F481797
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 810 | 602 | 534 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300007076|Ga0075435_100337571|Ga0075435_1003375712 |
| Length | 121 |
| Sequence | MSARHVRKGDLVMVTSGSHKGKTGTVMRVISGDEPGSGRVVIKGLNLRTKHLRPTQKAPQGGIVTREAPVHISNVSPVDKNGKPTRVRFKSKPDGSKVRLAATTGETLGEPIRSAESKKSH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 6 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 7 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 8 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 9 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 10 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 11 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 12 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 13 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 14 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 15 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 16 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 17 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 18 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 19 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 20 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 21 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 22 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 23 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 24 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 25 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 26 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 27 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 28 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 29 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 30 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 31 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 32 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 33 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 34 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 35 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 36 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 37 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 38 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 39 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 40 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 41 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 42 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 43 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 44 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 45 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 46 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 47 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 48 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 49 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 50 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 51 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 52 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 53 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 54 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 55 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 56 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 57 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 58 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 59 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 60 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 61 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 62 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 63 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 64 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 65 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 66 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 67 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 68 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 69 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 70 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 71 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 72 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 73 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 74 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 75 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 76 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 77 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 78 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 79 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 80 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 81 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 82 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 83 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 84 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 85 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 86 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 87 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 88 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 89 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 90 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 91 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 92 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 93 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 94 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 95 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 96 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 97 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 98 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 99 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 100 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 101 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 102 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 103 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 104 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 105 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 106 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 107 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 108 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 109 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 110 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 111 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 112 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 113 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 114 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 115 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 116 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 117 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 118 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 119 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 120 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 121 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 122 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 123 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 124 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 125 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 126 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 127 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 128 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 129 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 130 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 131 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 132 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 133 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 134 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 135 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 136 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 137 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 138 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 139 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 140 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 141 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 142 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 143 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 144 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 145 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 146 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 147 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 148 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 149 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 150 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 151 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 152 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 153 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 154 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 155 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 156 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 157 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 158 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 159 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 160 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 161 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 162 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 163 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 164 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 165 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 166 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 167 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 168 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 169 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 170 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 171 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 172 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 173 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 174 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 175 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 176 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 177 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 178 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 179 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 180 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 181 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 182 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 183 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 184 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 185 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 186 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 187 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 188 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 189 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 190 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 191 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 192 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 193 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 194 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 195 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 196 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 197 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 198 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 199 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 200 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 201 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 202 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 203 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 204 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 205 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 206 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 207 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 208 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 209 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 210 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 211 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 212 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 213 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 214 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 215 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 216 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 217 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 218 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 219 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 220 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 221 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 222 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 223 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 224 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 225 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 226 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 227 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 228 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 229 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 230 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 231 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 232 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 233 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 234 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 235 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 236 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 237 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 238 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 239 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 240 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 241 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 242 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 243 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 244 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 245 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 246 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 247 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 248 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 249 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 250 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 251 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 252 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 253 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 254 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 255 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 256 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 257 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 258 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 259 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 260 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 261 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 262 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 263 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 264 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 265 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 266 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 267 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 268 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 269 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 270 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 271 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 272 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 274 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 275 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 276 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 277 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 278 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 279 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 280 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 281 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 282 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 283 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 284 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 285 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 286 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 287 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 288 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 289 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 290 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 291 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 292 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 293 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 294 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 295 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 296 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 297 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 298 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 299 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 300 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 301 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 302 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 303 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 304 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 305 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 306 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 307 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 308 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 309 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 310 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 311 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 312 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 313 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 314 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 315 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 316 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 317 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 318 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 319 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 320 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 321 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 322 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 323 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 325 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 327 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 328 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 329 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 330 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 331 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 332 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 333 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 334 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 335 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 336 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 337 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 338 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 339 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 340 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 341 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 342 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 343 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 344 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 345 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 346 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 347 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 348 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 349 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 350 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 351 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 381 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 383 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 384 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 385 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 386 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 389 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 390 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 391 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 392 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 393 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 394 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 395 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 396 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 397 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 398 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 399 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 400 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 401 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 402 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 403 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 404 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 405 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 406 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 407 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 408 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 409 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 410 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 411 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 412 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 413 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 414 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 415 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 416 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 417 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 418 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 420 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 421 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 422 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 423 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 424 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 425 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 426 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 427 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 428 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 429 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 430 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 431 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 432 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 433 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 434 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 435 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 436 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 437 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 438 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 439 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 440 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 441 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 442 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 443 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 444 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 445 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 446 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 447 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 490 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 491 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 492 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 493 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 494 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 495 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 496 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 497 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 498 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 499 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 500 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 501 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 502 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 503 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 504 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 505 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 506 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 507 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 508 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 509 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 510 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 511 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 512 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 513 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 514 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 515 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 516 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 517 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 519 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 520 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 521 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 522 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 523 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 524 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 525 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 526 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 527 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 528 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 529 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 530 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 531 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 532 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 533 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 534 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 535 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 536 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 537 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 538 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 539 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 540 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 541 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 542 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 543 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 544 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 545 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 546 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 547 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 548 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 549 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 550 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 551 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 552 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 553 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 554 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 555 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 560 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 561 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 562 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 563 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 564 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 565 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 566 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 567 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 568 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 569 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 570 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 571 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 572 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 573 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 574 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 575 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 576 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 577 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 578 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 579 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 580 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 581 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 582 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 583 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 584 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 585 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 586 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 587 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 588 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 589 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 590 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 591 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 592 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 593 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 594 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 595 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 596 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 597 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 598 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 599 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 600 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 601 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 602 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 62.72 |
| Metatranscriptomes | 3.21 |
| Isolates | 34.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.7 |
| Nodule | 29.63 |
| Rhizoplane | 3.21 |
| Rhizosphere | 56.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNBas_1000512 | 3300000531 | Bacteria | 1728 |
| 2 | LJNas_1005486 | 3300000546 | Bacteria | 1383 |
| 3 | JGI24740J21852_10003752 | 3300001979 | Bacteria | 6614 |
| 4 | JGI24739J22299_10014505 | 3300001989 | Bacteria | 2867 |
| 5 | JGI24735J21928_10008865 | 3300002067 | Bacteria | 3244 |
| 6 | JGI25156J39149_1004694 | 3300002705 | Bacteria | 4104 |
| 7 | JGI25157J39369_1002241 | 3300002741 | Bacteria | 5220 |
| 8 | JGI25151J46595_10014201 | 3300003187 | Bacteria | 3556 |
| 9 | JGI25406J46586_10056851 | 3300003203 | Bacteria | 1281 |
| 10 | JGI25406J46586_10060086 | 3300003203 | Bacteria | 1231 |
| 11 | JGI25165J46597_1001303 | 3300003214 | Bacteria | 14268 |
| 12 | rootH2_10008940 | 3300003320 | Bacteria | 20037 |
| 13 | JGI25405J52794_10019071 | 3300003911 | Bacteria | 1373 |
| 14 | JGI25405J52794_10021947 | 3300003911 | Bacteria | 1292 |
| 15 | Ga0058862_11907125 | 3300004803 | Bacteria | 611 |
| 16 | Ga0070658_10028805 | 3300005327 | Bacteria | 4459 |
| 17 | Ga0070683_101382862 | 3300005329 | Bacteria | 676 |
| 18 | Ga0070683_102230312 | 3300005329 | Bacteria | 526 |
| 19 | Ga0070690_100938696 | 3300005330 | Bacteria | 679 |
| 20 | Ga0070670_100876681 | 3300005331 | Bacteria | 813 |
| 21 | Ga0068868_102241852 | 3300005338 | Bacteria | 520 |
| 22 | Ga0070661_100005946 | 3300005344 | Bacteria | 8403 |
| 23 | Ga0070668_100991484 | 3300005347 | Bacteria | 755 |
| 24 | Ga0070668_101822623 | 3300005347 | Bacteria | 560 |
| 25 | Ga0070675_100665801 | 3300005354 | Bacteria | 947 |
| 26 | Ga0070675_101703736 | 3300005354 | Bacteria | 582 |
| 27 | Ga0070671_100896302 | 3300005355 | Bacteria | 775 |
| 28 | Ga0070667_100813487 | 3300005367 | Bacteria | 868 |
| 29 | Ga0070709_10004276 | 3300005434 | Bacteria | 7699 |
| 30 | Ga0070709_10514065 | 3300005434 | Bacteria | 911 |
| 31 | Ga0070714_100850879 | 3300005435 | Bacteria | 884 |
| 32 | Ga0070714_100896558 | 3300005435 | Bacteria | 861 |
| 33 | Ga0070714_101699098 | 3300005435 | Bacteria | 616 |
| 34 | Ga0070713_100027784 | 3300005436 | Bacteria | 4460 |
| 35 | Ga0070713_100134612 | 3300005436 | Bacteria | 2183 |
| 36 | Ga0070713_100311006 | 3300005436 | Bacteria | 1453 |
| 37 | Ga0070713_100410163 | 3300005436 | Bacteria | 1267 |
| 38 | Ga0070713_101304049 | 3300005436 | Bacteria | 704 |
| 39 | Ga0070710_10008016 | 3300005437 | Bacteria | 5135 |
| 40 | Ga0070710_10033673 | 3300005437 | Bacteria | 2783 |
| 41 | Ga0070711_100004304 | 3300005439 | Bacteria | 8381 |
| 42 | Ga0070711_100016474 | 3300005439 | Bacteria | 4695 |
| 43 | Ga0070663_100031905 | 3300005455 | Bacteria | 3626 |
| 44 | Ga0070663_100354335 | 3300005455 | Bacteria | 1189 |
| 45 | Ga0070663_101068184 | 3300005455 | Bacteria | 704 |
| 46 | Ga0070678_102360482 | 3300005456 | Bacteria | 505 |
| 47 | Ga0070681_10606884 | 3300005458 | Bacteria | 1009 |
| 48 | Ga0070706_100497194 | 3300005467 | Bacteria | 1135 |
| 49 | Ga0070706_100739256 | 3300005467 | Bacteria | 912 |
| 50 | Ga0070698_100248890 | 3300005471 | Bacteria | 1710 |
| 51 | Ga0070698_101067047 | 3300005471 | Bacteria | 756 |
| 52 | Ga0070684_101908397 | 3300005535 | Bacteria | 560 |
| 53 | Ga0068853_101643701 | 3300005539 | Bacteria | 622 |
| 54 | Ga0070695_100305763 | 3300005545 | Bacteria | 1177 |
| 55 | Ga0070696_101148084 | 3300005546 | Bacteria | 655 |
| 56 | Ga0070665_100909118 | 3300005548 | Bacteria | 893 |
| 57 | Ga0068855_100210622 | 3300005563 | Bacteria | 2184 |
| 58 | Ga0068856_101637289 | 3300005614 | Bacteria | 656 |
| 59 | Ga0068852_100180569 | 3300005616 | Bacteria | 1984 |
| 60 | Ga0068866_11245579 | 3300005718 | Bacteria | 539 |
| 61 | Ga0068863_101225410 | 3300005841 | Bacteria | 756 |
| 62 | Ga0081455_10012098 | 3300005937 | Bacteria | 8627 |
| 63 | Ga0081455_10243564 | 3300005937 | Bacteria | 1320 |
| 64 | Ga0075365_10000107 | 3300006038 | Bacteria | 24426 |
| 65 | Ga0075365_11145344 | 3300006038 | Bacteria | 547 |
| 66 | Ga0075368_10135628 | 3300006042 | Bacteria | 1024 |
| 67 | Ga0075368_10284110 | 3300006042 | Bacteria | 711 |
| 68 | Ga0075368_10470280 | 3300006042 | Bacteria | 558 |
| 69 | Ga0075363_100062673 | 3300006048 | Bacteria | 2005 |
| 70 | Ga0075364_11181400 | 3300006051 | Bacteria | 519 |
| 71 | Ga0070716_100401666 | 3300006173 | Bacteria | 986 |
| 72 | Ga0070716_100503906 | 3300006173 | Bacteria | 893 |
| 73 | Ga0070712_100020480 | 3300006175 | Bacteria | 4328 |
| 74 | Ga0070712_100025062 | 3300006175 | Bacteria | 3960 |
| 75 | Ga0075367_10076001 | 3300006178 | Bacteria | 2026 |
| 76 | Ga0075369_10203729 | 3300006186 | Bacteria | 913 |
| 77 | Ga0075366_10587023 | 3300006195 | Bacteria | 690 |
| 78 | Ga0075370_10384138 | 3300006353 | Bacteria | 841 |
| 79 | Ga0075428_100451792 | 3300006844 | Bacteria | 1376 |
| 80 | Ga0075428_100537794 | 3300006844 | Bacteria | 1249 |
| 81 | Ga0075430_100178685 | 3300006846 | Bacteria | 1765 |
| 82 | Ga0075430_100378381 | 3300006846 | Bacteria | 1168 |
| 83 | Ga0075430_100429717 | 3300006846 | Bacteria | 1090 |
| 84 | Ga0075431_100616853 | 3300006847 | Bacteria | 1067 |
| 85 | Ga0075434_100648721 | 3300006871 | Bacteria | 1074 |
| 86 | Ga0075434_101452939 | 3300006871 | Bacteria | 695 |
| 87 | Ga0075429_100164008 | 3300006880 | Bacteria | 1946 |
| 88 | Ga0075429_100695756 | 3300006880 | Bacteria | 890 |
| 89 | Ga0068865_100236139 | 3300006881 | Bacteria | 1437 |
| 90 | Ga0075436_100305975 | 3300006914 | Bacteria | 1140 |
| 91 | Ga0075435_100322044 | 3300007076 | Bacteria | 1323 |
| 92 | Ga0075435_100337571 | 3300007076 | Bacteria | 1291 |
| 93 | Ga0105240_10475761 | 3300009093 | Bacteria | 1393 |
| 94 | Ga0105240_10652743 | 3300009093 | Bacteria | 1153 |
| 95 | Ga0105240_10912012 | 3300009093 | Bacteria | 945 |
| 96 | Ga0105240_11344212 | 3300009093 | Bacteria | 752 |
| 97 | Ga0111539_10163484 | 3300009094 | Bacteria | 2603 |
| 98 | Ga0111539_12349564 | 3300009094 | Bacteria | 618 |
| 99 | Ga0105245_10211036 | 3300009098 | Bacteria | 1869 |
| 100 | Ga0114129_11039093 | 3300009147 | Bacteria | 1029 |
| 101 | Ga0114129_12790258 | 3300009147 | Bacteria | 581 |
| 102 | Ga0105241_11758349 | 3300009174 | Bacteria | 604 |
| 103 | Ga0105237_10267620 | 3300009545 | Bacteria | 1712 |
| 104 | Ga0105237_10933630 | 3300009545 | Bacteria | 875 |
| 105 | Ga0105237_11774512 | 3300009545 | Bacteria | 625 |
| 106 | Ga0105238_10026677 | 3300009551 | Bacteria | 5890 |
| 107 | Ga0105238_12120359 | 3300009551 | Bacteria | 596 |
| 108 | Ga0105249_11449026 | 3300009553 | Bacteria | 759 |
| 109 | Ga0157319_1055856 | 3300012497 | Bacteria | 502 |
| 110 | Ga0157315_1002191 | 3300012508 | Bacteria | 1193 |
| 111 | Ga0157373_10918017 | 3300013100 | Bacteria | 650 |
| 112 | Ga0157373_11021898 | 3300013100 | Bacteria | 618 |
| 113 | Ga0157370_11047510 | 3300013104 | Bacteria | 738 |
| 114 | Ga0157378_10572183 | 3300013297 | Bacteria | 1138 |
| 115 | Ga0163162_11022366 | 3300013306 | Bacteria | 935 |
| 116 | Ga0163162_11696312 | 3300013306 | Bacteria | 721 |
| 117 | Ga0157372_12179280 | 3300013307 | Bacteria | 637 |
| 118 | Ga0163163_11035873 | 3300014325 | Bacteria | 884 |
| 119 | Ga0157380_10034018 | 3300014326 | Bacteria | 3929 |
| 120 | Ga0157380_10298854 | 3300014326 | Bacteria | 1482 |
| 121 | Ga0157380_13262196 | 3300014326 | Bacteria | 518 |
| 122 | Ga0182008_10460986 | 3300014497 | Bacteria | 693 |
| 123 | Ga0182006_1109411 | 3300015261 | Bacteria | 971 |
| 124 | Ga0163161_10148208 | 3300017792 | Bacteria | 1782 |
| 125 | Ga0213873_10019900 | 3300021358 | Bacteria | 1562 |
| 126 | Ga0213874_10110692 | 3300021377 | Bacteria | 923 |
| 127 | Ga0213874_10238810 | 3300021377 | Bacteria | 666 |
| 128 | Ga0213876_10753566 | 3300021384 | Bacteria | 518 |
| 129 | Ga0224572_1027189 | 3300024225 | Bacteria | 1096 |
| 130 | Ga0228598_1040293 | 3300024227 | Bacteria | 922 |
| 131 | Ga0228598_1051633 | 3300024227 | Bacteria | 816 |
| 132 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 133 | Ga0209026_1019700 | 3300025250 | Bacteria | 1055 |
| 134 | Ga0209759_1000119 | 3300025256 | Bacteria | 141051 |
| 135 | Ga0209233_1000188 | 3300025261 | Bacteria | 132904 |
| 136 | Ga0209233_1056679 | 3300025261 | Bacteria | 772 |
| 137 | Ga0209758_1006057 | 3300025297 | Bacteria | 8913 |
| 138 | Ga0207692_10273065 | 3300025898 | Bacteria | 1020 |
| 139 | Ga0207692_10330105 | 3300025898 | Bacteria | 936 |
| 140 | Ga0207647_10548456 | 3300025904 | Bacteria | 641 |
| 141 | Ga0207685_10194365 | 3300025905 | Bacteria | 949 |
| 142 | Ga0207699_10006191 | 3300025906 | Bacteria | 5772 |
| 143 | Ga0207643_10130247 | 3300025908 | Bacteria | 1496 |
| 144 | Ga0207684_10619235 | 3300025910 | Bacteria | 924 |
| 145 | Ga0207695_10447902 | 3300025913 | Bacteria | 1174 |
| 146 | Ga0207695_10769648 | 3300025913 | Bacteria | 843 |
| 147 | Ga0207695_10830404 | 3300025913 | Bacteria | 804 |
| 148 | Ga0207671_10148713 | 3300025914 | Bacteria | 1809 |
| 149 | Ga0207671_10217826 | 3300025914 | Bacteria | 1495 |
| 150 | Ga0207693_10022819 | 3300025915 | Bacteria | 4968 |
| 151 | Ga0207693_10108170 | 3300025915 | Bacteria | 2181 |
| 152 | Ga0207663_10147730 | 3300025916 | Bacteria | 1645 |
| 153 | Ga0207663_10464189 | 3300025916 | Bacteria | 978 |
| 154 | Ga0207663_11160299 | 3300025916 | Bacteria | 621 |
| 155 | Ga0207657_11098082 | 3300025919 | Bacteria | 608 |
| 156 | Ga0207649_10000194 | 3300025920 | Bacteria | 50112 |
| 157 | Ga0207649_11022365 | 3300025920 | Bacteria | 651 |
| 158 | Ga0207700_10090721 | 3300025928 | Bacteria | 2412 |
| 159 | Ga0207700_10246796 | 3300025928 | Bacteria | 1524 |
| 160 | Ga0207690_10464805 | 3300025932 | Bacteria | 1019 |
| 161 | Ga0207669_10656824 | 3300025937 | Bacteria | 858 |
| 162 | Ga0207665_10083411 | 3300025939 | Bacteria | 2204 |
| 163 | Ga0207665_10756257 | 3300025939 | Bacteria | 766 |
| 164 | Ga0207691_10458711 | 3300025940 | Bacteria | 1084 |
| 165 | Ga0207661_12025456 | 3300025944 | Bacteria | 522 |
| 166 | Ga0207667_10951322 | 3300025949 | Bacteria | 848 |
| 167 | Ga0207640_10465117 | 3300025981 | Bacteria | 1045 |
| 168 | Ga0207639_10032054 | 3300026041 | Bacteria | 3866 |
| 169 | Ga0207639_10841057 | 3300026041 | Bacteria | 856 |
| 170 | Ga0207678_10049649 | 3300026067 | Bacteria | 3626 |
| 171 | Ga0207678_11046836 | 3300026067 | Bacteria | 722 |
| 172 | Ga0207678_11592866 | 3300026067 | Bacteria | 575 |
| 173 | Ga0207702_11985607 | 3300026078 | Bacteria | 572 |
| 174 | Ga0207674_10501111 | 3300026116 | Bacteria | 1173 |
| 175 | Ga0207698_10235545 | 3300026142 | Bacteria | 1665 |
| 176 | Ga0209969_1006180 | 3300027360 | Bacteria | 1685 |
| 177 | Ga0210000_1005563 | 3300027462 | Bacteria | 1828 |
| 178 | Ga0209982_1062947 | 3300027552 | Bacteria | 604 |
| 179 | Ga0209971_1067815 | 3300027682 | Bacteria | 865 |
| 180 | Ga0209813_10325881 | 3300027866 | Bacteria | 603 |
| 181 | Ga0209974_10010537 | 3300027876 | Bacteria | 3118 |
| 182 | Ga0265355_1012431 | 3300028036 | Bacteria | 706 |
| 183 | Ga0265318_10000037 | 3300028577 | Bacteria | 138223 |
| 184 | Ga0265318_10185884 | 3300028577 | Bacteria | 761 |
| 185 | Ga0265338_10051741 | 3300028800 | Bacteria | 3694 |
| 186 | Ga0265338_10168013 | 3300028800 | Bacteria | 1686 |
| 187 | Ga0265324_10092997 | 3300029957 | Bacteria | 1026 |
| 188 | Ga0265762_1129483 | 3300030760 | Bacteria | 584 |
| 189 | Ga0265763_1000060 | 3300030763 | Bacteria | 4522 |
| 190 | Ga0265330_10182616 | 3300031235 | Bacteria | 888 |
| 191 | Ga0265332_10163035 | 3300031238 | Bacteria | 931 |
| 192 | Ga0265325_10256877 | 3300031241 | Bacteria | 790 |
| 193 | Ga0265339_10000053 | 3300031249 | Bacteria | 101277 |
| 194 | Ga0265339_10136500 | 3300031249 | Bacteria | 1251 |
| 195 | Ga0265331_10000186 | 3300031250 | Bacteria | 76149 |
| 196 | Ga0265331_10004741 | 3300031250 | Bacteria | 8403 |
| 197 | Ga0265327_10001297 | 3300031251 | Bacteria | 32731 |
| 198 | Ga0265316_10547776 | 3300031344 | Bacteria | 824 |
| 199 | Ga0265313_10000098 | 3300031595 | Bacteria | 89130 |
| 200 | Ga0265313_10190826 | 3300031595 | Bacteria | 857 |
| 201 | Ga0307508_10107154 | 3300031616 | Bacteria | 2393 |
| 202 | Ga0316575_10000478 | 3300031665 | Bacteria | 11549 |
| 203 | Ga0265314_10028299 | 3300031711 | Bacteria | 4180 |
| 204 | Ga0265314_10108357 | 3300031711 | Bacteria | 1770 |
| 205 | Ga0265342_10131168 | 3300031712 | Bacteria | 1404 |
| 206 | Ga0326468_10126830 | 3300031889 | Bacteria | 504 |
| 207 | Ga0316585_10188778 | 3300032137 | Bacteria | 681 |
| 208 | Ga0373944_0014329 | 3300035089 | Bacteria | 2212 |
| 209 | Ga0373952_0125763 | 3300035092 | Bacteria | 700 |
| 210 | Ga0373932_0254903 | 3300035112 | Bacteria | 641 |
| 211 | Ga0373945_0075515 | 3300035116 | Bacteria | 1283 |
| 212 | Ga0373956_0004726 | 3300035119 | Bacteria | 5447 |
| 213 | Ga0373956_0129696 | 3300035119 | Bacteria | 1180 |
| 214 | Ga0373957_0099970 | 3300035120 | Bacteria | 1160 |
| 215 | Ga0373943_0269998 | 3300035170 | Bacteria | 959 |
| 216 | Ga0373946_0017706 | 3300035171 | Bacteria | 2729 |
| 217 | Ga0373955_0012493 | 3300035172 | Bacteria | 4080 |
| 218 | Ga0373955_0391799 | 3300035172 | Bacteria | 843 |
| 219 | Ga0316574_0473572 | 3300035398 | Bacteria | 783 |
| 220 | Ga0316574_0473891 | 3300035398 | Bacteria | 783 |
| 221 | Ga0373924_0007245 | 3300035410 | Bacteria | 3999 |
| 222 | Ga0373931_0102300 | 3300035691 | Bacteria | 1613 |
| 223 | Ga0373935_0603953 | 3300035692 | Bacteria | 802 |
| 224 | Ga0373935_1367409 | 3300035692 | Bacteria | 529 |
| 225 | Ga0373933_0000858 | 3300035724 | Bacteria | 18640 |
| 226 | Ga0373947_0072680 | 3300035725 | Bacteria | 2112 |
| 227 | Ga0373937_0001081 | 3300036401 | Bacteria | 22992 |
| 228 | Ga0373937_0027613 | 3300036401 | Bacteria | 5134 |
| 229 | Ga0265778_015410 | 3300036457 | Bacteria | 909 |
| 230 | Ga0316582_0092116 | 3300036647 | Bacteria | 1997 |
| 231 | Ga0373925_0020584 | 3300037068 | Bacteria | 4805 |
| 232 | Ga0395899_0000073 | 3300037312 | Bacteria | 181387 |
| 233 | Ga0395899_0075725 | 3300037312 | Bacteria | 2457 |
| 234 | Ga0395899_0522157 | 3300037312 | Bacteria | 767 |
| 235 | Ga0395900_0000027 | 3300037418 | Bacteria | 285957 |
| 236 | Ga0395900_0012290 | 3300037418 | Bacteria | 8757 |
| 237 | Ga0395900_0237581 | 3300037418 | Bacteria | 1829 |
| 238 | Ga0395898_0000255 | 3300037466 | Bacteria | 131017 |
| 239 | Ga0395898_0029950 | 3300037466 | Bacteria | 5449 |
| 240 | Ga0395898_0676107 | 3300037466 | Bacteria | 974 |
| 241 | Ga0395898_0814957 | 3300037466 | Bacteria | 873 |
| 242 | Ga0395905_0000032 | 3300037471 | Bacteria | 285932 |
| 243 | Ga0395905_0361417 | 3300037471 | Bacteria | 1344 |
| 244 | Ga0395901_0000110 | 3300038443 | Bacteria | 112682 |
| 245 | Ga0395901_0052439 | 3300038443 | Bacteria | 4239 |
| 246 | Ga0436365_0395732 | 3300039437 | Bacteria | 1877 |
| 247 | Ga0436365_0507633 | 3300039437 | Bacteria | 825 |
| 248 | Ga0436365_1013719 | 3300039437 | Bacteria | 1092 |
| 249 | Ga0436365_1489226 | 3300039437 | Bacteria | 543 |
| 250 | Ga0436365_1728357 | 3300039437 | Bacteria | 1331 |
| 251 | Ga0436360_0309547 | 3300039438 | Bacteria | 532 |
| 252 | Ga0436361_0355909 | 3300039447 | Bacteria | 584 |
| 253 | Ga0436361_0661719 | 3300039447 | Bacteria | 723 |
| 254 | Ga0436363_0141605 | 3300039450 | Bacteria | 956 |
| 255 | Ga0436363_1592451 | 3300039450 | Bacteria | 810 |
| 256 | Ga0436362_0518937 | 3300039453 | Bacteria | 1227 |
| 257 | Ga0439465_0071193 | 3300041413 | Bacteria | 1166 |
| 258 | Ga0439465_0121371 | 3300041413 | Bacteria | 916 |
| 259 | Ga0451787_066607 | 3300041441 | Bacteria | 696 |
| 260 | Ga0451787_431217 | 3300041441 | Bacteria | 778 |
| 261 | Ga0451807_1116814 | 3300041486 | Bacteria | 674 |
| 262 | Ga0451833_0858461 | 3300041491 | Bacteria | 596 |
| 263 | Ga0451839_1433262 | 3300041496 | Bacteria | 805 |
| 264 | Ga0451841_0060129 | 3300041498 | Bacteria | 956 |
| 265 | Ga0450893_0137798 | 3300042532 | Bacteria | 519 |
| 266 | Ga0466972_0010313 | 3300044658 | Bacteria | 4691 |
| 267 | Ga0466961_0605332 | 3300044693 | Bacteria | 659 |
| 268 | Ga0466963_0104366 | 3300044694 | Bacteria | 1942 |
| 269 | Ga0466968_0054651 | 3300044735 | Bacteria | 1712 |
| 270 | Ga0466968_0317749 | 3300044735 | Bacteria | 752 |
| 271 | Ga0466970_0180053 | 3300044765 | Bacteria | 1173 |
| 272 | Ga0466970_0720346 | 3300044765 | Bacteria | 582 |
| 273 | Ga0466957_0159103 | 3300044842 | Bacteria | 1466 |
| 274 | Ga0466957_0533626 | 3300044842 | Bacteria | 816 |
| 275 | Ga0466960_0029748 | 3300044901 | Bacteria | 2509 |
| 276 | Ga0466959_0414687 | 3300045049 | Bacteria | 914 |
| 277 | Ga0466967_0129036 | 3300045976 | Bacteria | 2345 |
| 278 | Ga0466967_0392850 | 3300045976 | Bacteria | 1348 |
| 279 | Ga0495592_0002995 | 3300046454 | Bacteria | 12028 |
| 280 | Ga0495629_0003398 | 3300046459 | Bacteria | 12038 |
| 281 | Ga0495651_0013698 | 3300046462 | Bacteria | 6268 |
| 282 | Ga0495651_0123510 | 3300046462 | Bacteria | 1899 |
| 283 | Ga0495653_0000370 | 3300046463 | Bacteria | 36284 |
| 284 | Ga0495580_0168910 | 3300046472 | Bacteria | 1513 |
| 285 | Ga0495639_0132461 | 3300046475 | Bacteria | 1194 |
| 286 | Ga0495662_0025995 | 3300046476 | Bacteria | 2828 |
| 287 | Ga0495664_0288120 | 3300046477 | Bacteria | 992 |
| 288 | Ga0495608_0094808 | 3300046511 | Bacteria | 1928 |
| 289 | Ga0495618_0014905 | 3300046514 | Bacteria | 4741 |
| 290 | Ga0495618_0509271 | 3300046514 | Bacteria | 725 |
| 291 | Ga0495628_0003568 | 3300046516 | Bacteria | 13931 |
| 292 | Ga0495630_0084974 | 3300046517 | Bacteria | 2389 |
| 293 | Ga0495632_0437005 | 3300046519 | Bacteria | 569 |
| 294 | Ga0495666_0143070 | 3300046526 | Bacteria | 1114 |
| 295 | Ga0495652_0004294 | 3300046529 | Bacteria | 13663 |
| 296 | Ga0495665_0297276 | 3300046531 | Bacteria | 827 |
| 297 | Ga0495640_0000769 | 3300046533 | Bacteria | 24154 |
| 298 | Ga0495586_0141238 | 3300046535 | Bacteria | 1352 |
| 299 | Ga0495587_0001283 | 3300046536 | Bacteria | 16691 |
| 300 | Ga0495645_0030738 | 3300046543 | Bacteria | 3913 |
| 301 | Ga0495622_0370131 | 3300046557 | Bacteria | 619 |
| 302 | Ga0495667_0001942 | 3300046559 | Bacteria | 13669 |
| 303 | Ga0495656_0050677 | 3300046615 | Bacteria | 1774 |
| 304 | Ga0495634_0002200 | 3300046642 | Bacteria | 16376 |
| 305 | Ga0495635_0004328 | 3300046663 | Bacteria | 9835 |
| 306 | Ga0495635_0082274 | 3300046663 | Bacteria | 2203 |
| 307 | Ga0495657_0007254 | 3300046675 | Bacteria | 8587 |
| 308 | Ga0495599_0011656 | 3300046678 | Bacteria | 5408 |
| 309 | Ga0495623_0003723 | 3300046679 | Bacteria | 10054 |
| 310 | Ga0495647_0298270 | 3300046681 | Bacteria | 726 |
| 311 | Ga0495658_0188648 | 3300046683 | Bacteria | 1281 |
| 312 | Ga0495658_0608878 | 3300046683 | Bacteria | 700 |
| 313 | Ga0495613_0034160 | 3300046689 | Bacteria | 3778 |
| 314 | Ga0495613_0136291 | 3300046689 | Bacteria | 1756 |
| 315 | Ga0495624_0145066 | 3300046690 | Bacteria | 1453 |
| 316 | Ga0495624_0251830 | 3300046690 | Bacteria | 1068 |
| 317 | Ga0495649_0061685 | 3300046694 | Bacteria | 2016 |
| 318 | Ga0495600_0000422 | 3300046809 | Bacteria | 21824 |
| 319 | Ga0495604_0000406 | 3300047317 | Bacteria | 38847 |
| 320 | Ga0495674_0000757 | 3300047319 | Bacteria | 30677 |
| 321 | Ga0495674_0474619 | 3300047319 | Bacteria | 1003 |
| 322 | Ga0495680_0001477 | 3300047322 | Bacteria | 25369 |
| 323 | Ga0495675_0020789 | 3300047444 | Bacteria | 4177 |
| 324 | Ga0495677_0037133 | 3300047445 | Bacteria | 1780 |
| 325 | Ga0495684_0002545 | 3300047471 | Bacteria | 14510 |
| 326 | Ga0495684_0453272 | 3300047471 | Bacteria | 891 |
| 327 | Ga0495593_0014136 | 3300047673 | Bacteria | 4542 |
| 328 | Ga0495602_0010292 | 3300048088 | Bacteria | 9709 |
| 329 | Ga0496100_0158697 | 3300048903 | Bacteria | 1620 |
| 330 | Ga0496100_0440679 | 3300048903 | Bacteria | 997 |
| 331 | Ga0496102_0689692 | 3300048905 | Bacteria | 944 |
| 332 | Ga0496102_0957674 | 3300048905 | Bacteria | 777 |
| 333 | Ga0496102_1623407 | 3300048905 | Bacteria | 565 |
| 334 | Ga0496103_0109331 | 3300048906 | Bacteria | 1755 |
| 335 | Ga0496103_0840181 | 3300048906 | Bacteria | 578 |
| 336 | Ga0496104_0156871 | 3300048907 | Bacteria | 2184 |
| 337 | Ga0496104_0399628 | 3300048907 | Bacteria | 1286 |
| 338 | Ga0496105_0210599 | 3300048908 | Bacteria | 1584 |
| 339 | Ga0496106_0125870 | 3300048909 | Bacteria | 2006 |
| 340 | Ga0496108_0349307 | 3300048911 | Bacteria | 1290 |
| 341 | Ga0496108_0781465 | 3300048911 | Bacteria | 824 |
| 342 | Ga0496108_1582916 | 3300048911 | Bacteria | 543 |
| 343 | Ga0496109_0490138 | 3300048912 | Bacteria | 1160 |
| 344 | Ga0496110_0484898 | 3300048913 | Bacteria | 1126 |
| 345 | Ga0496110_1911742 | 3300048913 | Bacteria | 503 |
| 346 | Ga0496112_0261573 | 3300048915 | Bacteria | 1680 |
| 347 | Ga0496112_1331898 | 3300048915 | Bacteria | 633 |
| 348 | Ga0496113_1088968 | 3300048916 | Bacteria | 627 |
| 349 | Ga0496114_0449076 | 3300048917 | Bacteria | 1142 |
| 350 | Ga0496115_0009751 | 3300048918 | Bacteria | 7152 |
| 351 | Ga0496117_0256739 | 3300048920 | Bacteria | 950 |
| 352 | Ga0496119_0062884 | 3300048922 | Bacteria | 2210 |
| 353 | Ga0496119_0064924 | 3300048922 | Bacteria | 2165 |
| 354 | Ga0496120_0014732 | 3300048923 | Bacteria | 5192 |
| 355 | Ga0496121_0315610 | 3300048924 | Bacteria | 1054 |
| 356 | Ga0496121_0393347 | 3300048924 | Bacteria | 910 |
| 357 | Ga0496125_0372968 | 3300048928 | Bacteria | 844 |
| 358 | Ga0496126_0342511 | 3300048929 | Bacteria | 1224 |
| 359 | Ga0501312_006401 | 3300049528 | Bacteria | 1468 |
| 360 | Ga0501313_015486 | 3300049529 | Bacteria | 910 |
| 361 | Ga0501321_023114 | 3300049537 | Bacteria | 787 |
| 362 | Ga0501335_018154 | 3300049551 | Bacteria | 735 |
| 363 | Ga0501031_0000651 | 3300049568 | Bacteria | 20547 |
| 364 | Ga0501031_0002703 | 3300049568 | Bacteria | 11283 |
| 365 | Ga0501031_0011241 | 3300049568 | Bacteria | 5833 |
| 366 | Ga0501031_0214542 | 3300049568 | Bacteria | 1254 |
| 367 | Ga0501032_0000111 | 3300049569 | Bacteria | 69802 |
| 368 | Ga0501032_0042271 | 3300049569 | Bacteria | 3092 |
| 369 | Ga0501032_0066026 | 3300049569 | Bacteria | 2418 |
| 370 | Ga0501032_0085200 | 3300049569 | Bacteria | 2101 |
| 371 | Ga0501032_0550690 | 3300049569 | Bacteria | 735 |
| 372 | Ga0501033_0012240 | 3300049570 | Bacteria | 6548 |
| 373 | Ga0501033_0059135 | 3300049570 | Bacteria | 2830 |
| 374 | Ga0501033_0079988 | 3300049570 | Bacteria | 2398 |
| 375 | Ga0501033_0087475 | 3300049570 | Bacteria | 2280 |
| 376 | Ga0501033_0389767 | 3300049570 | Bacteria | 972 |
| 377 | Ga0501034_0004897 | 3300049571 | Bacteria | 14760 |
| 378 | Ga0501034_0006180 | 3300049571 | Bacteria | 12912 |
| 379 | Ga0501034_0056638 | 3300049571 | Bacteria | 3943 |
| 380 | Ga0501034_0355386 | 3300049571 | Bacteria | 1393 |
| 381 | Ga0501034_1286529 | 3300049571 | Bacteria | 608 |
| 382 | Ga0501036_0002605 | 3300049572 | Bacteria | 14223 |
| 383 | Ga0501036_0021849 | 3300049572 | Bacteria | 5380 |
| 384 | Ga0501036_0025540 | 3300049572 | Bacteria | 4984 |
| 385 | Ga0501036_0038561 | 3300049572 | Bacteria | 4044 |
| 386 | Ga0501036_0286977 | 3300049572 | Bacteria | 1377 |
| 387 | Ga0501037_0000131 | 3300049573 | Bacteria | 69802 |
| 388 | Ga0501037_0006435 | 3300049573 | Bacteria | 8594 |
| 389 | Ga0501037_0469909 | 3300049573 | Bacteria | 856 |
| 390 | Ga0501038_0000109 | 3300049574 | Bacteria | 69802 |
| 391 | Ga0501038_0001882 | 3300049574 | Bacteria | 19398 |
| 392 | Ga0501038_0096205 | 3300049574 | Bacteria | 2472 |
| 393 | Ga0501038_0131973 | 3300049574 | Bacteria | 2050 |
| 394 | Ga0501039_0002279 | 3300049575 | Bacteria | 14235 |
| 395 | Ga0501039_0098169 | 3300049575 | Bacteria | 2285 |
| 396 | Ga0501039_0183472 | 3300049575 | Bacteria | 1645 |
| 397 | Ga0501039_0237035 | 3300049575 | Bacteria | 1435 |
| 398 | Ga0501040_0008666 | 3300049576 | Bacteria | 6603 |
| 399 | Ga0501040_1251478 | 3300049576 | Bacteria | 538 |
| 400 | Ga0501041_0226440 | 3300049577 | Bacteria | 1174 |
| 401 | Ga0501042_0060942 | 3300049578 | Bacteria | 2695 |
| 402 | Ga0501042_0400790 | 3300049578 | Bacteria | 994 |
| 403 | Ga0501043_0021749 | 3300049579 | Bacteria | 5029 |
| 404 | Ga0501043_0024392 | 3300049579 | Bacteria | 4746 |
| 405 | Ga0501043_0047851 | 3300049579 | Bacteria | 3362 |
| 406 | Ga0501043_0284223 | 3300049579 | Bacteria | 1267 |
| 407 | Ga0501046_0018165 | 3300049580 | Bacteria | 5856 |
| 408 | Ga0501046_0109256 | 3300049580 | Bacteria | 2114 |
| 409 | Ga0501046_0202688 | 3300049580 | Bacteria | 1476 |
| 410 | Ga0501046_0302279 | 3300049580 | Bacteria | 1168 |
| 411 | Ga0501047_0011259 | 3300049581 | Bacteria | 8466 |
| 412 | Ga0501047_0080199 | 3300049581 | Bacteria | 3137 |
| 413 | Ga0501047_0197317 | 3300049581 | Bacteria | 1874 |
| 414 | Ga0501048_0030318 | 3300049582 | Bacteria | 3913 |
| 415 | Ga0501048_0060021 | 3300049582 | Bacteria | 2695 |
| 416 | Ga0501048_0085647 | 3300049582 | Bacteria | 2223 |
| 417 | Ga0501068_0022655 | 3300049584 | Bacteria | 3674 |
| 418 | Ga0501068_0036227 | 3300049584 | Bacteria | 2949 |
| 419 | Ga0501068_0694292 | 3300049584 | Bacteria | 665 |
| 420 | Ga0501069_0013201 | 3300049585 | Bacteria | 4401 |
| 421 | Ga0501069_0485558 | 3300049585 | Bacteria | 736 |
| 422 | Ga0501070_0001286 | 3300049586 | Bacteria | 22525 |
| 423 | Ga0501070_0006301 | 3300049586 | Bacteria | 10097 |
| 424 | Ga0501070_0266802 | 3300049586 | Bacteria | 1398 |
| 425 | Ga0501070_0497119 | 3300049586 | Bacteria | 980 |
| 426 | Ga0501070_0527999 | 3300049586 | Bacteria | 946 |
| 427 | Ga0501070_0656325 | 3300049586 | Bacteria | 832 |
| 428 | Ga0501070_1013278 | 3300049586 | Bacteria | 643 |
| 429 | Ga0501070_1458797 | 3300049586 | Bacteria | 519 |
| 430 | Ga0501071_0046823 | 3300049587 | Bacteria | 3106 |
| 431 | Ga0501071_0249510 | 3300049587 | Bacteria | 1339 |
| 432 | Ga0501072_0149867 | 3300049588 | Bacteria | 1860 |
| 433 | Ga0501072_0187300 | 3300049588 | Bacteria | 1651 |
| 434 | Ga0501072_1166430 | 3300049588 | Bacteria | 599 |
| 435 | Ga0501073_0002084 | 3300049589 | Bacteria | 14969 |
| 436 | Ga0501073_0047706 | 3300049589 | Bacteria | 3009 |
| 437 | Ga0501073_0062660 | 3300049589 | Bacteria | 2594 |
| 438 | Ga0501073_0125304 | 3300049589 | Bacteria | 1781 |
| 439 | Ga0501073_0172957 | 3300049589 | Bacteria | 1495 |
| 440 | Ga0501073_0370679 | 3300049589 | Bacteria | 989 |
| 441 | Ga0501073_0866120 | 3300049589 | Bacteria | 622 |
| 442 | Ga0501074_0201847 | 3300049590 | Bacteria | 1417 |
| 443 | Ga0501074_0436632 | 3300049590 | Bacteria | 928 |
| 444 | Ga0501074_1143674 | 3300049590 | Bacteria | 546 |
| 445 | Ga0501075_0756460 | 3300049591 | Bacteria | 740 |
| 446 | Ga0501076_0107789 | 3300049592 | Bacteria | 2250 |
| 447 | Ga0501077_1030740 | 3300049593 | Bacteria | 529 |
| 448 | Ga0501079_0026674 | 3300049741 | Bacteria | 4430 |
| 449 | Ga0501080_0004752 | 3300049742 | Bacteria | 12113 |
| 450 | Ga0501080_0013181 | 3300049742 | Bacteria | 7595 |
| 451 | Ga0501080_0017194 | 3300049742 | Bacteria | 6681 |
| 452 | Ga0501080_0098262 | 3300049742 | Bacteria | 2717 |
| 453 | Ga0501080_1707180 | 3300049742 | Bacteria | 531 |
| 454 | Ga0501083_0007595 | 3300049744 | Bacteria | 7680 |
| 455 | Ga0501083_0027007 | 3300049744 | Bacteria | 3964 |
| 456 | Ga0501083_0465931 | 3300049744 | Bacteria | 822 |
| 457 | Ga0501035_0000347 | 3300049822 | Bacteria | 53369 |
| 458 | Ga0501035_0002188 | 3300049822 | Bacteria | 19398 |
| 459 | Ga0501035_0048543 | 3300049822 | Bacteria | 3807 |
| 460 | Ga0501035_0055030 | 3300049822 | Bacteria | 3553 |
| 461 | Ga0501035_0153056 | 3300049822 | Bacteria | 2000 |
| 462 | Ga0501035_0727136 | 3300049822 | Bacteria | 798 |
| 463 | Ga0501044_0000234 | 3300049823 | Bacteria | 69802 |
| 464 | Ga0501044_0009229 | 3300049823 | Bacteria | 10770 |
| 465 | Ga0501044_0015755 | 3300049823 | Bacteria | 8141 |
| 466 | Ga0501044_0018610 | 3300049823 | Bacteria | 7441 |
| 467 | Ga0501044_0129860 | 3300049823 | Bacteria | 2515 |
| 468 | Ga0501044_0146350 | 3300049823 | Bacteria | 2348 |
| 469 | Ga0501044_0333346 | 3300049823 | Bacteria | 1439 |
| 470 | Ga0501044_0429468 | 3300049823 | Bacteria | 1230 |
| 471 | Ga0501044_0517929 | 3300049823 | Bacteria | 1093 |
| 472 | Ga0501044_1400925 | 3300049823 | Bacteria | 565 |
| 473 | Ga0501044_1538128 | 3300049823 | Bacteria | 530 |
| 474 | Ga0501045_0001715 | 3300049824 | Bacteria | 14765 |
| 475 | Ga0501045_0449763 | 3300049824 | Bacteria | 958 |
| 476 | Ga0501045_0599919 | 3300049824 | Bacteria | 815 |
| 477 | Ga0501045_0822268 | 3300049824 | Unclassified | 684 |
| 478 | nmdc:mga0yw44_18471_c1 | 3300050492 | Bacteria | 3821 |
| 479 | nmdc:mga0k408_553229_c1 | 3300050493 | Bacteria | 680 |
| 480 | nmdc:mga06z11_617120_c1 | 3300050494 | Bacteria | 660 |
| 481 | nmdc:mga04h51_196536_c1 | 3300050495 | Bacteria | 791 |
| 482 | nmdc:mga09592_471962_c1 | 3300050508 | Bacteria | 1082 |
| 483 | nmdc:mga09592_525365_c1 | 3300050508 | Bacteria | 1018 |
| 484 | nmdc:mga0qj67_224796_c1 | 3300050509 | Bacteria | 1524 |
| 485 | nmdc:mga0qj67_353427_c1 | 3300050509 | Bacteria | 1188 |
| 486 | nmdc:mga06r32_130312_c1 | 3300050510 | Bacteria | 2487 |
| 487 | nmdc:mga08y16_1691682_c1 | 3300050511 | Bacteria | 588 |
| 488 | nmdc:mga0n895_606845_c1 | 3300050512 | Bacteria | 1096 |
| 489 | nmdc:mga0rr50_325194_c1 | 3300050513 | Bacteria | 1290 |
| 490 | nmdc:mga0rr50_379767_c1 | 3300050513 | Bacteria | 1191 |
| 491 | nmdc:mga0a205_1218321_c1 | 3300050515 | Bacteria | 600 |
| 492 | nmdc:mga0a205_493253_c1 | 3300050515 | Bacteria | 1082 |
| 493 | nmdc:mga0sz30_14247_c1 | 3300050516 | Bacteria | 2669 |
| 494 | Ga0495601_0003476 | 3300053077 | Bacteria | 9041 |
| 495 | Ga0495601_0573828 | 3300053077 | Bacteria | 725 |
| 496 | Ga0495612_0007484 | 3300053078 | Bacteria | 4462 |
| 497 | Ga0495595_0000821 | 3300053084 | Bacteria | 11875 |
| 498 | Ga0495619_0000352 | 3300053085 | Bacteria | 32130 |
| 499 | Ga0500651_0506400 | 3300053093 | Bacteria | 665 |
| 500 | Ga0500641_0198078 | 3300053096 | Bacteria | 858 |
| 501 | Ga0500592_022787 | 3300053116 | Bacteria | 1009 |
| 502 | Ga0500593_003205 | 3300053117 | Bacteria | 6141 |
| 503 | Ga0500594_0257413 | 3300053118 | Bacteria | 581 |
| 504 | Ga0500642_0430824 | 3300053130 | Bacteria | 570 |
| 505 | Ga0500568_0001953 | 3300053139 | Bacteria | 12637 |
| 506 | Ga0500604_0179226 | 3300053151 | Bacteria | 726 |
| 507 | Ga0501084_0020595 | 3300054114 | Bacteria | 5500 |
| 508 | Ga0501084_0230662 | 3300054114 | Bacteria | 1563 |
| 509 | Ga0501084_1528553 | 3300054114 | Bacteria | 558 |
| 510 | Ga0501084_1818114 | 3300054114 | Bacteria | 509 |
| 511 | Ga0590077_067914 | 3300059426 | Bacteria | 812 |
| 512 | Ga0587070_228317 | 3300059491 | Bacteria | 508 |
| 513 | Ga0587073_0119065 | 3300059492 | Bacteria | 710 |
| 514 | Ga0587082_026237 | 3300059504 | Bacteria | 985 |
| 515 | Ga0587083_0103868 | 3300059505 | Bacteria | 712 |
| 516 | Ga0587088_006769 | 3300059508 | Bacteria | 1561 |
| 517 | Ga0587090_026089 | 3300059510 | Bacteria | 948 |
| 518 | Ga0587092_023191 | 3300059512 | Bacteria | 976 |
| 519 | Ga0587106_069174 | 3300059605 | Bacteria | 665 |
| 520 | Ga0587128_033624 | 3300059630 | Bacteria | 863 |
| 521 | Ga0587067_015720 | 3300059640 | Bacteria | 1232 |
| 522 | Ga0587072_037251 | 3300059643 | Bacteria | 932 |
| 523 | Ga0587075_020850 | 3300059644 | Bacteria | 971 |
| 524 | Ga0587075_082031 | 3300059644 | Bacteria | 617 |
| 525 | Ga0587076_035591 | 3300059645 | Bacteria | 906 |
| 526 | Ga0587076_207793 | 3300059645 | Bacteria | 507 |
| 527 | Ga0587078_013727 | 3300059646 | Bacteria | 962 |
| 528 | Ga0587107_009427 | 3300059652 | Bacteria | 1152 |
| 529 | Ga0587071_100113 | 3300060344 | Bacteria | 669 |
| 530 | Ga0501082_0051352 | 3300060353 | Bacteria | 3554 |
| 531 | Ga0501082_0901501 | 3300060353 | Bacteria | 773 |
| 532 | Ga0501082_1014961 | 3300060353 | Bacteria | 725 |
| 533 | Ga0501082_1430201 | 3300060353 | Bacteria | 604 |
| 534 | Ga0530510_0511183 | 3300061734 | Bacteria | 911 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300059512 | Ga0587092_023191 | Ga0587092_023191_136_417 | 84 |
| 2 | 3300006038 | Ga0075365_11145344 | Ga0075365_111453442 | 89 |
| 3 | 3300006042 | Ga0075368_10135628 | Ga0075368_101356282 | 89 |
| 4 | 3300006186 | Ga0075369_10203729 | Ga0075369_102037292 | 89 |
| 5 | 3300035691 | Ga0373931_0102300 | Ga0373931_0102300_1108_1422 | 89 |
| 6 | 3300050492 | nmdc:mga0yw44_18471_c1 | nmdc:mga0yw44_18471_c1_992_1306 | 89 |
| 7 | 3300050516 | nmdc:mga0sz30_14247_c1 | nmdc:mga0sz30_14247_c1_484_798 | 89 |
| 8 | 3300053096 | Ga0500641_0198078 | Ga0500641_0198078_219_605 | 89 |
| 9 | 3300049571 | Ga0501034_1286529 | Ga0501034_1286529_173_535 | 90 |
| 10 | 3300049588 | Ga0501072_0149867 | Ga0501072_0149867_428_790 | 90 |
| 11 | 3300049589 | Ga0501073_0002084 | Ga0501073_0002084_8740_9102 | 90 |
| 12 | 3300049742 | Ga0501080_0013181 | Ga0501080_0013181_3368_3730 | 90 |
| 13 | 3300049744 | Ga0501083_0007595 | Ga0501083_0007595_5634_5996 | 90 |
| 14 | 3300054114 | Ga0501084_0020595 | Ga0501084_0020595_118_480 | 90 |
| 15 | 3300060353 | Ga0501082_0051352 | Ga0501082_0051352_385_747 | 90 |
| 16 | 3300014326 | Ga0157380_10034018 | Ga0157380_100340185 | 91 |
| 17 | 3300049824 | Ga0501045_0822268 | Ga0501045_0822268_370_666 | 91 |
| 18 | 3300002705 | JGI25156J39149_1004694 | JGI25156J39149_10046945 | 92 |
| 19 | 3300002741 | JGI25157J39369_1002241 | JGI25157J39369_10022416 | 92 |
| 20 | 3300009093 | Ga0105240_10912012 | Ga0105240_109120122 | 92 |
| 21 | 3300025250 | Ga0209026_1000002 | Ga0209026_1000002476 | 92 |
| 22 | 3300025256 | Ga0209759_1000119 | Ga0209759_100011914 | 92 |
| 23 | 3300025913 | Ga0207695_10769648 | Ga0207695_107696482 | 92 |
| 24 | 3300048922 | Ga0496119_0064924 | Ga0496119_0064924_1819_2133 | 92 |
| 25 | 3300053116 | Ga0500592_022787 | Ga0500592_022787_138_452 | 94 |
| 26 | 3300001989 | JGI24739J22299_10014505 | JGI24739J22299_100145052 | 95 |
| 27 | 3300002067 | JGI24735J21928_10008865 | JGI24735J21928_100088652 | 95 |
| 28 | 3300005329 | Ga0070683_102230312 | Ga0070683_1022303122 | 95 |
| 29 | 3300005535 | Ga0070684_101908397 | Ga0070684_1019083971 | 95 |
| 30 | 3300005539 | Ga0068853_101643701 | Ga0068853_1016437012 | 95 |
| 31 | 3300005563 | Ga0068855_100210622 | Ga0068855_1002106222 | 95 |
| 32 | 3300005614 | Ga0068856_101637289 | Ga0068856_1016372892 | 95 |
| 33 | 3300005616 | Ga0068852_100180569 | Ga0068852_1001805692 | 95 |
| 34 | 3300005937 | Ga0081455_10012098 | Ga0081455_1001209814 | 95 |
| 35 | 3300006042 | Ga0075368_10284110 | Ga0075368_102841102 | 95 |
| 36 | 3300006178 | Ga0075367_10076001 | Ga0075367_100760014 | 95 |
| 37 | 3300006353 | Ga0075370_10384138 | Ga0075370_103841382 | 95 |
| 38 | 3300009093 | Ga0105240_11344212 | Ga0105240_113442121 | 95 |
| 39 | 3300009174 | Ga0105241_11758349 | Ga0105241_117583492 | 95 |
| 40 | 3300009545 | Ga0105237_11774512 | Ga0105237_117745122 | 95 |
| 41 | 3300009551 | Ga0105238_10026677 | Ga0105238_100266772 | 95 |
| 42 | 3300009551 | Ga0105238_12120359 | Ga0105238_121203591 | 95 |
| 43 | 3300013100 | Ga0157373_10918017 | Ga0157373_109180172 | 95 |
| 44 | 3300013104 | Ga0157370_11047510 | Ga0157370_110475102 | 95 |
| 45 | 3300013307 | Ga0157372_12179280 | Ga0157372_121792802 | 95 |
| 46 | 3300014497 | Ga0182008_10460986 | Ga0182008_104609862 | 95 |
| 47 | 3300025261 | Ga0209233_1056679 | Ga0209233_10566792 | 95 |
| 48 | 3300025297 | Ga0209758_1006057 | Ga0209758_100605713 | 95 |
| 49 | 3300025904 | Ga0207647_10548456 | Ga0207647_105484562 | 95 |
| 50 | 3300025914 | Ga0207671_10148713 | Ga0207671_101487132 | 95 |
| 51 | 3300025919 | Ga0207657_11098082 | Ga0207657_110980822 | 95 |
| 52 | 3300025920 | Ga0207649_11022365 | Ga0207649_110223652 | 95 |
| 53 | 3300025932 | Ga0207690_10464805 | Ga0207690_104648052 | 95 |
| 54 | 3300025944 | Ga0207661_12025456 | Ga0207661_120254562 | 95 |
| 55 | 3300025949 | Ga0207667_10951322 | Ga0207667_109513222 | 95 |
| 56 | 3300025981 | Ga0207640_10465117 | Ga0207640_104651172 | 95 |
| 57 | 3300026041 | Ga0207639_10032054 | Ga0207639_100320542 | 95 |
| 58 | 3300026067 | Ga0207678_11592866 | Ga0207678_115928662 | 95 |
| 59 | 3300026078 | Ga0207702_11985607 | Ga0207702_119856072 | 95 |
| 60 | 3300026116 | Ga0207674_10501111 | Ga0207674_105011113 | 95 |
| 61 | 3300026142 | Ga0207698_10235545 | Ga0207698_102355454 | 95 |
| 62 | 3300027866 | Ga0209813_10325881 | Ga0209813_103258812 | 95 |
| 63 | 3300037312 | Ga0395899_0075725 | Ga0395899_0075725_531_845 | 95 |
| 64 | 3300037312 | Ga0395899_0522157 | Ga0395899_0522157_281_595 | 95 |
| 65 | 3300037418 | Ga0395900_0012290 | Ga0395900_0012290_2365_2679 | 95 |
| 66 | 3300037418 | Ga0395900_0237581 | Ga0395900_0237581_657_971 | 95 |
| 67 | 3300037466 | Ga0395898_0029950 | Ga0395898_0029950_3122_3436 | 95 |
| 68 | 3300037466 | Ga0395898_0676107 | Ga0395898_0676107_215_529 | 95 |
| 69 | 3300037466 | Ga0395898_0814957 | Ga0395898_0814957_281_595 | 95 |
| 70 | 3300037471 | Ga0395905_0361417 | Ga0395905_0361417_992_1306 | 95 |
| 71 | 3300038443 | Ga0395901_0052439 | Ga0395901_0052439_1947_2261 | 95 |
| 72 | 3300044658 | Ga0466972_0010313 | Ga0466972_0010313_2622_2936 | 95 |
| 73 | 3300044735 | Ga0466968_0054651 | Ga0466968_0054651_1306_1620 | 95 |
| 74 | 3300044765 | Ga0466970_0180053 | Ga0466970_0180053_507_821 | 95 |
| 75 | 3300044901 | Ga0466960_0029748 | Ga0466960_0029748_1768_2082 | 95 |
| 76 | 3300045976 | Ga0466967_0392850 | Ga0466967_0392850_21_335 | 95 |
| 77 | 3300048905 | Ga0496102_0689692 | Ga0496102_0689692_271_585 | 95 |
| 78 | 3300048906 | Ga0496103_0109331 | Ga0496103_0109331_979_1293 | 95 |
| 79 | 3300048913 | Ga0496110_0484898 | Ga0496110_0484898_645_959 | 95 |
| 80 | 3300048915 | Ga0496112_0261573 | Ga0496112_0261573_1142_1456 | 95 |
| 81 | 3300048916 | Ga0496113_1088968 | Ga0496113_1088968_106_420 | 95 |
| 82 | 3300048920 | Ga0496117_0256739 | Ga0496117_0256739_215_529 | 95 |
| 83 | 3300048924 | Ga0496121_0315610 | Ga0496121_0315610_339_653 | 95 |
| 84 | 3300048928 | Ga0496125_0372968 | Ga0496125_0372968_395_709 | 95 |
| 85 | 3300048929 | Ga0496126_0342511 | Ga0496126_0342511_506_820 | 95 |
| 86 | 3300049589 | Ga0501073_0866120 | Ga0501073_0866120_199_513 | 95 |
| 87 | 3300049742 | Ga0501080_1707180 | Ga0501080_1707180_90_404 | 95 |
| 88 | 3300049823 | Ga0501044_1538128 | Ga0501044_1538128_125_439 | 95 |
| 89 | 3300050493 | nmdc:mga0k408_553229_c1 | nmdc:mga0k408_553229_c1_329_643 | 95 |
| 90 | 3300050494 | nmdc:mga06z11_617120_c1 | nmdc:mga06z11_617120_c1_256_570 | 95 |
| 91 | 3300050495 | nmdc:mga04h51_196536_c1 | nmdc:mga04h51_196536_c1_253_567 | 95 |
| 92 | 3300059491 | Ga0587070_228317 | Ga0587070_228317_64_378 | 95 |
| 93 | 3300059492 | Ga0587073_0119065 | Ga0587073_0119065_218_532 | 95 |
| 94 | 3300059504 | Ga0587082_026237 | Ga0587082_026237_503_817 | 95 |
| 95 | 3300059505 | Ga0587083_0103868 | Ga0587083_0103868_239_553 | 95 |
| 96 | 3300059508 | Ga0587088_006769 | Ga0587088_006769_932_1246 | 95 |
| 97 | 3300059510 | Ga0587090_026089 | Ga0587090_026089_503_817 | 95 |
| 98 | 3300059605 | Ga0587106_069174 | Ga0587106_069174_293_607 | 95 |
| 99 | 3300059630 | Ga0587128_033624 | Ga0587128_033624_456_770 | 95 |
| 100 | 3300059640 | Ga0587067_015720 | Ga0587067_015720_503_817 | 95 |
| 101 | 3300059643 | Ga0587072_037251 | Ga0587072_037251_218_532 | 95 |
| 102 | 3300059644 | Ga0587075_020850 | Ga0587075_020850_218_532 | 95 |
| 103 | 3300059644 | Ga0587075_082031 | Ga0587075_082031_218_532 | 95 |
| 104 | 3300059645 | Ga0587076_035591 | Ga0587076_035591_529_843 | 95 |
| 105 | 3300059646 | Ga0587078_013727 | Ga0587078_013727_441_755 | 95 |
| 106 | 3300059652 | Ga0587107_009427 | Ga0587107_009427_406_720 | 95 |
| 107 | 3300060344 | Ga0587071_100113 | Ga0587071_100113_218_532 | 95 |
| 108 | iso_pu_bacteria | 2922158528 | 2922161786 | 95 |
| 109 | 3300059645 | Ga0587076_207793 | Ga0587076_207793_25_339 | 97 |
| 110 | iso_pu_bacteria | 2956897341 | 2956900805 | 97 |
| 111 | iso_pu_bacteria | 2503198000 | 2503202656 | 99 |
| 112 | iso_pu_bacteria | 2508501123 | 2509117729 | 99 |
| 113 | iso_pu_bacteria | 2508501127 | 2509143586 | 99 |
| 114 | iso_pu_bacteria | 2509276018 | 2509372999 | 99 |
| 115 | iso_pu_bacteria | 2509276022 | 2509397161 | 99 |
| 116 | iso_pu_bacteria | 2510065059 | 2510319909 | 99 |
| 117 | iso_pu_bacteria | 2512875016 | 2512930570 | 99 |
| 118 | iso_pu_bacteria | 2512875024 | 2512958302 | 99 |
| 119 | iso_pu_bacteria | 2513237090 | 2513612123 | 99 |
| 120 | iso_pu_bacteria | 2513237164 | 2514032565 | 99 |
| 121 | iso_pu_bacteria | 2513237305 | 2514422076 | 99 |
| 122 | iso_pu_bacteria | 2588253730 | 2588516212 | 99 |
| 123 | iso_pu_bacteria | 2597489875 | 2597813659 | 99 |
| 124 | iso_pu_bacteria | 2599185301 | 2599939547 | 99 |
| 125 | iso_pu_bacteria | 2643221550 | 2643773782 | 99 |
| 126 | iso_pu_bacteria | 2643221551 | 2643775178 | 99 |
| 127 | iso_pu_bacteria | 2643221555 | 2643793624 | 99 |
| 128 | iso_pu_bacteria | 2643221564 | 2643837520 | 99 |
| 129 | iso_pu_bacteria | 2643221595 | 2643987307 | 99 |
| 130 | iso_pu_bacteria | 2643221627 | 2644155631 | 99 |
| 131 | iso_pu_bacteria | 2687453392 | 2688599068 | 99 |
| 132 | iso_pu_bacteria | 2693429783 | 2694631917 | 99 |
| 133 | iso_pu_bacteria | 2693429784 | 2694634662 | 99 |
| 134 | iso_pu_bacteria | 2721755686 | 2723576072 | 99 |
| 135 | iso_pu_bacteria | 2756170246 | 2756677762 | 99 |
| 136 | iso_pu_bacteria | 2791355123 | 2792750755 | 99 |
| 137 | iso_pu_bacteria | 2841734538 | 2841740447 | 99 |
| 138 | iso_pu_bacteria | 2844002411 | 2844006792 | 99 |
| 139 | iso_pu_bacteria | 2844009547 | 2844014467 | 99 |
| 140 | iso_pu_bacteria | 2847670302 | 2847670800 | 99 |
| 141 | iso_pu_bacteria | 2847686936 | 2847687063 | 99 |
| 142 | iso_pu_bacteria | 2856314179 | 2856316257 | 99 |
| 143 | iso_pu_bacteria | 2856320880 | 2856325081 | 99 |
| 144 | iso_pu_bacteria | 2856328259 | 2856330561 | 99 |
| 145 | iso_pu_bacteria | 2856334872 | 2856340861 | 99 |
| 146 | iso_pu_bacteria | 2856342000 | 2856345829 | 99 |
| 147 | iso_pu_bacteria | 2856349417 | 2856349745 | 99 |
| 148 | iso_pu_bacteria | 2856356410 | 2856359239 | 99 |
| 149 | iso_pu_bacteria | 2856364286 | 2856369145 | 99 |
| 150 | iso_pu_bacteria | 2857349434 | 2857355591 | 99 |
| 151 | iso_pu_bacteria | 2857367948 | 2857372489 | 99 |
| 152 | iso_pu_bacteria | 2869162929 | 2869168972 | 99 |
| 153 | iso_pu_bacteria | 2869169390 | 2869174085 | 99 |
| 154 | iso_pu_bacteria | 2869234852 | 2869237157 | 99 |
| 155 | iso_pu_bacteria | 2869242130 | 2869243183 | 99 |
| 156 | iso_pu_bacteria | 2869249662 | 2869252746 | 99 |
| 157 | iso_pu_bacteria | 2869256925 | 2869262751 | 99 |
| 158 | iso_pu_bacteria | 2869264136 | 2869270268 | 99 |
| 159 | iso_pu_bacteria | 2869271264 | 2869273284 | 99 |
| 160 | iso_pu_bacteria | 2869278585 | 2869280897 | 99 |
| 161 | iso_pu_bacteria | 2869285874 | 2869288397 | 99 |
| 162 | iso_pu_bacteria | 2871429161 | 2871432106 | 99 |
| 163 | iso_pu_bacteria | 2871444079 | 2871448841 | 99 |
| 164 | iso_pu_bacteria | 2871451962 | 2871455267 | 99 |
| 165 | iso_pu_bacteria | 2871459585 | 2871459670 | 99 |
| 166 | iso_pu_bacteria | 2871466892 | 2871470925 | 99 |
| 167 | iso_pu_bacteria | 2871474448 | 2871480985 | 99 |
| 168 | iso_pu_bacteria | 2871481445 | 2871484303 | 99 |
| 169 | iso_pu_bacteria | 2871488783 | 2871495247 | 99 |
| 170 | iso_pu_bacteria | 2871495908 | 2871500463 | 99 |
| 171 | iso_pu_bacteria | 2874102143 | 2874104420 | 99 |
| 172 | iso_pu_bacteria | 2874109183 | 2874115354 | 99 |
| 173 | iso_pu_bacteria | 2874116593 | 2874121366 | 99 |
| 174 | iso_pu_bacteria | 2874123672 | 2874125714 | 99 |
| 175 | iso_pu_bacteria | 2874131515 | 2874137243 | 99 |
| 176 | iso_pu_bacteria | 2874139085 | 2874141435 | 99 |
| 177 | iso_pu_bacteria | 2874146452 | 2874150985 | 99 |
| 178 | iso_pu_bacteria | 2874155637 | 2874157324 | 99 |
| 179 | iso_pu_bacteria | 2874162495 | 2874163771 | 99 |
| 180 | iso_pu_bacteria | 2874168670 | 2874172578 | 99 |
| 181 | iso_pu_bacteria | 2876363079 | 2876368084 | 99 |
| 182 | iso_pu_bacteria | 2876369609 | 2876374955 | 99 |
| 183 | iso_pu_bacteria | 2876377896 | 2876385313 | 99 |
| 184 | iso_pu_bacteria | 2876386047 | 2876392715 | 99 |
| 185 | iso_pu_bacteria | 2876392853 | 2876395260 | 99 |
| 186 | iso_pu_bacteria | 2876399893 | 2876405249 | 99 |
| 187 | iso_pu_bacteria | 2876406927 | 2876409336 | 99 |
| 188 | iso_pu_bacteria | 2876413966 | 2876417014 | 99 |
| 189 | iso_pu_bacteria | 2876420981 | 2876427157 | 99 |
| 190 | iso_pu_bacteria | 2878035449 | 2878041580 | 99 |
| 191 | iso_pu_bacteria | 2878730984 | 2878734402 | 99 |
| 192 | iso_pu_bacteria | 2878738818 | 2878743164 | 99 |
| 193 | iso_pu_bacteria | 2878745973 | 2878748825 | 99 |
| 194 | iso_pu_bacteria | 2878753008 | 2878758087 | 99 |
| 195 | iso_pu_bacteria | 2878760144 | 2878764552 | 99 |
| 196 | iso_pu_bacteria | 2878767105 | 2878771653 | 99 |
| 197 | iso_pu_bacteria | 2878774303 | 2878776392 | 99 |
| 198 | iso_pu_bacteria | 2878781027 | 2878782377 | 99 |
| 199 | iso_pu_bacteria | 2878788777 | 2878796099 | 99 |
| 200 | iso_pu_bacteria | 2881147464 | 2881152557 | 99 |
| 201 | iso_pu_bacteria | 2881155292 | 2881155984 | 99 |
| 202 | iso_pu_bacteria | 2881161766 | 2881161787 | 99 |
| 203 | iso_pu_bacteria | 2881845957 | 2881846271 | 99 |
| 204 | iso_pu_bacteria | 2881861095 | 2881862934 | 99 |
| 205 | iso_pu_bacteria | 2882632389 | 2882633068 | 99 |
| 206 | iso_pu_bacteria | 2882912400 | 2882916436 | 99 |
| 207 | iso_pu_bacteria | 2885305155 | 2885310672 | 99 |
| 208 | iso_pu_bacteria | 2885312484 | 2885317436 | 99 |
| 209 | iso_pu_bacteria | 2885318864 | 2885322428 | 99 |
| 210 | iso_pu_bacteria | 2885326080 | 2885333105 | 99 |
| 211 | iso_pu_bacteria | 2885334103 | 2885340433 | 99 |
| 212 | iso_pu_bacteria | 2885342637 | 2885343916 | 99 |
| 213 | iso_pu_bacteria | 2885350715 | 2885355692 | 99 |
| 214 | iso_pu_bacteria | 2888337043 | 2888340688 | 99 |
| 215 | iso_pu_bacteria | 2888343758 | 2888347867 | 99 |
| 216 | iso_pu_bacteria | 2888350351 | 2888356884 | 99 |
| 217 | iso_pu_bacteria | 2889010040 | 2889011931 | 99 |
| 218 | iso_pu_bacteria | 2889016732 | 2889023137 | 99 |
| 219 | iso_pu_bacteria | 2903448605 | 2903452104 | 99 |
| 220 | iso_pu_bacteria | 2903492973 | 2903495122 | 99 |
| 221 | iso_pu_bacteria | 2903492973 | 2903496181 | 99 |
| 222 | iso_pu_bacteria | 2903513507 | 2903518368 | 99 |
| 223 | iso_pu_bacteria | 2903521522 | 2903527080 | 99 |
| 224 | iso_pu_bacteria | 2903528002 | 2903533307 | 99 |
| 225 | iso_pu_bacteria | 2903540706 | 2903545276 | 99 |
| 226 | iso_pu_bacteria | 2904659560 | 2904661890 | 99 |
| 227 | iso_pu_bacteria | 2906308376 | 2906311177 | 99 |
| 228 | iso_pu_bacteria | 2906321335 | 2906323944 | 99 |
| 229 | iso_pu_bacteria | 2906328253 | 2906328365 | 99 |
| 230 | iso_pu_bacteria | 2906354277 | 2906363114 | 99 |
| 231 | iso_pu_bacteria | 2906363423 | 2906370614 | 99 |
| 232 | iso_pu_bacteria | 2906370794 | 2906374318 | 99 |
| 233 | iso_pu_bacteria | 2906378014 | 2906378277 | 99 |
| 234 | iso_pu_bacteria | 2906401398 | 2906407934 | 99 |
| 235 | iso_pu_bacteria | 2906408224 | 2906410568 | 99 |
| 236 | iso_pu_bacteria | 2906414383 | 2906416394 | 99 |
| 237 | iso_pu_bacteria | 2906427513 | 2906432075 | 99 |
| 238 | iso_pu_bacteria | 2922130491 | 2922132708 | 99 |
| 239 | iso_pu_bacteria | 2922151315 | 2922154894 | 99 |
| 240 | iso_pu_bacteria | 2922172374 | 2922175796 | 99 |
| 241 | iso_pu_bacteria | 2922185730 | 2922191540 | 99 |
| 242 | iso_pu_bacteria | 2924710171 | 2924712772 | 99 |
| 243 | iso_pu_bacteria | 2924718760 | 2924725449 | 99 |
| 244 | iso_pu_bacteria | 2924726620 | 2924727274 | 99 |
| 245 | iso_pu_bacteria | 2924733363 | 2924736142 | 99 |
| 246 | iso_pu_bacteria | 2924741084 | 2924744187 | 99 |
| 247 | iso_pu_bacteria | 2924748358 | 2924750377 | 99 |
| 248 | iso_pu_bacteria | 2924754689 | 2924756174 | 99 |
| 249 | iso_pu_bacteria | 2924762789 | 2924763831 | 99 |
| 250 | iso_pu_bacteria | 2924776078 | 2924777278 | 99 |
| 251 | iso_pu_bacteria | 2924784321 | 2924785828 | 99 |
| 252 | iso_pu_bacteria | 2937813078 | 2937813398 | 99 |
| 253 | iso_pu_bacteria | 2937822353 | 2937826669 | 99 |
| 254 | iso_pu_bacteria | 2937836603 | 2937839999 | 99 |
| 255 | iso_pu_bacteria | 2937848649 | 2937853634 | 99 |
| 256 | iso_pu_bacteria | 2937861824 | 2937864419 | 99 |
| 257 | iso_pu_bacteria | 2937868953 | 2937869768 | 99 |
| 258 | iso_pu_bacteria | 2937877337 | 2937879317 | 99 |
| 259 | iso_pu_bacteria | 2937891427 | 2937898203 | 99 |
| 260 | iso_pu_bacteria | 2937972304 | 2937974949 | 99 |
| 261 | iso_pu_bacteria | 2937980651 | 2937988345 | 99 |
| 262 | iso_pu_bacteria | 2937994558 | 2937999126 | 99 |
| 263 | iso_pu_bacteria | 2938014810 | 2938019873 | 99 |
| 264 | iso_pu_bacteria | 2958034702 | 2958036860 | 99 |
| 265 | iso_pu_bacteria | 2958041894 | 2958050482 | 99 |
| 266 | iso_pu_bacteria | 2958064165 | 2958070264 | 99 |
| 267 | iso_pu_bacteria | 2958071322 | 2958072562 | 99 |
| 268 | iso_pu_bacteria | 2958084443 | 2958086492 | 99 |
| 269 | iso_pu_bacteria | 2958092219 | 2958100697 | 99 |
| 270 | iso_pu_bacteria | 2958100919 | 2958101578 | 99 |
| 271 | iso_pu_bacteria | 2958108152 | 2958110469 | 99 |
| 272 | iso_pu_bacteria | 2958115193 | 2958122501 | 99 |
| 273 | iso_pu_bacteria | 2958122699 | 2958130098 | 99 |
| 274 | iso_pu_bacteria | 2958130278 | 2958132798 | 99 |
| 275 | iso_pu_bacteria | 2958137437 | 2958142870 | 99 |
| 276 | iso_pu_bacteria | 2958144490 | 2958145621 | 99 |
| 277 | iso_pu_bacteria | 2958158011 | 2958162962 | 99 |
| 278 | iso_pu_bacteria | 2958165035 | 2958169600 | 99 |
| 279 | iso_pu_bacteria | 2958172287 | 2958177440 | 99 |
| 280 | iso_pu_bacteria | 2958179912 | 2958182930 | 99 |
| 281 | iso_pu_bacteria | 2961077736 | 2961080810 | 99 |
| 282 | iso_pu_bacteria | 2961114664 | 2961117043 | 99 |
| 283 | iso_pu_bacteria | 2961127735 | 2961129434 | 99 |
| 284 | iso_pu_bacteria | 2961136820 | 2961139062 | 99 |
| 285 | iso_pu_bacteria | 2961163497 | 2961168060 | 99 |
| 286 | iso_pu_bacteria | 2961170736 | 2961174717 | 99 |
| 287 | iso_pu_bacteria | 2961183825 | 2961186455 | 99 |
| 288 | iso_pu_bacteria | 2963644680 | 2963648657 | 99 |
| 289 | iso_pu_bacteria | 2965018300 | 2965022879 | 99 |
| 290 | iso_pu_bacteria | 2965025482 | 2965027336 | 99 |
| 291 | iso_pu_bacteria | 2965032056 | 2965032564 | 99 |
| 292 | iso_pu_bacteria | 2965040258 | 2965040808 | 99 |
| 293 | iso_pu_bacteria | 2965047637 | 2965050112 | 99 |
| 294 | iso_pu_bacteria | 2965062239 | 2965066161 | 99 |
| 295 | iso_pu_bacteria | 2965089291 | 2965091041 | 99 |
| 296 | iso_pu_bacteria | 2965102966 | 2965104368 | 99 |
| 297 | iso_pu_bacteria | 2965110997 | 2965119202 | 99 |
| 298 | iso_pu_bacteria | 2965119406 | 2965122188 | 99 |
| 299 | iso_pu_bacteria | 2967996073 | 2968000652 | 99 |
| 300 | iso_pu_bacteria | 2968003550 | 2968009975 | 99 |
| 301 | iso_pu_bacteria | 2968016561 | 2968017465 | 99 |
| 302 | iso_pu_bacteria | 2968083720 | 2968083884 | 99 |
| 303 | iso_pu_bacteria | 2968091066 | 2968092499 | 99 |
| 304 | iso_pu_bacteria | 2968097103 | 2968102413 | 99 |
| 305 | iso_pu_bacteria | 2968110612 | 2968112951 | 99 |
| 306 | iso_pu_bacteria | 2968117919 | 2968122816 | 99 |
| 307 | iso_pu_bacteria | 2968128360 | 2968128770 | 99 |
| 308 | iso_pu_bacteria | 2968138860 | 2968145980 | 99 |
| 309 | iso_pu_bacteria | 2968171901 | 2968176460 | 99 |
| 310 | iso_pu_bacteria | 2970469710 | 2970472359 | 99 |
| 311 | iso_pu_bacteria | 2970489779 | 2970490906 | 99 |
| 312 | iso_pu_bacteria | 2970503327 | 2970507303 | 99 |
| 313 | iso_pu_bacteria | 2970510686 | 2970513848 | 99 |
| 314 | iso_pu_bacteria | 2970524798 | 2970530016 | 99 |
| 315 | iso_pu_bacteria | 2970532167 | 2970538250 | 99 |
| 316 | iso_pu_bacteria | 2970540015 | 2970540156 | 99 |
| 317 | iso_pu_bacteria | 2970547951 | 2970548659 | 99 |
| 318 | iso_pu_bacteria | 2970554993 | 2970559399 | 99 |
| 319 | iso_pu_bacteria | 2970593180 | 2970595501 | 99 |
| 320 | iso_pu_bacteria | 2970619444 | 2970620317 | 99 |
| 321 | iso_pu_bacteria | 2970627176 | 2970631999 | 99 |
| 322 | iso_pu_bacteria | 2977821940 | 2977828839 | 99 |
| 323 | iso_pu_bacteria | 2977828996 | 2977829838 | 99 |
| 324 | iso_pu_bacteria | 2977843712 | 2977845398 | 99 |
| 325 | iso_pu_bacteria | 2977851361 | 2977851795 | 99 |
| 326 | iso_pu_bacteria | 2977858184 | 2977860262 | 99 |
| 327 | iso_pu_bacteria | 2977864932 | 2977871962 | 99 |
| 328 | iso_pu_bacteria | 2977872689 | 2977877378 | 99 |
| 329 | iso_pu_bacteria | 2977907340 | 2977911822 | 99 |
| 330 | iso_pu_bacteria | 2977915119 | 2977917210 | 99 |
| 331 | iso_pu_bacteria | 2977922695 | 2977928123 | 99 |
| 332 | iso_pu_bacteria | 2977935797 | 2977939444 | 99 |
| 333 | iso_pu_bacteria | 2977942078 | 2977946931 | 99 |
| 334 | iso_pu_bacteria | 2977950692 | 2977951358 | 99 |
| 335 | iso_pu_bacteria | 2977957713 | 2977958677 | 99 |
| 336 | iso_pu_bacteria | 2977971508 | 2977976594 | 99 |
| 337 | iso_pu_bacteria | 2977986579 | 2977989483 | 99 |
| 338 | iso_pu_bacteria | 2979710463 | 2979716960 | 99 |
| 339 | iso_pu_bacteria | 2979764755 | 2979764879 | 99 |
| 340 | iso_pu_bacteria | 2979772303 | 2979777665 | 99 |
| 341 | iso_pu_bacteria | 2979779861 | 2979783230 | 99 |
| 342 | iso_pu_bacteria | 2979793036 | 2979798560 | 99 |
| 343 | iso_pu_bacteria | 2979808191 | 2979812499 | 99 |
| 344 | iso_pu_bacteria | 2987636660 | 2987640725 | 99 |
| 345 | iso_pu_bacteria | 2987645492 | 2987647822 | 99 |
| 346 | iso_pu_bacteria | 2987652177 | 2987652485 | 99 |
| 347 | iso_pu_bacteria | 2987659509 | 2987664074 | 99 |
| 348 | iso_pu_bacteria | 2987666974 | 2987670299 | 99 |
| 349 | iso_pu_bacteria | 2987673487 | 2987674285 | 99 |
| 350 | iso_pu_bacteria | 2996341866 | 2996347152 | 99 |
| 351 | iso_pu_bacteria | 2996348954 | 2996351230 | 99 |
| 352 | iso_pu_bacteria | 2996386984 | 2996390915 | 99 |
| 353 | iso_pu_bacteria | 3000135777 | 3000136174 | 99 |
| 354 | iso_pu_bacteria | 3004167301 | 3004170184 | 99 |
| 355 | iso_pu_bacteria | 3004188549 | 3004193129 | 99 |
| 356 | iso_pu_bacteria | 3004195979 | 3004197768 | 99 |
| 357 | iso_pu_bacteria | 3004203850 | 3004208922 | 99 |
| 358 | iso_pu_bacteria | 3004211236 | 3004213108 | 99 |
| 359 | iso_pu_bacteria | 3004218560 | 3004222129 | 99 |
| 360 | iso_pu_bacteria | 3004232784 | 3004239284 | 99 |
| 361 | iso_pu_bacteria | 3004239961 | 3004242906 | 99 |
| 362 | iso_pu_bacteria | 3004248173 | 3004255298 | 99 |
| 363 | iso_pu_bacteria | 3004268573 | 3004273810 | 99 |
| 364 | iso_pu_bacteria | 3004275668 | 3004277928 | 99 |
| 365 | iso_pu_bacteria | 3004289098 | 3004290237 | 99 |
| 366 | iso_pu_bacteria | 3004334049 | 3004340246 | 99 |
| 367 | iso_pu_bacteria | 637000159 | 637073565 | 99 |
| 368 | iso_pu_bacteria | 649633066 | 649873501 | 99 |
| 369 | iso_pu_bacteria | 8004300914 | 8004304424 | 99 |
| 370 | iso_pu_bacteria | 8004312739 | 8004316473 | 99 |
| 371 | iso_pu_bacteria | 8004361976 | 8004366435 | 99 |
| 372 | iso_pu_bacteria | 8004374579 | 8004379599 | 99 |
| 373 | iso_pu_bacteria | 8004387939 | 8004390928 | 99 |
| 374 | iso_pu_bacteria | 8004395343 | 8004396383 | 99 |
| 375 | iso_pu_bacteria | 8004445564 | 8004451620 | 99 |
| 376 | iso_pu_bacteria | 8004633249 | 8004638917 | 99 |
| 377 | iso_pu_bacteria | 8004640170 | 8004643111 | 99 |
| 378 | iso_pu_bacteria | 8004703790 | 8004714461 | 99 |
| 379 | iso_pu_bacteria | 8004714634 | 8004717480 | 99 |
| 380 | iso_pu_bacteria | 8004727605 | 8004731776 | 99 |
| 381 | iso_pu_bacteria | 8055617313 | 8055622000 | 99 |
| 382 | 3300003187 | JGI25151J46595_10014201 | JGI25151J46595_100142014 | 100 |
| 383 | iso_pu_bacteria | 2919450847 | 2919456092 | 100 |
| 384 | iso_pu_bacteria | 8001845381 | 8001845407 | 100 |
| 385 | 3300027360 | Ga0209969_1006180 | Ga0209969_10061801 | 101 |
| 386 | 3300027462 | Ga0210000_1005563 | Ga0210000_10055632 | 101 |
| 387 | 3300027552 | Ga0209982_1062947 | Ga0209982_10629472 | 101 |
| 388 | 3300027682 | Ga0209971_1067815 | Ga0209971_10678152 | 101 |
| 389 | 3300027876 | Ga0209974_10010537 | Ga0209974_100105375 | 101 |
| 390 | 3300036647 | Ga0316582_0092116 | Ga0316582_0092116_1499_1810 | 101 |
| 391 | 3300049528 | Ga0501312_006401 | Ga0501312_006401_593_904 | 101 |
| 392 | 3300049529 | Ga0501313_015486 | Ga0501313_015486_503_814 | 101 |
| 393 | 3300049537 | Ga0501321_023114 | Ga0501321_023114_73_384 | 101 |
| 394 | 3300049551 | Ga0501335_018154 | Ga0501335_018154_113_424 | 101 |
| 395 | 3300005471 | Ga0070698_100248890 | Ga0070698_1002488903 | 102 |
| 396 | 3300006871 | Ga0075434_101452939 | Ga0075434_1014529391 | 102 |
| 397 | 3300006881 | Ga0068865_100236139 | Ga0068865_1002361393 | 102 |
| 398 | 3300007076 | Ga0075435_100322044 | Ga0075435_1003220442 | 102 |
| 399 | 3300009094 | Ga0111539_12349564 | Ga0111539_123495641 | 102 |
| 400 | 3300013306 | Ga0163162_11696312 | Ga0163162_116963121 | 102 |
| 401 | 3300025940 | Ga0207691_10458711 | Ga0207691_104587112 | 102 |
| 402 | 3300031665 | Ga0316575_10000478 | Ga0316575_100004789 | 102 |
| 403 | 3300031889 | Ga0326468_10126830 | Ga0326468_101268302 | 102 |
| 404 | 3300046514 | Ga0495618_0509271 | Ga0495618_0509271_74_412 | 102 |
| 405 | 3300046517 | Ga0495630_0084974 | Ga0495630_0084974_1047_1385 | 102 |
| 406 | 3300046557 | Ga0495622_0370131 | Ga0495622_0370131_224_562 | 102 |
| 407 | 3300046663 | Ga0495635_0082274 | Ga0495635_0082274_1317_1655 | 102 |
| 408 | 3300046681 | Ga0495647_0298270 | Ga0495647_0298270_45_383 | 102 |
| 409 | 3300046689 | Ga0495613_0136291 | Ga0495613_0136291_1372_1710 | 102 |
| 410 | 3300046690 | Ga0495624_0145066 | Ga0495624_0145066_213_551 | 102 |
| 411 | 3300046694 | Ga0495649_0061685 | Ga0495649_0061685_1546_1905 | 102 |
| 412 | 3300047319 | Ga0495674_0474619 | Ga0495674_0474619_621_959 | 102 |
| 413 | 3300049572 | Ga0501036_0286977 | Ga0501036_0286977_565_894 | 102 |
| 414 | 3300049589 | Ga0501073_0125304 | Ga0501073_0125304_1134_1484 | 102 |
| 415 | 3300049823 | Ga0501044_0146350 | Ga0501044_0146350_1239_1595 | 102 |
| 416 | 3300050511 | nmdc:mga08y16_1691682_c1 | nmdc:mga08y16_1691682_c1_221_553 | 102 |
| 417 | 3300060353 | Ga0501082_1014961 | Ga0501082_1014961_255_584 | 102 |
| 418 | iso_pu_bacteria | 2977898635 | 2977899882 | 102 |
| 419 | 3300003214 | JGI25165J46597_1001303 | JGI25165J46597_100130314 | 103 |
| 420 | 3300003320 | rootH2_10008940 | rootH2_1000894013 | 103 |
| 421 | 3300005330 | Ga0070690_100938696 | Ga0070690_1009386961 | 103 |
| 422 | 3300005344 | Ga0070661_100005946 | Ga0070661_1000059467 | 103 |
| 423 | 3300005354 | Ga0070675_100665801 | Ga0070675_1006658012 | 103 |
| 424 | 3300005355 | Ga0070671_100896302 | Ga0070671_1008963021 | 103 |
| 425 | 3300005455 | Ga0070663_100031905 | Ga0070663_1000319057 | 103 |
| 426 | 3300005455 | Ga0070663_101068184 | Ga0070663_1010681841 | 103 |
| 427 | 3300005545 | Ga0070695_100305763 | Ga0070695_1003057632 | 103 |
| 428 | 3300005546 | Ga0070696_101148084 | Ga0070696_1011480842 | 103 |
| 429 | 3300005718 | Ga0068866_11245579 | Ga0068866_112455792 | 103 |
| 430 | 3300006195 | Ga0075366_10587023 | Ga0075366_105870231 | 103 |
| 431 | 3300006844 | Ga0075428_100537794 | Ga0075428_1005377942 | 103 |
| 432 | 3300006846 | Ga0075430_100178685 | Ga0075430_1001786852 | 103 |
| 433 | 3300006846 | Ga0075430_100378381 | Ga0075430_1003783812 | 103 |
| 434 | 3300006847 | Ga0075431_100616853 | Ga0075431_1006168533 | 103 |
| 435 | 3300006880 | Ga0075429_100164008 | Ga0075429_1001640085 | 103 |
| 436 | 3300006880 | Ga0075429_100695756 | Ga0075429_1006957562 | 103 |
| 437 | 3300009093 | Ga0105240_10475761 | Ga0105240_104757613 | 103 |
| 438 | 3300009147 | Ga0114129_11039093 | Ga0114129_110390932 | 103 |
| 439 | 3300013100 | Ga0157373_11021898 | Ga0157373_110218982 | 103 |
| 440 | 3300013306 | Ga0163162_11022366 | Ga0163162_110223662 | 103 |
| 441 | 3300014325 | Ga0163163_11035873 | Ga0163163_110358731 | 103 |
| 442 | 3300014326 | Ga0157380_10298854 | Ga0157380_102988542 | 103 |
| 443 | 3300014326 | Ga0157380_13262196 | Ga0157380_132621961 | 103 |
| 444 | 3300021384 | Ga0213876_10753566 | Ga0213876_107535661 | 103 |
| 445 | 3300025261 | Ga0209233_1000188 | Ga0209233_100018846 | 103 |
| 446 | 3300025908 | Ga0207643_10130247 | Ga0207643_101302471 | 103 |
| 447 | 3300025913 | Ga0207695_10830404 | Ga0207695_108304042 | 103 |
| 448 | 3300025920 | Ga0207649_10000194 | Ga0207649_1000019458 | 103 |
| 449 | 3300025937 | Ga0207669_10656824 | Ga0207669_106568242 | 103 |
| 450 | 3300026067 | Ga0207678_10049649 | Ga0207678_100496493 | 103 |
| 451 | 3300031250 | Ga0265331_10000186 | Ga0265331_1000018637 | 103 |
| 452 | 3300031250 | Ga0265331_10004741 | Ga0265331_100047412 | 103 |
| 453 | 3300031251 | Ga0265327_10001297 | Ga0265327_1000129743 | 103 |
| 454 | 3300031711 | Ga0265314_10108357 | Ga0265314_101083572 | 103 |
| 455 | 3300035092 | Ga0373952_0125763 | Ga0373952_0125763_278_589 | 103 |
| 456 | 3300037312 | Ga0395899_0000073 | Ga0395899_0000073_74529_74843 | 103 |
| 457 | 3300037418 | Ga0395900_0000027 | Ga0395900_0000027_179099_179413 | 103 |
| 458 | 3300037466 | Ga0395898_0000255 | Ga0395898_0000255_24159_24473 | 103 |
| 459 | 3300037471 | Ga0395905_0000032 | Ga0395905_0000032_106520_106834 | 103 |
| 460 | 3300038443 | Ga0395901_0000110 | Ga0395901_0000110_106545_106859 | 103 |
| 461 | 3300039437 | Ga0436365_1489226 | Ga0436365_1489226_167_490 | 103 |
| 462 | 3300041413 | Ga0439465_0071193 | Ga0439465_0071193_77_391 | 103 |
| 463 | 3300041496 | Ga0451839_1433262 | Ga0451839_1433262_94_408 | 103 |
| 464 | 3300046519 | Ga0495632_0437005 | Ga0495632_0437005_174_488 | 103 |
| 465 | 3300046615 | Ga0495656_0050677 | Ga0495656_0050677_1232_1546 | 103 |
| 466 | 3300047445 | Ga0495677_0037133 | Ga0495677_0037133_1327_1641 | 103 |
| 467 | 3300048922 | Ga0496119_0062884 | Ga0496119_0062884_1563_1877 | 103 |
| 468 | 3300048923 | Ga0496120_0014732 | Ga0496120_0014732_4652_4966 | 103 |
| 469 | 3300049568 | Ga0501031_0000651 | Ga0501031_0000651_14366_14680 | 103 |
| 470 | 3300049568 | Ga0501031_0002703 | Ga0501031_0002703_981_1295 | 103 |
| 471 | 3300049568 | Ga0501031_0214542 | Ga0501031_0214542_195_509 | 103 |
| 472 | 3300049569 | Ga0501032_0000111 | Ga0501032_0000111_5868_6182 | 103 |
| 473 | 3300049569 | Ga0501032_0042271 | Ga0501032_0042271_1556_1870 | 103 |
| 474 | 3300049569 | Ga0501032_0066026 | Ga0501032_0066026_169_483 | 103 |
| 475 | 3300049569 | Ga0501032_0550690 | Ga0501032_0550690_203_517 | 103 |
| 476 | 3300049570 | Ga0501033_0012240 | Ga0501033_0012240_448_762 | 103 |
| 477 | 3300049570 | Ga0501033_0059135 | Ga0501033_0059135_556_870 | 103 |
| 478 | 3300049570 | Ga0501033_0079988 | Ga0501033_0079988_135_449 | 103 |
| 479 | 3300049570 | Ga0501033_0087475 | Ga0501033_0087475_31_345 | 103 |
| 480 | 3300049570 | Ga0501033_0389767 | Ga0501033_0389767_503_817 | 103 |
| 481 | 3300049571 | Ga0501034_0004897 | Ga0501034_0004897_94_408 | 103 |
| 482 | 3300049571 | Ga0501034_0006180 | Ga0501034_0006180_12149_12463 | 103 |
| 483 | 3300049571 | Ga0501034_0056638 | Ga0501034_0056638_2576_2890 | 103 |
| 484 | 3300049572 | Ga0501036_0002605 | Ga0501036_0002605_8042_8356 | 103 |
| 485 | 3300049572 | Ga0501036_0021849 | Ga0501036_0021849_4955_5269 | 103 |
| 486 | 3300049572 | Ga0501036_0025540 | Ga0501036_0025540_705_1019 | 103 |
| 487 | 3300049572 | Ga0501036_0038561 | Ga0501036_0038561_2228_2542 | 103 |
| 488 | 3300049573 | Ga0501037_0000131 | Ga0501037_0000131_63621_63935 | 103 |
| 489 | 3300049573 | Ga0501037_0006435 | Ga0501037_0006435_133_447 | 103 |
| 490 | 3300049573 | Ga0501037_0469909 | Ga0501037_0469909_42_356 | 103 |
| 491 | 3300049574 | Ga0501038_0000109 | Ga0501038_0000109_63621_63935 | 103 |
| 492 | 3300049574 | Ga0501038_0001882 | Ga0501038_0001882_13186_13500 | 103 |
| 493 | 3300049574 | Ga0501038_0096205 | Ga0501038_0096205_448_762 | 103 |
| 494 | 3300049575 | Ga0501039_0002279 | Ga0501039_0002279_5868_6182 | 103 |
| 495 | 3300049575 | Ga0501039_0098169 | Ga0501039_0098169_768_1082 | 103 |
| 496 | 3300049575 | Ga0501039_0183472 | Ga0501039_0183472_49_363 | 103 |
| 497 | 3300049576 | Ga0501040_0008666 | Ga0501040_0008666_5386_5700 | 103 |
| 498 | 3300049576 | Ga0501040_1251478 | Ga0501040_1251478_130_444 | 103 |
| 499 | 3300049578 | Ga0501042_0060942 | Ga0501042_0060942_2127_2441 | 103 |
| 500 | 3300049579 | Ga0501043_0021749 | Ga0501043_0021749_4366_4680 | 103 |
| 501 | 3300049579 | Ga0501043_0024392 | Ga0501043_0024392_133_447 | 103 |
| 502 | 3300049579 | Ga0501043_0047851 | Ga0501043_0047851_2068_2382 | 103 |
| 503 | 3300049579 | Ga0501043_0284223 | Ga0501043_0284223_115_429 | 103 |
| 504 | 3300049580 | Ga0501046_0018165 | Ga0501046_0018165_4434_4748 | 103 |
| 505 | 3300049580 | Ga0501046_0109256 | Ga0501046_0109256_873_1187 | 103 |
| 506 | 3300049580 | Ga0501046_0202688 | Ga0501046_0202688_748_1062 | 103 |
| 507 | 3300049580 | Ga0501046_0302279 | Ga0501046_0302279_656_970 | 103 |
| 508 | 3300049581 | Ga0501047_0011259 | Ga0501047_0011259_8020_8334 | 103 |
| 509 | 3300049581 | Ga0501047_0080199 | Ga0501047_0080199_111_425 | 103 |
| 510 | 3300049581 | Ga0501047_0197317 | Ga0501047_0197317_685_999 | 103 |
| 511 | 3300049582 | Ga0501048_0030318 | Ga0501048_0030318_2064_2378 | 103 |
| 512 | 3300049582 | Ga0501048_0060021 | Ga0501048_0060021_1184_1498 | 103 |
| 513 | 3300049584 | Ga0501068_0022655 | Ga0501068_0022655_704_1018 | 103 |
| 514 | 3300049584 | Ga0501068_0036227 | Ga0501068_0036227_1522_1836 | 103 |
| 515 | 3300049585 | Ga0501069_0013201 | Ga0501069_0013201_41_355 | 103 |
| 516 | 3300049585 | Ga0501069_0485558 | Ga0501069_0485558_385_699 | 103 |
| 517 | 3300049586 | Ga0501070_0001286 | Ga0501070_0001286_7728_8042 | 103 |
| 518 | 3300049586 | Ga0501070_0006301 | Ga0501070_0006301_4010_4324 | 103 |
| 519 | 3300049586 | Ga0501070_0266802 | Ga0501070_0266802_584_898 | 103 |
| 520 | 3300049586 | Ga0501070_0497119 | Ga0501070_0497119_10_324 | 103 |
| 521 | 3300049586 | Ga0501070_0527999 | Ga0501070_0527999_246_560 | 103 |
| 522 | 3300049586 | Ga0501070_0656325 | Ga0501070_0656325_121_435 | 103 |
| 523 | 3300049586 | Ga0501070_1013278 | Ga0501070_1013278_162_476 | 103 |
| 524 | 3300049587 | Ga0501071_0046823 | Ga0501071_0046823_94_408 | 103 |
| 525 | 3300049587 | Ga0501071_0249510 | Ga0501071_0249510_675_989 | 103 |
| 526 | 3300049588 | Ga0501072_0187300 | Ga0501072_0187300_329_643 | 103 |
| 527 | 3300049588 | Ga0501072_1166430 | Ga0501072_1166430_271_585 | 103 |
| 528 | 3300049589 | Ga0501073_0047706 | Ga0501073_0047706_754_1068 | 103 |
| 529 | 3300049589 | Ga0501073_0062660 | Ga0501073_0062660_1751_2065 | 103 |
| 530 | 3300049589 | Ga0501073_0172957 | Ga0501073_0172957_206_520 | 103 |
| 531 | 3300049590 | Ga0501074_0436632 | Ga0501074_0436632_248_562 | 103 |
| 532 | 3300049590 | Ga0501074_1143674 | Ga0501074_1143674_79_393 | 103 |
| 533 | 3300049741 | Ga0501079_0026674 | Ga0501079_0026674_610_924 | 103 |
| 534 | 3300049742 | Ga0501080_0004752 | Ga0501080_0004752_1783_2097 | 103 |
| 535 | 3300049742 | Ga0501080_0017194 | Ga0501080_0017194_6007_6321 | 103 |
| 536 | 3300049742 | Ga0501080_0098262 | Ga0501080_0098262_921_1235 | 103 |
| 537 | 3300049744 | Ga0501083_0027007 | Ga0501083_0027007_2683_2997 | 103 |
| 538 | 3300049744 | Ga0501083_0465931 | Ga0501083_0465931_172_486 | 103 |
| 539 | 3300049822 | Ga0501035_0000347 | Ga0501035_0000347_52962_53276 | 103 |
| 540 | 3300049822 | Ga0501035_0002188 | Ga0501035_0002188_13186_13500 | 103 |
| 541 | 3300049822 | Ga0501035_0048543 | Ga0501035_0048543_2564_2878 | 103 |
| 542 | 3300049822 | Ga0501035_0055030 | Ga0501035_0055030_1889_2203 | 103 |
| 543 | 3300049822 | Ga0501035_0153056 | Ga0501035_0153056_854_1168 | 103 |
| 544 | 3300049822 | Ga0501035_0727136 | Ga0501035_0727136_383_697 | 103 |
| 545 | 3300049823 | Ga0501044_0000234 | Ga0501044_0000234_63621_63935 | 103 |
| 546 | 3300049823 | Ga0501044_0009229 | Ga0501044_0009229_5899_6213 | 103 |
| 547 | 3300049823 | Ga0501044_0015755 | Ga0501044_0015755_4477_4791 | 103 |
| 548 | 3300049823 | Ga0501044_0018610 | Ga0501044_0018610_6763_7077 | 103 |
| 549 | 3300049823 | Ga0501044_0333346 | Ga0501044_0333346_260_574 | 103 |
| 550 | 3300049823 | Ga0501044_0429468 | Ga0501044_0429468_55_369 | 103 |
| 551 | 3300049823 | Ga0501044_0517929 | Ga0501044_0517929_726_1040 | 103 |
| 552 | 3300049823 | Ga0501044_1400925 | Ga0501044_1400925_78_392 | 103 |
| 553 | 3300049824 | Ga0501045_0001715 | Ga0501045_0001715_10833_11147 | 103 |
| 554 | 3300049824 | Ga0501045_0599919 | Ga0501045_0599919_462_776 | 103 |
| 555 | 3300050508 | nmdc:mga09592_471962_c1 | nmdc:mga09592_471962_c1_731_1057 | 103 |
| 556 | 3300050508 | nmdc:mga09592_525365_c1 | nmdc:mga09592_525365_c1_330_656 | 103 |
| 557 | 3300050509 | nmdc:mga0qj67_224796_c1 | nmdc:mga0qj67_224796_c1_577_903 | 103 |
| 558 | 3300050510 | nmdc:mga06r32_130312_c1 | nmdc:mga06r32_130312_c1_293_619 | 103 |
| 559 | 3300053130 | Ga0500642_0430824 | Ga0500642_0430824_227_541 | 103 |
| 560 | 3300053139 | Ga0500568_0001953 | Ga0500568_0001953_6466_6780 | 103 |
| 561 | 3300054114 | Ga0501084_1818114 | Ga0501084_1818114_164_478 | 103 |
| 562 | 3300060353 | Ga0501082_0901501 | Ga0501082_0901501_84_398 | 103 |
| 563 | 3300000531 | CNBas_1000512 | CNBas_10005124 | 104 |
| 564 | 3300000546 | LJNas_1005486 | LJNas_10054862 | 104 |
| 565 | 3300001979 | JGI24740J21852_10003752 | JGI24740J21852_100037529 | 104 |
| 566 | 3300003203 | JGI25406J46586_10056851 | JGI25406J46586_100568512 | 104 |
| 567 | 3300003203 | JGI25406J46586_10060086 | JGI25406J46586_100600862 | 104 |
| 568 | 3300003911 | JGI25405J52794_10019071 | JGI25405J52794_100190713 | 104 |
| 569 | 3300003911 | JGI25405J52794_10021947 | JGI25405J52794_100219473 | 104 |
| 570 | 3300004803 | Ga0058862_11907125 | Ga0058862_119071251 | 104 |
| 571 | 3300005327 | Ga0070658_10028805 | Ga0070658_100288053 | 104 |
| 572 | 3300005329 | Ga0070683_101382862 | Ga0070683_1013828621 | 104 |
| 573 | 3300005331 | Ga0070670_100876681 | Ga0070670_1008766812 | 104 |
| 574 | 3300005338 | Ga0068868_102241852 | Ga0068868_1022418521 | 104 |
| 575 | 3300005347 | Ga0070668_100991484 | Ga0070668_1009914842 | 104 |
| 576 | 3300005347 | Ga0070668_101822623 | Ga0070668_1018226232 | 104 |
| 577 | 3300005354 | Ga0070675_101703736 | Ga0070675_1017037361 | 104 |
| 578 | 3300005367 | Ga0070667_100813487 | Ga0070667_1008134872 | 104 |
| 579 | 3300005434 | Ga0070709_10004276 | Ga0070709_1000427614 | 104 |
| 580 | 3300005434 | Ga0070709_10514065 | Ga0070709_105140652 | 104 |
| 581 | 3300005435 | Ga0070714_100850879 | Ga0070714_1008508792 | 104 |
| 582 | 3300005435 | Ga0070714_100896558 | Ga0070714_1008965582 | 104 |
| 583 | 3300005435 | Ga0070714_101699098 | Ga0070714_1016990982 | 104 |
| 584 | 3300005436 | Ga0070713_100027784 | Ga0070713_1000277847 | 104 |
| 585 | 3300005436 | Ga0070713_100134612 | Ga0070713_1001346122 | 104 |
| 586 | 3300005436 | Ga0070713_100311006 | Ga0070713_1003110063 | 104 |
| 587 | 3300005436 | Ga0070713_100410163 | Ga0070713_1004101632 | 104 |
| 588 | 3300005436 | Ga0070713_101304049 | Ga0070713_1013040491 | 104 |
| 589 | 3300005437 | Ga0070710_10008016 | Ga0070710_1000801610 | 104 |
| 590 | 3300005437 | Ga0070710_10033673 | Ga0070710_100336731 | 104 |
| 591 | 3300005439 | Ga0070711_100004304 | Ga0070711_10000430415 | 104 |
| 592 | 3300005439 | Ga0070711_100016474 | Ga0070711_1000164749 | 104 |
| 593 | 3300005455 | Ga0070663_100354335 | Ga0070663_1003543351 | 104 |
| 594 | 3300005456 | Ga0070678_102360482 | Ga0070678_1023604822 | 104 |
| 595 | 3300005458 | Ga0070681_10606884 | Ga0070681_106068843 | 104 |
| 596 | 3300005467 | Ga0070706_100497194 | Ga0070706_1004971942 | 104 |
| 597 | 3300005467 | Ga0070706_100739256 | Ga0070706_1007392562 | 104 |
| 598 | 3300005471 | Ga0070698_101067047 | Ga0070698_1010670472 | 104 |
| 599 | 3300005548 | Ga0070665_100909118 | Ga0070665_1009091182 | 104 |
| 600 | 3300005841 | Ga0068863_101225410 | Ga0068863_1012254102 | 104 |
| 601 | 3300005937 | Ga0081455_10243564 | Ga0081455_102435642 | 104 |
| 602 | 3300006038 | Ga0075365_10000107 | Ga0075365_1000010728 | 104 |
| 603 | 3300006042 | Ga0075368_10470280 | Ga0075368_104702802 | 104 |
| 604 | 3300006048 | Ga0075363_100062673 | Ga0075363_1000626735 | 104 |
| 605 | 3300006051 | Ga0075364_11181400 | Ga0075364_111814002 | 104 |
| 606 | 3300006173 | Ga0070716_100401666 | Ga0070716_1004016662 | 104 |
| 607 | 3300006173 | Ga0070716_100503906 | Ga0070716_1005039062 | 104 |
| 608 | 3300006175 | Ga0070712_100020480 | Ga0070712_1000204805 | 104 |
| 609 | 3300006175 | Ga0070712_100025062 | Ga0070712_1000250623 | 104 |
| 610 | 3300006844 | Ga0075428_100451792 | Ga0075428_1004517922 | 104 |
| 611 | 3300006846 | Ga0075430_100429717 | Ga0075430_1004297173 | 104 |
| 612 | 3300006871 | Ga0075434_100648721 | Ga0075434_1006487212 | 104 |
| 613 | 3300006914 | Ga0075436_100305975 | Ga0075436_1003059752 | 104 |
| 614 | 3300007076 | Ga0075435_100337571 | Ga0075435_1003375712 | 104 |
| 615 | 3300009093 | Ga0105240_10652743 | Ga0105240_106527432 | 104 |
| 616 | 3300009094 | Ga0111539_10163484 | Ga0111539_101634842 | 104 |
| 617 | 3300009098 | Ga0105245_10211036 | Ga0105245_102110364 | 104 |
| 618 | 3300009147 | Ga0114129_12790258 | Ga0114129_127902581 | 104 |
| 619 | 3300009545 | Ga0105237_10267620 | Ga0105237_102676202 | 104 |
| 620 | 3300009545 | Ga0105237_10933630 | Ga0105237_109336302 | 104 |
| 621 | 3300009553 | Ga0105249_11449026 | Ga0105249_114490262 | 104 |
| 622 | 3300012497 | Ga0157319_1055856 | Ga0157319_10558562 | 104 |
| 623 | 3300012508 | Ga0157315_1002191 | Ga0157315_10021914 | 104 |
| 624 | 3300013297 | Ga0157378_10572183 | Ga0157378_105721832 | 104 |
| 625 | 3300015261 | Ga0182006_1109411 | Ga0182006_11094112 | 104 |
| 626 | 3300017792 | Ga0163161_10148208 | Ga0163161_101482084 | 104 |
| 627 | 3300021358 | Ga0213873_10019900 | Ga0213873_100199004 | 104 |
| 628 | 3300021377 | Ga0213874_10110692 | Ga0213874_101106922 | 104 |
| 629 | 3300021377 | Ga0213874_10238810 | Ga0213874_102388102 | 104 |
| 630 | 3300024225 | Ga0224572_1027189 | Ga0224572_10271892 | 104 |
| 631 | 3300024227 | Ga0228598_1040293 | Ga0228598_10402932 | 104 |
| 632 | 3300024227 | Ga0228598_1051633 | Ga0228598_10516332 | 104 |
| 633 | 3300025250 | Ga0209026_1019700 | Ga0209026_10197002 | 104 |
| 634 | 3300025898 | Ga0207692_10273065 | Ga0207692_102730652 | 104 |
| 635 | 3300025898 | Ga0207692_10330105 | Ga0207692_103301052 | 104 |
| 636 | 3300025905 | Ga0207685_10194365 | Ga0207685_101943652 | 104 |
| 637 | 3300025906 | Ga0207699_10006191 | Ga0207699_100061912 | 104 |
| 638 | 3300025910 | Ga0207684_10619235 | Ga0207684_106192352 | 104 |
| 639 | 3300025913 | Ga0207695_10447902 | Ga0207695_104479022 | 104 |
| 640 | 3300025914 | Ga0207671_10217826 | Ga0207671_102178262 | 104 |
| 641 | 3300025915 | Ga0207693_10022819 | Ga0207693_100228196 | 104 |
| 642 | 3300025915 | Ga0207693_10108170 | Ga0207693_101081705 | 104 |
| 643 | 3300025916 | Ga0207663_10147730 | Ga0207663_101477304 | 104 |
| 644 | 3300025916 | Ga0207663_10464189 | Ga0207663_104641892 | 104 |
| 645 | 3300025916 | Ga0207663_11160299 | Ga0207663_111602992 | 104 |
| 646 | 3300025928 | Ga0207700_10090721 | Ga0207700_100907216 | 104 |
| 647 | 3300025928 | Ga0207700_10246796 | Ga0207700_102467964 | 104 |
| 648 | 3300025939 | Ga0207665_10083411 | Ga0207665_100834112 | 104 |
| 649 | 3300025939 | Ga0207665_10756257 | Ga0207665_107562572 | 104 |
| 650 | 3300026041 | Ga0207639_10841057 | Ga0207639_108410572 | 104 |
| 651 | 3300026067 | Ga0207678_11046836 | Ga0207678_110468362 | 104 |
| 652 | 3300028036 | Ga0265355_1012431 | Ga0265355_10124312 | 104 |
| 653 | 3300028577 | Ga0265318_10000037 | Ga0265318_1000003714 | 104 |
| 654 | 3300028577 | Ga0265318_10185884 | Ga0265318_101858842 | 104 |
| 655 | 3300028800 | Ga0265338_10051741 | Ga0265338_100517412 | 104 |
| 656 | 3300028800 | Ga0265338_10168013 | Ga0265338_101680134 | 104 |
| 657 | 3300029957 | Ga0265324_10092997 | Ga0265324_100929972 | 104 |
| 658 | 3300030760 | Ga0265762_1129483 | Ga0265762_11294832 | 104 |
| 659 | 3300030763 | Ga0265763_1000060 | Ga0265763_10000606 | 104 |
| 660 | 3300031235 | Ga0265330_10182616 | Ga0265330_101826161 | 104 |
| 661 | 3300031238 | Ga0265332_10163035 | Ga0265332_101630352 | 104 |
| 662 | 3300031241 | Ga0265325_10256877 | Ga0265325_102568772 | 104 |
| 663 | 3300031249 | Ga0265339_10000053 | Ga0265339_1000005317 | 104 |
| 664 | 3300031249 | Ga0265339_10136500 | Ga0265339_101365002 | 104 |
| 665 | 3300031344 | Ga0265316_10547776 | Ga0265316_105477762 | 104 |
| 666 | 3300031595 | Ga0265313_10000098 | Ga0265313_1000009870 | 104 |
| 667 | 3300031595 | Ga0265313_10190826 | Ga0265313_101908262 | 104 |
| 668 | 3300031616 | Ga0307508_10107154 | Ga0307508_101071542 | 104 |
| 669 | 3300031711 | Ga0265314_10028299 | Ga0265314_100282995 | 104 |
| 670 | 3300031712 | Ga0265342_10131168 | Ga0265342_101311682 | 104 |
| 671 | 3300032137 | Ga0316585_10188778 | Ga0316585_101887782 | 104 |
| 672 | 3300035089 | Ga0373944_0014329 | Ga0373944_0014329_346_672 | 104 |
| 673 | 3300035112 | Ga0373932_0254903 | Ga0373932_0254903_39_353 | 104 |
| 674 | 3300035116 | Ga0373945_0075515 | Ga0373945_0075515_485_799 | 104 |
| 675 | 3300035119 | Ga0373956_0004726 | Ga0373956_0004726_2615_2941 | 104 |
| 676 | 3300035119 | Ga0373956_0129696 | Ga0373956_0129696_512_829 | 104 |
| 677 | 3300035120 | Ga0373957_0099970 | Ga0373957_0099970_158_484 | 104 |
| 678 | 3300035170 | Ga0373943_0269998 | Ga0373943_0269998_508_834 | 104 |
| 679 | 3300035171 | Ga0373946_0017706 | Ga0373946_0017706_849_1175 | 104 |
| 680 | 3300035172 | Ga0373955_0012493 | Ga0373955_0012493_45_371 | 104 |
| 681 | 3300035172 | Ga0373955_0391799 | Ga0373955_0391799_62_379 | 104 |
| 682 | 3300035398 | Ga0316574_0473572 | Ga0316574_0473572_18_335 | 104 |
| 683 | 3300035398 | Ga0316574_0473891 | Ga0316574_0473891_41_358 | 104 |
| 684 | 3300035410 | Ga0373924_0007245 | Ga0373924_0007245_360_686 | 104 |
| 685 | 3300035692 | Ga0373935_0603953 | Ga0373935_0603953_219_545 | 104 |
| 686 | 3300035692 | Ga0373935_1367409 | Ga0373935_1367409_110_424 | 104 |
| 687 | 3300035724 | Ga0373933_0000858 | Ga0373933_0000858_17825_18151 | 104 |
| 688 | 3300035725 | Ga0373947_0072680 | Ga0373947_0072680_357_683 | 104 |
| 689 | 3300036401 | Ga0373937_0001081 | Ga0373937_0001081_8631_8957 | 104 |
| 690 | 3300036401 | Ga0373937_0027613 | Ga0373937_0027613_3530_3847 | 104 |
| 691 | 3300036457 | Ga0265778_015410 | Ga0265778_015410_398_721 | 104 |
| 692 | 3300037068 | Ga0373925_0020584 | Ga0373925_0020584_1206_1532 | 104 |
| 693 | 3300039437 | Ga0436365_0395732 | Ga0436365_0395732_349_675 | 104 |
| 694 | 3300039437 | Ga0436365_0507633 | Ga0436365_0507633_66_392 | 104 |
| 695 | 3300039437 | Ga0436365_1013719 | Ga0436365_1013719_135_449 | 104 |
| 696 | 3300039437 | Ga0436365_1728357 | Ga0436365_1728357_610_924 | 104 |
| 697 | 3300039438 | Ga0436360_0309547 | Ga0436360_0309547_18_335 | 104 |
| 698 | 3300039447 | Ga0436361_0355909 | Ga0436361_0355909_81_398 | 104 |
| 699 | 3300039447 | Ga0436361_0661719 | Ga0436361_0661719_378_692 | 104 |
| 700 | 3300039450 | Ga0436363_0141605 | Ga0436363_0141605_197_511 | 104 |
| 701 | 3300039450 | Ga0436363_1592451 | Ga0436363_1592451_199_525 | 104 |
| 702 | 3300039453 | Ga0436362_0518937 | Ga0436362_0518937_887_1204 | 104 |
| 703 | 3300041413 | Ga0439465_0121371 | Ga0439465_0121371_556_873 | 104 |
| 704 | 3300041441 | Ga0451787_066607 | Ga0451787_066607_104_418 | 104 |
| 705 | 3300041441 | Ga0451787_431217 | Ga0451787_431217_323_637 | 104 |
| 706 | 3300041486 | Ga0451807_1116814 | Ga0451807_1116814_255_575 | 104 |
| 707 | 3300041491 | Ga0451833_0858461 | Ga0451833_0858461_46_360 | 104 |
| 708 | 3300041498 | Ga0451841_0060129 | Ga0451841_0060129_614_928 | 104 |
| 709 | 3300042532 | Ga0450893_0137798 | Ga0450893_0137798_159_488 | 104 |
| 710 | 3300044693 | Ga0466961_0605332 | Ga0466961_0605332_163_477 | 104 |
| 711 | 3300044694 | Ga0466963_0104366 | Ga0466963_0104366_481_795 | 104 |
| 712 | 3300044735 | Ga0466968_0317749 | Ga0466968_0317749_317_631 | 104 |
| 713 | 3300044765 | Ga0466970_0720346 | Ga0466970_0720346_52_366 | 104 |
| 714 | 3300044842 | Ga0466957_0159103 | Ga0466957_0159103_184_498 | 104 |
| 715 | 3300044842 | Ga0466957_0533626 | Ga0466957_0533626_211_525 | 104 |
| 716 | 3300045049 | Ga0466959_0414687 | Ga0466959_0414687_454_768 | 104 |
| 717 | 3300045976 | Ga0466967_0129036 | Ga0466967_0129036_133_447 | 104 |
| 718 | 3300046454 | Ga0495592_0002995 | Ga0495592_0002995_8367_8693 | 104 |
| 719 | 3300046459 | Ga0495629_0003398 | Ga0495629_0003398_4717_5043 | 104 |
| 720 | 3300046462 | Ga0495651_0013698 | Ga0495651_0013698_2984_3310 | 104 |
| 721 | 3300046462 | Ga0495651_0123510 | Ga0495651_0123510_87_404 | 104 |
| 722 | 3300046463 | Ga0495653_0000370 | Ga0495653_0000370_28361_28687 | 104 |
| 723 | 3300046472 | Ga0495580_0168910 | Ga0495580_0168910_1103_1429 | 104 |
| 724 | 3300046475 | Ga0495639_0132461 | Ga0495639_0132461_502_828 | 104 |
| 725 | 3300046476 | Ga0495662_0025995 | Ga0495662_0025995_245_571 | 104 |
| 726 | 3300046477 | Ga0495664_0288120 | Ga0495664_0288120_347_673 | 104 |
| 727 | 3300046511 | Ga0495608_0094808 | Ga0495608_0094808_1027_1353 | 104 |
| 728 | 3300046514 | Ga0495618_0014905 | Ga0495618_0014905_366_692 | 104 |
| 729 | 3300046516 | Ga0495628_0003568 | Ga0495628_0003568_3543_3869 | 104 |
| 730 | 3300046526 | Ga0495666_0143070 | Ga0495666_0143070_158_484 | 104 |
| 731 | 3300046529 | Ga0495652_0004294 | Ga0495652_0004294_2513_2839 | 104 |
| 732 | 3300046531 | Ga0495665_0297276 | Ga0495665_0297276_157_483 | 104 |
| 733 | 3300046533 | Ga0495640_0000769 | Ga0495640_0000769_12171_12497 | 104 |
| 734 | 3300046535 | Ga0495586_0141238 | Ga0495586_0141238_219_545 | 104 |
| 735 | 3300046536 | Ga0495587_0001283 | Ga0495587_0001283_14025_14351 | 104 |
| 736 | 3300046543 | Ga0495645_0030738 | Ga0495645_0030738_3494_3820 | 104 |
| 737 | 3300046559 | Ga0495667_0001942 | Ga0495667_0001942_4985_5311 | 104 |
| 738 | 3300046642 | Ga0495634_0002200 | Ga0495634_0002200_5010_5336 | 104 |
| 739 | 3300046663 | Ga0495635_0004328 | Ga0495635_0004328_2837_3163 | 104 |
| 740 | 3300046675 | Ga0495657_0007254 | Ga0495657_0007254_3026_3352 | 104 |
| 741 | 3300046678 | Ga0495599_0011656 | Ga0495599_0011656_3251_3577 | 104 |
| 742 | 3300046679 | Ga0495623_0003723 | Ga0495623_0003723_4960_5286 | 104 |
| 743 | 3300046683 | Ga0495658_0188648 | Ga0495658_0188648_685_1011 | 104 |
| 744 | 3300046683 | Ga0495658_0608878 | Ga0495658_0608878_284_601 | 104 |
| 745 | 3300046689 | Ga0495613_0034160 | Ga0495613_0034160_1972_2298 | 104 |
| 746 | 3300046690 | Ga0495624_0251830 | Ga0495624_0251830_584_910 | 104 |
| 747 | 3300046809 | Ga0495600_0000422 | Ga0495600_0000422_7927_8253 | 104 |
| 748 | 3300047317 | Ga0495604_0000406 | Ga0495604_0000406_14066_14392 | 104 |
| 749 | 3300047319 | Ga0495674_0000757 | Ga0495674_0000757_26300_26626 | 104 |
| 750 | 3300047322 | Ga0495680_0001477 | Ga0495680_0001477_8344_8670 | 104 |
| 751 | 3300047444 | Ga0495675_0020789 | Ga0495675_0020789_2481_2807 | 104 |
| 752 | 3300047471 | Ga0495684_0002545 | Ga0495684_0002545_11958_12284 | 104 |
| 753 | 3300047471 | Ga0495684_0453272 | Ga0495684_0453272_279_596 | 104 |
| 754 | 3300047673 | Ga0495593_0014136 | Ga0495593_0014136_599_925 | 104 |
| 755 | 3300048088 | Ga0495602_0010292 | Ga0495602_0010292_1139_1465 | 104 |
| 756 | 3300048903 | Ga0496100_0158697 | Ga0496100_0158697_1226_1552 | 104 |
| 757 | 3300048903 | Ga0496100_0440679 | Ga0496100_0440679_264_581 | 104 |
| 758 | 3300048905 | Ga0496102_0957674 | Ga0496102_0957674_62_388 | 104 |
| 759 | 3300048905 | Ga0496102_1623407 | Ga0496102_1623407_187_513 | 104 |
| 760 | 3300048906 | Ga0496103_0840181 | Ga0496103_0840181_84_410 | 104 |
| 761 | 3300048907 | Ga0496104_0156871 | Ga0496104_0156871_436_762 | 104 |
| 762 | 3300048907 | Ga0496104_0399628 | Ga0496104_0399628_583_900 | 104 |
| 763 | 3300048908 | Ga0496105_0210599 | Ga0496105_0210599_1200_1517 | 104 |
| 764 | 3300048909 | Ga0496106_0125870 | Ga0496106_0125870_718_1044 | 104 |
| 765 | 3300048911 | Ga0496108_0349307 | Ga0496108_0349307_325_642 | 104 |
| 766 | 3300048911 | Ga0496108_0781465 | Ga0496108_0781465_102_428 | 104 |
| 767 | 3300048911 | Ga0496108_1582916 | Ga0496108_1582916_113_433 | 104 |
| 768 | 3300048912 | Ga0496109_0490138 | Ga0496109_0490138_74_400 | 104 |
| 769 | 3300048913 | Ga0496110_1911742 | Ga0496110_1911742_65_382 | 104 |
| 770 | 3300048915 | Ga0496112_1331898 | Ga0496112_1331898_258_584 | 104 |
| 771 | 3300048917 | Ga0496114_0449076 | Ga0496114_0449076_152_478 | 104 |
| 772 | 3300048918 | Ga0496115_0009751 | Ga0496115_0009751_4160_4477 | 104 |
| 773 | 3300048924 | Ga0496121_0393347 | Ga0496121_0393347_256_570 | 104 |
| 774 | 3300049568 | Ga0501031_0011241 | Ga0501031_0011241_4231_4557 | 104 |
| 775 | 3300049569 | Ga0501032_0085200 | Ga0501032_0085200_1701_2027 | 104 |
| 776 | 3300049571 | Ga0501034_0355386 | Ga0501034_0355386_83_409 | 104 |
| 777 | 3300049574 | Ga0501038_0131973 | Ga0501038_0131973_1355_1681 | 104 |
| 778 | 3300049575 | Ga0501039_0237035 | Ga0501039_0237035_478_792 | 104 |
| 779 | 3300049577 | Ga0501041_0226440 | Ga0501041_0226440_122_448 | 104 |
| 780 | 3300049578 | Ga0501042_0400790 | Ga0501042_0400790_497_823 | 104 |
| 781 | 3300049582 | Ga0501048_0085647 | Ga0501048_0085647_1846_2172 | 104 |
| 782 | 3300049584 | Ga0501068_0694292 | Ga0501068_0694292_311_637 | 104 |
| 783 | 3300049586 | Ga0501070_1458797 | Ga0501070_1458797_138_464 | 104 |
| 784 | 3300049589 | Ga0501073_0370679 | Ga0501073_0370679_214_540 | 104 |
| 785 | 3300049590 | Ga0501074_0201847 | Ga0501074_0201847_31_357 | 104 |
| 786 | 3300049591 | Ga0501075_0756460 | Ga0501075_0756460_370_699 | 104 |
| 787 | 3300049592 | Ga0501076_0107789 | Ga0501076_0107789_803_1129 | 104 |
| 788 | 3300049593 | Ga0501077_1030740 | Ga0501077_1030740_93_419 | 104 |
| 789 | 3300049823 | Ga0501044_0129860 | Ga0501044_0129860_1635_1961 | 104 |
| 790 | 3300049824 | Ga0501045_0449763 | Ga0501045_0449763_555_881 | 104 |
| 791 | 3300050509 | nmdc:mga0qj67_353427_c1 | nmdc:mga0qj67_353427_c1_619_939 | 104 |
| 792 | 3300050512 | nmdc:mga0n895_606845_c1 | nmdc:mga0n895_606845_c1_48_374 | 104 |
| 793 | 3300050513 | nmdc:mga0rr50_325194_c1 | nmdc:mga0rr50_325194_c1_180_494 | 104 |
| 794 | 3300050513 | nmdc:mga0rr50_379767_c1 | nmdc:mga0rr50_379767_c1_556_921 | 104 |
| 795 | 3300050515 | nmdc:mga0a205_1218321_c1 | nmdc:mga0a205_1218321_c1_91_405 | 104 |
| 796 | 3300050515 | nmdc:mga0a205_493253_c1 | nmdc:mga0a205_493253_c1_688_1014 | 104 |
| 797 | 3300053077 | Ga0495601_0003476 | Ga0495601_0003476_4525_4851 | 104 |
| 798 | 3300053077 | Ga0495601_0573828 | Ga0495601_0573828_307_624 | 104 |
| 799 | 3300053078 | Ga0495612_0007484 | Ga0495612_0007484_4053_4379 | 104 |
| 800 | 3300053084 | Ga0495595_0000821 | Ga0495595_0000821_8591_8917 | 104 |
| 801 | 3300053085 | Ga0495619_0000352 | Ga0495619_0000352_22571_22897 | 104 |
| 802 | 3300053093 | Ga0500651_0506400 | Ga0500651_0506400_246_560 | 104 |
| 803 | 3300053117 | Ga0500593_003205 | Ga0500593_003205_3983_4309 | 104 |
| 804 | 3300053118 | Ga0500594_0257413 | Ga0500594_0257413_40_366 | 104 |
| 805 | 3300053151 | Ga0500604_0179226 | Ga0500604_0179226_174_500 | 104 |
| 806 | 3300054114 | Ga0501084_0230662 | Ga0501084_0230662_301_624 | 104 |
| 807 | 3300054114 | Ga0501084_1528553 | Ga0501084_1528553_54_380 | 104 |
| 808 | 3300059426 | Ga0590077_067914 | Ga0590077_067914_394_711 | 104 |
| 809 | 3300060353 | Ga0501082_1430201 | Ga0501082_1430201_147_473 | 104 |
| 810 | 3300061734 | Ga0530510_0511183 | Ga0530510_0511183_95_421 | 104 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7zq6-assembly1.cif.gz_u | 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain | 0.9526 | 2 | 102 |
| 7zq6-assembly1.cif.gz_u | 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain | 0.9426 | 2 | 102 |
| 8cgd-assembly1.cif.gz_t | clindamycin bound to the 50s subunit | 0.9398 | 2 | 102 |
| 6gsk-assembly2.cif.gz_C5 | structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site | 0.9373 | 5 | 72 |
| 8cgk-assembly1.cif.gz_t | lincomycin and avilamycin bound to the 50s subunit | 0.9351 | 2 | 102 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6KSP8_36_136_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9212 | 3 | 100 | 2.30.30.30 |
| af_Q653V9_69_173_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9162 | 5 | 99 | 2.30.30.30 |
| af_Q96A35_47_153_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9141 | 5 | 99 | 2.30.30.30 |
| af_Q8I5H8_47_152_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9099 | 5 | 100 | 2.30.30.30 |
| af_Q55DJ4_14_116_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9066 | 3 | 100 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7D9HM89-F1-model_v4 | Large ribosomal subunit protein uL24m (39S ribosomal protein L24, mitochondrial) | 0.9523 | 5 | 102 |
GO:0003723
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7X5JDA8-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9511 | 3 | 102 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1I1PN76-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9509 | 1 | 102 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A7RLR8-F1-model_v4 | Large ribosomal subunit protein uL24m (39S ribosomal protein L24, mitochondrial) | 0.9492 | 3 | 102 |
GO:0003723
GO:0003735 GO:0005739 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A4V3BBM6-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9482 | 1 | 102 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar