ga0207678_10092769 | Ga0207678_100927692 | 153 |
| 411 | 3300026078 | Ga0207702_10018713 | Ga0207702_100187133 | 153 |
| 412 | 3300026078 | Ga0207702_10052142 | Ga0207702_100521423 | 153 |
| 413 | 3300026078 | Ga0207702_10066422 | Ga0207702_100664222 | 153 |
| 414 | 3300026078 | Ga0207702_11621557 | Ga0207702_116215571 | 153 |
| 415 | 3300026088 | Ga0207641_10000031 | Ga0207641_10000031170 | 153 |
| 416 | 3300026088 | Ga0207641_10686291 | Ga0207641_106862912 | 153 |
| 417 | 3300026089 | Ga0207648_10357096 | Ga0207648_103570961 | 153 |
| 418 | 3300026095 | Ga0207676_10000072 | Ga0207676_1000007229 | 153 |
| 419 | 3300026116 | Ga0207674_10003053 | Ga0207674_1000305311 | 153 |
| 420 | 3300026116 | Ga0207674_10006642 | Ga0207674_100066422 | 153 |
| 421 | 3300026121 | Ga0207683_11160850 | Ga0207683_111608502 | 153 |
| 422 | 3300026142 | Ga0207698_10025863 | Ga0207698_100258634 | 153 |
| 423 | 3300028379 | Ga0268266_10056076 | Ga0268266_100560763 | 153 |
| 424 | 3300028379 | Ga0268266_10064839 | Ga0268266_100648394 | 153 |
| 425 | 3300028380 | Ga0268265_10146257 | Ga0268265_101462572 | 153 |
| 426 | 3300028381 | Ga0268264_10000785 | Ga0268264_1000078537 | 153 |
| 427 | 3300028786 | Ga0307517_10075608 | Ga0307517_100756083 | 153 |
| 428 | 3300028794 | Ga0307515_10325087 | Ga0307515_103250872 | 153 |
| 429 | 3300030522 | Ga0307512_10435641 | Ga0307512_104356411 | 153 |
| 430 | 3300030733 | Ga0314311_1234836 | Ga0314311_12348362 | 153 |
| 431 | 3300031616 | Ga0307508_10000011 | Ga0307508_10000011170 | 153 |
| 432 | 3300031731 | Ga0307405_10109097 | Ga0307405_101090972 | 153 |
| 433 | 3300031903 | Ga0307407_10113528 | Ga0307407_101135284 | 153 |
| 434 | 3300031911 | Ga0307412_10026022 | Ga0307412_100260222 | 153 |
| 435 | 3300031995 | Ga0307409_100021228 | Ga0307409_1000212284 | 153 |
| 436 | 3300032002 | Ga0307416_100273430 | Ga0307416_1002734302 | 153 |
| 437 | 3300032004 | Ga0307414_11189774 | Ga0307414_111897741 | 153 |
| 438 | 3300032126 | Ga0307415_100044257 | Ga0307415_1000442576 | 153 |
| 439 | 3300033180 | Ga0307510_10066895 | Ga0307510_100668956 | 153 |
| 440 | 3300035118 | Ga0373954_0103957 | Ga0373954_0103957_717_1178 | 153 |
| 441 | 3300035119 | Ga0373956_0348221 | Ga0373956_0348221_169_630 | 153 |
| 442 | 3300035172 | Ga0373955_0007600 | Ga0373955_0007600_2445_2906 | 153 |
| 443 | 3300035692 | Ga0373935_0578125 | Ga0373935_0578125_228_689 | 153 |
| 444 | 3300035724 | Ga0373933_0013243 | Ga0373933_0013243_3361_3822 | 153 |
| 445 | 3300036401 | Ga0373937_0047729 | Ga0373937_0047729_1651_2133 | 153 |
| 446 | 3300036401 | Ga0373937_0102021 | Ga0373937_0102021_661_1122 | 153 |
| 447 | 3300037312 | Ga0395899_0002299 | Ga0395899_0002299_620_1081 | 153 |
| 448 | 3300037312 | Ga0395899_0019311 | Ga0395899_0019311_4005_4466 | 153 |
| 449 | 3300037312 | Ga0395899_0037173 | Ga0395899_0037173_1089_1550 | 153 |
| 450 | 3300037312 | Ga0395899_0063584 | Ga0395899_0063584_987_1448 | 153 |
| 451 | 3300037312 | Ga0395899_0174455 | Ga0395899_0174455_655_1116 | 153 |
| 452 | 3300037312 | Ga0395899_0213365 | Ga0395899_0213365_413_874 | 153 |
| 453 | 3300037312 | Ga0395899_0256610 | Ga0395899_0256610_542_1003 | 153 |
| 454 | 3300037418 | Ga0395900_0002548 | Ga0395900_0002548_1640_2101 | 153 |
| 455 | 3300037418 | Ga0395900_0044846 | Ga0395900_0044846_3678_4139 | 153 |
| 456 | 3300037418 | Ga0395900_0066250 | Ga0395900_0066250_1150_1611 | 153 |
| 457 | 3300037418 | Ga0395900_0096980 | Ga0395900_0096980_921_1382 | 153 |
| 458 | 3300037418 | Ga0395900_0131864 | Ga0395900_0131864_1419_1880 | 153 |
| 459 | 3300037418 | Ga0395900_0192374 | Ga0395900_0192374_1424_1885 | 153 |
| 460 | 3300037418 | Ga0395900_0211241 | Ga0395900_0211241_968_1429 | 153 |
| 461 | 3300037418 | Ga0395900_0245869 | Ga0395900_0245869_749_1210 | 153 |
| 462 | 3300037418 | Ga0395900_0316383 | Ga0395900_0316383_41_502 | 153 |
| 463 | 3300037418 | Ga0395900_0333416 | Ga0395900_0333416_13_474 | 153 |
| 464 | 3300037418 | Ga0395900_0667608 | Ga0395900_0667608_215_676 | 153 |
| 465 | 3300037466 | Ga0395898_0025707 | Ga0395898_0025707_2730_3191 | 153 |
| 466 | 3300037466 | Ga0395898_0093802 | Ga0395898_0093802_1044_1505 | 153 |
| 467 | 3300037466 | Ga0395898_0164557 | Ga0395898_0164557_644_1105 | 153 |
| 468 | 3300037466 | Ga0395898_0233521 | Ga0395898_0233521_1264_1725 | 153 |
| 469 | 3300037466 | Ga0395898_0235873 | Ga0395898_0235873_74_535 | 153 |
| 470 | 3300037466 | Ga0395898_0652849 | Ga0395898_0652849_137_598 | 153 |
| 471 | 3300037471 | Ga0395905_0000409 | Ga0395905_0000409_27026_27487 | 153 |
| 472 | 3300037471 | Ga0395905_0007919 | Ga0395905_0007919_7798_8259 | 153 |
| 473 | 3300037471 | Ga0395905_0029823 | Ga0395905_0029823_4557_5018 | 153 |
| 474 | 3300037471 | Ga0395905_0031015 | Ga0395905_0031015_1024_1485 | 153 |
| 475 | 3300037471 | Ga0395905_0053376 | Ga0395905_0053376_1850_2311 | 153 |
| 476 | 3300037471 | Ga0395905_0057214 | Ga0395905_0057214_690_1151 | 153 |
| 477 | 3300037471 | Ga0395905_0193828 | Ga0395905_0193828_755_1216 | 153 |
| 478 | 3300037471 | Ga0395905_0287733 | Ga0395905_0287733_791_1252 | 153 |
| 479 | 3300037471 | Ga0395905_0294247 | Ga0395905_0294247_653_1114 | 153 |
| 480 | 3300037471 | Ga0395905_0310813 | Ga0395905_0310813_96_557 | 153 |
| 481 | 3300037471 | Ga0395905_0396107 | Ga0395905_0396107_275_736 | 153 |
| 482 | 3300037471 | Ga0395905_0670827 | Ga0395905_0670827_62_523 | 153 |
| 483 | 3300037471 | Ga0395905_0836201 | Ga0395905_0836201_96_557 | 153 |
| 484 | 3300038443 | Ga0395901_0010738 | Ga0395901_0010738_1411_1872 | 153 |
| 485 | 3300038443 | Ga0395901_0011872 | Ga0395901_0011872_1668_2129 | 153 |
| 486 | 3300038443 | Ga0395901_0173259 | Ga0395901_0173259_1504_2001 | 153 |
| 487 | 3300038443 | Ga0395901_0271979 | Ga0395901_0271979_130_591 | 153 |
| 488 | 3300038443 | Ga0395901_0300704 | Ga0395901_0300704_511_972 | 153 |
| 489 | 3300038443 | Ga0395901_0440581 | Ga0395901_0440581_545_1006 | 153 |
| 490 | 3300038443 | Ga0395901_0468286 | Ga0395901_0468286_452_913 | 153 |
| 491 | 3300038443 | Ga0395901_0521168 | Ga0395901_0521168_66_527 | 153 |
| 492 | 3300038443 | Ga0395901_1006920 | Ga0395901_1006920_82_543 | 153 |
| 493 | 3300039437 | Ga0436365_1054374 | Ga0436365_1054374_645_1106 | 153 |
| 494 | 3300041404 | Ga0439436_0003483 | Ga0439436_0003483_1902_2369 | 153 |
| 495 | 3300041404 | Ga0439436_0055151 | Ga0439436_0055151_566_1033 | 153 |
| 496 | 3300041406 | Ga0439439_0006576 | Ga0439439_0006576_1447_1914 | 153 |
| 497 | 3300041407 | Ga0439447_019635 | Ga0439447_019635_801_1268 | 153 |
| 498 | 3300041410 | Ga0439461_0000178 | Ga0439461_0000178_4358_4825 | 153 |
| 499 | 3300041410 | Ga0439461_0014873 | Ga0439461_0014873_67_534 | 153 |
| 500 | 3300041411 | Ga0439466_0130849 | Ga0439466_0130849_80_547 | 153 |
| 501 | 3300041413 | Ga0439465_0009623 | Ga0439465_0009623_244_711 | 153 |
| 502 | 3300041413 | Ga0439465_0030423 | Ga0439465_0030423_58_525 | 153 |
| 503 | 3300041498 | Ga0451841_0580323 | Ga0451841_0580323_184_651 | 153 |
| 504 | 3300041997 | Ga0439431_0000015 | Ga0439431_0000015_15283_15750 | 153 |
| 505 | 3300041997 | Ga0439431_0004975 | Ga0439431_0004975_582_1049 | 153 |
| 506 | 3300042002 | Ga0439442_001570 | Ga0439442_001570_971_1438 | 153 |
| 507 | 3300042002 | Ga0439442_008630 | Ga0439442_008630_412_879 | 153 |
| 508 | 3300042004 | Ga0439445_0003451 | Ga0439445_0003451_741_1208 | 153 |
| 509 | 3300042004 | Ga0439445_0003697 | Ga0439445_0003697_1851_2318 | 153 |
| 510 | 3300042006 | Ga0439432_006574 | Ga0439432_006574_1466_1933 | 153 |
| 511 | 3300042006 | Ga0439432_013379 | Ga0439432_013379_1331_1798 | 153 |
| 512 | 3300042010 | Ga0439452_028811 | Ga0439452_028811_639_1106 | 153 |
| 513 | 3300042014 | Ga0439457_033383 | Ga0439457_033383_263_730 | 153 |
| 514 | 3300042015 | Ga0439462_0010019 | Ga0439462_0010019_1171_1638 | 153 |
| 515 | 3300042015 | Ga0439462_0010888 | Ga0439462_0010888_361_828 | 153 |
| 516 | 3300042121 | Ga0450919_012947 | Ga0450919_012947_163_630 | 153 |
| 517 | 3300042122 | Ga0450920_035414 | Ga0450920_035414_26_493 | 153 |
| 518 | 3300042125 | Ga0450923_066810 | Ga0450923_066810_192_653 | 153 |
| 519 | 3300042131 | Ga0450894_030654 | Ga0450894_030654_118_585 | 153 |
| 520 | 3300042142 | Ga0450905_000807 | Ga0450905_000807_589_1050 | 153 |
| 521 | 3300042144 | Ga0450889_000518 | Ga0450889_000518_3643_4104 | 153 |
| 522 | 3300042147 | Ga0450910_047813 | Ga0450910_047813_198_665 | 153 |
| 523 | 3300042156 | Ga0439446_0006326 | Ga0439446_0006326_99_566 | 153 |
| 524 | 3300042184 | Ga0450908_028476 | Ga0450908_028476_67_534 | 153 |
| 525 | 3300042185 | Ga0450909_005358 | Ga0450909_005358_668_1135 | 153 |
| 526 | 3300042435 | Ga0439434_0002354 | Ga0439434_0002354_4364_4831 | 153 |
| 527 | 3300042435 | Ga0439434_0005342 | Ga0439434_0005342_1567_2034 | 153 |
| 528 | 3300044656 | Ga0466969_0253822 | Ga0466969_0253822_34_495 | 153 |
| 529 | 3300044658 | Ga0466972_0054673 | Ga0466972_0054673_1298_1759 | 153 |
| 530 | 3300044658 | Ga0466972_0054969 | Ga0466972_0054969_686_1147 | 153 |
| 531 | 3300044658 | Ga0466972_0096323 | Ga0466972_0096323_847_1308 | 153 |
| 532 | 3300044683 | Ga0466965_0202783 | Ga0466965_0202783_322_783 | 153 |
| 533 | 3300044683 | Ga0466965_0684844 | Ga0466965_0684844_98_559 | 153 |
| 534 | 3300044684 | Ga0466966_0047420 | Ga0466966_0047420_1327_1788 | 153 |
| 535 | 3300044684 | Ga0466966_0490891 | Ga0466966_0490891_226_687 | 153 |
| 536 | 3300044684 | Ga0466966_0538916 | Ga0466966_0538916_18_479 | 153 |
| 537 | 3300044684 | Ga0466966_0910100 | Ga0466966_0910100_20_481 | 153 |
| 538 | 3300044693 | Ga0466961_0353616 | Ga0466961_0353616_23_484 | 153 |
| 539 | 3300044694 | Ga0466963_0062599 | Ga0466963_0062599_53_514 | 153 |
| 540 | 3300044694 | Ga0466963_0280400 | Ga0466963_0280400_146_607 | 153 |
| 541 | 3300044694 | Ga0466963_0461350 | Ga0466963_0461350_421_882 | 153 |
| 542 | 3300044719 | Ga0466971_0025809 | Ga0466971_0025809_1096_1557 | 153 |
| 543 | 3300044719 | Ga0466971_0040567 | Ga0466971_0040567_1516_1977 | 153 |
| 544 | 3300044719 | Ga0466971_0209539 | Ga0466971_0209539_73_534 | 153 |
| 545 | 3300044735 | Ga0466968_0239433 | Ga0466968_0239433_177_638 | 153 |
| 546 | 3300044842 | Ga0466957_0002469 | Ga0466957_0002469_2170_2631 | 153 |
| 547 | 3300044842 | Ga0466957_0060558 | Ga0466957_0060558_73_534 | 153 |
| 548 | 3300044901 | Ga0466960_0021758 | Ga0466960_0021758_1641_2102 | 153 |
| 549 | 3300045049 | Ga0466959_0296613 | Ga0466959_0296613_124_585 | 153 |
| 550 | 3300045836 | Ga0466958_0000506 | Ga0466958_0000506_9627_10088 | 153 |
| 551 | 3300045836 | Ga0466958_0240527 | Ga0466958_0240527_410_871 | 153 |
| 552 | 3300045836 | Ga0466958_0588751 | Ga0466958_0588751_92_553 | 153 |
| 553 | 3300045976 | Ga0466967_0021699 | Ga0466967_0021699_1044_1505 | 153 |
| 554 | 3300045976 | Ga0466967_0072671 | Ga0466967_0072671_1816_2277 | 153 |
| 555 | 3300045976 | Ga0466967_0118471 | Ga0466967_0118471_1211_1672 | 153 |
| 556 | 3300045976 | Ga0466967_0196153 | Ga0466967_0196153_1365_1826 | 153 |
| 557 | 3300045976 | Ga0466967_0359547 | Ga0466967_0359547_486_947 | 153 |
| 558 | 3300045976 | Ga0466967_0402299 | Ga0466967_0402299_264_725 | 153 |
| 559 | 3300045976 | Ga0466967_0449707 | Ga0466967_0449707_694_1155 | 153 |
| 560 | 3300045976 | Ga0466967_1591370 | Ga0466967_1591370_158_619 | 153 |
| 561 | 3300045976 | Ga0466967_1844498 | Ga0466967_1844498_62_523 | 153 |
| 562 | 3300045976 | Ga0466967_2108633 | Ga0466967_2108633_56_517 | 153 |
| 563 | 3300045976 | Ga0466967_2218823 | Ga0466967_2218823_14_475 | 153 |
| 564 | 3300045976 | Ga0466967_2255187 | Ga0466967_2255187_19_498 | 153 |
| 565 | 3300046460 | Ga0495638_0000207 | Ga0495638_0000207_68646_69113 | 153 |
| 566 | 3300046474 | Ga0495605_0174557 | Ga0495605_0174557_80_541 | 153 |
| 567 | 3300046492 | Ga0495585_0033580 | Ga0495585_0033580_2357_2824 | 153 |
| 568 | 3300046506 | Ga0495583_0004661 | Ga0495583_0004661_8331_8798 | 153 |
| 569 | 3300046507 | Ga0495606_0081466 | Ga0495606_0081466_332_799 | 153 |
| 570 | 3300046507 | Ga0495606_0455880 | Ga0495606_0455880_86_547 | 153 |
| 571 | 3300046512 | Ga0495610_0263897 | Ga0495610_0263897_28_489 | 153 |
| 572 | 3300046522 | Ga0495643_0200499 | Ga0495643_0200499_48_509 | 153 |
| 573 | 3300046529 | Ga0495652_0484320 | Ga0495652_0484320_335_802 | 153 |
| 574 | 3300046530 | Ga0495654_0077426 | Ga0495654_0077426_85_552 | 153 |
| 575 | 3300046616 | Ga0495668_0176176 | Ga0495668_0176176_188_670 | 153 |
| 576 | 3300046660 | Ga0495625_0003111 | Ga0495625_0003111_10748_11215 | 153 |
| 577 | 3300046660 | Ga0495625_0164006 | Ga0495625_0164006_425_892 | 153 |
| 578 | 3300046679 | Ga0495623_0034060 | Ga0495623_0034060_1918_2379 | 153 |
| 579 | 3300046684 | Ga0495669_0002918 | Ga0495669_0002918_5676_6137 | 153 |
| 580 | 3300046684 | Ga0495669_0105850 | Ga0495669_0105850_310_771 | 153 |
| 581 | 3300046684 | Ga0495669_0211987 | Ga0495669_0211987_378_839 | 153 |
| 582 | 3300046691 | Ga0495670_0090704 | Ga0495670_0090704_947_1408 | 153 |
| 583 | 3300046692 | Ga0495671_0008914 | Ga0495671_0008914_2544_3026 | 153 |
| 584 | 3300047443 | Ga0495687_121374 | Ga0495687_121374_140_607 | 153 |
| 585 | 3300047445 | Ga0495677_0007182 | Ga0495677_0007182_1738_2205 | 153 |
| 586 | 3300047447 | Ga0495685_123399 | Ga0495685_123399_92_553 | 153 |
| 587 | 3300047472 | Ga0495686_0211929 | Ga0495686_0211929_68_535 | 153 |
| 588 | 3300048088 | Ga0495602_0064575 | Ga0495602_0064575_2180_2641 | 153 |
| 589 | 3300048903 | Ga0496100_0648349 | Ga0496100_0648349_214_675 | 153 |
| 590 | 3300048904 | Ga0496101_0179780 | Ga0496101_0179780_992_1453 | 153 |
| 591 | 3300048904 | Ga0496101_0679483 | Ga0496101_0679483_119_580 | 153 |
| 592 | 3300048909 | Ga0496106_0077572 | Ga0496106_0077572_1892_2353 | 153 |
| 593 | 3300048910 | Ga0496107_0024108 | Ga0496107_0024108_1879_2340 | 153 |
| 594 | 3300048910 | Ga0496107_0385240 | Ga0496107_0385240_142_603 | 153 |
| 595 | 3300048911 | Ga0496108_0264936 | Ga0496108_0264936_860_1321 | 153 |
| 596 | 3300048912 | Ga0496109_0027277 | Ga0496109_0027277_186_647 | 153 |
| 597 | 3300048912 | Ga0496109_0793114 | Ga0496109_0793114_316_777 | 153 |
| 598 | 3300048913 | Ga0496110_0078443 | Ga0496110_0078443_237_698 | 153 |
| 599 | 3300048913 | Ga0496110_1216993 | Ga0496110_1216993_131_592 | 153 |
| 600 | 3300048914 | Ga0496111_0003794 | Ga0496111_0003794_5800_6261 | 153 |
| 601 | 3300048914 | Ga0496111_0556205 | Ga0496111_0556205_31_492 | 153 |
| 602 | 3300048914 | Ga0496111_1301184 | Ga0496111_1301184_25_486 | 153 |
| 603 | 3300048915 | Ga0496112_0009881 | Ga0496112_0009881_340_801 | 153 |
| 604 | 3300048915 | Ga0496112_0084606 | Ga0496112_0084606_1729_2190 | 153 |
| 605 | 3300048915 | Ga0496112_1108622 | Ga0496112_1108622_74_535 | 153 |
| 606 | 3300048916 | Ga0496113_0008196 | Ga0496113_0008196_2685_3146 | 153 |
| 607 | 3300048916 | Ga0496113_0216587 | Ga0496113_0216587_67_528 | 153 |
| 608 | 3300048916 | Ga0496113_0508911 | Ga0496113_0508911_302_763 | 153 |
| 609 | 3300048924 | Ga0496121_0046213 | Ga0496121_0046213_366_848 | 153 |
| 610 | 3300048925 | Ga0496122_0330217 | Ga0496122_0330217_109_576 | 153 |
| 611 | 3300049571 | Ga0501034_0180614 | Ga0501034_0180614_294_761 | 153 |
| 612 | 3300049580 | Ga0501046_0567953 | Ga0501046_0567953_249_716 | 153 |
| 613 | 3300049581 | Ga0501047_0072301 | Ga0501047_0072301_1743_2222 | 153 |
| 614 | 3300049586 | Ga0501070_0076252 | Ga0501070_0076252_1225_1686 | 153 |
| 615 | 3300049664 | Ga0501224_000007 | Ga0501224_000007_9293_9769 | 153 |
| 616 | 3300049668 | Ga0501233_000599 | Ga0501233_000599_616_1092 | 153 |
| 617 | 3300049705 | Ga0501225_0000055 | Ga0501225_0000055_29140_29616 | 153 |
| 618 | 3300049707 | Ga0501234_000955 | Ga0501234_000955_2848_3324 | 153 |
| 619 | 3300049758 | Ga0501241_083320 | Ga0501241_083320_175_657 | 153 |
| 620 | 3300049822 | Ga0501035_0278680 | Ga0501035_0278680_10_492 | 153 |
| 621 | 3300049853 | Ga0501226_000025 | Ga0501226_000025_81423_81899 | 153 |
| 622 | 3300050489 | nmdc:mga03683_34509_c1 | nmdc:mga03683_34509_c1_529_996 | 153 |
| 623 | 3300050496 | nmdc:mga07m45_25838_c1 | nmdc:mga07m45_25838_c1_2510_2971 | 153 |
| 624 | 3300050507 | nmdc:mga05p37_243419_c1 | nmdc:mga05p37_243419_c1_246_707 | 153 |
| 625 | 3300050511 | nmdc:mga08y16_61453_c1 | nmdc:mga08y16_61453_c1_1387_1848 | 153 |
| 626 | 3300050516 | nmdc:mga0sz30_65946_c1 | nmdc:mga0sz30_65946_c1_809_1276 | 153 |
| 627 | 3300053078 | Ga0495612_0056875 | Ga0495612_0056875_681_1142 | 153 |
| 628 | 3300053087 | Ga0500643_000904 | Ga0500643_000904_6094_6561 | 153 |
| 629 | 3300053094 | Ga0500566_0000285 | Ga0500566_0000285_23964_24455 | 153 |
| 630 | 3300053118 | Ga0500594_0001763 | Ga0500594_0001763_736_1203 | 153 |
| 631 | 3300053119 | Ga0500595_010229 | Ga0500595_010229_1590_2111 | 153 |
| 632 | 3300053122 | Ga0500608_000327 | Ga0500608_000327_4812_5279 | 153 |
| 633 | 3300053122 | Ga0500608_033290 | Ga0500608_033290_689_1153 | 153 |
| 634 | 3300053130 | Ga0500642_0000002 | Ga0500642_0000002_678833_679297 | 153 |
| 635 | 3300053134 | Ga0500658_0000662 | Ga0500658_0000662_3309_3776 | 153 |
| 636 | 3300053136 | Ga0500559_0003325 | Ga0500559_0003325_6914_7381 | 153 |
| 637 | 3300053136 | Ga0500559_0035376 | Ga0500559_0035376_1648_2115 | 153 |
| 638 | 3300053138 | Ga0500564_000959 | Ga0500564_000959_6309_6776 | 153 |
| 639 | 3300053140 | Ga0500573_0002298 | Ga0500573_0002298_2515_2982 | 153 |
| 640 | 3300053140 | Ga0500573_0177095 | Ga0500573_0177095_416_883 | 153 |
| 641 | 3300053151 | Ga0500604_0140797 | Ga0500604_0140797_190_651 | 153 |
| 642 | 3300053156 | Ga0500622_0197561 | Ga0500622_0197561_192_656 | 153 |
| 643 | 3300053723 | Ga0500567_001496 | Ga0500567_001496_8776_9243 | 153 |
| 644 | 3300053729 | Ga0500625_000001 | Ga0500625_000001_220811_221278 | 153 |
| 645 | 3300053730 | Ga0500645_000064 | Ga0500645_000064_75401_75883 | 153 |
| 646 | 3300061719 | Ga0466962_0038732 | Ga0466962_0038732_784_1245 | 153 |
| 647 | 3300003187 | JGI25151J46595_10088405 | JGI25151J46595_100884052 | 154 |
| 648 | 3300003781 | Ga0055536_1003969 | Ga0055536_10039696 | 154 |
| 649 | 3300003781 | Ga0055536_1006424 | Ga0055536_10064247 | 154 |
| 650 | 3300003781 | Ga0055536_1015396 | Ga0055536_10153962 | 154 |
| 651 | 3300003784 | Ga0055534_1019585 | Ga0055534_10195852 | 154 |
| 652 | 3300003791 | Ga0055530_10000115 | Ga0055530_1000011542 | 154 |
| 653 | 3300003794 | Ga0055531_10006063 | Ga0055531_100060632 | 154 |
| 654 | 3300003794 | Ga0055531_10006683 | Ga0055531_100066832 | 154 |
| 655 | 3300005445 | Ga0070708_100141656 | Ga0070708_1001416564 | 154 |
| 656 | 3300005617 | Ga0068859_100481698 | Ga0068859_1004816982 | 154 |
| 657 | 3300006042 | Ga0075368_10116970 | Ga0075368_101169701 | 154 |
| 658 | 3300006931 | Ga0097620_100481677 | Ga0097620_1004816772 | 154 |
| 659 | 3300009093 | Ga0105240_10929977 | Ga0105240_109299772 | 154 |
| 660 | 3300009545 | Ga0105237_10216772 | Ga0105237_102167722 | 154 |
| 661 | 3300013307 | Ga0157372_11871339 | Ga0157372_118713391 | 154 |
| 662 | 3300021388 | Ga0213875_10005097 | Ga0213875_100050973 | 154 |
| 663 | 3300025291 | Ga0209675_1000104 | Ga0209675_100010492 | 154 |
| 664 | 3300025292 | Ga0209676_1000807 | Ga0209676_10008079 | 154 |
| 665 | 3300025292 | Ga0209676_1001060 | Ga0209676_10010609 | 154 |
| 666 | 3300025292 | Ga0209676_1001199 | Ga0209676_100119912 | 154 |
| 667 | 3300025292 | Ga0209676_1044912 | Ga0209676_10449122 | 154 |
| 668 | 3300025294 | Ga0209025_1006362 | Ga0209025_10063622 | 154 |
| 669 | 3300025298 | Ga0209050_1000286 | Ga0209050_100028625 | 154 |
| 670 | 3300025298 | Ga0209050_1004981 | Ga0209050_10049814 | 154 |
| 671 | 3300025298 | Ga0209050_1072435 | Ga0209050_10724351 | 154 |
| 672 | 3300025304 | Ga0209257_1000245 | Ga0209257_100024521 | 154 |
| 673 | 3300025304 | Ga0209257_1000321 | Ga0209257_100032167 | 154 |
| 674 | 3300025304 | Ga0209257_1001354 | Ga0209257_100135421 | 154 |
| 675 | 3300025304 | Ga0209257_1014820 | Ga0209257_10148204 | 154 |
| 676 | 3300025913 | Ga0207695_10660640 | Ga0207695_106606402 | 154 |
| 677 | 3300025914 | Ga0207671_10081045 | Ga0207671_100810453 | 154 |
| 678 | 3300025923 | Ga0207681_10190284 | Ga0207681_101902843 | 154 |
| 679 | 3300025931 | Ga0207644_11753146 | Ga0207644_117531461 | 154 |
| 680 | 3300031731 | Ga0307405_11004197 | Ga0307405_110041972 | 154 |
| 681 | 3300031824 | Ga0307413_10460217 | Ga0307413_104602172 | 154 |
| 682 | 3300031901 | Ga0307406_10025518 | Ga0307406_100255185 | 154 |
| 683 | 3300031901 | Ga0307406_10135661 | Ga0307406_101356612 | 154 |
| 684 | 3300031901 | Ga0307406_10214331 | Ga0307406_102143312 | 154 |
| 685 | 3300031911 | Ga0307412_10002668 | Ga0307412_100026685 | 154 |
| 686 | 3300031911 | Ga0307412_10042785 | Ga0307412_100427853 | 154 |
| 687 | 3300031911 | Ga0307412_10095174 | Ga0307412_100951744 | 154 |
| 688 | 3300032004 | Ga0307414_10001684 | Ga0307414_100016847 | 154 |
| 689 | 3300032004 | Ga0307414_10001894 | Ga0307414_100018944 | 154 |
| 690 | 3300032004 | Ga0307414_10002573 | Ga0307414_100025732 | 154 |
| 691 | 3300032004 | Ga0307414_10046896 | Ga0307414_100468964 | 154 |
| 692 | 3300032004 | Ga0307414_10115705 | Ga0307414_101157052 | 154 |
| 693 | 3300032004 | Ga0307414_10133282 | Ga0307414_101332822 | 154 |
| 694 | 3300032004 | Ga0307414_10159311 | Ga0307414_101593112 | 154 |
| 695 | 3300032004 | Ga0307414_10365512 | Ga0307414_103655122 | 154 |
| 696 | 3300032004 | Ga0307414_10393190 | Ga0307414_103931902 | 154 |
| 697 | 3300037853 | Ga0436364_1172297 | Ga0436364_1172297_13431_13910 | 154 |
| 698 | 3300039437 | Ga0436365_1325832 | Ga0436365_1325832_720_1199 | 154 |
| 699 | 3300041460 | Ga0451802_0494763 | Ga0451802_0494763_390_875 | 154 |
| 700 | 3300041494 | Ga0451837_0848718 | Ga0451837_0848718_31_516 | 154 |
| 701 | 3300046522 | Ga0495643_0039984 | Ga0495643_0039984_2058_2522 | 154 |
| 702 | 3300046530 | Ga0495654_0059377 | Ga0495654_0059377_139_603 | 154 |
| 703 | 3300046616 | Ga0495668_0000004 | Ga0495668_0000004_36875_37339 | 154 |
| 704 | 3300046660 | Ga0495625_0001182 | Ga0495625_0001182_8933_9397 | 154 |
| 705 | 3300046660 | Ga0495625_0068441 | Ga0495625_0068441_930_1394 | 154 |
| 706 | 3300048905 | Ga0496102_0000481 | Ga0496102_0000481_10812_11276 | 154 |
| 707 | 3300048906 | Ga0496103_0000347 | Ga0496103_0000347_10584_11048 | 154 |
| 708 | 3300048918 | Ga0496115_0000534 | Ga0496115_0000534_11829_12308 | 154 |
| 709 | 3300048919 | Ga0496116_0002244 | Ga0496116_0002244_8448_8912 | 154 |
| 710 | 3300048920 | Ga0496117_0001149 | Ga0496117_0001149_29023_29487 | 154 |
| 711 | 3300048921 | Ga0496118_0001071 | Ga0496118_0001071_14020_14484 | 154 |
| 712 | 3300048922 | Ga0496119_0017078 | Ga0496119_0017078_2070_2534 | 154 |
| 713 | 3300048923 | Ga0496120_0023307 | Ga0496120_0023307_2657_3121 | 154 |
| 714 | 3300048927 | Ga0496124_0000996 | Ga0496124_0000996_33613_34077 | 154 |
| 715 | 3300048928 | Ga0496125_0091212 | Ga0496125_0091212_661_1125 | 154 |
| 716 | 3300048929 | Ga0496126_0140950 | Ga0496126_0140950_519_989 | 154 |
| 717 | 3300049568 | Ga0501031_0020490 | Ga0501031_0020490_3590_4057 | 154 |
| 718 | 3300049569 | Ga0501032_0167496 | Ga0501032_0167496_147_614 | 154 |
| 719 | 3300049571 | Ga0501034_0051979 | Ga0501034_0051979_3199_3666 | 154 |
| 720 | 3300049571 | Ga0501034_0255901 | Ga0501034_0255901_838_1302 | 154 |
| 721 | 3300049571 | Ga0501034_1698074 | Ga0501034_1698074_28_492 | 154 |
| 722 | 3300049572 | Ga0501036_0021382 | Ga0501036_0021382_228_695 | 154 |
| 723 | 3300049574 | Ga0501038_0275900 | Ga0501038_0275900_296_763 | 154 |
| 724 | 3300049579 | Ga0501043_0074501 | Ga0501043_0074501_1744_2211 | 154 |
| 725 | 3300049580 | Ga0501046_0248288 | Ga0501046_0248288_236_703 | 154 |
| 726 | 3300049581 | Ga0501047_0039638 | Ga0501047_0039638_3528_3995 | 154 |
| 727 | 3300049582 | Ga0501048_0074744 | Ga0501048_0074744_1687_2154 | 154 |
| 728 | 3300049822 | Ga0501035_0012295 | Ga0501035_0012295_5379_5846 | 154 |
| 729 | 3300049823 | Ga0501044_0203278 | Ga0501044_0203278_74_643 | 154 |
| 730 | 3300049824 | Ga0501045_0866897 | Ga0501045_0866897_53_520 | 154 |
| 731 | 3300050495 | nmdc:mga04h51_117222_c1 | nmdc:mga04h51_117222_c1_408_872 | 154 |
| 732 | 3300053091 | Ga0500647_0070056 | Ga0500647_0070056_396_860 | 154 |
| 733 | 3300053093 | Ga0500651_0220937 | Ga0500651_0220937_236_700 | 154 |
| 734 | 3300053119 | Ga0500595_004422 | Ga0500595_004422_1427_1897 | 154 |
| 735 | 3300053125 | Ga0500618_014525 | Ga0500618_014525_1241_1705 | 154 |
| 736 | 3300053133 | Ga0500655_012842 | Ga0500655_012842_537_1001 | 154 |
| 737 | 3300053134 | Ga0500658_0033119 | Ga0500658_0033119_1041_1505 | 154 |
| 738 | 3300053139 | Ga0500568_0004150 | Ga0500568_0004150_1449_1913 | 154 |
| 739 | 3300053158 | Ga0500627_0000009 | Ga0500627_0000009_109164_109628 | 154 |
| 740 | 3300053158 | Ga0500627_0094683 | Ga0500627_0094683_639_1103 | 154 |
| 741 | 3300053177 | Ga0500636_0040341 | Ga0500636_0040341_1234_1698 | 154 |
| 742 | 3300053735 | Ga0500596_006952 | Ga0500596_006952_1279_1743 | 154 |
| 743 | 2162886007 | SwRhRL2b_contig_2687397 | SwRhRL2b_0287.00007510 | 155 |
| 744 | 3300001976 | JGI24752J21851_1001224 | JGI24752J21851_10012243 | 155 |
| 745 | 3300001989 | JGI24739J22299_10002936 | JGI24739J22299_100029363 | 155 |
| 746 | 3300001990 | JGI24737J22298_10007810 | JGI24737J22298_100078102 | 155 |
| 747 | 3300002075 | JGI24738J21930_10003430 | JGI24738J21930_100034307 | 155 |
| 748 | 3300005289 | Ga0065704_10074901 | Ga0065704_100749017 | 155 |
| 749 | 3300005295 | Ga0065707_10081882 | Ga0065707_1008188232 | 155 |
| 750 | 3300005331 | Ga0070670_100000030 | Ga0070670_10000003073 | 155 |
| 751 | 3300005367 | Ga0070667_100000161 | Ga0070667_10000016185 | 155 |
| 752 | 3300005457 | Ga0070662_100016573 | Ga0070662_1000165732 | 155 |
| 753 | 3300005539 | Ga0068853_100012834 | Ga0068853_1000128343 | 155 |
| 754 | 3300005539 | Ga0068853_100067073 | Ga0068853_1000670732 | 155 |
| 755 | 3300005548 | Ga0070665_100359322 | Ga0070665_1003593222 | 155 |
| 756 | 3300005577 | Ga0068857_100041693 | Ga0068857_1000416938 | 155 |
| 757 | 3300005578 | Ga0068854_100055677 | Ga0068854_1000556773 | 155 |
| 758 | 3300005617 | Ga0068859_100213296 | Ga0068859_1002132963 | 155 |
| 759 | 3300005618 | Ga0068864_100000041 | Ga0068864_10000004173 | 155 |
| 760 | 3300005841 | Ga0068863_100000035 | Ga0068863_10000003573 | 155 |
| 761 | 3300005842 | Ga0068858_100575641 | Ga0068858_1005756412 | 155 |
| 762 | 3300005844 | Ga0068862_100000042 | Ga0068862_100000042102 | 155 |
| 763 | 3300005937 | Ga0081455_10000405 | Ga0081455_1000040510 | 155 |
| 764 | 3300006931 | Ga0097620_100213276 | Ga0097620_1002132763 | 155 |
| 765 | 3300009101 | Ga0105247_10038819 | Ga0105247_100388192 | 155 |
| 766 | 3300009177 | Ga0105248_10000045 | Ga0105248_1000004571 | 155 |
| 767 | 3300009551 | Ga0105238_10035938 | Ga0105238_100359382 | 155 |
| 768 | 3300009553 | Ga0105249_10000055 | Ga0105249_10000055101 | 155 |
| 769 | 3300013297 | Ga0157378_10037607 | Ga0157378_100376073 | 155 |
| 770 | 3300013306 | Ga0163162_10010728 | Ga0163162_1001072811 | 155 |
| 771 | 3300014325 | Ga0163163_10257193 | Ga0163163_102571932 | 155 |
| 772 | 3300014326 | Ga0157380_10007873 | Ga0157380_100078736 | 155 |
| 773 | 3300014968 | Ga0157379_10021517 | Ga0157379_100215173 | 155 |
| 774 | 3300025900 | Ga0207710_10135767 | Ga0207710_101357671 | 155 |
| 775 | 3300025904 | Ga0207647_10028509 | Ga0207647_100285095 | 155 |
| 776 | 3300025925 | Ga0207650_10000111 | Ga0207650_1000011113 | 155 |
| 777 | 3300025933 | Ga0207706_10015487 | Ga0207706_100154873 | 155 |
| 778 | 3300025941 | Ga0207711_10000027 | Ga0207711_10000027166 | 155 |
| 779 | 3300025961 | Ga0207712_10000813 | Ga0207712_1000081311 | 155 |
| 780 | 3300025981 | Ga0207640_10111478 | Ga0207640_101114783 | 155 |
| 781 | 3300025986 | Ga0207658_10000839 | Ga0207658_1000083910 | 155 |
| 782 | 3300026041 | Ga0207639_10110813 | Ga0207639_101108133 | 155 |
| 783 | 3300026088 | Ga0207641_10000041 | Ga0207641_1000004172 | 155 |
| 784 | 3300026095 | Ga0207676_10000039 | Ga0207676_10000039105 | 155 |
| 785 | 3300026116 | Ga0207674_10005772 | Ga0207674_100057729 | 155 |
| 786 | 3300028380 | Ga0268265_10000061 | Ga0268265_1000006180 | 155 |
| 787 | 3300031548 | Ga0307408_100058897 | Ga0307408_1000588973 | 155 |
| 788 | 3300031731 | Ga0307405_10101755 | Ga0307405_101017553 | 155 |
| 789 | 3300031901 | Ga0307406_10189804 | Ga0307406_101898042 | 155 |
| 790 | 3300031995 | Ga0307409_100277372 | Ga0307409_1002773722 | 155 |
| 791 | 3300032002 | Ga0307416_100032603 | Ga0307416_1000326032 | 155 |
| 792 | 3300041459 | Ga0451800_1680169 | Ga0451800_1680169_85_552 | 155 |
| 793 | 3300046525 | Ga0495663_0107436 | Ga0495663_0107436_113_580 | 155 |
| 794 | 3300046530 | Ga0495654_0077322 | Ga0495654_0077322_848_1315 | 155 |
| 795 | 3300046530 | Ga0495654_0096319 | Ga0495654_0096319_570_1037 | 155 |
| 796 | 3300046616 | Ga0495668_0006873 | Ga0495668_0006873_4375_4842 | 155 |
| 797 | 3300046616 | Ga0495668_0040848 | Ga0495668_0040848_818_1285 | 155 |
| 798 | 3300046660 | Ga0495625_0320073 | Ga0495625_0320073_131_598 | 155 |
| 799 | 3300047447 | Ga0495685_071854 | Ga0495685_071854_278_745 | 155 |
| 800 | 3300048091 | Ga0495626_0193598 | Ga0495626_0193598_22_489 | 155 |
| 801 | 3300048904 | Ga0496101_0075810 | Ga0496101_0075810_212_679 | 155 |
| 802 | 3300048906 | Ga0496103_0141373 | Ga0496103_0141373_1060_1527 | 155 |
| 803 | 3300048920 | Ga0496117_0002571 | Ga0496117_0002571_10241_10708 | 155 |
| 804 | 3300048921 | Ga0496118_0000493 | Ga0496118_0000493_7090_7557 | 155 |
| 805 | 3300048924 | Ga0496121_0338970 | Ga0496121_0338970_414_881 | 155 |
| 806 | 3300049459 | Ga0495678_141173 | Ga0495678_141173_64_531 | 155 |
| 807 | 3300053087 | Ga0500643_000293 | Ga0500643_000293_19541_20008 | 155 |
| 808 | 3300053116 | Ga0500592_000213 | Ga0500592_000213_5195_5662 | 155 |
| 809 | 3300053116 | Ga0500592_031987 | Ga0500592_031987_156_623 | 155 |
| 810 | 3300053158 | Ga0500627_0057845 | Ga0500627_0057845_819_1286 | 155 |
| 811 | 3300053158 | Ga0500627_0241872 | Ga0500627_0241872_322_789 | 155 |
| 812 | 3300053727 | Ga0500611_133902 | Ga0500611_133902_59_526 | 155 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d01-assembly1.cif.gz_K | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9751 | 3 | 154 |
| 3d01-assembly2.cif.gz_E | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9723 | 3 | 153 |
| 3d01-assembly3.cif.gz_C | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9721 | 3 | 153 |
| 3d01-assembly4.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9656 | 3 | 154 |
| 3d01-assembly1.cif.gz_I | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9634 | 3 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4I058_2_156_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.977 | 3 | 153 | 3.30.1330.40 |
| 3d01E00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9633 | 3 | 153 | 3.30.1330.40 |
| af_I6YGW9_1_150_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9481 | 1 | 152 | 3.30.1330.40 |
| af_I6YGW9_1_150_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9421 | 1 | 152 | 3.30.1330.40 |
| 2otmC00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.936 | 1 | 152 | 3.30.1330.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3I1J2-F1-model_v4 | deleted | 0.9971 | 58 | 153 |
|
| AF-A0A4Q3AEF4-F1-model_v4 | RidA family protein | 0.9964 | 18 | 153 |
|
| AF-A0A847ZXD2-F1-model_v4 | RidA family protein | 0.9963 | 58 | 153 |
|
| AF-A0A2A4UHN9-F1-model_v4 | Endoribonuclease L-PSP/chorismate mutase-like domain-containing protein | 0.9963 | 65 | 153 |
|
| AF-A0A6L8G997-F1-model_v4 | RidA family protein | 0.996 | 35 | 153 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar