F481797

General Info

Members Datasets Scaffolds Average Seq Length
810 602 534 103

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100337571|Ga0075435_1003375712
Length 121
Sequence MSARHVRKGDLVMVTSGSHKGKTGTVMRVISGDEPGSGRVVIKGLNLRTKHLRPTQKAPQGGIVTREAPVHISNVSPVDKNGKPTRVRFKSKPDGSKVRLAATTGETLGEPIRSAESKKSH

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
10 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
11 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
12 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
13 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
14 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
15 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
16 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
17 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
18 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
19 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
20 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
21 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
22 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
23 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
24 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
25 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
26 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
27 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
28 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
29 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
30 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
31 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
32 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
33 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
34 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
35 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
36 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
37 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
38 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
39 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
40 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
41 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
42 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
43 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
44 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
45 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
46 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
47 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
48 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
49 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
50 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
51 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
52 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
53 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
54 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
55 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
56 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
57 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
58 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
59 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
60 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
61 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
62 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
63 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
64 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
65 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
66 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
67 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
68 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
69 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
70 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
71 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
72 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
73 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
74 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
75 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
76 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
77 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
78 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
79 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
80 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
81 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
82 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
83 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
84 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
85 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
86 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
87 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
88 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
89 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
90 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
91 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
92 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
93 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
94 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
95 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
96 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
97 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
98 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
99 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
100 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
101 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
102 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
103 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
104 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
105 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
106 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
107 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
108 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
109 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
110 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
111 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
112 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
113 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
114 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
115 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
116 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
117 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
118 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
119 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
120 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
121 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
122 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
123 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
124 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
125 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
126 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
127 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
128 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
129 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
130 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
131 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
132 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
133 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
134 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
135 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
136 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
137 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
138 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
139 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
140 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
141 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
142 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
143 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
144 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
145 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
146 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
147 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
148 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
149 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
150 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
151 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
152 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
153 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
154 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
155 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
156 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
157 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
158 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
159 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
160 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
161 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
162 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
163 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
164 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
165 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
166 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
167 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
168 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
169 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
170 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
171 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
172 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
173 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
174 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
175 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
176 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
177 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
178 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
179 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
180 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
181 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
182 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
183 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
184 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
185 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
186 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
187 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
188 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
189 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
190 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
191 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
192 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
193 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
194 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
195 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
196 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
197 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
198 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
199 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
200 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
201 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
202 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
203 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
204 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
205 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
206 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
207 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
208 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
209 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
210 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
211 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
212 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
213 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
214 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
215 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
216 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
217 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
218 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
219 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
220 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
221 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
222 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
223 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
224 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
225 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
226 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
227 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
228 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
229 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
230 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
231 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
232 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
233 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
234 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
235 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
236 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
237 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
238 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
239 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
240 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
241 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
242 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
243 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
244 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
245 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
246 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
247 3004167301 Mesorhizobium loti 582 Isolate Unclassified
248 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
249 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
250 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
251 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
252 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
253 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
254 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
255 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
256 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
257 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
258 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
259 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
260 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
261 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
262 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
263 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
264 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
265 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
266 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
267 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
268 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
269 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
270 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
271 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
272 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
274 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
275 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
276 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
277 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
278 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
279 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
280 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
281 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
282 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
283 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
284 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
285 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
286 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
287 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
288 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
289 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
290 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
291 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
292 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
293 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
294 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
295 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
296 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
297 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
298 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
299 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
300 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
301 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
302 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
303 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
304 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
305 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
306 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
307 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
308 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
309 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
310 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
311 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
312 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
313 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
314 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
315 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
316 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
317 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
318 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
319 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
320 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
321 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
322 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
323 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
324 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
325 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
326 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
327 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
328 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
329 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
330 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
331 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
332 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
333 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
334 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
335 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
336 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
337 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
338 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
339 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
340 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
341 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
342 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
343 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
344 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
345 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
346 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
347 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
348 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
349 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
350 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
351 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
377 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
378 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
379 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
380 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
381 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
382 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
383 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
384 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
385 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
386 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
389 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
390 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
391 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
392 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
393 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
394 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
395 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
396 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
397 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
398 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
399 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
400 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
401 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
402 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
403 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
404 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
405 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
406 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
407 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
408 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
409 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
410 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
411 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
412 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
413 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
414 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
415 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
416 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
417 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
418 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
420 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
421 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
422 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
423 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
424 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
425 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
426 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
427 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
428 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
429 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
430 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
431 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
432 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
433 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
434 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
435 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
436 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
437 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
438 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
439 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
440 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
441 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
442 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
443 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
444 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
445 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
446 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
447 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
448 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
449 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
450 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
451 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
452 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
453 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
454 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
455 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
456 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
457 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
458 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
459 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
460 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
461 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
462 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
463 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
464 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
465 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
466 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
467 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
468 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
469 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
470 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
471 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
472 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
473 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
474 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
475 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
476 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
477 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
478 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
479 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
480 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
481 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
482 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
483 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
484 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
485 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
486 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
487 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
488 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
489 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
490 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
491 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
492 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
493 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
494 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
495 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
496 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
497 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
498 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
499 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
500 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
501 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
502 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
503 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
504 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
505 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
506 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
507 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
508 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
510 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
511 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
512 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
513 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
514 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
515 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
516 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
517 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
518 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
519 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
520 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
521 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
522 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
523 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
524 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
525 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
526 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
527 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
528 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
529 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
530 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
531 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
532 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
533 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
534 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
535 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
536 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
537 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
538 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
539 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
540 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
541 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
542 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
543 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
544 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
545 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
546 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
547 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
548 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
549 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
550 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
551 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
552 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
553 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
554 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
555 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
556 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
557 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
558 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
559 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
560 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
561 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
562 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
563 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
564 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
565 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
566 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
567 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
568 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
569 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
571 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
572 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
573 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
574 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
575 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
576 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
577 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
578 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
579 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
580 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
581 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
582 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
583 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
584 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
585 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
586 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
587 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
588 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
589 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
590 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
591 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
592 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
593 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
594 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
595 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
596 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
597 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
598 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
599 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
600 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
601 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
602 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 62.72
Metatranscriptomes 3.21
Isolates 34.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.7
Nodule 29.63
Rhizoplane 3.21
Rhizosphere 56.3
Stem 0
Stem Tuber 0
Unclassified 7.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNBas_1000512 3300000531 Bacteria 1728
2 LJNas_1005486 3300000546 Bacteria 1383
3 JGI24740J21852_10003752 3300001979 Bacteria 6614
4 JGI24739J22299_10014505 3300001989 Bacteria 2867
5 JGI24735J21928_10008865 3300002067 Bacteria 3244
6 JGI25156J39149_1004694 3300002705 Bacteria 4104
7 JGI25157J39369_1002241 3300002741 Bacteria 5220
8 JGI25151J46595_10014201 3300003187 Bacteria 3556
9 JGI25406J46586_10056851 3300003203 Bacteria 1281
10 JGI25406J46586_10060086 3300003203 Bacteria 1231
11 JGI25165J46597_1001303 3300003214 Bacteria 14268
12 rootH2_10008940 3300003320 Bacteria 20037
13 JGI25405J52794_10019071 3300003911 Bacteria 1373
14 JGI25405J52794_10021947 3300003911 Bacteria 1292
15 Ga0058862_11907125 3300004803 Bacteria 611
16 Ga0070658_10028805 3300005327 Bacteria 4459
17 Ga0070683_101382862 3300005329 Bacteria 676
18 Ga0070683_102230312 3300005329 Bacteria 526
19 Ga0070690_100938696 3300005330 Bacteria 679
20 Ga0070670_100876681 3300005331 Bacteria 813
21 Ga0068868_102241852 3300005338 Bacteria 520
22 Ga0070661_100005946 3300005344 Bacteria 8403
23 Ga0070668_100991484 3300005347 Bacteria 755
24 Ga0070668_101822623 3300005347 Bacteria 560
25 Ga0070675_100665801 3300005354 Bacteria 947
26 Ga0070675_101703736 3300005354 Bacteria 582
27 Ga0070671_100896302 3300005355 Bacteria 775
28 Ga0070667_100813487 3300005367 Bacteria 868
29 Ga0070709_10004276 3300005434 Bacteria 7699
30 Ga0070709_10514065 3300005434 Bacteria 911
31 Ga0070714_100850879 3300005435 Bacteria 884
32 Ga0070714_100896558 3300005435 Bacteria 861
33 Ga0070714_101699098 3300005435 Bacteria 616
34 Ga0070713_100027784 3300005436 Bacteria 4460
35 Ga0070713_100134612 3300005436 Bacteria 2183
36 Ga0070713_100311006 3300005436 Bacteria 1453
37 Ga0070713_100410163 3300005436 Bacteria 1267
38 Ga0070713_101304049 3300005436 Bacteria 704
39 Ga0070710_10008016 3300005437 Bacteria 5135
40 Ga0070710_10033673 3300005437 Bacteria 2783
41 Ga0070711_100004304 3300005439 Bacteria 8381
42 Ga0070711_100016474 3300005439 Bacteria 4695
43 Ga0070663_100031905 3300005455 Bacteria 3626
44 Ga0070663_100354335 3300005455 Bacteria 1189
45 Ga0070663_101068184 3300005455 Bacteria 704
46 Ga0070678_102360482 3300005456 Bacteria 505
47 Ga0070681_10606884 3300005458 Bacteria 1009
48 Ga0070706_100497194 3300005467 Bacteria 1135
49 Ga0070706_100739256 3300005467 Bacteria 912
50 Ga0070698_100248890 3300005471 Bacteria 1710
51 Ga0070698_101067047 3300005471 Bacteria 756
52 Ga0070684_101908397 3300005535 Bacteria 560
53 Ga0068853_101643701 3300005539 Bacteria 622
54 Ga0070695_100305763 3300005545 Bacteria 1177
55 Ga0070696_101148084 3300005546 Bacteria 655
56 Ga0070665_100909118 3300005548 Bacteria 893
57 Ga0068855_100210622 3300005563 Bacteria 2184
58 Ga0068856_101637289 3300005614 Bacteria 656
59 Ga0068852_100180569 3300005616 Bacteria 1984
60 Ga0068866_11245579 3300005718 Bacteria 539
61 Ga0068863_101225410 3300005841 Bacteria 756
62 Ga0081455_10012098 3300005937 Bacteria 8627
63 Ga0081455_10243564 3300005937 Bacteria 1320
64 Ga0075365_10000107 3300006038 Bacteria 24426
65 Ga0075365_11145344 3300006038 Bacteria 547
66 Ga0075368_10135628 3300006042 Bacteria 1024
67 Ga0075368_10284110 3300006042 Bacteria 711
68 Ga0075368_10470280 3300006042 Bacteria 558
69 Ga0075363_100062673 3300006048 Bacteria 2005
70 Ga0075364_11181400 3300006051 Bacteria 519
71 Ga0070716_100401666 3300006173 Bacteria 986
72 Ga0070716_100503906 3300006173 Bacteria 893
73 Ga0070712_100020480 3300006175 Bacteria 4328
74 Ga0070712_100025062 3300006175 Bacteria 3960
75 Ga0075367_10076001 3300006178 Bacteria 2026
76 Ga0075369_10203729 3300006186 Bacteria 913
77 Ga0075366_10587023 3300006195 Bacteria 690
78 Ga0075370_10384138 3300006353 Bacteria 841
79 Ga0075428_100451792 3300006844 Bacteria 1376
80 Ga0075428_100537794 3300006844 Bacteria 1249
81 Ga0075430_100178685 3300006846 Bacteria 1765
82 Ga0075430_100378381 3300006846 Bacteria 1168
83 Ga0075430_100429717 3300006846 Bacteria 1090
84 Ga0075431_100616853 3300006847 Bacteria 1067
85 Ga0075434_100648721 3300006871 Bacteria 1074
86 Ga0075434_101452939 3300006871 Bacteria 695
87 Ga0075429_100164008 3300006880 Bacteria 1946
88 Ga0075429_100695756 3300006880 Bacteria 890
89 Ga0068865_100236139 3300006881 Bacteria 1437
90 Ga0075436_100305975 3300006914 Bacteria 1140
91 Ga0075435_100322044 3300007076 Bacteria 1323
92 Ga0075435_100337571 3300007076 Bacteria 1291
93 Ga0105240_10475761 3300009093 Bacteria 1393
94 Ga0105240_10652743 3300009093 Bacteria 1153
95 Ga0105240_10912012 3300009093 Bacteria 945
96 Ga0105240_11344212 3300009093 Bacteria 752
97 Ga0111539_10163484 3300009094 Bacteria 2603
98 Ga0111539_12349564 3300009094 Bacteria 618
99 Ga0105245_10211036 3300009098 Bacteria 1869
100 Ga0114129_11039093 3300009147 Bacteria 1029
101 Ga0114129_12790258 3300009147 Bacteria 581
102 Ga0105241_11758349 3300009174 Bacteria 604
103 Ga0105237_10267620 3300009545 Bacteria 1712
104 Ga0105237_10933630 3300009545 Bacteria 875
105 Ga0105237_11774512 3300009545 Bacteria 625
106 Ga0105238_10026677 3300009551 Bacteria 5890
107 Ga0105238_12120359 3300009551 Bacteria 596
108 Ga0105249_11449026 3300009553 Bacteria 759
109 Ga0157319_1055856 3300012497 Bacteria 502
110 Ga0157315_1002191 3300012508 Bacteria 1193
111 Ga0157373_10918017 3300013100 Bacteria 650
112 Ga0157373_11021898 3300013100 Bacteria 618
113 Ga0157370_11047510 3300013104 Bacteria 738
114 Ga0157378_10572183 3300013297 Bacteria 1138
115 Ga0163162_11022366 3300013306 Bacteria 935
116 Ga0163162_11696312 3300013306 Bacteria 721
117 Ga0157372_12179280 3300013307 Bacteria 637
118 Ga0163163_11035873 3300014325 Bacteria 884
119 Ga0157380_10034018 3300014326 Bacteria 3929
120 Ga0157380_10298854 3300014326 Bacteria 1482
121 Ga0157380_13262196 3300014326 Bacteria 518
122 Ga0182008_10460986 3300014497 Bacteria 693
123 Ga0182006_1109411 3300015261 Bacteria 971
124 Ga0163161_10148208 3300017792 Bacteria 1782
125 Ga0213873_10019900 3300021358 Bacteria 1562
126 Ga0213874_10110692 3300021377 Bacteria 923
127 Ga0213874_10238810 3300021377 Bacteria 666
128 Ga0213876_10753566 3300021384 Bacteria 518
129 Ga0224572_1027189 3300024225 Bacteria 1096
130 Ga0228598_1040293 3300024227 Bacteria 922
131 Ga0228598_1051633 3300024227 Bacteria 816
132 Ga0209026_1000002 3300025250 Bacteria 1136158
133 Ga0209026_1019700 3300025250 Bacteria 1055
134 Ga0209759_1000119 3300025256 Bacteria 141051
135 Ga0209233_1000188 3300025261 Bacteria 132904
136 Ga0209233_1056679 3300025261 Bacteria 772
137 Ga0209758_1006057 3300025297 Bacteria 8913
138 Ga0207692_10273065 3300025898 Bacteria 1020
139 Ga0207692_10330105 3300025898 Bacteria 936
140 Ga0207647_10548456 3300025904 Bacteria 641
141 Ga0207685_10194365 3300025905 Bacteria 949
142 Ga0207699_10006191 3300025906 Bacteria 5772
143 Ga0207643_10130247 3300025908 Bacteria 1496
144 Ga0207684_10619235 3300025910 Bacteria 924
145 Ga0207695_10447902 3300025913 Bacteria 1174
146 Ga0207695_10769648 3300025913 Bacteria 843
147 Ga0207695_10830404 3300025913 Bacteria 804
148 Ga0207671_10148713 3300025914 Bacteria 1809
149 Ga0207671_10217826 3300025914 Bacteria 1495
150 Ga0207693_10022819 3300025915 Bacteria 4968
151 Ga0207693_10108170 3300025915 Bacteria 2181
152 Ga0207663_10147730 3300025916 Bacteria 1645
153 Ga0207663_10464189 3300025916 Bacteria 978
154 Ga0207663_11160299 3300025916 Bacteria 621
155 Ga0207657_11098082 3300025919 Bacteria 608
156 Ga0207649_10000194 3300025920 Bacteria 50112
157 Ga0207649_11022365 3300025920 Bacteria 651
158 Ga0207700_10090721 3300025928 Bacteria 2412
159 Ga0207700_10246796 3300025928 Bacteria 1524
160 Ga0207690_10464805 3300025932 Bacteria 1019
161 Ga0207669_10656824 3300025937 Bacteria 858
162 Ga0207665_10083411 3300025939 Bacteria 2204
163 Ga0207665_10756257 3300025939 Bacteria 766
164 Ga0207691_10458711 3300025940 Bacteria 1084
165 Ga0207661_12025456 3300025944 Bacteria 522
166 Ga0207667_10951322 3300025949 Bacteria 848
167 Ga0207640_10465117 3300025981 Bacteria 1045
168 Ga0207639_10032054 3300026041 Bacteria 3866
169 Ga0207639_10841057 3300026041 Bacteria 856
170 Ga0207678_10049649 3300026067 Bacteria 3626
171 Ga0207678_11046836 3300026067 Bacteria 722
172 Ga0207678_11592866 3300026067 Bacteria 575
173 Ga0207702_11985607 3300026078 Bacteria 572
174 Ga0207674_10501111 3300026116 Bacteria 1173
175 Ga0207698_10235545 3300026142 Bacteria 1665
176 Ga0209969_1006180 3300027360 Bacteria 1685
177 Ga0210000_1005563 3300027462 Bacteria 1828
178 Ga0209982_1062947 3300027552 Bacteria 604
179 Ga0209971_1067815 3300027682 Bacteria 865
180 Ga0209813_10325881 3300027866 Bacteria 603
181 Ga0209974_10010537 3300027876 Bacteria 3118
182 Ga0265355_1012431 3300028036 Bacteria 706
183 Ga0265318_10000037 3300028577 Bacteria 138223
184 Ga0265318_10185884 3300028577 Bacteria 761
185 Ga0265338_10051741 3300028800 Bacteria 3694
186 Ga0265338_10168013 3300028800 Bacteria 1686
187 Ga0265324_10092997 3300029957 Bacteria 1026
188 Ga0265762_1129483 3300030760 Bacteria 584
189 Ga0265763_1000060 3300030763 Bacteria 4522
190 Ga0265330_10182616 3300031235 Bacteria 888
191 Ga0265332_10163035 3300031238 Bacteria 931
192 Ga0265325_10256877 3300031241 Bacteria 790
193 Ga0265339_10000053 3300031249 Bacteria 101277
194 Ga0265339_10136500 3300031249 Bacteria 1251
195 Ga0265331_10000186 3300031250 Bacteria 76149
196 Ga0265331_10004741 3300031250 Bacteria 8403
197 Ga0265327_10001297 3300031251 Bacteria 32731
198 Ga0265316_10547776 3300031344 Bacteria 824
199 Ga0265313_10000098 3300031595 Bacteria 89130
200 Ga0265313_10190826 3300031595 Bacteria 857
201 Ga0307508_10107154 3300031616 Bacteria 2393
202 Ga0316575_10000478 3300031665 Bacteria 11549
203 Ga0265314_10028299 3300031711 Bacteria 4180
204 Ga0265314_10108357 3300031711 Bacteria 1770
205 Ga0265342_10131168 3300031712 Bacteria 1404
206 Ga0326468_10126830 3300031889 Bacteria 504
207 Ga0316585_10188778 3300032137 Bacteria 681
208 Ga0373944_0014329 3300035089 Bacteria 2212
209 Ga0373952_0125763 3300035092 Bacteria 700
210 Ga0373932_0254903 3300035112 Bacteria 641
211 Ga0373945_0075515 3300035116 Bacteria 1283
212 Ga0373956_0004726 3300035119 Bacteria 5447
213 Ga0373956_0129696 3300035119 Bacteria 1180
214 Ga0373957_0099970 3300035120 Bacteria 1160
215 Ga0373943_0269998 3300035170 Bacteria 959
216 Ga0373946_0017706 3300035171 Bacteria 2729
217 Ga0373955_0012493 3300035172 Bacteria 4080
218 Ga0373955_0391799 3300035172 Bacteria 843
219 Ga0316574_0473572 3300035398 Bacteria 783
220 Ga0316574_0473891 3300035398 Bacteria 783
221 Ga0373924_0007245 3300035410 Bacteria 3999
222 Ga0373931_0102300 3300035691 Bacteria 1613
223 Ga0373935_0603953 3300035692 Bacteria 802
224 Ga0373935_1367409 3300035692 Bacteria 529
225 Ga0373933_0000858 3300035724 Bacteria 18640
226 Ga0373947_0072680 3300035725 Bacteria 2112
227 Ga0373937_0001081 3300036401 Bacteria 22992
228 Ga0373937_0027613 3300036401 Bacteria 5134
229 Ga0265778_015410 3300036457 Bacteria 909
230 Ga0316582_0092116 3300036647 Bacteria 1997
231 Ga0373925_0020584 3300037068 Bacteria 4805
232 Ga0395899_0000073 3300037312 Bacteria 181387
233 Ga0395899_0075725 3300037312 Bacteria 2457
234 Ga0395899_0522157 3300037312 Bacteria 767
235 Ga0395900_0000027 3300037418 Bacteria 285957
236 Ga0395900_0012290 3300037418 Bacteria 8757
237 Ga0395900_0237581 3300037418 Bacteria 1829
238 Ga0395898_0000255 3300037466 Bacteria 131017
239 Ga0395898_0029950 3300037466 Bacteria 5449
240 Ga0395898_0676107 3300037466 Bacteria 974
241 Ga0395898_0814957 3300037466 Bacteria 873
242 Ga0395905_0000032 3300037471 Bacteria 285932
243 Ga0395905_0361417 3300037471 Bacteria 1344
244 Ga0395901_0000110 3300038443 Bacteria 112682
245 Ga0395901_0052439 3300038443 Bacteria 4239
246 Ga0436365_0395732 3300039437 Bacteria 1877
247 Ga0436365_0507633 3300039437 Bacteria 825
248 Ga0436365_1013719 3300039437 Bacteria 1092
249 Ga0436365_1489226 3300039437 Bacteria 543
250 Ga0436365_1728357 3300039437 Bacteria 1331
251 Ga0436360_0309547 3300039438 Bacteria 532
252 Ga0436361_0355909 3300039447 Bacteria 584
253 Ga0436361_0661719 3300039447 Bacteria 723
254 Ga0436363_0141605 3300039450 Bacteria 956
255 Ga0436363_1592451 3300039450 Bacteria 810
256 Ga0436362_0518937 3300039453 Bacteria 1227
257 Ga0439465_0071193 3300041413 Bacteria 1166
258 Ga0439465_0121371 3300041413 Bacteria 916
259 Ga0451787_066607 3300041441 Bacteria 696
260 Ga0451787_431217 3300041441 Bacteria 778
261 Ga0451807_1116814 3300041486 Bacteria 674
262 Ga0451833_0858461 3300041491 Bacteria 596
263 Ga0451839_1433262 3300041496 Bacteria 805
264 Ga0451841_0060129 3300041498 Bacteria 956
265 Ga0450893_0137798 3300042532 Bacteria 519
266 Ga0466972_0010313 3300044658 Bacteria 4691
267 Ga0466961_0605332 3300044693 Bacteria 659
268 Ga0466963_0104366 3300044694 Bacteria 1942
269 Ga0466968_0054651 3300044735 Bacteria 1712
270 Ga0466968_0317749 3300044735 Bacteria 752
271 Ga0466970_0180053 3300044765 Bacteria 1173
272 Ga0466970_0720346 3300044765 Bacteria 582
273 Ga0466957_0159103 3300044842 Bacteria 1466
274 Ga0466957_0533626 3300044842 Bacteria 816
275 Ga0466960_0029748 3300044901 Bacteria 2509
276 Ga0466959_0414687 3300045049 Bacteria 914
277 Ga0466967_0129036 3300045976 Bacteria 2345
278 Ga0466967_0392850 3300045976 Bacteria 1348
279 Ga0495592_0002995 3300046454 Bacteria 12028
280 Ga0495629_0003398 3300046459 Bacteria 12038
281 Ga0495651_0013698 3300046462 Bacteria 6268
282 Ga0495651_0123510 3300046462 Bacteria 1899
283 Ga0495653_0000370 3300046463 Bacteria 36284
284 Ga0495580_0168910 3300046472 Bacteria 1513
285 Ga0495639_0132461 3300046475 Bacteria 1194
286 Ga0495662_0025995 3300046476 Bacteria 2828
287 Ga0495664_0288120 3300046477 Bacteria 992
288 Ga0495608_0094808 3300046511 Bacteria 1928
289 Ga0495618_0014905 3300046514 Bacteria 4741
290 Ga0495618_0509271 3300046514 Bacteria 725
291 Ga0495628_0003568 3300046516 Bacteria 13931
292 Ga0495630_0084974 3300046517 Bacteria 2389
293 Ga0495632_0437005 3300046519 Bacteria 569
294 Ga0495666_0143070 3300046526 Bacteria 1114
295 Ga0495652_0004294 3300046529 Bacteria 13663
296 Ga0495665_0297276 3300046531 Bacteria 827
297 Ga0495640_0000769 3300046533 Bacteria 24154
298 Ga0495586_0141238 3300046535 Bacteria 1352
299 Ga0495587_0001283 3300046536 Bacteria 16691
300 Ga0495645_0030738 3300046543 Bacteria 3913
301 Ga0495622_0370131 3300046557 Bacteria 619
302 Ga0495667_0001942 3300046559 Bacteria 13669
303 Ga0495656_0050677 3300046615 Bacteria 1774
304 Ga0495634_0002200 3300046642 Bacteria 16376
305 Ga0495635_0004328 3300046663 Bacteria 9835
306 Ga0495635_0082274 3300046663 Bacteria 2203
307 Ga0495657_0007254 3300046675 Bacteria 8587
308 Ga0495599_0011656 3300046678 Bacteria 5408
309 Ga0495623_0003723 3300046679 Bacteria 10054
310 Ga0495647_0298270 3300046681 Bacteria 726
311 Ga0495658_0188648 3300046683 Bacteria 1281
312 Ga0495658_0608878 3300046683 Bacteria 700
313 Ga0495613_0034160 3300046689 Bacteria 3778
314 Ga0495613_0136291 3300046689 Bacteria 1756
315 Ga0495624_0145066 3300046690 Bacteria 1453
316 Ga0495624_0251830 3300046690 Bacteria 1068
317 Ga0495649_0061685 3300046694 Bacteria 2016
318 Ga0495600_0000422 3300046809 Bacteria 21824
319 Ga0495604_0000406 3300047317 Bacteria 38847
320 Ga0495674_0000757 3300047319 Bacteria 30677
321 Ga0495674_0474619 3300047319 Bacteria 1003
322 Ga0495680_0001477 3300047322 Bacteria 25369
323 Ga0495675_0020789 3300047444 Bacteria 4177
324 Ga0495677_0037133 3300047445 Bacteria 1780
325 Ga0495684_0002545 3300047471 Bacteria 14510
326 Ga0495684_0453272 3300047471 Bacteria 891
327 Ga0495593_0014136 3300047673 Bacteria 4542
328 Ga0495602_0010292 3300048088 Bacteria 9709
329 Ga0496100_0158697 3300048903 Bacteria 1620
330 Ga0496100_0440679 3300048903 Bacteria 997
331 Ga0496102_0689692 3300048905 Bacteria 944
332 Ga0496102_0957674 3300048905 Bacteria 777
333 Ga0496102_1623407 3300048905 Bacteria 565
334 Ga0496103_0109331 3300048906 Bacteria 1755
335 Ga0496103_0840181 3300048906 Bacteria 578
336 Ga0496104_0156871 3300048907 Bacteria 2184
337 Ga0496104_0399628 3300048907 Bacteria 1286
338 Ga0496105_0210599 3300048908 Bacteria 1584
339 Ga0496106_0125870 3300048909 Bacteria 2006
340 Ga0496108_0349307 3300048911 Bacteria 1290
341 Ga0496108_0781465 3300048911 Bacteria 824
342 Ga0496108_1582916 3300048911 Bacteria 543
343 Ga0496109_0490138 3300048912 Bacteria 1160
344 Ga0496110_0484898 3300048913 Bacteria 1126
345 Ga0496110_1911742 3300048913 Bacteria 503
346 Ga0496112_0261573 3300048915 Bacteria 1680
347 Ga0496112_1331898 3300048915 Bacteria 633
348 Ga0496113_1088968 3300048916 Bacteria 627
349 Ga0496114_0449076 3300048917 Bacteria 1142
350 Ga0496115_0009751 3300048918 Bacteria 7152
351 Ga0496117_0256739 3300048920 Bacteria 950
352 Ga0496119_0062884 3300048922 Bacteria 2210
353 Ga0496119_0064924 3300048922 Bacteria 2165
354 Ga0496120_0014732 3300048923 Bacteria 5192
355 Ga0496121_0315610 3300048924 Bacteria 1054
356 Ga0496121_0393347 3300048924 Bacteria 910
357 Ga0496125_0372968 3300048928 Bacteria 844
358 Ga0496126_0342511 3300048929 Bacteria 1224
359 Ga0501312_006401 3300049528 Bacteria 1468
360 Ga0501313_015486 3300049529 Bacteria 910
361 Ga0501321_023114 3300049537 Bacteria 787
362 Ga0501335_018154 3300049551 Bacteria 735
363 Ga0501031_0000651 3300049568 Bacteria 20547
364 Ga0501031_0002703 3300049568 Bacteria 11283
365 Ga0501031_0011241 3300049568 Bacteria 5833
366 Ga0501031_0214542 3300049568 Bacteria 1254
367 Ga0501032_0000111 3300049569 Bacteria 69802
368 Ga0501032_0042271 3300049569 Bacteria 3092
369 Ga0501032_0066026 3300049569 Bacteria 2418
370 Ga0501032_0085200 3300049569 Bacteria 2101
371 Ga0501032_0550690 3300049569 Bacteria 735
372 Ga0501033_0012240 3300049570 Bacteria 6548
373 Ga0501033_0059135 3300049570 Bacteria 2830
374 Ga0501033_0079988 3300049570 Bacteria 2398
375 Ga0501033_0087475 3300049570 Bacteria 2280
376 Ga0501033_0389767 3300049570 Bacteria 972
377 Ga0501034_0004897 3300049571 Bacteria 14760
378 Ga0501034_0006180 3300049571 Bacteria 12912
379 Ga0501034_0056638 3300049571 Bacteria 3943
380 Ga0501034_0355386 3300049571 Bacteria 1393
381 Ga0501034_1286529 3300049571 Bacteria 608
382 Ga0501036_0002605 3300049572 Bacteria 14223
383 Ga0501036_0021849 3300049572 Bacteria 5380
384 Ga0501036_0025540 3300049572 Bacteria 4984
385 Ga0501036_0038561 3300049572 Bacteria 4044
386 Ga0501036_0286977 3300049572 Bacteria 1377
387 Ga0501037_0000131 3300049573 Bacteria 69802
388 Ga0501037_0006435 3300049573 Bacteria 8594
389 Ga0501037_0469909 3300049573 Bacteria 856
390 Ga0501038_0000109 3300049574 Bacteria 69802
391 Ga0501038_0001882 3300049574 Bacteria 19398
392 Ga0501038_0096205 3300049574 Bacteria 2472
393 Ga0501038_0131973 3300049574 Bacteria 2050
394 Ga0501039_0002279 3300049575 Bacteria 14235
395 Ga0501039_0098169 3300049575 Bacteria 2285
396 Ga0501039_0183472 3300049575 Bacteria 1645
397 Ga0501039_0237035 3300049575 Bacteria 1435
398 Ga0501040_0008666 3300049576 Bacteria 6603
399 Ga0501040_1251478 3300049576 Bacteria 538
400 Ga0501041_0226440 3300049577 Bacteria 1174
401 Ga0501042_0060942 3300049578 Bacteria 2695
402 Ga0501042_0400790 3300049578 Bacteria 994
403 Ga0501043_0021749 3300049579 Bacteria 5029
404 Ga0501043_0024392 3300049579 Bacteria 4746
405 Ga0501043_0047851 3300049579 Bacteria 3362
406 Ga0501043_0284223 3300049579 Bacteria 1267
407 Ga0501046_0018165 3300049580 Bacteria 5856
408 Ga0501046_0109256 3300049580 Bacteria 2114
409 Ga0501046_0202688 3300049580 Bacteria 1476
410 Ga0501046_0302279 3300049580 Bacteria 1168
411 Ga0501047_0011259 3300049581 Bacteria 8466
412 Ga0501047_0080199 3300049581 Bacteria 3137
413 Ga0501047_0197317 3300049581 Bacteria 1874
414 Ga0501048_0030318 3300049582 Bacteria 3913
415 Ga0501048_0060021 3300049582 Bacteria 2695
416 Ga0501048_0085647 3300049582 Bacteria 2223
417 Ga0501068_0022655 3300049584 Bacteria 3674
418 Ga0501068_0036227 3300049584 Bacteria 2949
419 Ga0501068_0694292 3300049584 Bacteria 665
420 Ga0501069_0013201 3300049585 Bacteria 4401
421 Ga0501069_0485558 3300049585 Bacteria 736
422 Ga0501070_0001286 3300049586 Bacteria 22525
423 Ga0501070_0006301 3300049586 Bacteria 10097
424 Ga0501070_0266802 3300049586 Bacteria 1398
425 Ga0501070_0497119 3300049586 Bacteria 980
426 Ga0501070_0527999 3300049586 Bacteria 946
427 Ga0501070_0656325 3300049586 Bacteria 832
428 Ga0501070_1013278 3300049586 Bacteria 643
429 Ga0501070_1458797 3300049586 Bacteria 519
430 Ga0501071_0046823 3300049587 Bacteria 3106
431 Ga0501071_0249510 3300049587 Bacteria 1339
432 Ga0501072_0149867 3300049588 Bacteria 1860
433 Ga0501072_0187300 3300049588 Bacteria 1651
434 Ga0501072_1166430 3300049588 Bacteria 599
435 Ga0501073_0002084 3300049589 Bacteria 14969
436 Ga0501073_0047706 3300049589 Bacteria 3009
437 Ga0501073_0062660 3300049589 Bacteria 2594
438 Ga0501073_0125304 3300049589 Bacteria 1781
439 Ga0501073_0172957 3300049589 Bacteria 1495
440 Ga0501073_0370679 3300049589 Bacteria 989
441 Ga0501073_0866120 3300049589 Bacteria 622
442 Ga0501074_0201847 3300049590 Bacteria 1417
443 Ga0501074_0436632 3300049590 Bacteria 928
444 Ga0501074_1143674 3300049590 Bacteria 546
445 Ga0501075_0756460 3300049591 Bacteria 740
446 Ga0501076_0107789 3300049592 Bacteria 2250
447 Ga0501077_1030740 3300049593 Bacteria 529
448 Ga0501079_0026674 3300049741 Bacteria 4430
449 Ga0501080_0004752 3300049742 Bacteria 12113
450 Ga0501080_0013181 3300049742 Bacteria 7595
451 Ga0501080_0017194 3300049742 Bacteria 6681
452 Ga0501080_0098262 3300049742 Bacteria 2717
453 Ga0501080_1707180 3300049742 Bacteria 531
454 Ga0501083_0007595 3300049744 Bacteria 7680
455 Ga0501083_0027007 3300049744 Bacteria 3964
456 Ga0501083_0465931 3300049744 Bacteria 822
457 Ga0501035_0000347 3300049822 Bacteria 53369
458 Ga0501035_0002188 3300049822 Bacteria 19398
459 Ga0501035_0048543 3300049822 Bacteria 3807
460 Ga0501035_0055030 3300049822 Bacteria 3553
461 Ga0501035_0153056 3300049822 Bacteria 2000
462 Ga0501035_0727136 3300049822 Bacteria 798
463 Ga0501044_0000234 3300049823 Bacteria 69802
464 Ga0501044_0009229 3300049823 Bacteria 10770
465 Ga0501044_0015755 3300049823 Bacteria 8141
466 Ga0501044_0018610 3300049823 Bacteria 7441
467 Ga0501044_0129860 3300049823 Bacteria 2515
468 Ga0501044_0146350 3300049823 Bacteria 2348
469 Ga0501044_0333346 3300049823 Bacteria 1439
470 Ga0501044_0429468 3300049823 Bacteria 1230
471 Ga0501044_0517929 3300049823 Bacteria 1093
472 Ga0501044_1400925 3300049823 Bacteria 565
473 Ga0501044_1538128 3300049823 Bacteria 530
474 Ga0501045_0001715 3300049824 Bacteria 14765
475 Ga0501045_0449763 3300049824 Bacteria 958
476 Ga0501045_0599919 3300049824 Bacteria 815
477 Ga0501045_0822268 3300049824 Unclassified 684
478 nmdc:mga0yw44_18471_c1 3300050492 Bacteria 3821
479 nmdc:mga0k408_553229_c1 3300050493 Bacteria 680
480 nmdc:mga06z11_617120_c1 3300050494 Bacteria 660
481 nmdc:mga04h51_196536_c1 3300050495 Bacteria 791
482 nmdc:mga09592_471962_c1 3300050508 Bacteria 1082
483 nmdc:mga09592_525365_c1 3300050508 Bacteria 1018
484 nmdc:mga0qj67_224796_c1 3300050509 Bacteria 1524
485 nmdc:mga0qj67_353427_c1 3300050509 Bacteria 1188
486 nmdc:mga06r32_130312_c1 3300050510 Bacteria 2487
487 nmdc:mga08y16_1691682_c1 3300050511 Bacteria 588
488 nmdc:mga0n895_606845_c1 3300050512 Bacteria 1096
489 nmdc:mga0rr50_325194_c1 3300050513 Bacteria 1290
490 nmdc:mga0rr50_379767_c1 3300050513 Bacteria 1191
491 nmdc:mga0a205_1218321_c1 3300050515 Bacteria 600
492 nmdc:mga0a205_493253_c1 3300050515 Bacteria 1082
493 nmdc:mga0sz30_14247_c1 3300050516 Bacteria 2669
494 Ga0495601_0003476 3300053077 Bacteria 9041
495 Ga0495601_0573828 3300053077 Bacteria 725
496 Ga0495612_0007484 3300053078 Bacteria 4462
497 Ga0495595_0000821 3300053084 Bacteria 11875
498 Ga0495619_0000352 3300053085 Bacteria 32130
499 Ga0500651_0506400 3300053093 Bacteria 665
500 Ga0500641_0198078 3300053096 Bacteria 858
501 Ga0500592_022787 3300053116 Bacteria 1009
502 Ga0500593_003205 3300053117 Bacteria 6141
503 Ga0500594_0257413 3300053118 Bacteria 581
504 Ga0500642_0430824 3300053130 Bacteria 570
505 Ga0500568_0001953 3300053139 Bacteria 12637
506 Ga0500604_0179226 3300053151 Bacteria 726
507 Ga0501084_0020595 3300054114 Bacteria 5500
508 Ga0501084_0230662 3300054114 Bacteria 1563
509 Ga0501084_1528553 3300054114 Bacteria 558
510 Ga0501084_1818114 3300054114 Bacteria 509
511 Ga0590077_067914 3300059426 Bacteria 812
512 Ga0587070_228317 3300059491 Bacteria 508
513 Ga0587073_0119065 3300059492 Bacteria 710
514 Ga0587082_026237 3300059504 Bacteria 985
515 Ga0587083_0103868 3300059505 Bacteria 712
516 Ga0587088_006769 3300059508 Bacteria 1561
517 Ga0587090_026089 3300059510 Bacteria 948
518 Ga0587092_023191 3300059512 Bacteria 976
519 Ga0587106_069174 3300059605 Bacteria 665
520 Ga0587128_033624 3300059630 Bacteria 863
521 Ga0587067_015720 3300059640 Bacteria 1232
522 Ga0587072_037251 3300059643 Bacteria 932
523 Ga0587075_020850 3300059644 Bacteria 971
524 Ga0587075_082031 3300059644 Bacteria 617
525 Ga0587076_035591 3300059645 Bacteria 906
526 Ga0587076_207793 3300059645 Bacteria 507
527 Ga0587078_013727 3300059646 Bacteria 962
528 Ga0587107_009427 3300059652 Bacteria 1152
529 Ga0587071_100113 3300060344 Bacteria 669
530 Ga0501082_0051352 3300060353 Bacteria 3554
531 Ga0501082_0901501 3300060353 Bacteria 773
532 Ga0501082_1014961 3300060353 Bacteria 725
533 Ga0501082_1430201 3300060353 Bacteria 604
534 Ga0530510_0511183 3300061734 Bacteria 911

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300059512 Ga0587092_023191 Ga0587092_023191_136_417 84
2 3300006038 Ga0075365_11145344 Ga0075365_111453442 89
3 3300006042 Ga0075368_10135628 Ga0075368_101356282 89
4 3300006186 Ga0075369_10203729 Ga0075369_102037292 89
5 3300035691 Ga0373931_0102300 Ga0373931_0102300_1108_1422 89
6 3300050492 nmdc:mga0yw44_18471_c1 nmdc:mga0yw44_18471_c1_992_1306 89
7 3300050516 nmdc:mga0sz30_14247_c1 nmdc:mga0sz30_14247_c1_484_798 89
8 3300053096 Ga0500641_0198078 Ga0500641_0198078_219_605 89
9 3300049571 Ga0501034_1286529 Ga0501034_1286529_173_535 90
10 3300049588 Ga0501072_0149867 Ga0501072_0149867_428_790 90
11 3300049589 Ga0501073_0002084 Ga0501073_0002084_8740_9102 90
12 3300049742 Ga0501080_0013181 Ga0501080_0013181_3368_3730 90
13 3300049744 Ga0501083_0007595 Ga0501083_0007595_5634_5996 90
14 3300054114 Ga0501084_0020595 Ga0501084_0020595_118_480 90
15 3300060353 Ga0501082_0051352 Ga0501082_0051352_385_747 90
16 3300014326 Ga0157380_10034018 Ga0157380_100340185 91
17 3300049824 Ga0501045_0822268 Ga0501045_0822268_370_666 91
18 3300002705 JGI25156J39149_1004694 JGI25156J39149_10046945 92
19 3300002741 JGI25157J39369_1002241 JGI25157J39369_10022416 92
20 3300009093 Ga0105240_10912012 Ga0105240_109120122 92
21 3300025250 Ga0209026_1000002 Ga0209026_1000002476 92
22 3300025256 Ga0209759_1000119 Ga0209759_100011914 92
23 3300025913 Ga0207695_10769648 Ga0207695_107696482 92
24 3300048922 Ga0496119_0064924 Ga0496119_0064924_1819_2133 92
25 3300053116 Ga0500592_022787 Ga0500592_022787_138_452 94
26 3300001989 JGI24739J22299_10014505 JGI24739J22299_100145052 95
27 3300002067 JGI24735J21928_10008865 JGI24735J21928_100088652 95
28 3300005329 Ga0070683_102230312 Ga0070683_1022303122 95
29 3300005535 Ga0070684_101908397 Ga0070684_1019083971 95
30 3300005539 Ga0068853_101643701 Ga0068853_1016437012 95
31 3300005563 Ga0068855_100210622 Ga0068855_1002106222 95
32 3300005614 Ga0068856_101637289 Ga0068856_1016372892 95
33 3300005616 Ga0068852_100180569 Ga0068852_1001805692 95
34 3300005937 Ga0081455_10012098 Ga0081455_1001209814 95
35 3300006042 Ga0075368_10284110 Ga0075368_102841102 95
36 3300006178 Ga0075367_10076001 Ga0075367_100760014 95
37 3300006353 Ga0075370_10384138 Ga0075370_103841382 95
38 3300009093 Ga0105240_11344212 Ga0105240_113442121 95
39 3300009174 Ga0105241_11758349 Ga0105241_117583492 95
40 3300009545 Ga0105237_11774512 Ga0105237_117745122 95
41 3300009551 Ga0105238_10026677 Ga0105238_100266772 95
42 3300009551 Ga0105238_12120359 Ga0105238_121203591 95
43 3300013100 Ga0157373_10918017 Ga0157373_109180172 95
44 3300013104 Ga0157370_11047510 Ga0157370_110475102 95
45 3300013307 Ga0157372_12179280 Ga0157372_121792802 95
46 3300014497 Ga0182008_10460986 Ga0182008_104609862 95
47 3300025261 Ga0209233_1056679 Ga0209233_10566792 95
48 3300025297 Ga0209758_1006057 Ga0209758_100605713 95
49 3300025904 Ga0207647_10548456 Ga0207647_105484562 95
50 3300025914 Ga0207671_10148713 Ga0207671_101487132 95
51 3300025919 Ga0207657_11098082 Ga0207657_110980822 95
52 3300025920 Ga0207649_11022365 Ga0207649_110223652 95
53 3300025932 Ga0207690_10464805 Ga0207690_104648052 95
54 3300025944 Ga0207661_12025456 Ga0207661_120254562 95
55 3300025949 Ga0207667_10951322 Ga0207667_109513222 95
56 3300025981 Ga0207640_10465117 Ga0207640_104651172 95
57 3300026041 Ga0207639_10032054 Ga0207639_100320542 95
58 3300026067 Ga0207678_11592866 Ga0207678_115928662 95
59 3300026078 Ga0207702_11985607 Ga0207702_119856072 95
60 3300026116 Ga0207674_10501111 Ga0207674_105011113 95
61 3300026142 Ga0207698_10235545 Ga0207698_102355454 95
62 3300027866 Ga0209813_10325881 Ga0209813_103258812 95
63 3300037312 Ga0395899_0075725 Ga0395899_0075725_531_845 95
64 3300037312 Ga0395899_0522157 Ga0395899_0522157_281_595 95
65 3300037418 Ga0395900_0012290 Ga0395900_0012290_2365_2679 95
66 3300037418 Ga0395900_0237581 Ga0395900_0237581_657_971 95
67 3300037466 Ga0395898_0029950 Ga0395898_0029950_3122_3436 95
68 3300037466 Ga0395898_0676107 Ga0395898_0676107_215_529 95
69 3300037466 Ga0395898_0814957 Ga0395898_0814957_281_595 95
70 3300037471 Ga0395905_0361417 Ga0395905_0361417_992_1306 95
71 3300038443 Ga0395901_0052439 Ga0395901_0052439_1947_2261 95
72 3300044658 Ga0466972_0010313 Ga0466972_0010313_2622_2936 95
73 3300044735 Ga0466968_0054651 Ga0466968_0054651_1306_1620 95
74 3300044765 Ga0466970_0180053 Ga0466970_0180053_507_821 95
75 3300044901 Ga0466960_0029748 Ga0466960_0029748_1768_2082 95
76 3300045976 Ga0466967_0392850 Ga0466967_0392850_21_335 95
77 3300048905 Ga0496102_0689692 Ga0496102_0689692_271_585 95
78 3300048906 Ga0496103_0109331 Ga0496103_0109331_979_1293 95
79 3300048913 Ga0496110_0484898 Ga0496110_0484898_645_959 95
80 3300048915 Ga0496112_0261573 Ga0496112_0261573_1142_1456 95
81 3300048916 Ga0496113_1088968 Ga0496113_1088968_106_420 95
82 3300048920 Ga0496117_0256739 Ga0496117_0256739_215_529 95
83 3300048924 Ga0496121_0315610 Ga0496121_0315610_339_653 95
84 3300048928 Ga0496125_0372968 Ga0496125_0372968_395_709 95
85 3300048929 Ga0496126_0342511 Ga0496126_0342511_506_820 95
86 3300049589 Ga0501073_0866120 Ga0501073_0866120_199_513 95
87 3300049742 Ga0501080_1707180 Ga0501080_1707180_90_404 95
88 3300049823 Ga0501044_1538128 Ga0501044_1538128_125_439 95
89 3300050493 nmdc:mga0k408_553229_c1 nmdc:mga0k408_553229_c1_329_643 95
90 3300050494 nmdc:mga06z11_617120_c1 nmdc:mga06z11_617120_c1_256_570 95
91 3300050495 nmdc:mga04h51_196536_c1 nmdc:mga04h51_196536_c1_253_567 95
92 3300059491 Ga0587070_228317 Ga0587070_228317_64_378 95
93 3300059492 Ga0587073_0119065 Ga0587073_0119065_218_532 95
94 3300059504 Ga0587082_026237 Ga0587082_026237_503_817 95
95 3300059505 Ga0587083_0103868 Ga0587083_0103868_239_553 95
96 3300059508 Ga0587088_006769 Ga0587088_006769_932_1246 95
97 3300059510 Ga0587090_026089 Ga0587090_026089_503_817 95
98 3300059605 Ga0587106_069174 Ga0587106_069174_293_607 95
99 3300059630 Ga0587128_033624 Ga0587128_033624_456_770 95
100 3300059640 Ga0587067_015720 Ga0587067_015720_503_817 95
101 3300059643 Ga0587072_037251 Ga0587072_037251_218_532 95
102 3300059644 Ga0587075_020850 Ga0587075_020850_218_532 95
103 3300059644 Ga0587075_082031 Ga0587075_082031_218_532 95
104 3300059645 Ga0587076_035591 Ga0587076_035591_529_843 95
105 3300059646 Ga0587078_013727 Ga0587078_013727_441_755 95
106 3300059652 Ga0587107_009427 Ga0587107_009427_406_720 95
107 3300060344 Ga0587071_100113 Ga0587071_100113_218_532 95
108 iso_pu_bacteria 2922158528 2922161786 95
109 3300059645 Ga0587076_207793 Ga0587076_207793_25_339 97
110 iso_pu_bacteria 2956897341 2956900805 97
111 iso_pu_bacteria 2503198000 2503202656 99
112 iso_pu_bacteria 2508501123 2509117729 99
113 iso_pu_bacteria 2508501127 2509143586 99
114 iso_pu_bacteria 2509276018 2509372999 99
115 iso_pu_bacteria 2509276022 2509397161 99
116 iso_pu_bacteria 2510065059 2510319909 99
117 iso_pu_bacteria 2512875016 2512930570 99
118 iso_pu_bacteria 2512875024 2512958302 99
119 iso_pu_bacteria 2513237090 2513612123 99
120 iso_pu_bacteria 2513237164 2514032565 99
121 iso_pu_bacteria 2513237305 2514422076 99
122 iso_pu_bacteria 2588253730 2588516212 99
123 iso_pu_bacteria 2597489875 2597813659 99
124 iso_pu_bacteria 2599185301 2599939547 99
125 iso_pu_bacteria 2643221550 2643773782 99
126 iso_pu_bacteria 2643221551 2643775178 99
127 iso_pu_bacteria 2643221555 2643793624 99
128 iso_pu_bacteria 2643221564 2643837520 99
129 iso_pu_bacteria 2643221595 2643987307 99
130 iso_pu_bacteria 2643221627 2644155631 99
131 iso_pu_bacteria 2687453392 2688599068 99
132 iso_pu_bacteria 2693429783 2694631917 99
133 iso_pu_bacteria 2693429784 2694634662 99
134 iso_pu_bacteria 2721755686 2723576072 99
135 iso_pu_bacteria 2756170246 2756677762 99
136 iso_pu_bacteria 2791355123 2792750755 99
137 iso_pu_bacteria 2841734538 2841740447 99
138 iso_pu_bacteria 2844002411 2844006792 99
139 iso_pu_bacteria 2844009547 2844014467 99
140 iso_pu_bacteria 2847670302 2847670800 99
141 iso_pu_bacteria 2847686936 2847687063 99
142 iso_pu_bacteria 2856314179 2856316257 99
143 iso_pu_bacteria 2856320880 2856325081 99
144 iso_pu_bacteria 2856328259 2856330561 99
145 iso_pu_bacteria 2856334872 2856340861 99
146 iso_pu_bacteria 2856342000 2856345829 99
147 iso_pu_bacteria 2856349417 2856349745 99
148 iso_pu_bacteria 2856356410 2856359239 99
149 iso_pu_bacteria 2856364286 2856369145 99
150 iso_pu_bacteria 2857349434 2857355591 99
151 iso_pu_bacteria 2857367948 2857372489 99
152 iso_pu_bacteria 2869162929 2869168972 99
153 iso_pu_bacteria 2869169390 2869174085 99
154 iso_pu_bacteria 2869234852 2869237157 99
155 iso_pu_bacteria 2869242130 2869243183 99
156 iso_pu_bacteria 2869249662 2869252746 99
157 iso_pu_bacteria 2869256925 2869262751 99
158 iso_pu_bacteria 2869264136 2869270268 99
159 iso_pu_bacteria 2869271264 2869273284 99
160 iso_pu_bacteria 2869278585 2869280897 99
161 iso_pu_bacteria 2869285874 2869288397 99
162 iso_pu_bacteria 2871429161 2871432106 99
163 iso_pu_bacteria 2871444079 2871448841 99
164 iso_pu_bacteria 2871451962 2871455267 99
165 iso_pu_bacteria 2871459585 2871459670 99
166 iso_pu_bacteria 2871466892 2871470925 99
167 iso_pu_bacteria 2871474448 2871480985 99
168 iso_pu_bacteria 2871481445 2871484303 99
169 iso_pu_bacteria 2871488783 2871495247 99
170 iso_pu_bacteria 2871495908 2871500463 99
171 iso_pu_bacteria 2874102143 2874104420 99
172 iso_pu_bacteria 2874109183 2874115354 99
173 iso_pu_bacteria 2874116593 2874121366 99
174 iso_pu_bacteria 2874123672 2874125714 99
175 iso_pu_bacteria 2874131515 2874137243 99
176 iso_pu_bacteria 2874139085 2874141435 99
177 iso_pu_bacteria 2874146452 2874150985 99
178 iso_pu_bacteria 2874155637 2874157324 99
179 iso_pu_bacteria 2874162495 2874163771 99
180 iso_pu_bacteria 2874168670 2874172578 99
181 iso_pu_bacteria 2876363079 2876368084 99
182 iso_pu_bacteria 2876369609 2876374955 99
183 iso_pu_bacteria 2876377896 2876385313 99
184 iso_pu_bacteria 2876386047 2876392715 99
185 iso_pu_bacteria 2876392853 2876395260 99
186 iso_pu_bacteria 2876399893 2876405249 99
187 iso_pu_bacteria 2876406927 2876409336 99
188 iso_pu_bacteria 2876413966 2876417014 99
189 iso_pu_bacteria 2876420981 2876427157 99
190 iso_pu_bacteria 2878035449 2878041580 99
191 iso_pu_bacteria 2878730984 2878734402 99
192 iso_pu_bacteria 2878738818 2878743164 99
193 iso_pu_bacteria 2878745973 2878748825 99
194 iso_pu_bacteria 2878753008 2878758087 99
195 iso_pu_bacteria 2878760144 2878764552 99
196 iso_pu_bacteria 2878767105 2878771653 99
197 iso_pu_bacteria 2878774303 2878776392 99
198 iso_pu_bacteria 2878781027 2878782377 99
199 iso_pu_bacteria 2878788777 2878796099 99
200 iso_pu_bacteria 2881147464 2881152557 99
201 iso_pu_bacteria 2881155292 2881155984 99
202 iso_pu_bacteria 2881161766 2881161787 99
203 iso_pu_bacteria 2881845957 2881846271 99
204 iso_pu_bacteria 2881861095 2881862934 99
205 iso_pu_bacteria 2882632389 2882633068 99
206 iso_pu_bacteria 2882912400 2882916436 99
207 iso_pu_bacteria 2885305155 2885310672 99
208 iso_pu_bacteria 2885312484 2885317436 99
209 iso_pu_bacteria 2885318864 2885322428 99
210 iso_pu_bacteria 2885326080 2885333105 99
211 iso_pu_bacteria 2885334103 2885340433 99
212 iso_pu_bacteria 2885342637 2885343916 99
213 iso_pu_bacteria 2885350715 2885355692 99
214 iso_pu_bacteria 2888337043 2888340688 99
215 iso_pu_bacteria 2888343758 2888347867 99
216 iso_pu_bacteria 2888350351 2888356884 99
217 iso_pu_bacteria 2889010040 2889011931 99
218 iso_pu_bacteria 2889016732 2889023137 99
219 iso_pu_bacteria 2903448605 2903452104 99
220 iso_pu_bacteria 2903492973 2903495122 99
221 iso_pu_bacteria 2903492973 2903496181 99
222 iso_pu_bacteria 2903513507 2903518368 99
223 iso_pu_bacteria 2903521522 2903527080 99
224 iso_pu_bacteria 2903528002 2903533307 99
225 iso_pu_bacteria 2903540706 2903545276 99
226 iso_pu_bacteria 2904659560 2904661890 99
227 iso_pu_bacteria 2906308376 2906311177 99
228 iso_pu_bacteria 2906321335 2906323944 99
229 iso_pu_bacteria 2906328253 2906328365 99
230 iso_pu_bacteria 2906354277 2906363114 99
231 iso_pu_bacteria 2906363423 2906370614 99
232 iso_pu_bacteria 2906370794 2906374318 99
233 iso_pu_bacteria 2906378014 2906378277 99
234 iso_pu_bacteria 2906401398 2906407934 99
235 iso_pu_bacteria 2906408224 2906410568 99
236 iso_pu_bacteria 2906414383 2906416394 99
237 iso_pu_bacteria 2906427513 2906432075 99
238 iso_pu_bacteria 2922130491 2922132708 99
239 iso_pu_bacteria 2922151315 2922154894 99
240 iso_pu_bacteria 2922172374 2922175796 99
241 iso_pu_bacteria 2922185730 2922191540 99
242 iso_pu_bacteria 2924710171 2924712772 99
243 iso_pu_bacteria 2924718760 2924725449 99
244 iso_pu_bacteria 2924726620 2924727274 99
245 iso_pu_bacteria 2924733363 2924736142 99
246 iso_pu_bacteria 2924741084 2924744187 99
247 iso_pu_bacteria 2924748358 2924750377 99
248 iso_pu_bacteria 2924754689 2924756174 99
249 iso_pu_bacteria 2924762789 2924763831 99
250 iso_pu_bacteria 2924776078 2924777278 99
251 iso_pu_bacteria 2924784321 2924785828 99
252 iso_pu_bacteria 2937813078 2937813398 99
253 iso_pu_bacteria 2937822353 2937826669 99
254 iso_pu_bacteria 2937836603 2937839999 99
255 iso_pu_bacteria 2937848649 2937853634 99
256 iso_pu_bacteria 2937861824 2937864419 99
257 iso_pu_bacteria 2937868953 2937869768 99
258 iso_pu_bacteria 2937877337 2937879317 99
259 iso_pu_bacteria 2937891427 2937898203 99
260 iso_pu_bacteria 2937972304 2937974949 99
261 iso_pu_bacteria 2937980651 2937988345 99
262 iso_pu_bacteria 2937994558 2937999126 99
263 iso_pu_bacteria 2938014810 2938019873 99
264 iso_pu_bacteria 2958034702 2958036860 99
265 iso_pu_bacteria 2958041894 2958050482 99
266 iso_pu_bacteria 2958064165 2958070264 99
267 iso_pu_bacteria 2958071322 2958072562 99
268 iso_pu_bacteria 2958084443 2958086492 99
269 iso_pu_bacteria 2958092219 2958100697 99
270 iso_pu_bacteria 2958100919 2958101578 99
271 iso_pu_bacteria 2958108152 2958110469 99
272 iso_pu_bacteria 2958115193 2958122501 99
273 iso_pu_bacteria 2958122699 2958130098 99
274 iso_pu_bacteria 2958130278 2958132798 99
275 iso_pu_bacteria 2958137437 2958142870 99
276 iso_pu_bacteria 2958144490 2958145621 99
277 iso_pu_bacteria 2958158011 2958162962 99
278 iso_pu_bacteria 2958165035 2958169600 99
279 iso_pu_bacteria 2958172287 2958177440 99
280 iso_pu_bacteria 2958179912 2958182930 99
281 iso_pu_bacteria 2961077736 2961080810 99
282 iso_pu_bacteria 2961114664 2961117043 99
283 iso_pu_bacteria 2961127735 2961129434 99
284 iso_pu_bacteria 2961136820 2961139062 99
285 iso_pu_bacteria 2961163497 2961168060 99
286 iso_pu_bacteria 2961170736 2961174717 99
287 iso_pu_bacteria 2961183825 2961186455 99
288 iso_pu_bacteria 2963644680 2963648657 99
289 iso_pu_bacteria 2965018300 2965022879 99
290 iso_pu_bacteria 2965025482 2965027336 99
291 iso_pu_bacteria 2965032056 2965032564 99
292 iso_pu_bacteria 2965040258 2965040808 99
293 iso_pu_bacteria 2965047637 2965050112 99
294 iso_pu_bacteria 2965062239 2965066161 99
295 iso_pu_bacteria 2965089291 2965091041 99
296 iso_pu_bacteria 2965102966 2965104368 99
297 iso_pu_bacteria 2965110997 2965119202 99
298 iso_pu_bacteria 2965119406 2965122188 99
299 iso_pu_bacteria 2967996073 2968000652 99
300 iso_pu_bacteria 2968003550 2968009975 99
301 iso_pu_bacteria 2968016561 2968017465 99
302 iso_pu_bacteria 2968083720 2968083884 99
303 iso_pu_bacteria 2968091066 2968092499 99
304 iso_pu_bacteria 2968097103 2968102413 99
305 iso_pu_bacteria 2968110612 2968112951 99
306 iso_pu_bacteria 2968117919 2968122816 99
307 iso_pu_bacteria 2968128360 2968128770 99
308 iso_pu_bacteria 2968138860 2968145980 99
309 iso_pu_bacteria 2968171901 2968176460 99
310 iso_pu_bacteria 2970469710 2970472359 99
311 iso_pu_bacteria 2970489779 2970490906 99
312 iso_pu_bacteria 2970503327 2970507303 99
313 iso_pu_bacteria 2970510686 2970513848 99
314 iso_pu_bacteria 2970524798 2970530016 99
315 iso_pu_bacteria 2970532167 2970538250 99
316 iso_pu_bacteria 2970540015 2970540156 99
317 iso_pu_bacteria 2970547951 2970548659 99
318 iso_pu_bacteria 2970554993 2970559399 99
319 iso_pu_bacteria 2970593180 2970595501 99
320 iso_pu_bacteria 2970619444 2970620317 99
321 iso_pu_bacteria 2970627176 2970631999 99
322 iso_pu_bacteria 2977821940 2977828839 99
323 iso_pu_bacteria 2977828996 2977829838 99
324 iso_pu_bacteria 2977843712 2977845398 99
325 iso_pu_bacteria 2977851361 2977851795 99
326 iso_pu_bacteria 2977858184 2977860262 99
327 iso_pu_bacteria 2977864932 2977871962 99
328 iso_pu_bacteria 2977872689 2977877378 99
329 iso_pu_bacteria 2977907340 2977911822 99
330 iso_pu_bacteria 2977915119 2977917210 99
331 iso_pu_bacteria 2977922695 2977928123 99
332 iso_pu_bacteria 2977935797 2977939444 99
333 iso_pu_bacteria 2977942078 2977946931 99
334 iso_pu_bacteria 2977950692 2977951358 99
335 iso_pu_bacteria 2977957713 2977958677 99
336 iso_pu_bacteria 2977971508 2977976594 99
337 iso_pu_bacteria 2977986579 2977989483 99
338 iso_pu_bacteria 2979710463 2979716960 99
339 iso_pu_bacteria 2979764755 2979764879 99
340 iso_pu_bacteria 2979772303 2979777665 99
341 iso_pu_bacteria 2979779861 2979783230 99
342 iso_pu_bacteria 2979793036 2979798560 99
343 iso_pu_bacteria 2979808191 2979812499 99
344 iso_pu_bacteria 2987636660 2987640725 99
345 iso_pu_bacteria 2987645492 2987647822 99
346 iso_pu_bacteria 2987652177 2987652485 99
347 iso_pu_bacteria 2987659509 2987664074 99
348 iso_pu_bacteria 2987666974 2987670299 99
349 iso_pu_bacteria 2987673487 2987674285 99
350 iso_pu_bacteria 2996341866 2996347152 99
351 iso_pu_bacteria 2996348954 2996351230 99
352 iso_pu_bacteria 2996386984 2996390915 99
353 iso_pu_bacteria 3000135777 3000136174 99
354 iso_pu_bacteria 3004167301 3004170184 99
355 iso_pu_bacteria 3004188549 3004193129 99
356 iso_pu_bacteria 3004195979 3004197768 99
357 iso_pu_bacteria 3004203850 3004208922 99
358 iso_pu_bacteria 3004211236 3004213108 99
359 iso_pu_bacteria 3004218560 3004222129 99
360 iso_pu_bacteria 3004232784 3004239284 99
361 iso_pu_bacteria 3004239961 3004242906 99
362 iso_pu_bacteria 3004248173 3004255298 99
363 iso_pu_bacteria 3004268573 3004273810 99
364 iso_pu_bacteria 3004275668 3004277928 99
365 iso_pu_bacteria 3004289098 3004290237 99
366 iso_pu_bacteria 3004334049 3004340246 99
367 iso_pu_bacteria 637000159 637073565 99
368 iso_pu_bacteria 649633066 649873501 99
369 iso_pu_bacteria 8004300914 8004304424 99
370 iso_pu_bacteria 8004312739 8004316473 99
371 iso_pu_bacteria 8004361976 8004366435 99
372 iso_pu_bacteria 8004374579 8004379599 99
373 iso_pu_bacteria 8004387939 8004390928 99
374 iso_pu_bacteria 8004395343 8004396383 99
375 iso_pu_bacteria 8004445564 8004451620 99
376 iso_pu_bacteria 8004633249 8004638917 99
377 iso_pu_bacteria 8004640170 8004643111 99
378 iso_pu_bacteria 8004703790 8004714461 99
379 iso_pu_bacteria 8004714634 8004717480 99
380 iso_pu_bacteria 8004727605 8004731776 99
381 iso_pu_bacteria 8055617313 8055622000 99
382 3300003187 JGI25151J46595_10014201 JGI25151J46595_100142014 100
383 iso_pu_bacteria 2919450847 2919456092 100
384 iso_pu_bacteria 8001845381 8001845407 100
385 3300027360 Ga0209969_1006180 Ga0209969_10061801 101
386 3300027462 Ga0210000_1005563 Ga0210000_10055632 101
387 3300027552 Ga0209982_1062947 Ga0209982_10629472 101
388 3300027682 Ga0209971_1067815 Ga0209971_10678152 101
389 3300027876 Ga0209974_10010537 Ga0209974_100105375 101
390 3300036647 Ga0316582_0092116 Ga0316582_0092116_1499_1810 101
391 3300049528 Ga0501312_006401 Ga0501312_006401_593_904 101
392 3300049529 Ga0501313_015486 Ga0501313_015486_503_814 101
393 3300049537 Ga0501321_023114 Ga0501321_023114_73_384 101
394 3300049551 Ga0501335_018154 Ga0501335_018154_113_424 101
395 3300005471 Ga0070698_100248890 Ga0070698_1002488903 102
396 3300006871 Ga0075434_101452939 Ga0075434_1014529391 102
397 3300006881 Ga0068865_100236139 Ga0068865_1002361393 102
398 3300007076 Ga0075435_100322044 Ga0075435_1003220442 102
399 3300009094 Ga0111539_12349564 Ga0111539_123495641 102
400 3300013306 Ga0163162_11696312 Ga0163162_116963121 102
401 3300025940 Ga0207691_10458711 Ga0207691_104587112 102
402 3300031665 Ga0316575_10000478 Ga0316575_100004789 102
403 3300031889 Ga0326468_10126830 Ga0326468_101268302 102
404 3300046514 Ga0495618_0509271 Ga0495618_0509271_74_412 102
405 3300046517 Ga0495630_0084974 Ga0495630_0084974_1047_1385 102
406 3300046557 Ga0495622_0370131 Ga0495622_0370131_224_562 102
407 3300046663 Ga0495635_0082274 Ga0495635_0082274_1317_1655 102
408 3300046681 Ga0495647_0298270 Ga0495647_0298270_45_383 102
409 3300046689 Ga0495613_0136291 Ga0495613_0136291_1372_1710 102
410 3300046690 Ga0495624_0145066 Ga0495624_0145066_213_551 102
411 3300046694 Ga0495649_0061685 Ga0495649_0061685_1546_1905 102
412 3300047319 Ga0495674_0474619 Ga0495674_0474619_621_959 102
413 3300049572 Ga0501036_0286977 Ga0501036_0286977_565_894 102
414 3300049589 Ga0501073_0125304 Ga0501073_0125304_1134_1484 102
415 3300049823 Ga0501044_0146350 Ga0501044_0146350_1239_1595 102
416 3300050511 nmdc:mga08y16_1691682_c1 nmdc:mga08y16_1691682_c1_221_553 102
417 3300060353 Ga0501082_1014961 Ga0501082_1014961_255_584 102
418 iso_pu_bacteria 2977898635 2977899882 102
419 3300003214 JGI25165J46597_1001303 JGI25165J46597_100130314 103
420 3300003320 rootH2_10008940 rootH2_1000894013 103
421 3300005330 Ga0070690_100938696 Ga0070690_1009386961 103
422 3300005344 Ga0070661_100005946 Ga0070661_1000059467 103
423 3300005354 Ga0070675_100665801 Ga0070675_1006658012 103
424 3300005355 Ga0070671_100896302 Ga0070671_1008963021 103
425 3300005455 Ga0070663_100031905 Ga0070663_1000319057 103
426 3300005455 Ga0070663_101068184 Ga0070663_1010681841 103
427 3300005545 Ga0070695_100305763 Ga0070695_1003057632 103
428 3300005546 Ga0070696_101148084 Ga0070696_1011480842 103
429 3300005718 Ga0068866_11245579 Ga0068866_112455792 103
430 3300006195 Ga0075366_10587023 Ga0075366_105870231 103
431 3300006844 Ga0075428_100537794 Ga0075428_1005377942 103
432 3300006846 Ga0075430_100178685 Ga0075430_1001786852 103
433 3300006846 Ga0075430_100378381 Ga0075430_1003783812 103
434 3300006847 Ga0075431_100616853 Ga0075431_1006168533 103
435 3300006880 Ga0075429_100164008 Ga0075429_1001640085 103
436 3300006880 Ga0075429_100695756 Ga0075429_1006957562 103
437 3300009093 Ga0105240_10475761 Ga0105240_104757613 103
438 3300009147 Ga0114129_11039093 Ga0114129_110390932 103
439 3300013100 Ga0157373_11021898 Ga0157373_110218982 103
440 3300013306 Ga0163162_11022366 Ga0163162_110223662 103
441 3300014325 Ga0163163_11035873 Ga0163163_110358731 103
442 3300014326 Ga0157380_10298854 Ga0157380_102988542 103
443 3300014326 Ga0157380_13262196 Ga0157380_132621961 103
444 3300021384 Ga0213876_10753566 Ga0213876_107535661 103
445 3300025261 Ga0209233_1000188 Ga0209233_100018846 103
446 3300025908 Ga0207643_10130247 Ga0207643_101302471 103
447 3300025913 Ga0207695_10830404 Ga0207695_108304042 103
448 3300025920 Ga0207649_10000194 Ga0207649_1000019458 103
449 3300025937 Ga0207669_10656824 Ga0207669_106568242 103
450 3300026067 Ga0207678_10049649 Ga0207678_100496493 103
451 3300031250 Ga0265331_10000186 Ga0265331_1000018637 103
452 3300031250 Ga0265331_10004741 Ga0265331_100047412 103
453 3300031251 Ga0265327_10001297 Ga0265327_1000129743 103
454 3300031711 Ga0265314_10108357 Ga0265314_101083572 103
455 3300035092 Ga0373952_0125763 Ga0373952_0125763_278_589 103
456 3300037312 Ga0395899_0000073 Ga0395899_0000073_74529_74843 103
457 3300037418 Ga0395900_0000027 Ga0395900_0000027_179099_179413 103
458 3300037466 Ga0395898_0000255 Ga0395898_0000255_24159_24473 103
459 3300037471 Ga0395905_0000032 Ga0395905_0000032_106520_106834 103
460 3300038443 Ga0395901_0000110 Ga0395901_0000110_106545_106859 103
461 3300039437 Ga0436365_1489226 Ga0436365_1489226_167_490 103
462 3300041413 Ga0439465_0071193 Ga0439465_0071193_77_391 103
463 3300041496 Ga0451839_1433262 Ga0451839_1433262_94_408 103
464 3300046519 Ga0495632_0437005 Ga0495632_0437005_174_488 103
465 3300046615 Ga0495656_0050677 Ga0495656_0050677_1232_1546 103
466 3300047445 Ga0495677_0037133 Ga0495677_0037133_1327_1641 103
467 3300048922 Ga0496119_0062884 Ga0496119_0062884_1563_1877 103
468 3300048923 Ga0496120_0014732 Ga0496120_0014732_4652_4966 103
469 3300049568 Ga0501031_0000651 Ga0501031_0000651_14366_14680 103
470 3300049568 Ga0501031_0002703 Ga0501031_0002703_981_1295 103
471 3300049568 Ga0501031_0214542 Ga0501031_0214542_195_509 103
472 3300049569 Ga0501032_0000111 Ga0501032_0000111_5868_6182 103
473 3300049569 Ga0501032_0042271 Ga0501032_0042271_1556_1870 103
474 3300049569 Ga0501032_0066026 Ga0501032_0066026_169_483 103
475 3300049569 Ga0501032_0550690 Ga0501032_0550690_203_517 103
476 3300049570 Ga0501033_0012240 Ga0501033_0012240_448_762 103
477 3300049570 Ga0501033_0059135 Ga0501033_0059135_556_870 103
478 3300049570 Ga0501033_0079988 Ga0501033_0079988_135_449 103
479 3300049570 Ga0501033_0087475 Ga0501033_0087475_31_345 103
480 3300049570 Ga0501033_0389767 Ga0501033_0389767_503_817 103
481 3300049571 Ga0501034_0004897 Ga0501034_0004897_94_408 103
482 3300049571 Ga0501034_0006180 Ga0501034_0006180_12149_12463 103
483 3300049571 Ga0501034_0056638 Ga0501034_0056638_2576_2890 103
484 3300049572 Ga0501036_0002605 Ga0501036_0002605_8042_8356 103
485 3300049572 Ga0501036_0021849 Ga0501036_0021849_4955_5269 103
486 3300049572 Ga0501036_0025540 Ga0501036_0025540_705_1019 103
487 3300049572 Ga0501036_0038561 Ga0501036_0038561_2228_2542 103
488 3300049573 Ga0501037_0000131 Ga0501037_0000131_63621_63935 103
489 3300049573 Ga0501037_0006435 Ga0501037_0006435_133_447 103
490 3300049573 Ga0501037_0469909 Ga0501037_0469909_42_356 103
491 3300049574 Ga0501038_0000109 Ga0501038_0000109_63621_63935 103
492 3300049574 Ga0501038_0001882 Ga0501038_0001882_13186_13500 103
493 3300049574 Ga0501038_0096205 Ga0501038_0096205_448_762 103
494 3300049575 Ga0501039_0002279 Ga0501039_0002279_5868_6182 103
495 3300049575 Ga0501039_0098169 Ga0501039_0098169_768_1082 103
496 3300049575 Ga0501039_0183472 Ga0501039_0183472_49_363 103
497 3300049576 Ga0501040_0008666 Ga0501040_0008666_5386_5700 103
498 3300049576 Ga0501040_1251478 Ga0501040_1251478_130_444 103
499 3300049578 Ga0501042_0060942 Ga0501042_0060942_2127_2441 103
500 3300049579 Ga0501043_0021749 Ga0501043_0021749_4366_4680 103
501 3300049579 Ga0501043_0024392 Ga0501043_0024392_133_447 103
502 3300049579 Ga0501043_0047851 Ga0501043_0047851_2068_2382 103
503 3300049579 Ga0501043_0284223 Ga0501043_0284223_115_429 103
504 3300049580 Ga0501046_0018165 Ga0501046_0018165_4434_4748 103
505 3300049580 Ga0501046_0109256 Ga0501046_0109256_873_1187 103
506 3300049580 Ga0501046_0202688 Ga0501046_0202688_748_1062 103
507 3300049580 Ga0501046_0302279 Ga0501046_0302279_656_970 103
508 3300049581 Ga0501047_0011259 Ga0501047_0011259_8020_8334 103
509 3300049581 Ga0501047_0080199 Ga0501047_0080199_111_425 103
510 3300049581 Ga0501047_0197317 Ga0501047_0197317_685_999 103
511 3300049582 Ga0501048_0030318 Ga0501048_0030318_2064_2378 103
512 3300049582 Ga0501048_0060021 Ga0501048_0060021_1184_1498 103
513 3300049584 Ga0501068_0022655 Ga0501068_0022655_704_1018 103
514 3300049584 Ga0501068_0036227 Ga0501068_0036227_1522_1836 103
515 3300049585 Ga0501069_0013201 Ga0501069_0013201_41_355 103
516 3300049585 Ga0501069_0485558 Ga0501069_0485558_385_699 103
517 3300049586 Ga0501070_0001286 Ga0501070_0001286_7728_8042 103
518 3300049586 Ga0501070_0006301 Ga0501070_0006301_4010_4324 103
519 3300049586 Ga0501070_0266802 Ga0501070_0266802_584_898 103
520 3300049586 Ga0501070_0497119 Ga0501070_0497119_10_324 103
521 3300049586 Ga0501070_0527999 Ga0501070_0527999_246_560 103
522 3300049586 Ga0501070_0656325 Ga0501070_0656325_121_435 103
523 3300049586 Ga0501070_1013278 Ga0501070_1013278_162_476 103
524 3300049587 Ga0501071_0046823 Ga0501071_0046823_94_408 103
525 3300049587 Ga0501071_0249510 Ga0501071_0249510_675_989 103
526 3300049588 Ga0501072_0187300 Ga0501072_0187300_329_643 103
527 3300049588 Ga0501072_1166430 Ga0501072_1166430_271_585 103
528 3300049589 Ga0501073_0047706 Ga0501073_0047706_754_1068 103
529 3300049589 Ga0501073_0062660 Ga0501073_0062660_1751_2065 103
530 3300049589 Ga0501073_0172957 Ga0501073_0172957_206_520 103
531 3300049590 Ga0501074_0436632 Ga0501074_0436632_248_562 103
532 3300049590 Ga0501074_1143674 Ga0501074_1143674_79_393 103
533 3300049741 Ga0501079_0026674 Ga0501079_0026674_610_924 103
534 3300049742 Ga0501080_0004752 Ga0501080_0004752_1783_2097 103
535 3300049742 Ga0501080_0017194 Ga0501080_0017194_6007_6321 103
536 3300049742 Ga0501080_0098262 Ga0501080_0098262_921_1235 103
537 3300049744 Ga0501083_0027007 Ga0501083_0027007_2683_2997 103
538 3300049744 Ga0501083_0465931 Ga0501083_0465931_172_486 103
539 3300049822 Ga0501035_0000347 Ga0501035_0000347_52962_53276 103
540 3300049822 Ga0501035_0002188 Ga0501035_0002188_13186_13500 103
541 3300049822 Ga0501035_0048543 Ga0501035_0048543_2564_2878 103
542 3300049822 Ga0501035_0055030 Ga0501035_0055030_1889_2203 103
543 3300049822 Ga0501035_0153056 Ga0501035_0153056_854_1168 103
544 3300049822 Ga0501035_0727136 Ga0501035_0727136_383_697 103
545 3300049823 Ga0501044_0000234 Ga0501044_0000234_63621_63935 103
546 3300049823 Ga0501044_0009229 Ga0501044_0009229_5899_6213 103
547 3300049823 Ga0501044_0015755 Ga0501044_0015755_4477_4791 103
548 3300049823 Ga0501044_0018610 Ga0501044_0018610_6763_7077 103
549 3300049823 Ga0501044_0333346 Ga0501044_0333346_260_574 103
550 3300049823 Ga0501044_0429468 Ga0501044_0429468_55_369 103
551 3300049823 Ga0501044_0517929 Ga0501044_0517929_726_1040 103
552 3300049823 Ga0501044_1400925 Ga0501044_1400925_78_392 103
553 3300049824 Ga0501045_0001715 Ga0501045_0001715_10833_11147 103
554 3300049824 Ga0501045_0599919 Ga0501045_0599919_462_776 103
555 3300050508 nmdc:mga09592_471962_c1 nmdc:mga09592_471962_c1_731_1057 103
556 3300050508 nmdc:mga09592_525365_c1 nmdc:mga09592_525365_c1_330_656 103
557 3300050509 nmdc:mga0qj67_224796_c1 nmdc:mga0qj67_224796_c1_577_903 103
558 3300050510 nmdc:mga06r32_130312_c1 nmdc:mga06r32_130312_c1_293_619 103
559 3300053130 Ga0500642_0430824 Ga0500642_0430824_227_541 103
560 3300053139 Ga0500568_0001953 Ga0500568_0001953_6466_6780 103
561 3300054114 Ga0501084_1818114 Ga0501084_1818114_164_478 103
562 3300060353 Ga0501082_0901501 Ga0501082_0901501_84_398 103
563 3300000531 CNBas_1000512 CNBas_10005124 104
564 3300000546 LJNas_1005486 LJNas_10054862 104
565 3300001979 JGI24740J21852_10003752 JGI24740J21852_100037529 104
566 3300003203 JGI25406J46586_10056851 JGI25406J46586_100568512 104
567 3300003203 JGI25406J46586_10060086 JGI25406J46586_100600862 104
568 3300003911 JGI25405J52794_10019071 JGI25405J52794_100190713 104
569 3300003911 JGI25405J52794_10021947 JGI25405J52794_100219473 104
570 3300004803 Ga0058862_11907125 Ga0058862_119071251 104
571 3300005327 Ga0070658_10028805 Ga0070658_100288053 104
572 3300005329 Ga0070683_101382862 Ga0070683_1013828621 104
573 3300005331 Ga0070670_100876681 Ga0070670_1008766812 104
574 3300005338 Ga0068868_102241852 Ga0068868_1022418521 104
575 3300005347 Ga0070668_100991484 Ga0070668_1009914842 104
576 3300005347 Ga0070668_101822623 Ga0070668_1018226232 104
577 3300005354 Ga0070675_101703736 Ga0070675_1017037361 104
578 3300005367 Ga0070667_100813487 Ga0070667_1008134872 104
579 3300005434 Ga0070709_10004276 Ga0070709_1000427614 104
580 3300005434 Ga0070709_10514065 Ga0070709_105140652 104
581 3300005435 Ga0070714_100850879 Ga0070714_1008508792 104
582 3300005435 Ga0070714_100896558 Ga0070714_1008965582 104
583 3300005435 Ga0070714_101699098 Ga0070714_1016990982 104
584 3300005436 Ga0070713_100027784 Ga0070713_1000277847 104
585 3300005436 Ga0070713_100134612 Ga0070713_1001346122 104
586 3300005436 Ga0070713_100311006 Ga0070713_1003110063 104
587 3300005436 Ga0070713_100410163 Ga0070713_1004101632 104
588 3300005436 Ga0070713_101304049 Ga0070713_1013040491 104
589 3300005437 Ga0070710_10008016 Ga0070710_1000801610 104
590 3300005437 Ga0070710_10033673 Ga0070710_100336731 104
591 3300005439 Ga0070711_100004304 Ga0070711_10000430415 104
592 3300005439 Ga0070711_100016474 Ga0070711_1000164749 104
593 3300005455 Ga0070663_100354335 Ga0070663_1003543351 104
594 3300005456 Ga0070678_102360482 Ga0070678_1023604822 104
595 3300005458 Ga0070681_10606884 Ga0070681_106068843 104
596 3300005467 Ga0070706_100497194 Ga0070706_1004971942 104
597 3300005467 Ga0070706_100739256 Ga0070706_1007392562 104
598 3300005471 Ga0070698_101067047 Ga0070698_1010670472 104
599 3300005548 Ga0070665_100909118 Ga0070665_1009091182 104
600 3300005841 Ga0068863_101225410 Ga0068863_1012254102 104
601 3300005937 Ga0081455_10243564 Ga0081455_102435642 104
602 3300006038 Ga0075365_10000107 Ga0075365_1000010728 104
603 3300006042 Ga0075368_10470280 Ga0075368_104702802 104
604 3300006048 Ga0075363_100062673 Ga0075363_1000626735 104
605 3300006051 Ga0075364_11181400 Ga0075364_111814002 104
606 3300006173 Ga0070716_100401666 Ga0070716_1004016662 104
607 3300006173 Ga0070716_100503906 Ga0070716_1005039062 104
608 3300006175 Ga0070712_100020480 Ga0070712_1000204805 104
609 3300006175 Ga0070712_100025062 Ga0070712_1000250623 104
610 3300006844 Ga0075428_100451792 Ga0075428_1004517922 104
611 3300006846 Ga0075430_100429717 Ga0075430_1004297173 104
612 3300006871 Ga0075434_100648721 Ga0075434_1006487212 104
613 3300006914 Ga0075436_100305975 Ga0075436_1003059752 104
614 3300007076 Ga0075435_100337571 Ga0075435_1003375712 104
615 3300009093 Ga0105240_10652743 Ga0105240_106527432 104
616 3300009094 Ga0111539_10163484 Ga0111539_101634842 104
617 3300009098 Ga0105245_10211036 Ga0105245_102110364 104
618 3300009147 Ga0114129_12790258 Ga0114129_127902581 104
619 3300009545 Ga0105237_10267620 Ga0105237_102676202 104
620 3300009545 Ga0105237_10933630 Ga0105237_109336302 104
621 3300009553 Ga0105249_11449026 Ga0105249_114490262 104
622 3300012497 Ga0157319_1055856 Ga0157319_10558562 104
623 3300012508 Ga0157315_1002191 Ga0157315_10021914 104
624 3300013297 Ga0157378_10572183 Ga0157378_105721832 104
625 3300015261 Ga0182006_1109411 Ga0182006_11094112 104
626 3300017792 Ga0163161_10148208 Ga0163161_101482084 104
627 3300021358 Ga0213873_10019900 Ga0213873_100199004 104
628 3300021377 Ga0213874_10110692 Ga0213874_101106922 104
629 3300021377 Ga0213874_10238810 Ga0213874_102388102 104
630 3300024225 Ga0224572_1027189 Ga0224572_10271892 104
631 3300024227 Ga0228598_1040293 Ga0228598_10402932 104
632 3300024227 Ga0228598_1051633 Ga0228598_10516332 104
633 3300025250 Ga0209026_1019700 Ga0209026_10197002 104
634 3300025898 Ga0207692_10273065 Ga0207692_102730652 104
635 3300025898 Ga0207692_10330105 Ga0207692_103301052 104
636 3300025905 Ga0207685_10194365 Ga0207685_101943652 104
637 3300025906 Ga0207699_10006191 Ga0207699_100061912 104
638 3300025910 Ga0207684_10619235 Ga0207684_106192352 104
639 3300025913 Ga0207695_10447902 Ga0207695_104479022 104
640 3300025914 Ga0207671_10217826 Ga0207671_102178262 104
641 3300025915 Ga0207693_10022819 Ga0207693_100228196 104
642 3300025915 Ga0207693_10108170 Ga0207693_101081705 104
643 3300025916 Ga0207663_10147730 Ga0207663_101477304 104
644 3300025916 Ga0207663_10464189 Ga0207663_104641892 104
645 3300025916 Ga0207663_11160299 Ga0207663_111602992 104
646 3300025928 Ga0207700_10090721 Ga0207700_100907216 104
647 3300025928 Ga0207700_10246796 Ga0207700_102467964 104
648 3300025939 Ga0207665_10083411 Ga0207665_100834112 104
649 3300025939 Ga0207665_10756257 Ga0207665_107562572 104
650 3300026041 Ga0207639_10841057 Ga0207639_108410572 104
651 3300026067 Ga0207678_11046836 Ga0207678_110468362 104
652 3300028036 Ga0265355_1012431 Ga0265355_10124312 104
653 3300028577 Ga0265318_10000037 Ga0265318_1000003714 104
654 3300028577 Ga0265318_10185884 Ga0265318_101858842 104
655 3300028800 Ga0265338_10051741 Ga0265338_100517412 104
656 3300028800 Ga0265338_10168013 Ga0265338_101680134 104
657 3300029957 Ga0265324_10092997 Ga0265324_100929972 104
658 3300030760 Ga0265762_1129483 Ga0265762_11294832 104
659 3300030763 Ga0265763_1000060 Ga0265763_10000606 104
660 3300031235 Ga0265330_10182616 Ga0265330_101826161 104
661 3300031238 Ga0265332_10163035 Ga0265332_101630352 104
662 3300031241 Ga0265325_10256877 Ga0265325_102568772 104
663 3300031249 Ga0265339_10000053 Ga0265339_1000005317 104
664 3300031249 Ga0265339_10136500 Ga0265339_101365002 104
665 3300031344 Ga0265316_10547776 Ga0265316_105477762 104
666 3300031595 Ga0265313_10000098 Ga0265313_1000009870 104
667 3300031595 Ga0265313_10190826 Ga0265313_101908262 104
668 3300031616 Ga0307508_10107154 Ga0307508_101071542 104
669 3300031711 Ga0265314_10028299 Ga0265314_100282995 104
670 3300031712 Ga0265342_10131168 Ga0265342_101311682 104
671 3300032137 Ga0316585_10188778 Ga0316585_101887782 104
672 3300035089 Ga0373944_0014329 Ga0373944_0014329_346_672 104
673 3300035112 Ga0373932_0254903 Ga0373932_0254903_39_353 104
674 3300035116 Ga0373945_0075515 Ga0373945_0075515_485_799 104
675 3300035119 Ga0373956_0004726 Ga0373956_0004726_2615_2941 104
676 3300035119 Ga0373956_0129696 Ga0373956_0129696_512_829 104
677 3300035120 Ga0373957_0099970 Ga0373957_0099970_158_484 104
678 3300035170 Ga0373943_0269998 Ga0373943_0269998_508_834 104
679 3300035171 Ga0373946_0017706 Ga0373946_0017706_849_1175 104
680 3300035172 Ga0373955_0012493 Ga0373955_0012493_45_371 104
681 3300035172 Ga0373955_0391799 Ga0373955_0391799_62_379 104
682 3300035398 Ga0316574_0473572 Ga0316574_0473572_18_335 104
683 3300035398 Ga0316574_0473891 Ga0316574_0473891_41_358 104
684 3300035410 Ga0373924_0007245 Ga0373924_0007245_360_686 104
685 3300035692 Ga0373935_0603953 Ga0373935_0603953_219_545 104
686 3300035692 Ga0373935_1367409 Ga0373935_1367409_110_424 104
687 3300035724 Ga0373933_0000858 Ga0373933_0000858_17825_18151 104
688 3300035725 Ga0373947_0072680 Ga0373947_0072680_357_683 104
689 3300036401 Ga0373937_0001081 Ga0373937_0001081_8631_8957 104
690 3300036401 Ga0373937_0027613 Ga0373937_0027613_3530_3847 104
691 3300036457 Ga0265778_015410 Ga0265778_015410_398_721 104
692 3300037068 Ga0373925_0020584 Ga0373925_0020584_1206_1532 104
693 3300039437 Ga0436365_0395732 Ga0436365_0395732_349_675 104
694 3300039437 Ga0436365_0507633 Ga0436365_0507633_66_392 104
695 3300039437 Ga0436365_1013719 Ga0436365_1013719_135_449 104
696 3300039437 Ga0436365_1728357 Ga0436365_1728357_610_924 104
697 3300039438 Ga0436360_0309547 Ga0436360_0309547_18_335 104
698 3300039447 Ga0436361_0355909 Ga0436361_0355909_81_398 104
699 3300039447 Ga0436361_0661719 Ga0436361_0661719_378_692 104
700 3300039450 Ga0436363_0141605 Ga0436363_0141605_197_511 104
701 3300039450 Ga0436363_1592451 Ga0436363_1592451_199_525 104
702 3300039453 Ga0436362_0518937 Ga0436362_0518937_887_1204 104
703 3300041413 Ga0439465_0121371 Ga0439465_0121371_556_873 104
704 3300041441 Ga0451787_066607 Ga0451787_066607_104_418 104
705 3300041441 Ga0451787_431217 Ga0451787_431217_323_637 104
706 3300041486 Ga0451807_1116814 Ga0451807_1116814_255_575 104
707 3300041491 Ga0451833_0858461 Ga0451833_0858461_46_360 104
708 3300041498 Ga0451841_0060129 Ga0451841_0060129_614_928 104
709 3300042532 Ga0450893_0137798 Ga0450893_0137798_159_488 104
710 3300044693 Ga0466961_0605332 Ga0466961_0605332_163_477 104
711 3300044694 Ga0466963_0104366 Ga0466963_0104366_481_795 104
712 3300044735 Ga0466968_0317749 Ga0466968_0317749_317_631 104
713 3300044765 Ga0466970_0720346 Ga0466970_0720346_52_366 104
714 3300044842 Ga0466957_0159103 Ga0466957_0159103_184_498 104
715 3300044842 Ga0466957_0533626 Ga0466957_0533626_211_525 104
716 3300045049 Ga0466959_0414687 Ga0466959_0414687_454_768 104
717 3300045976 Ga0466967_0129036 Ga0466967_0129036_133_447 104
718 3300046454 Ga0495592_0002995 Ga0495592_0002995_8367_8693 104
719 3300046459 Ga0495629_0003398 Ga0495629_0003398_4717_5043 104
720 3300046462 Ga0495651_0013698 Ga0495651_0013698_2984_3310 104
721 3300046462 Ga0495651_0123510 Ga0495651_0123510_87_404 104
722 3300046463 Ga0495653_0000370 Ga0495653_0000370_28361_28687 104
723 3300046472 Ga0495580_0168910 Ga0495580_0168910_1103_1429 104
724 3300046475 Ga0495639_0132461 Ga0495639_0132461_502_828 104
725 3300046476 Ga0495662_0025995 Ga0495662_0025995_245_571 104
726 3300046477 Ga0495664_0288120 Ga0495664_0288120_347_673 104
727 3300046511 Ga0495608_0094808 Ga0495608_0094808_1027_1353 104
728 3300046514 Ga0495618_0014905 Ga0495618_0014905_366_692 104
729 3300046516 Ga0495628_0003568 Ga0495628_0003568_3543_3869 104
730 3300046526 Ga0495666_0143070 Ga0495666_0143070_158_484 104
731 3300046529 Ga0495652_0004294 Ga0495652_0004294_2513_2839 104
732 3300046531 Ga0495665_0297276 Ga0495665_0297276_157_483 104
733 3300046533 Ga0495640_0000769 Ga0495640_0000769_12171_12497 104
734 3300046535 Ga0495586_0141238 Ga0495586_0141238_219_545 104
735 3300046536 Ga0495587_0001283 Ga0495587_0001283_14025_14351 104
736 3300046543 Ga0495645_0030738 Ga0495645_0030738_3494_3820 104
737 3300046559 Ga0495667_0001942 Ga0495667_0001942_4985_5311 104
738 3300046642 Ga0495634_0002200 Ga0495634_0002200_5010_5336 104
739 3300046663 Ga0495635_0004328 Ga0495635_0004328_2837_3163 104
740 3300046675 Ga0495657_0007254 Ga0495657_0007254_3026_3352 104
741 3300046678 Ga0495599_0011656 Ga0495599_0011656_3251_3577 104
742 3300046679 Ga0495623_0003723 Ga0495623_0003723_4960_5286 104
743 3300046683 Ga0495658_0188648 Ga0495658_0188648_685_1011 104
744 3300046683 Ga0495658_0608878 Ga0495658_0608878_284_601 104
745 3300046689 Ga0495613_0034160 Ga0495613_0034160_1972_2298 104
746 3300046690 Ga0495624_0251830 Ga0495624_0251830_584_910 104
747 3300046809 Ga0495600_0000422 Ga0495600_0000422_7927_8253 104
748 3300047317 Ga0495604_0000406 Ga0495604_0000406_14066_14392 104
749 3300047319 Ga0495674_0000757 Ga0495674_0000757_26300_26626 104
750 3300047322 Ga0495680_0001477 Ga0495680_0001477_8344_8670 104
751 3300047444 Ga0495675_0020789 Ga0495675_0020789_2481_2807 104
752 3300047471 Ga0495684_0002545 Ga0495684_0002545_11958_12284 104
753 3300047471 Ga0495684_0453272 Ga0495684_0453272_279_596 104
754 3300047673 Ga0495593_0014136 Ga0495593_0014136_599_925 104
755 3300048088 Ga0495602_0010292 Ga0495602_0010292_1139_1465 104
756 3300048903 Ga0496100_0158697 Ga0496100_0158697_1226_1552 104
757 3300048903 Ga0496100_0440679 Ga0496100_0440679_264_581 104
758 3300048905 Ga0496102_0957674 Ga0496102_0957674_62_388 104
759 3300048905 Ga0496102_1623407 Ga0496102_1623407_187_513 104
760 3300048906 Ga0496103_0840181 Ga0496103_0840181_84_410 104
761 3300048907 Ga0496104_0156871 Ga0496104_0156871_436_762 104
762 3300048907 Ga0496104_0399628 Ga0496104_0399628_583_900 104
763 3300048908 Ga0496105_0210599 Ga0496105_0210599_1200_1517 104
764 3300048909 Ga0496106_0125870 Ga0496106_0125870_718_1044 104
765 3300048911 Ga0496108_0349307 Ga0496108_0349307_325_642 104
766 3300048911 Ga0496108_0781465 Ga0496108_0781465_102_428 104
767 3300048911 Ga0496108_1582916 Ga0496108_1582916_113_433 104
768 3300048912 Ga0496109_0490138 Ga0496109_0490138_74_400 104
769 3300048913 Ga0496110_1911742 Ga0496110_1911742_65_382 104
770 3300048915 Ga0496112_1331898 Ga0496112_1331898_258_584 104
771 3300048917 Ga0496114_0449076 Ga0496114_0449076_152_478 104
772 3300048918 Ga0496115_0009751 Ga0496115_0009751_4160_4477 104
773 3300048924 Ga0496121_0393347 Ga0496121_0393347_256_570 104
774 3300049568 Ga0501031_0011241 Ga0501031_0011241_4231_4557 104
775 3300049569 Ga0501032_0085200 Ga0501032_0085200_1701_2027 104
776 3300049571 Ga0501034_0355386 Ga0501034_0355386_83_409 104
777 3300049574 Ga0501038_0131973 Ga0501038_0131973_1355_1681 104
778 3300049575 Ga0501039_0237035 Ga0501039_0237035_478_792 104
779 3300049577 Ga0501041_0226440 Ga0501041_0226440_122_448 104
780 3300049578 Ga0501042_0400790 Ga0501042_0400790_497_823 104
781 3300049582 Ga0501048_0085647 Ga0501048_0085647_1846_2172 104
782 3300049584 Ga0501068_0694292 Ga0501068_0694292_311_637 104
783 3300049586 Ga0501070_1458797 Ga0501070_1458797_138_464 104
784 3300049589 Ga0501073_0370679 Ga0501073_0370679_214_540 104
785 3300049590 Ga0501074_0201847 Ga0501074_0201847_31_357 104
786 3300049591 Ga0501075_0756460 Ga0501075_0756460_370_699 104
787 3300049592 Ga0501076_0107789 Ga0501076_0107789_803_1129 104
788 3300049593 Ga0501077_1030740 Ga0501077_1030740_93_419 104
789 3300049823 Ga0501044_0129860 Ga0501044_0129860_1635_1961 104
790 3300049824 Ga0501045_0449763 Ga0501045_0449763_555_881 104
791 3300050509 nmdc:mga0qj67_353427_c1 nmdc:mga0qj67_353427_c1_619_939 104
792 3300050512 nmdc:mga0n895_606845_c1 nmdc:mga0n895_606845_c1_48_374 104
793 3300050513 nmdc:mga0rr50_325194_c1 nmdc:mga0rr50_325194_c1_180_494 104
794 3300050513 nmdc:mga0rr50_379767_c1 nmdc:mga0rr50_379767_c1_556_921 104
795 3300050515 nmdc:mga0a205_1218321_c1 nmdc:mga0a205_1218321_c1_91_405 104
796 3300050515 nmdc:mga0a205_493253_c1 nmdc:mga0a205_493253_c1_688_1014 104
797 3300053077 Ga0495601_0003476 Ga0495601_0003476_4525_4851 104
798 3300053077 Ga0495601_0573828 Ga0495601_0573828_307_624 104
799 3300053078 Ga0495612_0007484 Ga0495612_0007484_4053_4379 104
800 3300053084 Ga0495595_0000821 Ga0495595_0000821_8591_8917 104
801 3300053085 Ga0495619_0000352 Ga0495619_0000352_22571_22897 104
802 3300053093 Ga0500651_0506400 Ga0500651_0506400_246_560 104
803 3300053117 Ga0500593_003205 Ga0500593_003205_3983_4309 104
804 3300053118 Ga0500594_0257413 Ga0500594_0257413_40_366 104
805 3300053151 Ga0500604_0179226 Ga0500604_0179226_174_500 104
806 3300054114 Ga0501084_0230662 Ga0501084_0230662_301_624 104
807 3300054114 Ga0501084_1528553 Ga0501084_1528553_54_380 104
808 3300059426 Ga0590077_067914 Ga0590077_067914_394_711 104
809 3300060353 Ga0501082_1430201 Ga0501082_1430201_147_473 104
810 3300061734 Ga0530510_0511183 Ga0530510_0511183_95_421 104

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

45

108

0.95

PF00467

KOW

KOW motif

8

43

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zq6-assembly1.cif.gz_u 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain 0.9526 2 102
7zq6-assembly1.cif.gz_u 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain 0.9426 2 102
8cgd-assembly1.cif.gz_t clindamycin bound to the 50s subunit 0.9398 2 102
6gsk-assembly2.cif.gz_C5 structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site 0.9373 5 72
8cgk-assembly1.cif.gz_t lincomycin and avilamycin bound to the 50s subunit 0.9351 2 102
ID Description Score Start End Superfamily
af_C6KSP8_36_136_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9212 3 100 2.30.30.30
af_Q653V9_69_173_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9162 5 99 2.30.30.30
af_Q96A35_47_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9141 5 99 2.30.30.30
af_Q8I5H8_47_152_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9099 5 100 2.30.30.30
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9066 3 100 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A7D9HM89-F1-model_v4 Large ribosomal subunit protein uL24m (39S ribosomal protein L24, mitochondrial) 0.9523 5 102 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7X5JDA8-F1-model_v4 Large ribosomal subunit protein uL24 0.9511 3 102 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1I1PN76-F1-model_v4 Large ribosomal subunit protein uL24 0.9509 1 102 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A7RLR8-F1-model_v4 Large ribosomal subunit protein uL24m (39S ribosomal protein L24, mitochondrial) 0.9492 3 102 GO:0003723
GO:0003735
GO:0005739
GO:0005840
GO:0006412
GO:1990904
AF-A0A4V3BBM6-F1-model_v4 Large ribosomal subunit protein uL24 0.9482 1 102 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
88.66 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map