F481795

General Info

Members Datasets Scaffolds Average Seq Length
810 292 1620 265

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100051817|Ga0070698_1000518174
Length 324
Sequence MGRSSGCWDECPICICLVVVVASEPRGERQDRRISDIRPIGPIHLTDTSLNPYKRRMSFEPVTSAAVETFSLVKQFGSFVAVDHINLSVARGSFFGFLGPNGAGKSTTIKMLTGLLAPTSGSLRVLGLDIAEHPMEVKRRIGVVPEDLNLFERLTGAEMLAFTGRMYGLNKTEIAQRAKELLELMELQDEPKKLVIEYSHGMKKKLSLACALIHRPDILFLDEPFEGVDAIASRTLKDLLSRLTARGLTVFLTSHVLEIVERLCSDIAIISQGKLLASGELNELRKGIRLAEDGKGPVSLEEYFIHLVGGSRSAGEEEVLQWLT

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
170 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
171 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
172 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
176 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
178 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
199 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
211 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
212 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
213 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
256 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
257 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
258 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
262 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
263 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
264 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
265 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
266 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
267 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
268 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
269 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
270 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
271 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
272 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
273 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
274 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
275 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
276 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.12
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.85
Rhizosphere 97.16
Stem 0
Stem Tuber 0
Unclassified 1.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100051817 3300005471 Bacteria 4178
2 CNAas_1000805 3300000532 Bacteria 2982
3 JGI25406J46586_10016376 3300003203 Bacteria 3092
4 rootL2_10129164 3300003322 Bacteria 2449
5 Ga0065714_10064478 3300005288 Bacteria 56205
6 Ga0065704_10004781 3300005289 Bacteria 6356
7 Ga0065704_10126348 3300005289 Bacteria 1691
8 Ga0065712_10000121 3300005290 Bacteria 103063
9 Ga0065712_10140325 3300005290 Bacteria 1456
10 Ga0065715_10006611 3300005293 Bacteria 4246
11 Ga0065715_10089388 3300005293 Bacteria 10629
12 Ga0065715_10098705 3300005293 Bacteria 3479
13 Ga0065715_10101842 3300005293 Bacteria 3166
14 Ga0065715_10112357 3300005293 Bacteria 2533
15 Ga0065715_10136770 3300005293 Bacteria 1895
16 Ga0065715_10145009 3300005293 Bacteria 1800
17 Ga0065707_10003321 3300005295 Bacteria 7332
18 Ga0065707_10020581 3300005295 Bacteria 1971
19 Ga0065707_10111190 3300005295 Bacteria 2403
20 Ga0065707_10295966 3300005295 Bacteria 1014
21 Ga0070676_10356829 3300005328 Bacteria 1006
22 Ga0070690_100070610 3300005330 Bacteria 2268
23 Ga0070690_100082607 3300005330 Bacteria 2103
24 Ga0070690_100104446 3300005330 Bacteria 1882
25 Ga0070690_100309197 3300005330 Bacteria 1136
26 Ga0070670_100104522 3300005331 Bacteria 2439
27 Ga0070670_100227768 3300005331 Bacteria 1622
28 Ga0068869_100003799 3300005334 Bacteria 9306
29 Ga0068869_100009108 3300005334 Bacteria 6431
30 Ga0068869_100041526 3300005334 Bacteria 3295
31 Ga0068869_100044898 3300005334 Bacteria 3179
32 Ga0068869_100049261 3300005334 Bacteria 3049
33 Ga0068869_100253402 3300005334 Bacteria 1407
34 Ga0068869_100367488 3300005334 Bacteria 1176
35 Ga0068869_100438974 3300005334 Bacteria 1080
36 Ga0068869_100475233 3300005334 Bacteria 1040
37 Ga0070666_10034069 3300005335 Bacteria 3375
38 Ga0070666_10074404 3300005335 Bacteria 2315
39 Ga0070666_10102411 3300005335 Bacteria 1974
40 Ga0070680_100000433 3300005336 Bacteria 28525
41 Ga0070680_100198106 3300005336 Bacteria 1693
42 Ga0070680_100385496 3300005336 Bacteria 1194
43 Ga0070682_100000058 3300005337 Bacteria 108660
44 Ga0070660_100024967 3300005339 Bacteria 4439
45 Ga0070689_100001007 3300005340 Bacteria 17652
46 Ga0070689_100037584 3300005340 Bacteria 3702
47 Ga0070689_100041872 3300005340 Bacteria 3516
48 Ga0070689_100165502 3300005340 Bacteria 1789
49 Ga0070689_100232900 3300005340 Bacteria 1515
50 Ga0070689_100305920 3300005340 Bacteria 1324
51 Ga0070689_100435634 3300005340 Bacteria 1113
52 Ga0070689_100460575 3300005340 Bacteria 1083
53 Ga0070687_100039901 3300005343 Bacteria 2362
54 Ga0070661_100207699 3300005344 Bacteria 1498
55 Ga0070692_10000272 3300005345 Bacteria 14480
56 Ga0070692_10069774 3300005345 Bacteria 1870
57 Ga0070692_10103212 3300005345 Bacteria 1566
58 Ga0070669_100008036 3300005353 Bacteria 7531
59 Ga0070669_100032842 3300005353 Bacteria 3750
60 Ga0070669_100100847 3300005353 Bacteria 2177
61 Ga0070669_100124198 3300005353 Bacteria 1973
62 Ga0070669_100227629 3300005353 Bacteria 1476
63 Ga0070669_100313527 3300005353 Bacteria 1265
64 Ga0070675_100002860 3300005354 Bacteria 13007
65 Ga0070675_100081360 3300005354 Bacteria 2701
66 Ga0070675_100138495 3300005354 Bacteria 2079
67 Ga0070675_100215909 3300005354 Bacteria 1669
68 Ga0070675_100338952 3300005354 Bacteria 1331
69 Ga0070675_100605599 3300005354 Bacteria 994
70 Ga0070671_100002033 3300005355 Bacteria 15586
71 Ga0070671_100013754 3300005355 Bacteria 6529
72 Ga0070671_100249282 3300005355 Bacteria 1508
73 Ga0070674_100016675 3300005356 Bacteria 4608
74 Ga0070673_100000496 3300005364 Bacteria 20985
75 Ga0070673_100104148 3300005364 Bacteria 2342
76 Ga0070688_100003628 3300005365 Bacteria 7967
77 Ga0070688_100074403 3300005365 Bacteria 2182
78 Ga0070688_100409403 3300005365 Bacteria 1005
79 Ga0070667_100031073 3300005367 Bacteria 4453
80 Ga0070667_100063028 3300005367 Bacteria 3141
81 Ga0070701_10040303 3300005438 Bacteria 2374
82 Ga0070701_10077989 3300005438 Bacteria 1786
83 Ga0070705_100090987 3300005440 Bacteria 1900
84 Ga0070705_100105553 3300005440 Bacteria 1789
85 Ga0070700_100005787 3300005441 Bacteria 6561
86 Ga0070700_100006168 3300005441 Bacteria 6386
87 Ga0070700_100072502 3300005441 Bacteria 2202
88 Ga0070700_100088629 3300005441 Bacteria 2014
89 Ga0070694_100011013 3300005444 Bacteria 5594
90 Ga0070694_100021105 3300005444 Bacteria 4159
91 Ga0070694_100085452 3300005444 Bacteria 2203
92 Ga0070694_100090937 3300005444 Bacteria 2141
93 Ga0070694_100093284 3300005444 Bacteria 2116
94 Ga0070694_100146242 3300005444 Bacteria 1722
95 Ga0070694_100184802 3300005444 Bacteria 1544
96 Ga0070694_100234719 3300005444 Bacteria 1381
97 Ga0070694_100303017 3300005444 Bacteria 1225
98 Ga0070694_100304625 3300005444 Bacteria 1222
99 Ga0070708_100163193 3300005445 Bacteria 2077
100 Ga0070708_100328228 3300005445 Bacteria 1441
101 Ga0070708_100569082 3300005445 Unclassified 1068
102 Ga0070678_100085239 3300005456 Bacteria 2407
103 Ga0070662_100011430 3300005457 Bacteria 5860
104 Ga0070662_100044935 3300005457 Bacteria 3167
105 Ga0070662_100162457 3300005457 Bacteria 1748
106 Ga0070662_100310618 3300005457 Bacteria 1283
107 Ga0070662_100723602 3300005457 Bacteria 843
108 Ga0070681_10000065 3300005458 Bacteria 76633
109 Ga0070681_10000347 3300005458 Bacteria 37367
110 Ga0070681_10002491 3300005458 Bacteria 16858
111 Ga0070681_10060954 3300005458 Bacteria 3749
112 Ga0070681_10400322 3300005458 Bacteria 1284
113 Ga0068867_100015337 3300005459 Bacteria 5433
114 Ga0068867_100205084 3300005459 Bacteria 1580
115 Ga0070685_10150419 3300005466 Bacteria 1475
116 Ga0070706_100003255 3300005467 Bacteria 16057
117 Ga0070706_100003761 3300005467 Bacteria 14814
118 Ga0070706_100026557 3300005467 Bacteria 5328
119 Ga0070706_100042282 3300005467 Bacteria 4209
120 Ga0070706_100132750 3300005467 Bacteria 2324
121 Ga0070698_100005396 3300005471 Bacteria 13980
122 Ga0070698_100030706 3300005471 Bacteria 5570
123 Ga0070698_100187471 3300005471 Bacteria 2006
124 Ga0070699_100002201 3300005518 Bacteria 17638
125 Ga0070699_100018455 3300005518 Bacteria 5992
126 Ga0070679_100000013 3300005530 Bacteria 151602
127 Ga0070679_100029337 3300005530 Bacteria 5428
128 Ga0070679_100069085 3300005530 Bacteria 3524
129 Ga0070679_100549859 3300005530 Bacteria 1098
130 Ga0070697_100000014 3300005536 Bacteria 144589
131 Ga0070697_100000543 3300005536 Bacteria 28395
132 Ga0070697_100031063 3300005536 Bacteria 4294
133 Ga0070697_100305682 3300005536 Bacteria 1367
134 Ga0068853_100031259 3300005539 Bacteria 4503
135 Ga0068853_100046493 3300005539 Bacteria 3722
136 Ga0068853_100176795 3300005539 Bacteria 1934
137 Ga0068853_100252655 3300005539 Bacteria 1618
138 Ga0070672_100071245 3300005543 Bacteria 2764
139 Ga0070672_100076676 3300005543 Bacteria 2671
140 Ga0070686_100014980 3300005544 Bacteria 4480
141 Ga0070686_100121611 3300005544 Bacteria 1793
142 Ga0070686_100566726 3300005544 Bacteria 890
143 Ga0070695_100076474 3300005545 Bacteria 2205
144 Ga0070695_100104966 3300005545 Bacteria 1909
145 Ga0070695_100328942 3300005545 Bacteria 1138
146 Ga0070696_100032210 3300005546 Bacteria 3597
147 Ga0070696_100079149 3300005546 Bacteria 2325
148 Ga0070696_100177875 3300005546 Bacteria 1577
149 Ga0070696_100185281 3300005546 Bacteria 1546
150 Ga0070696_100496929 3300005546 Bacteria 970
151 Ga0070693_100001535 3300005547 Bacteria 10422
152 Ga0070693_100020209 3300005547 Bacteria 3507
153 Ga0070693_100222510 3300005547 Bacteria 1237
154 Ga0070693_100522015 3300005547 Bacteria 846
155 Ga0070665_100000230 3300005548 Bacteria 92897
156 Ga0070665_100268151 3300005548 Bacteria 1709
157 Ga0070704_100169214 3300005549 Bacteria 1736
158 Ga0070704_100251008 3300005549 Bacteria 1453
159 Ga0068855_100194054 3300005563 Bacteria 2289
160 Ga0068855_100518586 3300005563 Bacteria 1293
161 Ga0070664_100003128 3300005564 Bacteria 13373
162 Ga0070664_100044925 3300005564 Bacteria 3731
163 Ga0068857_100028950 3300005577 Unclassified 4888
164 Ga0068857_100128397 3300005577 Bacteria 2285
165 Ga0068857_100171614 3300005577 Bacteria 1971
166 Ga0068857_100334198 3300005577 Bacteria 1401
167 Ga0068857_100757127 3300005577 Bacteria 925
168 Ga0068854_100213503 3300005578 Bacteria 1523
169 Ga0068854_100252460 3300005578 Bacteria 1409
170 Ga0068854_100295212 3300005578 Bacteria 1309
171 Ga0068854_100316143 3300005578 Bacteria 1268
172 Ga0068856_100118567 3300005614 Bacteria 2647
173 Ga0070702_100000473 3300005615 Bacteria 14381
174 Ga0070702_100029276 3300005615 Bacteria 2992
175 Ga0070702_100044997 3300005615 Bacteria 2495
176 Ga0070702_100253628 3300005615 Bacteria 1194
177 Ga0070702_100496674 3300005615 Bacteria 895
178 Ga0068852_100232265 3300005616 Bacteria 1759
179 Ga0068852_100270905 3300005616 Bacteria 1634
180 Ga0068859_100001640 3300005617 Bacteria 22832
181 Ga0068859_100013796 3300005617 Bacteria 8101
182 Ga0068859_100044713 3300005617 Bacteria 4449
183 Ga0068859_100047431 3300005617 Bacteria 4316
184 Ga0068859_100052602 3300005617 Bacteria 4094
185 Ga0068859_100053875 3300005617 Unclassified 4045
186 Ga0068859_100106124 3300005617 Bacteria 2868
187 Ga0068859_100122344 3300005617 Bacteria 2669
188 Ga0068859_100123448 3300005617 Bacteria 2657
189 Ga0068859_100124287 3300005617 Bacteria 2648
190 Ga0068859_100352622 3300005617 Bacteria 1566
191 Ga0068859_100646363 3300005617 Bacteria 1150
192 Ga0068859_100705055 3300005617 Bacteria 1100
193 Ga0068859_100855081 3300005617 Bacteria 996
194 Ga0068864_100000825 3300005618 Bacteria 26108
195 Ga0068864_100005309 3300005618 Bacteria 10549
196 Ga0068864_100053554 3300005618 Bacteria 3481
197 Ga0068864_100110538 3300005618 Bacteria 2448
198 Ga0068864_100160132 3300005618 Bacteria 2046
199 Ga0068864_100271735 3300005618 Bacteria 1580
200 Ga0068864_100307791 3300005618 Bacteria 1485
201 Ga0068864_100562713 3300005618 Bacteria 1103
202 Ga0068866_10007005 3300005718 Bacteria 4712
203 Ga0068861_100034593 3300005719 Bacteria 3737
204 Ga0068861_100240254 3300005719 Bacteria 1540
205 Ga0068851_10000555 3300005834 Bacteria 16260
206 Ga0068870_10033933 3300005840 Bacteria 2608
207 Ga0068870_10098425 3300005840 Bacteria 1648
208 Ga0068870_10274899 3300005840 Bacteria 1054
209 Ga0068863_100001500 3300005841 Bacteria 23101
210 Ga0068863_100018091 3300005841 Bacteria 6748
211 Ga0068863_100019434 3300005841 Bacteria 6498
212 Ga0068863_100035355 3300005841 Bacteria 4759
213 Ga0068863_100066430 3300005841 Bacteria 3411
214 Ga0068863_100121611 3300005841 Bacteria 2490
215 Ga0068863_100165909 3300005841 Bacteria 2118
216 Ga0068863_100227022 3300005841 Bacteria 1800
217 Ga0068863_100304477 3300005841 Bacteria 1546
218 Ga0068863_100413164 3300005841 Bacteria 1321
219 Ga0068863_100506066 3300005841 Bacteria 1190
220 Ga0068858_100007251 3300005842 Bacteria 10740
221 Ga0068858_100020884 3300005842 Bacteria 6120
222 Ga0068858_100074354 3300005842 Bacteria 3155
223 Ga0068858_100101064 3300005842 Bacteria 2689
224 Ga0068858_100110124 3300005842 Bacteria 2571
225 Ga0068858_100155672 3300005842 Bacteria 2150
226 Ga0068860_100005975 3300005843 Bacteria 12253
227 Ga0068860_100029389 3300005843 Bacteria 5286
228 Ga0068860_100052873 3300005843 Bacteria 3863
229 Ga0068860_100076851 3300005843 Bacteria 3175
230 Ga0068860_100090578 3300005843 Bacteria 2913
231 Ga0068860_100108693 3300005843 Bacteria 2651
232 Ga0068860_100217316 3300005843 Bacteria 1855
233 Ga0068860_100220039 3300005843 Bacteria 1844
234 Ga0068860_100426261 3300005843 Bacteria 1316
235 Ga0068860_100548689 3300005843 Bacteria 1158
236 Ga0068862_100018791 3300005844 Bacteria 5759
237 Ga0068862_100033335 3300005844 Bacteria 4352
238 Ga0068862_100042223 3300005844 Bacteria 3884
239 Ga0068862_100052561 3300005844 Bacteria 3486
240 Ga0068862_100216227 3300005844 Bacteria 1734
241 Ga0068862_100265321 3300005844 Bacteria 1569
242 Ga0068862_100389643 3300005844 Bacteria 1301
243 Ga0068862_100502325 3300005844 Bacteria 1151
244 Ga0081539_10000998 3300005985 Bacteria 52505
245 Ga0081539_10002485 3300005985 Bacteria 25925
246 Ga0081539_10038462 3300005985 Bacteria 2835
247 Ga0070717_10269022 3300006028 Bacteria 1509
248 Ga0070717_10631659 3300006028 Bacteria 972
249 Ga0070716_100003957 3300006173 Bacteria 7031
250 Ga0070716_100063527 3300006173 Bacteria 2144
251 Ga0070716_100178437 3300006173 Bacteria 1392
252 Ga0097621_100005562 3300006237 Bacteria 8884
253 Ga0097621_100014904 3300006237 Bacteria 5833
254 Ga0097621_100121270 3300006237 Bacteria 2218
255 Ga0097621_100468784 3300006237 Bacteria 1137
256 Ga0068871_100009782 3300006358 Bacteria 6958
257 Ga0068871_100080977 3300006358 Bacteria 2689
258 Ga0068871_100121502 3300006358 Bacteria 2206
259 Ga0068871_100206536 3300006358 Bacteria 1698
260 Ga0068871_100452034 3300006358 Unclassified 1152
261 Ga0075428_100058601 3300006844 Bacteria 4216
262 Ga0075428_100261641 3300006844 Bacteria 1863
263 Ga0075428_100765214 3300006844 Bacteria 1027
264 Ga0075430_100007319 3300006846 Bacteria 9320
265 Ga0075430_100602672 3300006846 Bacteria 906
266 Ga0075431_100007697 3300006847 Bacteria 10727
267 Ga0075431_100013490 3300006847 Bacteria 8253
268 Ga0075431_100098145 3300006847 Bacteria 3025
269 Ga0075433_10034030 3300006852 Unclassified 4373
270 Ga0075433_10039854 3300006852 Bacteria 4063
271 Ga0075433_10090515 3300006852 Bacteria 2704
272 Ga0075433_10196213 3300006852 Bacteria 1796
273 Ga0075433_10330296 3300006852 Bacteria 1348
274 Ga0075434_100006039 3300006871 Bacteria 11074
275 Ga0075434_100236776 3300006871 Bacteria 1845
276 Ga0075434_100676743 3300006871 Bacteria 1050
277 Ga0075429_100039101 3300006880 Bacteria 4129
278 Ga0075429_100070531 3300006880 Bacteria 3043
279 Ga0068865_100165963 3300006881 Bacteria 1689
280 Ga0068865_100337447 3300006881 Bacteria 1217
281 Ga0097620_100001640 3300006931 Bacteria 22832
282 Ga0097620_100013796 3300006931 Bacteria 8101
283 Ga0097620_100044713 3300006931 Bacteria 4449
284 Ga0097620_100047430 3300006931 Bacteria 4316
285 Ga0097620_100052604 3300006931 Bacteria 4094
286 Ga0097620_100053875 3300006931 Unclassified 4045
287 Ga0097620_100106117 3300006931 Bacteria 2868
288 Ga0097620_100122349 3300006931 Bacteria 2669
289 Ga0097620_100123454 3300006931 Bacteria 2657
290 Ga0097620_100124284 3300006931 Bacteria 2648
291 Ga0097620_100352643 3300006931 Bacteria 1566
292 Ga0097620_100646425 3300006931 Bacteria 1150
293 Ga0097620_100705030 3300006931 Bacteria 1100
294 Ga0097620_100855060 3300006931 Bacteria 996
295 Ga0099794_10082363 3300007265 Bacteria 1588
296 Ga0105251_10143131 3300009011 Bacteria 1081
297 Ga0105240_10054251 3300009093 Bacteria 5024
298 Ga0105240_10090524 3300009093 Bacteria 3739
299 Ga0111539_10011605 3300009094 Bacteria 11056
300 Ga0111539_10016312 3300009094 Bacteria 9209
301 Ga0111539_10031357 3300009094 Bacteria 6457
302 Ga0111539_10036634 3300009094 Bacteria 5929
303 Ga0111539_10076534 3300009094 Bacteria 3940
304 Ga0111539_10113175 3300009094 Bacteria 3183
305 Ga0111539_10321355 3300009094 Bacteria 1801
306 Ga0111539_10376696 3300009094 Bacteria 1652
307 Ga0105245_10478383 3300009098 Bacteria 1258
308 Ga0105245_10537766 3300009098 Bacteria 1189
309 Ga0105247_10005198 3300009101 Bacteria 8229
310 Ga0105247_10036598 3300009101 Bacteria 2992
311 Ga0105247_10049870 3300009101 Bacteria 2575
312 Ga0114129_10005287 3300009147 Bacteria 18217
313 Ga0114129_10006447 3300009147 Bacteria 16640
314 Ga0114129_10017602 3300009147 Bacteria 10173
315 Ga0114129_10037261 3300009147 Bacteria 6867
316 Ga0114129_10042510 3300009147 Bacteria 6400
317 Ga0114129_10061845 3300009147 Bacteria 5233
318 Ga0114129_10187607 3300009147 Bacteria 2809
319 Ga0114129_10380952 3300009147 Bacteria 1863
320 Ga0114129_10451198 3300009147 Bacteria 1686
321 Ga0114129_10554131 3300009147 Bacteria 1495
322 Ga0114129_10757773 3300009147 Bacteria 1242
323 Ga0105243_10100847 3300009148 Bacteria 2396
324 Ga0105243_10127672 3300009148 Bacteria 2153
325 Ga0105243_10203254 3300009148 Bacteria 1739
326 Ga0105243_10235081 3300009148 Bacteria 1628
327 Ga0105243_10745328 3300009148 Bacteria 960
328 Ga0105241_10039659 3300009174 Bacteria 3553
329 Ga0105241_10044938 3300009174 Bacteria 3349
330 Ga0105241_10065877 3300009174 Bacteria 2800
331 Ga0105241_10104947 3300009174 Bacteria 2253
332 Ga0105241_10701208 3300009174 Bacteria 924
333 Ga0105242_10005113 3300009176 Bacteria 10115
334 Ga0105242_10060304 3300009176 Bacteria 3117
335 Ga0105242_10151589 3300009176 Bacteria 2021
336 Ga0105242_10556892 3300009176 Bacteria 1100
337 Ga0105242_10772210 3300009176 Bacteria 948
338 Ga0105248_10000923 3300009177 Bacteria 32713
339 Ga0105248_10003960 3300009177 Bacteria 16380
340 Ga0105248_10014445 3300009177 Bacteria 8692
341 Ga0105248_10047232 3300009177 Bacteria 4828
342 Ga0105248_10129922 3300009177 Bacteria 2842
343 Ga0105248_10155921 3300009177 Bacteria 2576
344 Ga0105248_10354509 3300009177 Bacteria 1652
345 Ga0105248_10959338 3300009177 Bacteria 966
346 Ga0105237_10000218 3300009545 Bacteria 80923
347 Ga0105237_10011434 3300009545 Bacteria 9389
348 Ga0105237_10178050 3300009545 Bacteria 2127
349 Ga0105238_10092159 3300009551 Bacteria 3018
350 Ga0105249_10003176 3300009553 Bacteria 14209
351 Ga0105249_10034069 3300009553 Bacteria 4613
352 Ga0105249_10044740 3300009553 Bacteria 4025
353 Ga0105249_10055470 3300009553 Unclassified 3625
354 Ga0105249_10058526 3300009553 Unclassified 3532
355 Ga0105249_10232042 3300009553 Bacteria 1820
356 Ga0105239_10165519 3300010375 Bacteria 2472
357 Ga0105239_10319551 3300010375 Bacteria 1750
358 Ga0105246_10018528 3300011119 Bacteria 4440
359 Ga0105246_10055733 3300011119 Bacteria 2729
360 Ga0105246_10088330 3300011119 Bacteria 2227
361 Ga0105246_10107953 3300011119 Bacteria 2039
362 Ga0105246_10730061 3300011119 Bacteria 871
363 Ga0157373_10010942 3300013100 Bacteria 6679
364 Ga0157373_10051740 3300013100 Bacteria 2924
365 Ga0157373_10091127 3300013100 Bacteria 2147
366 Ga0157373_10168360 3300013100 Bacteria 1542
367 Ga0157371_10416506 3300013102 Bacteria 984
368 Ga0157374_10038831 3300013296 Bacteria 4378
369 Ga0157374_10098061 3300013296 Bacteria 2805
370 Ga0157378_10004668 3300013297 Bacteria 12018
371 Ga0157378_10176670 3300013297 Bacteria 2006
372 Ga0157378_10314864 3300013297 Bacteria 1519
373 Ga0157378_10322346 3300013297 Unclassified 1501
374 Ga0157378_10429007 3300013297 Bacteria 1308
375 Ga0157378_10544201 3300013297 Bacteria 1165
376 Ga0163162_10001781 3300013306 Bacteria 20195
377 Ga0163162_10008825 3300013306 Bacteria 9803
378 Ga0163162_10044764 3300013306 Bacteria 4433
379 Ga0163162_10049974 3300013306 Bacteria 4193
380 Ga0163162_10058536 3300013306 Bacteria 3883
381 Ga0163162_10145598 3300013306 Bacteria 2485
382 Ga0163162_10648922 3300013306 Bacteria 1179
383 Ga0157372_10075011 3300013307 Bacteria 3815
384 Ga0157372_10157063 3300013307 Bacteria 2627
385 Ga0157372_10334449 3300013307 Bacteria 1764
386 Ga0157372_10561140 3300013307 Bacteria 1331
387 Ga0157375_10002866 3300013308 Bacteria 14936
388 Ga0157375_10006469 3300013308 Bacteria 10208
389 Ga0157375_10011187 3300013308 Bacteria 7916
390 Ga0157375_10074704 3300013308 Unclassified 3412
391 Ga0157375_10105041 3300013308 Bacteria 2914
392 Ga0157375_10196792 3300013308 Bacteria 2171
393 Ga0157375_10385295 3300013308 Bacteria 1568
394 Ga0163163_10018309 3300014325 Bacteria 6553
395 Ga0163163_10023458 3300014325 Bacteria 5856
396 Ga0163163_10028658 3300014325 Bacteria 5351
397 Ga0163163_10046287 3300014325 Bacteria 4274
398 Ga0163163_10160657 3300014325 Bacteria 2292
399 Ga0163163_10169285 3300014325 Bacteria 2231
400 Ga0163163_10484754 3300014325 Bacteria 1298
401 Ga0163163_10873340 3300014325 Bacteria 963
402 Ga0157380_10002595 3300014326 Bacteria 12214
403 Ga0157380_10034080 3300014326 Bacteria 3926
404 Ga0157380_10054555 3300014326 Bacteria 3172
405 Ga0157380_10123618 3300014326 Bacteria 2196
406 Ga0182008_10149629 3300014497 Bacteria 1170
407 Ga0157377_10006185 3300014745 Bacteria 5690
408 Ga0157379_10005330 3300014968 Bacteria 11049
409 Ga0157379_10068429 3300014968 Bacteria 3174
410 Ga0157376_10029406 3300014969 Bacteria 4377
411 Ga0157376_10244358 3300014969 Bacteria 1673
412 Ga0157376_10603084 3300014969 Bacteria 1093
413 Ga0182007_10022345 3300015262 Bacteria 2235
414 Ga0163161_10003079 3300017792 Bacteria 11765
415 Ga0163161_10095342 3300017792 Bacteria 2207
416 Ga0207697_10067017 3300025315 Bacteria 1500
417 Ga0207697_10070197 3300025315 Bacteria 1467
418 Ga0207642_10206582 3300025899 Bacteria 1088
419 Ga0207642_10295722 3300025899 Bacteria 937
420 Ga0207710_10004624 3300025900 Bacteria 5977
421 Ga0207710_10049257 3300025900 Bacteria 1887
422 Ga0207680_10007430 3300025903 Bacteria 5342
423 Ga0207680_10060849 3300025903 Bacteria 2301
424 Ga0207647_10001233 3300025904 Bacteria 19700
425 Ga0207647_10212541 3300025904 Bacteria 1116
426 Ga0207645_10305533 3300025907 Bacteria 1060
427 Ga0207645_10392603 3300025907 Bacteria 932
428 Ga0207643_10001186 3300025908 Bacteria 15432
429 Ga0207643_10283199 3300025908 Bacteria 1028
430 Ga0207643_10308112 3300025908 Bacteria 987
431 Ga0207684_10000316 3300025910 Bacteria 68606
432 Ga0207684_10005331 3300025910 Bacteria 11888
433 Ga0207654_10195678 3300025911 Bacteria 1328
434 Ga0207707_10000004 3300025912 Bacteria 391281
435 Ga0207707_10005000 3300025912 Bacteria 11648
436 Ga0207707_10097962 3300025912 Bacteria 2563
437 Ga0207695_10065520 3300025913 Bacteria 3735
438 Ga0207671_10016678 3300025914 Bacteria 5701
439 Ga0207660_10000663 3300025917 Bacteria 23050
440 Ga0207660_10033981 3300025917 Bacteria 3531
441 Ga0207660_10249043 3300025917 Bacteria 1402
442 Ga0207662_10003060 3300025918 Bacteria 8536
443 Ga0207662_10051065 3300025918 Bacteria 2459
444 Ga0207662_10316967 3300025918 Bacteria 1040
445 Ga0207662_10437528 3300025918 Bacteria 892
446 Ga0207657_10078198 3300025919 Unclassified 2786
447 Ga0207649_10013893 3300025920 Bacteria 4504
448 Ga0207649_10474941 3300025920 Bacteria 947
449 Ga0207649_10635037 3300025920 Bacteria 824
450 Ga0207652_10000122 3300025921 Bacteria 85075
451 Ga0207681_10017438 3300025923 Bacteria 4508
452 Ga0207681_10056293 3300025923 Bacteria 2682
453 Ga0207681_10182647 3300025923 Bacteria 1599
454 Ga0207681_10432691 3300025923 Bacteria 1068
455 Ga0207694_10156946 3300025924 Bacteria 1836
456 Ga0207650_10005336 3300025925 Bacteria 8765
457 Ga0207650_10166958 3300025925 Unclassified 1747
458 Ga0207650_10184360 3300025925 Bacteria 1665
459 Ga0207659_10000399 3300025926 Bacteria 26210
460 Ga0207659_10081710 3300025926 Bacteria 2390
461 Ga0207659_10122322 3300025926 Bacteria 1996
462 Ga0207659_10394881 3300025926 Bacteria 1156
463 Ga0207687_10320410 3300025927 Bacteria 1255
464 Ga0207700_10157786 3300025928 Bacteria 1881
465 Ga0207644_10002495 3300025931 Bacteria 11844
466 Ga0207690_10355947 3300025932 Bacteria 1158
467 Ga0207706_10044205 3300025933 Bacteria 3949
468 Ga0207686_10109908 3300025934 Bacteria 1857
469 Ga0207686_10239792 3300025934 Bacteria 1319
470 Ga0207709_10292395 3300025935 Bacteria 1208
471 Ga0207670_10000411 3300025936 Bacteria 24367
472 Ga0207670_10037155 3300025936 Bacteria 3173
473 Ga0207670_10041388 3300025936 Bacteria 3030
474 Ga0207670_10266514 3300025936 Bacteria 1330
475 Ga0207670_10280522 3300025936 Bacteria 1298
476 Ga0207670_10387280 3300025936 Bacteria 1115
477 Ga0207670_10423140 3300025936 Bacteria 1069
478 Ga0207669_10007531 3300025937 Bacteria 5043
479 Ga0207704_10339398 3300025938 Bacteria 1166
480 Ga0207665_10012015 3300025939 Bacteria 5686
481 Ga0207665_10058611 3300025939 Bacteria 2604
482 Ga0207665_10208437 3300025939 Bacteria 1427
483 Ga0207691_10003290 3300025940 Bacteria 15741
484 Ga0207691_10011110 3300025940 Bacteria 8643
485 Ga0207711_10005506 3300025941 Bacteria 10706
486 Ga0207711_10063753 3300025941 Bacteria 3182
487 Ga0207711_10066225 3300025941 Bacteria 3124
488 Ga0207711_10148123 3300025941 Bacteria 2116
489 Ga0207711_10216578 3300025941 Bacteria 1750
490 Ga0207711_10437982 3300025941 Bacteria 1216
491 Ga0207689_10011916 3300025942 Bacteria 7450
492 Ga0207689_10021032 3300025942 Bacteria 5484
493 Ga0207689_10024611 3300025942 Bacteria 5049
494 Ga0207689_10038335 3300025942 Bacteria 3970
495 Ga0207689_10047449 3300025942 Bacteria 3546
496 Ga0207689_10083075 3300025942 Bacteria 2633
497 Ga0207689_10101870 3300025942 Bacteria 2359
498 Ga0207689_10297933 3300025942 Bacteria 1336
499 Ga0207679_10013118 3300025945 Bacteria 5427
500 Ga0207679_10175986 3300025945 Bacteria 1766
501 Ga0207667_10387545 3300025949 Bacteria 1423
502 Ga0207651_10003295 3300025960 Bacteria 7910
503 Ga0207651_10093098 3300025960 Bacteria 2212
504 Ga0207712_10010766 3300025961 Bacteria 5814
505 Ga0207712_10025329 3300025961 Unclassified 3941
506 Ga0207712_10132187 3300025961 Bacteria 1903
507 Ga0207640_10186870 3300025981 Bacteria 1559
508 Ga0207640_10245573 3300025981 Bacteria 1386
509 Ga0207640_10374597 3300025981 Bacteria 1152
510 Ga0207658_10103898 3300025986 Bacteria 2231
511 Ga0207677_10036800 3300026023 Bacteria 3193
512 Ga0207703_10025587 3300026035 Bacteria 4642
513 Ga0207703_10060750 3300026035 Bacteria 3091
514 Ga0207703_10080476 3300026035 Bacteria 2713
515 Ga0207703_10083997 3300026035 Bacteria 2662
516 Ga0207703_10188099 3300026035 Bacteria 1827
517 Ga0207703_10441453 3300026035 Bacteria 1214
518 Ga0207639_10016962 3300026041 Bacteria 5160
519 Ga0207639_10101215 3300026041 Bacteria 2329
520 Ga0207639_10164249 3300026041 Bacteria 1874
521 Ga0207708_10000893 3300026075 Bacteria 22407
522 Ga0207708_10004419 3300026075 Bacteria 10361
523 Ga0207708_10025777 3300026075 Bacteria 4449
524 Ga0207708_10046525 3300026075 Bacteria 3304
525 Ga0207708_10104090 3300026075 Bacteria 2199
526 Ga0207708_10243157 3300026075 Bacteria 1448
527 Ga0207702_10028260 3300026078 Bacteria 4660
528 Ga0207641_10004793 3300026088 Bacteria 11661
529 Ga0207641_10026373 3300026088 Bacteria 4795
530 Ga0207641_10070011 3300026088 Bacteria 3014
531 Ga0207641_10081235 3300026088 Bacteria 2815
532 Ga0207641_10091125 3300026088 Bacteria 2667
533 Ga0207641_10098894 3300026088 Bacteria 2566
534 Ga0207641_10105283 3300026088 Bacteria 2492
535 Ga0207641_10123874 3300026088 Bacteria 2311
536 Ga0207641_10374137 3300026088 Bacteria 1363
537 Ga0207641_10446878 3300026088 Bacteria 1249
538 Ga0207641_10516689 3300026088 Bacteria 1161
539 Ga0207648_10009088 3300026089 Bacteria 9553
540 Ga0207648_10086912 3300026089 Bacteria 2728
541 Ga0207676_10003355 3300026095 Bacteria 11348
542 Ga0207676_10004979 3300026095 Bacteria 9410
543 Ga0207676_10005472 3300026095 Bacteria 8989
544 Ga0207676_10033255 3300026095 Bacteria 3894
545 Ga0207676_10055814 3300026095 Bacteria 3103
546 Ga0207674_10032263 3300026116 Bacteria 5496
547 Ga0207674_10077289 3300026116 Bacteria 3335
548 Ga0207674_10123766 3300026116 Bacteria 2552
549 Ga0207674_10171499 3300026116 Bacteria 2123
550 Ga0207674_10280357 3300026116 Bacteria 1615
551 Ga0207674_10288441 3300026116 Bacteria 1590
552 Ga0207674_10341450 3300026116 Bacteria 1448
553 Ga0207675_100007196 3300026118 Bacteria 10514
554 Ga0207675_100007484 3300026118 Bacteria 10319
555 Ga0207675_100035880 3300026118 Bacteria 4625
556 Ga0207675_100098352 3300026118 Bacteria 2755
557 Ga0207675_100230960 3300026118 Bacteria 1785
558 Ga0207675_100282590 3300026118 Bacteria 1613
559 Ga0207675_100300054 3300026118 Bacteria 1564
560 Ga0207675_100501634 3300026118 Bacteria 1208
561 Ga0207675_100629896 3300026118 Bacteria 1077
562 Ga0207675_100911370 3300026118 Bacteria 895
563 Ga0207683_10076693 3300026121 Bacteria 2959
564 Ga0207698_10028909 3300026142 Bacteria 3961
565 Ga0207698_10098456 3300026142 Bacteria 2417
566 Ga0207698_10270822 3300026142 Bacteria 1565
567 Ga0207428_10204882 3300027907 Bacteria 1484
568 Ga0207428_10396409 3300027907 Bacteria 1011
569 Ga0207428_10444774 3300027907 Bacteria 945
570 Ga0268266_10000261 3300028379 Bacteria 88643
571 Ga0268266_10185283 3300028379 Bacteria 1898
572 Ga0268266_10200526 3300028379 Bacteria 1826
573 Ga0268265_10023667 3300028380 Bacteria 4333
574 Ga0268265_10140981 3300028380 Bacteria 2018
575 Ga0268265_10202771 3300028380 Bacteria 1722
576 Ga0268265_10207595 3300028380 Bacteria 1704
577 Ga0268265_10363341 3300028380 Bacteria 1326
578 Ga0268264_10027856 3300028381 Bacteria 4619
579 Ga0268264_10052898 3300028381 Bacteria 3387
580 Ga0268264_10102985 3300028381 Bacteria 2485
581 Ga0268264_10112956 3300028381 Bacteria 2382
582 Ga0268264_10205944 3300028381 Bacteria 1803
583 Ga0268264_10220081 3300028381 Bacteria 1747
584 Ga0268264_10310885 3300028381 Bacteria 1487
585 Ga0268264_10347250 3300028381 Bacteria 1411
586 Ga0268264_10361179 3300028381 Bacteria 1385
587 Ga0268264_10379219 3300028381 Bacteria 1354
588 Ga0268264_10551639 3300028381 Bacteria 1130
589 Ga0265337_1001836 3300028556 Bacteria 10180
590 Ga0265337_1010226 3300028556 Bacteria 3298
591 Ga0265326_10026394 3300028558 Bacteria 1657
592 Ga0265319_1064067 3300028563 Bacteria 1187
593 Ga0265323_10000097 3300028653 Bacteria 49698
594 Ga0265323_10013737 3300028653 Bacteria 3222
595 Ga0307515_10336040 3300028794 Bacteria 1166
596 Ga0265338_10000016 3300028800 Bacteria 347424
597 Ga0265338_10000232 3300028800 Bacteria 103731
598 Ga0265338_10005281 3300028800 Bacteria 16905
599 Ga0265338_10005545 3300028800 Bacteria 16427
600 Ga0265338_10007602 3300028800 Bacteria 13385
601 Ga0265338_10035983 3300028800 Bacteria 4747
602 Ga0265338_10038823 3300028800 Bacteria 4503
603 Ga0265338_10159328 3300028800 Bacteria 1745
604 Ga0265338_10280259 3300028800 Bacteria 1218
605 Ga0265338_10408990 3300028800 Bacteria 966
606 Ga0265324_10068547 3300029957 Bacteria 1209
607 Ga0265760_10013119 3300031090 Bacteria 2371
608 Ga0265320_10001236 3300031240 Bacteria 18763
609 Ga0265320_10009064 3300031240 Bacteria 6033
610 Ga0265320_10052101 3300031240 Bacteria 1983
611 Ga0265320_10097828 3300031240 Bacteria 1353
612 Ga0265325_10000042 3300031241 Bacteria 91033
613 Ga0265325_10014953 3300031241 Bacteria 4375
614 Ga0265325_10018801 3300031241 Bacteria 3830
615 Ga0265339_10000302 3300031249 Bacteria 40316
616 Ga0265339_10091895 3300031249 Bacteria 1590
617 Ga0265331_10000263 3300031250 Bacteria 60138
618 Ga0265316_10015217 3300031344 Bacteria 6734
619 Ga0307513_10008983 3300031456 Bacteria 12679
620 Ga0307408_100057479 3300031548 Bacteria 2824
621 Ga0265313_10001034 3300031595 Bacteria 27061
622 Ga0265314_10000097 3300031711 Bacteria 133806
623 Ga0265314_10000174 3300031711 Bacteria 95226
624 Ga0316578_10181623 3300031728 Bacteria 1268
625 Ga0307405_10018892 3300031731 Bacteria 3814
626 Ga0307405_10199311 3300031731 Bacteria 1452
627 Ga0307405_10330087 3300031731 Bacteria 1169
628 Ga0307413_10085385 3300031824 Bacteria 2038
629 Ga0307413_10087983 3300031824 Bacteria 2014
630 Ga0307410_10007344 3300031852 Bacteria 6026
631 Ga0307410_10082588 3300031852 Bacteria 2261
632 Ga0307406_10002514 3300031901 Bacteria 9996
633 Ga0307406_10024430 3300031901 Bacteria 3610
634 Ga0307406_10165423 3300031901 Bacteria 1595
635 Ga0307406_10169958 3300031901 Bacteria 1577
636 Ga0307407_10256752 3300031903 Bacteria 1200
637 Ga0307412_10002080 3300031911 Bacteria 11110
638 Ga0307412_10025337 3300031911 Bacteria 3673
639 Ga0307412_10192334 3300031911 Bacteria 1543
640 Ga0307409_100165845 3300031995 Bacteria 1938
641 Ga0307409_100326972 3300031995 Bacteria 1437
642 Ga0307416_100025872 3300032002 Bacteria 4313
643 Ga0307416_100049632 3300032002 Bacteria 3338
644 Ga0307416_100089595 3300032002 Bacteria 2635
645 Ga0307416_100132058 3300032002 Bacteria 2250
646 Ga0307416_100169989 3300032002 Bacteria 2027
647 Ga0307416_100666323 3300032002 Bacteria 1127
648 Ga0307416_100708963 3300032002 Bacteria 1096
649 Ga0307414_10004245 3300032004 Bacteria 7767
650 Ga0307414_10324357 3300032004 Bacteria 1312
651 Ga0307414_10591221 3300032004 Bacteria 994
652 Ga0307411_10236471 3300032005 Bacteria 1427
653 Ga0307415_100102674 3300032126 Bacteria 2101
654 Ga0307415_100272372 3300032126 Bacteria 1387
655 Ga0373951_0000784 3300035091 Bacteria 8661
656 Ga0373953_0070674 3300035117 Bacteria 1440
657 Ga0373947_0122220 3300035725 Bacteria 1655
658 Ga0373937_0025390 3300036401 Bacteria 5349
659 Ga0395900_0704184 3300037418 Bacteria 943
660 Ga0395898_0272464 3300037466 Bacteria 1614
661 Ga0395905_0016061 3300037471 Bacteria 7117
662 Ga0395901_0299975 3300038443 Bacteria 1666
663 Ga0395901_0371118 3300038443 Bacteria 1474
664 Ga0237819_10661 3300038705 Bacteria 1191
665 Ga0436365_1342320 3300039437 Archaea 3184
666 Ga0436365_1601972 3300039437 Bacteria 65837
667 Ga0436365_1692876 3300039437 Bacteria 39820
668 Ga0436360_0969177 3300039438 Bacteria 796
669 Ga0436362_1089436 3300039453 Bacteria 990
670 Ga0439448_0013726 3300042005 Bacteria 2438
671 Ga0439455_0066004 3300042012 Bacteria 966
672 Ga0439458_0004052 3300042157 Bacteria 3382
673 Ga0439464_0015029 3300042439 Bacteria 2087
674 Ga0453684_0021095 3300044712 Bacteria 9762
675 Ga0451576_0034681 3300045051 Bacteria 5359
676 Ga0451576_0127936 3300045051 Bacteria 2647
677 Ga0451576_0243750 3300045051 Bacteria 1878
678 Ga0451576_0347670 3300045051 Bacteria 1553
679 Ga0451576_0396365 3300045051 Bacteria 1447
680 Ga0451576_0711445 3300045051 Bacteria 1055
681 Ga0451576_0790342 3300045051 Bacteria 997
682 Ga0451576_1045052 3300045051 Bacteria 856
683 Ga0495592_0000108 3300046454 Bacteria 74029
684 Ga0495592_0375978 3300046454 Bacteria 905
685 Ga0495629_0114030 3300046459 Bacteria 1884
686 Ga0495641_0012114 3300046461 Bacteria 4850
687 Ga0495651_0458719 3300046462 Bacteria 822
688 Ga0495653_0224419 3300046463 Bacteria 1261
689 Ga0495580_0443288 3300046472 Bacteria 872
690 Ga0495582_0206792 3300046473 Bacteria 1122
691 Ga0495664_0024623 3300046477 Bacteria 3500
692 Ga0495610_0108444 3300046512 Bacteria 1233
693 Ga0495618_0004563 3300046514 Bacteria 8500
694 Ga0495628_0000042 3300046516 Bacteria 102062
695 Ga0495630_0022398 3300046517 Bacteria 4665
696 Ga0495630_0052706 3300046517 Bacteria 3046
697 Ga0495663_0000564 3300046525 Bacteria 13042
698 Ga0495666_0046772 3300046526 Bacteria 2085
699 Ga0495652_0047434 3300046529 Bacteria 3684
700 Ga0495652_0066622 3300046529 Bacteria 3021
701 Ga0495640_0045708 3300046533 Bacteria 3038
702 Ga0495640_0056175 3300046533 Bacteria 2690
703 Ga0495586_0002436 3300046535 Bacteria 10094
704 Ga0495586_0004253 3300046535 Bacteria 7656
705 Ga0495598_0000356 3300046537 Bacteria 8179
706 Ga0495598_0032446 3300046537 Bacteria 1476
707 Ga0495621_0000389 3300046539 Bacteria 10778
708 Ga0495621_0131303 3300046539 Bacteria 975
709 Ga0495645_0020490 3300046543 Bacteria 4772
710 Ga0495668_0112363 3300046616 Bacteria 1490
711 Ga0495634_0119264 3300046642 Bacteria 1690
712 Ga0495634_0244028 3300046642 Bacteria 1101
713 Ga0495599_0045099 3300046678 Bacteria 2764
714 Ga0495658_0007587 3300046683 Bacteria 5378
715 Ga0495658_0014788 3300046683 Bacteria 3992
716 Ga0495669_0188376 3300046684 Bacteria 984
717 Ga0495613_0004554 3300046689 Bacteria 10399
718 Ga0495624_0031700 3300046690 Bacteria 3433
719 Ga0495636_0045462 3300047318 Bacteria 1830
720 Ga0495674_0003775 3300047319 Bacteria 14733
721 Ga0495672_0083295 3300047320 Bacteria 1777
722 Ga0495684_0427787 3300047471 Bacteria 924
723 Ga0495614_0114427 3300048089 Bacteria 1186
724 Ga0496102_0872152 3300048905 Bacteria 822
725 Ga0496104_0390471 3300048907 Bacteria 1304
726 Ga0496104_0441127 3300048907 Bacteria 1214
727 Ga0496104_0482277 3300048907 Bacteria 1151
728 Ga0496110_0133586 3300048913 Bacteria 2242
729 Ga0496110_0149430 3300048913 Bacteria 2115
730 Ga0496110_0194284 3300048913 Bacteria 1843
731 Ga0496110_0347630 3300048913 Bacteria 1351
732 Ga0496112_0216087 3300048915 Bacteria 1874
733 Ga0496112_0280047 3300048915 Bacteria 1615
734 Ga0496112_0473156 3300048915 Bacteria 1190
735 Ga0496113_0179342 3300048916 Bacteria 1679
736 Ga0496113_0190488 3300048916 Bacteria 1628
737 Ga0496114_0084095 3300048917 Bacteria 2694
738 Ga0496115_0159387 3300048918 Bacteria 1865
739 Ga0501291_012740 3300049514 Bacteria 1233
740 Ga0501298_021689 3300049521 Bacteria 1204
741 Ga0501299_009411 3300049522 Bacteria 1610
742 Ga0501038_0083525 3300049574 Bacteria 2688
743 Ga0501072_0383166 3300049588 Bacteria 1116
744 Ga0501072_0535289 3300049588 Bacteria 926
745 Ga0501075_0321137 3300049591 Bacteria 1180
746 Ga0501198_006491 3300049649 Bacteria 1667
747 Ga0501202_017426 3300049652 Bacteria 1403
748 Ga0501202_024827 3300049652 Bacteria 1217
749 Ga0501207_004036 3300049654 Bacteria 1983
750 Ga0501207_031555 3300049654 Bacteria 892
751 Ga0501208_007855 3300049655 Bacteria 1418
752 Ga0501216_000457 3300049660 Bacteria 4847
753 Ga0501216_039691 3300049660 Bacteria 896
754 Ga0501217_014590 3300049661 Bacteria 1777
755 Ga0501217_022049 3300049661 Bacteria 1508
756 Ga0501217_048016 3300049661 Bacteria 1107
757 Ga0501223_016864 3300049663 Bacteria 1443
758 Ga0501227_001051 3300049665 Bacteria 6141
759 Ga0501227_046686 3300049665 Bacteria 1083
760 Ga0501233_008087 3300049668 Bacteria 2020
761 Ga0501239_018602 3300049672 Bacteria 836
762 Ga0501240_006135 3300049673 Bacteria 1468
763 Ga0501249_016541 3300049679 Bacteria 1585
764 Ga0501249_017482 3300049679 Bacteria 1546
765 Ga0501257_018160 3300049686 Bacteria 1639
766 Ga0501260_000597 3300049689 Bacteria 2788
767 Ga0501225_0002911 3300049705 Bacteria 5255
768 Ga0501225_0009704 3300049705 Bacteria 2738
769 Ga0501234_003183 3300049707 Bacteria 2582
770 Ga0501079_0172852 3300049741 Bacteria 1685
771 Ga0501080_0026430 3300049742 Bacteria 5394
772 Ga0501279_008181 3300049775 Bacteria 1396
773 Ga0501035_0502808 3300049822 Bacteria 997
774 Ga0501212_003761 3300049851 Bacteria 1925
775 Ga0501212_019577 3300049851 Bacteria 1037
776 nmdc:mga05p37_181368_c1 3300050507 Bacteria 2561
777 nmdc:mga05p37_24798_c1 3300050507 Bacteria 7290
778 nmdc:mga05p37_343342_c1 3300050507 Bacteria 1760
779 nmdc:mga05p37_351208_c1 3300050507 Bacteria 1736
780 nmdc:mga05p37_600446_c1 3300050507 Bacteria 1242
781 nmdc:mga05p37_65634_c1 3300050507 Bacteria 4465
782 nmdc:mga05p37_663448_c1 3300050507 Bacteria 1165
783 nmdc:mga05p37_79382_c1 3300050507 Bacteria 4041
784 nmdc:mga05p37_98916_c1 3300050507 Bacteria 3593
785 nmdc:mga09592_135250_c1 3300050508 Bacteria 2123
786 nmdc:mga09592_96275_c1 3300050508 Bacteria 2532
787 nmdc:mga0qj67_287075_c1 3300050509 Bacteria 1334
788 nmdc:mga0qj67_539443_c1 3300050509 Bacteria 936
789 nmdc:mga06r32_133410_c1 3300050510 Bacteria 2457
790 nmdc:mga06r32_690289_c1 3300050510 Bacteria 987
791 nmdc:mga08y16_183991_c1 3300050511 Bacteria 2168
792 nmdc:mga08y16_20316_c1 3300050511 Bacteria 7011
793 nmdc:mga08y16_5518_c1 3300050511 Bacteria 13237
794 nmdc:mga08y16_8906_c1 3300050511 Bacteria 7963
795 nmdc:mga0n895_228132_c1 3300050512 Bacteria 1890
796 nmdc:mga0n895_415840_c1 3300050512 Bacteria 1359
797 nmdc:mga0n895_455996_c1 3300050512 Bacteria 1290
798 nmdc:mga0n895_694379_c1 3300050512 Bacteria 1014
799 nmdc:mga0n895_8528_c1 3300050512 Bacteria 8881
800 nmdc:mga0rr50_10199_c1 3300050513 Bacteria 5948
801 nmdc:mga0a205_158003_c1 3300050515 Bacteria 2165
802 nmdc:mga0a205_174264_c1 3300050515 Bacteria 2047
803 nmdc:mga0a205_266503_c1 3300050515 Bacteria 1590
804 nmdc:mga0a205_31488_c1 3300050515 Bacteria 5081
805 nmdc:mga0a205_500501_c1 3300050515 Bacteria 1072
806 nmdc:mga0a205_52839_c1 3300050515 Bacteria 3921
807 nmdc:mga0a205_62094_c1 3300050515 Bacteria 3610
808 Ga0495601_0212439 3300053077 Bacteria 1264
809 Ga0495619_0318222 3300053085 Bacteria 1077
810 2673164051 2671180531 Bacteria 9045424
811 Ga0070698_100051817
812 CNAas_1000805
813 JGI25406J46586_10016376
814 rootL2_10129164
815 Ga0065714_10064478
816 Ga0065704_10004781
817 Ga0065704_10126348
818 Ga0065712_10000121
819 Ga0065712_10140325
820 Ga0065715_10006611
821 Ga0065715_10089388
822 Ga0065715_10098705
823 Ga0065715_10101842
824 Ga0065715_10112357
825 Ga0065715_10136770
826 Ga0065715_10145009
827 Ga0065707_10003321
828 Ga0065707_10020581
829 Ga0065707_10111190
830 Ga0065707_10295966
831 Ga0070676_10356829
832 Ga0070690_100070610
833 Ga0070690_100082607
834 Ga0070690_100104446
835 Ga0070690_100309197
836 Ga0070670_100104522
837 Ga0070670_100227768
838 Ga0068869_100003799
839 Ga0068869_100009108
840 Ga0068869_100041526
841 Ga0068869_100044898
842 Ga0068869_100049261
843 Ga0068869_100253402
844 Ga0068869_100367488
845 Ga0068869_100438974
846 Ga0068869_100475233
847 Ga0070666_10034069
848 Ga0070666_10074404
849 Ga0070666_10102411
850 Ga0070680_100000433
851 Ga0070680_100198106
852 Ga0070680_100385496
853 Ga0070682_100000058
854 Ga0070660_100024967
855 Ga0070689_100001007
856 Ga0070689_100037584
857 Ga0070689_100041872
858 Ga0070689_100165502
859 Ga0070689_100232900
860 Ga0070689_100305920
861 Ga0070689_100435634
862 Ga0070689_100460575
863 Ga0070687_100039901
864 Ga0070661_100207699
865 Ga0070692_10000272
866 Ga0070692_10069774
867 Ga0070692_10103212
868 Ga0070669_100008036
869 Ga0070669_100032842
870 Ga0070669_100100847
871 Ga0070669_100124198
872 Ga0070669_100227629
873 Ga0070669_100313527
874 Ga0070675_100002860
875 Ga0070675_100081360
876 Ga0070675_100138495
877 Ga0070675_100215909
878 Ga0070675_100338952
879 Ga0070675_100605599
880 Ga0070671_100002033
881 Ga0070671_100013754
882 Ga0070671_100249282
883 Ga0070674_100016675
884 Ga0070673_100000496
885 Ga0070673_100104148
886 Ga0070688_100003628
887 Ga0070688_100074403
888 Ga0070688_100409403
889 Ga0070667_100031073
890 Ga0070667_100063028
891 Ga0070701_10040303
892 Ga0070701_10077989
893 Ga0070705_100090987
894 Ga0070705_100105553
895 Ga0070700_100005787
896 Ga0070700_100006168
897 Ga0070700_100072502
898 Ga0070700_100088629
899 Ga0070694_100011013
900 Ga0070694_100021105
901 Ga0070694_100085452
902 Ga0070694_100090937
903 Ga0070694_100093284
904 Ga0070694_100146242
905 Ga0070694_100184802
906 Ga0070694_100234719
907 Ga0070694_100303017
908 Ga0070694_100304625
909 Ga0070708_100163193
910 Ga0070708_100328228
911 Ga0070708_100569082
912 Ga0070678_100085239
913 Ga0070662_100011430
914 Ga0070662_100044935
915 Ga0070662_100162457
916 Ga0070662_100310618
917 Ga0070662_100723602
918 Ga0070681_10000065
919 Ga0070681_10000347
920 Ga0070681_10002491
921 Ga0070681_10060954
922 Ga0070681_10400322
923 Ga0068867_100015337
924 Ga0068867_100205084
925 Ga0070685_10150419
926 Ga0070706_100003255
927 Ga0070706_100003761
928 Ga0070706_100026557
929 Ga0070706_100042282
930 Ga0070706_100132750
931 Ga0070698_100005396
932 Ga0070698_100030706
933 Ga0070698_100187471
934 Ga0070699_100002201
935 Ga0070699_100018455
936 Ga0070679_100000013
937 Ga0070679_100029337
938 Ga0070679_100069085
939 Ga0070679_100549859
940 Ga0070697_100000014
941 Ga0070697_100000543
942 Ga0070697_100031063
943 Ga0070697_100305682
944 Ga0068853_100031259
945 Ga0068853_100046493
946 Ga0068853_100176795
947 Ga0068853_100252655
948 Ga0070672_100071245
949 Ga0070672_100076676
950 Ga0070686_100014980
951 Ga0070686_100121611
952 Ga0070686_100566726
953 Ga0070695_100076474
954 Ga0070695_100104966
955 Ga0070695_100328942
956 Ga0070696_100032210
957 Ga0070696_100079149
958 Ga0070696_100177875
959 Ga0070696_100185281
960 Ga0070696_100496929
961 Ga0070693_100001535
962 Ga0070693_100020209
963 Ga0070693_100222510
964 Ga0070693_100522015
965 Ga0070665_100000230
966 Ga0070665_100268151
967 Ga0070704_100169214
968 Ga0070704_100251008
969 Ga0068855_100194054
970 Ga0068855_100518586
971 Ga0070664_100003128
972 Ga0070664_100044925
973 Ga0068857_100028950
974 Ga0068857_100128397
975 Ga0068857_100171614
976 Ga0068857_100334198
977 Ga0068857_100757127
978 Ga0068854_100213503
979 Ga0068854_100252460
980 Ga0068854_100295212
981 Ga0068854_100316143
982 Ga0068856_100118567
983 Ga0070702_100000473
984 Ga0070702_100029276
985 Ga0070702_100044997
986 Ga0070702_100253628
987 Ga0070702_100496674
988 Ga0068852_100232265
989 Ga0068852_100270905
990 Ga0068859_100001640
991 Ga0068859_100013796
992 Ga0068859_100044713
993 Ga0068859_100047431
994 Ga0068859_100052602
995 Ga0068859_100053875
996 Ga0068859_100106124
997 Ga0068859_100122344
998 Ga0068859_100123448
999 Ga0068859_100124287
1000 Ga0068859_100352622
1001 Ga0068859_100646363
1002 Ga0068859_100705055
1003 Ga0068859_100855081
1004 Ga0068864_100000825
1005 Ga0068864_100005309
1006 Ga0068864_100053554
1007 Ga0068864_100110538
1008 Ga0068864_100160132
1009 Ga0068864_100271735
1010 Ga0068864_100307791
1011 Ga0068864_100562713
1012 Ga0068866_10007005
1013 Ga0068861_100034593
1014 Ga0068861_100240254
1015 Ga0068851_10000555
1016 Ga0068870_10033933
1017 Ga0068870_10098425
1018 Ga0068870_10274899
1019 Ga0068863_100001500
1020 Ga0068863_100018091
1021 Ga0068863_100019434
1022 Ga0068863_100035355
1023 Ga0068863_100066430
1024 Ga0068863_100121611
1025 Ga0068863_100165909
1026 Ga0068863_100227022
1027 Ga0068863_100304477
1028 Ga0068863_100413164
1029 Ga0068863_100506066
1030 Ga0068858_100007251
1031 Ga0068858_100020884
1032 Ga0068858_100074354
1033 Ga0068858_100101064
1034 Ga0068858_100110124
1035 Ga0068858_100155672
1036 Ga0068860_100005975
1037 Ga0068860_100029389
1038 Ga0068860_100052873
1039 Ga0068860_100076851
1040 Ga0068860_100090578
1041 Ga0068860_100108693
1042 Ga0068860_100217316
1043 Ga0068860_100220039
1044 Ga0068860_100426261
1045 Ga0068860_100548689
1046 Ga0068862_100018791
1047 Ga0068862_100033335
1048 Ga0068862_100042223
1049 Ga0068862_100052561
1050 Ga0068862_100216227
1051 Ga0068862_100265321
1052 Ga0068862_100389643
1053 Ga0068862_100502325
1054 Ga0081539_10000998
1055 Ga0081539_10002485
1056 Ga0081539_10038462
1057 Ga0070717_10269022
1058 Ga0070717_10631659
1059 Ga0070716_100003957
1060 Ga0070716_100063527
1061 Ga0070716_100178437
1062 Ga0097621_100005562
1063 Ga0097621_100014904
1064 Ga0097621_100121270
1065 Ga0097621_100468784
1066 Ga0068871_100009782
1067 Ga0068871_100080977
1068 Ga0068871_100121502
1069 Ga0068871_100206536
1070 Ga0068871_100452034
1071 Ga0075428_100058601
1072 Ga0075428_100261641
1073 Ga0075428_100765214
1074 Ga0075430_100007319
1075 Ga0075430_100602672
1076 Ga0075431_100007697
1077 Ga0075431_100013490
1078 Ga0075431_100098145
1079 Ga0075433_10034030
1080 Ga0075433_10039854
1081 Ga0075433_10090515
1082 Ga0075433_10196213
1083 Ga0075433_10330296
1084 Ga0075434_100006039
1085 Ga0075434_100236776
1086 Ga0075434_100676743
1087 Ga0075429_100039101
1088 Ga0075429_100070531
1089 Ga0068865_100165963
1090 Ga0068865_100337447
1091 Ga0097620_100001640
1092 Ga0097620_100013796
1093 Ga0097620_100044713
1094 Ga0097620_100047430
1095 Ga0097620_100052604
1096 Ga0097620_100053875
1097 Ga0097620_100106117
1098 Ga0097620_100122349
1099 Ga0097620_100123454
1100 Ga0097620_100124284
1101 Ga0097620_100352643
1102 Ga0097620_100646425
1103 Ga0097620_100705030
1104 Ga0097620_100855060
1105 Ga0099794_10082363
1106 Ga0105251_10143131
1107 Ga0105240_10054251
1108 Ga0105240_10090524
1109 Ga0111539_10011605
1110 Ga0111539_10016312
1111 Ga0111539_10031357
1112 Ga0111539_10036634
1113 Ga0111539_10076534
1114 Ga0111539_10113175
1115 Ga0111539_10321355
1116 Ga0111539_10376696
1117 Ga0105245_10478383
1118 Ga0105245_10537766
1119 Ga0105247_10005198
1120 Ga0105247_10036598
1121 Ga0105247_10049870
1122 Ga0114129_10005287
1123 Ga0114129_10006447
1124 Ga0114129_10017602
1125 Ga0114129_10037261
1126 Ga0114129_10042510
1127 Ga0114129_10061845
1128 Ga0114129_10187607
1129 Ga0114129_10380952
1130 Ga0114129_10451198
1131 Ga0114129_10554131
1132 Ga0114129_10757773
1133 Ga0105243_10100847
1134 Ga0105243_10127672
1135 Ga0105243_10203254
1136 Ga0105243_10235081
1137 Ga0105243_10745328
1138 Ga0105241_10039659
1139 Ga0105241_10044938
1140 Ga0105241_10065877
1141 Ga0105241_10104947
1142 Ga0105241_10701208
1143 Ga0105242_10005113
1144 Ga0105242_10060304
1145 Ga0105242_10151589
1146 Ga0105242_10556892
1147 Ga0105242_10772210
1148 Ga0105248_10000923
1149 Ga0105248_10003960
1150 Ga0105248_10014445
1151 Ga0105248_10047232
1152 Ga0105248_10129922
1153 Ga0105248_10155921
1154 Ga0105248_10354509
1155 Ga0105248_10959338
1156 Ga0105237_10000218
1157 Ga0105237_10011434
1158 Ga0105237_10178050
1159 Ga0105238_10092159
1160 Ga0105249_10003176
1161 Ga0105249_10034069
1162 Ga0105249_10044740
1163 Ga0105249_10055470
1164 Ga0105249_10058526
1165 Ga0105249_10232042
1166 Ga0105239_10165519
1167 Ga0105239_10319551
1168 Ga0105246_10018528
1169 Ga0105246_10055733
1170 Ga0105246_10088330
1171 Ga0105246_10107953
1172 Ga0105246_10730061
1173 Ga0157373_10010942
1174 Ga0157373_10051740
1175 Ga0157373_10091127
1176 Ga0157373_10168360
1177 Ga0157371_10416506
1178 Ga0157374_10038831
1179 Ga0157374_10098061
1180 Ga0157378_10004668
1181 Ga0157378_10176670
1182 Ga0157378_10314864
1183 Ga0157378_10322346
1184 Ga0157378_10429007
1185 Ga0157378_10544201
1186 Ga0163162_10001781
1187 Ga0163162_10008825
1188 Ga0163162_10044764
1189 Ga0163162_10049974
1190 Ga0163162_10058536
1191 Ga0163162_10145598
1192 Ga0163162_10648922
1193 Ga0157372_10075011
1194 Ga0157372_10157063
1195 Ga0157372_10334449
1196 Ga0157372_10561140
1197 Ga0157375_10002866
1198 Ga0157375_10006469
1199 Ga0157375_10011187
1200 Ga0157375_10074704
1201 Ga0157375_10105041
1202 Ga0157375_10196792
1203 Ga0157375_10385295
1204 Ga0163163_10018309
1205 Ga0163163_10023458
1206 Ga0163163_10028658
1207 Ga0163163_10046287
1208 Ga0163163_10160657
1209 Ga0163163_10169285
1210 Ga0163163_10484754
1211 Ga0163163_10873340
1212 Ga0157380_10002595
1213 Ga0157380_10034080
1214 Ga0157380_10054555
1215 Ga0157380_10123618
1216 Ga0182008_10149629
1217 Ga0157377_10006185
1218 Ga0157379_10005330
1219 Ga0157379_10068429
1220 Ga0157376_10029406
1221 Ga0157376_10244358
1222 Ga0157376_10603084
1223 Ga0182007_10022345
1224 Ga0163161_10003079
1225 Ga0163161_10095342
1226 Ga0207697_10067017
1227 Ga0207697_10070197
1228 Ga0207642_10206582
1229 Ga0207642_10295722
1230 Ga0207710_10004624
1231 Ga0207710_10049257
1232 Ga0207680_10007430
1233 Ga0207680_10060849
1234 Ga0207647_10001233
1235 Ga0207647_10212541
1236 Ga0207645_10305533
1237 Ga0207645_10392603
1238 Ga0207643_10001186
1239 Ga0207643_10283199
1240 Ga0207643_10308112
1241 Ga0207684_10000316
1242 Ga0207684_10005331
1243 Ga0207654_10195678
1244 Ga0207707_10000004
1245 Ga0207707_10005000
1246 Ga0207707_10097962
1247 Ga0207695_10065520
1248 Ga0207671_10016678
1249 Ga0207660_10000663
1250 Ga0207660_10033981
1251 Ga0207660_10249043
1252 Ga0207662_10003060
1253 Ga0207662_10051065
1254 Ga0207662_10316967
1255 Ga0207662_10437528
1256 Ga0207657_10078198
1257 Ga0207649_10013893
1258 Ga0207649_10474941
1259 Ga0207649_10635037
1260 Ga0207652_10000122
1261 Ga0207681_10017438
1262 Ga0207681_10056293
1263 Ga0207681_10182647
1264 Ga0207681_10432691
1265 Ga0207694_10156946
1266 Ga0207650_10005336
1267 Ga0207650_10166958
1268 Ga0207650_10184360
1269 Ga0207659_10000399
1270 Ga0207659_10081710
1271 Ga0207659_10122322
1272 Ga0207659_10394881
1273 Ga0207687_10320410
1274 Ga0207700_10157786
1275 Ga0207644_10002495
1276 Ga0207690_10355947
1277 Ga0207706_10044205
1278 Ga0207686_10109908
1279 Ga0207686_10239792
1280 Ga0207709_10292395
1281 Ga0207670_10000411
1282 Ga0207670_10037155
1283 Ga0207670_10041388
1284 Ga0207670_10266514
1285 Ga0207670_10280522
1286 Ga0207670_10387280
1287 Ga0207670_10423140
1288 Ga0207669_10007531
1289 Ga0207704_10339398
1290 Ga0207665_10012015
1291 Ga0207665_10058611
1292 Ga0207665_10208437
1293 Ga0207691_10003290
1294 Ga0207691_10011110
1295 Ga0207711_10005506
1296 Ga0207711_10063753
1297 Ga0207711_10066225
1298 Ga0207711_10148123
1299 Ga0207711_10216578
1300 Ga0207711_10437982
1301 Ga0207689_10011916
1302 Ga0207689_10021032
1303 Ga0207689_10024611
1304 Ga0207689_10038335
1305 Ga0207689_10047449
1306 Ga0207689_10083075
1307 Ga0207689_10101870
1308 Ga0207689_10297933
1309 Ga0207679_10013118
1310 Ga0207679_10175986
1311 Ga0207667_10387545
1312 Ga0207651_10003295
1313 Ga0207651_10093098
1314 Ga0207712_10010766
1315 Ga0207712_10025329
1316 Ga0207712_10132187
1317 Ga0207640_10186870
1318 Ga0207640_10245573
1319 Ga0207640_10374597
1320 Ga0207658_10103898
1321 Ga0207677_10036800
1322 Ga0207703_10025587
1323 Ga0207703_10060750
1324 Ga0207703_10080476
1325 Ga0207703_10083997
1326 Ga0207703_10188099
1327 Ga0207703_10441453
1328 Ga0207639_10016962
1329 Ga0207639_10101215
1330 Ga0207639_10164249
1331 Ga0207708_10000893
1332 Ga0207708_10004419
1333 Ga0207708_10025777
1334 Ga0207708_10046525
1335 Ga0207708_10104090
1336 Ga0207708_10243157
1337 Ga0207702_10028260
1338 Ga0207641_10004793
1339 Ga0207641_10026373
1340 Ga0207641_10070011
1341 Ga0207641_10081235
1342 Ga0207641_10091125
1343 Ga0207641_10098894
1344 Ga0207641_10105283
1345 Ga0207641_10123874
1346 Ga0207641_10374137
1347 Ga0207641_10446878
1348 Ga0207641_10516689
1349 Ga0207648_10009088
1350 Ga0207648_10086912
1351 Ga0207676_10003355
1352 Ga0207676_10004979
1353 Ga0207676_10005472
1354 Ga0207676_10033255
1355 Ga0207676_10055814
1356 Ga0207674_10032263
1357 Ga0207674_10077289
1358 Ga0207674_10123766
1359 Ga0207674_10171499
1360 Ga0207674_10280357
1361 Ga0207674_10288441
1362 Ga0207674_10341450
1363 Ga0207675_100007196
1364 Ga0207675_100007484
1365 Ga0207675_100035880
1366 Ga0207675_100098352
1367 Ga0207675_100230960
1368 Ga0207675_100282590
1369 Ga0207675_100300054
1370 Ga0207675_100501634
1371 Ga0207675_100629896
1372 Ga0207675_100911370
1373 Ga0207683_10076693
1374 Ga0207698_10028909
1375 Ga0207698_10098456
1376 Ga0207698_10270822
1377 Ga0207428_10204882
1378 Ga0207428_10396409
1379 Ga0207428_10444774
1380 Ga0268266_10000261
1381 Ga0268266_10185283
1382 Ga0268266_10200526
1383 Ga0268265_10023667
1384 Ga0268265_10140981
1385 Ga0268265_10202771
1386 Ga0268265_10207595
1387 Ga0268265_10363341
1388 Ga0268264_10027856
1389 Ga0268264_10052898
1390 Ga0268264_10102985
1391 Ga0268264_10112956
1392 Ga0268264_10205944
1393 Ga0268264_10220081
1394 Ga0268264_10310885
1395 Ga0268264_10347250
1396 Ga0268264_10361179
1397 Ga0268264_10379219
1398 Ga0268264_10551639
1399 Ga0265337_1001836
1400 Ga0265337_1010226
1401 Ga0265326_10026394
1402 Ga0265319_1064067
1403 Ga0265323_10000097
1404 Ga0265323_10013737
1405 Ga0307515_10336040
1406 Ga0265338_10000016
1407 Ga0265338_10000232
1408 Ga0265338_10005281
1409 Ga0265338_10005545
1410 Ga0265338_10007602
1411 Ga0265338_10035983
1412 Ga0265338_10038823
1413 Ga0265338_10159328
1414 Ga0265338_10280259
1415 Ga0265338_10408990
1416 Ga0265324_10068547
1417 Ga0265760_10013119
1418 Ga0265320_10001236
1419 Ga0265320_10009064
1420 Ga0265320_10052101
1421 Ga0265320_10097828
1422 Ga0265325_10000042
1423 Ga0265325_10014953
1424 Ga0265325_10018801
1425 Ga0265339_10000302
1426 Ga0265339_10091895
1427 Ga0265331_10000263
1428 Ga0265316_10015217
1429 Ga0307513_10008983
1430 Ga0307408_100057479
1431 Ga0265313_10001034
1432 Ga0265314_10000097
1433 Ga0265314_10000174
1434 Ga0316578_10181623
1435 Ga0307405_10018892
1436 Ga0307405_10199311
1437 Ga0307405_10330087
1438 Ga0307413_10085385
1439 Ga0307413_10087983
1440 Ga0307410_10007344
1441 Ga0307410_10082588
1442 Ga0307406_10002514
1443 Ga0307406_10024430
1444 Ga0307406_10165423
1445 Ga0307406_10169958
1446 Ga0307407_10256752
1447 Ga0307412_10002080
1448 Ga0307412_10025337
1449 Ga0307412_10192334
1450 Ga0307409_100165845
1451 Ga0307409_100326972
1452 Ga0307416_100025872
1453 Ga0307416_100049632
1454 Ga0307416_100089595
1455 Ga0307416_100132058
1456 Ga0307416_100169989
1457 Ga0307416_100666323
1458 Ga0307416_100708963
1459 Ga0307414_10004245
1460 Ga0307414_10324357
1461 Ga0307414_10591221
1462 Ga0307411_10236471
1463 Ga0307415_100102674
1464 Ga0307415_100272372
1465 Ga0373951_0000784
1466 Ga0373953_0070674
1467 Ga0373947_0122220
1468 Ga0373937_0025390
1469 Ga0395900_0704184
1470 Ga0395898_0272464
1471 Ga0395905_0016061
1472 Ga0395901_0299975
1473 Ga0395901_0371118
1474 Ga0237819_10661
1475 Ga0436365_1342320
1476 Ga0436365_1601972
1477 Ga0436365_1692876
1478 Ga0436360_0969177
1479 Ga0436362_1089436
1480 Ga0439448_0013726
1481 Ga0439455_0066004
1482 Ga0439458_0004052
1483 Ga0439464_0015029
1484 Ga0453684_0021095
1485 Ga0451576_0034681
1486 Ga0451576_0127936
1487 Ga0451576_0243750
1488 Ga0451576_0347670
1489 Ga0451576_0396365
1490 Ga0451576_0711445
1491 Ga0451576_0790342
1492 Ga0451576_1045052
1493 Ga0495592_0000108
1494 Ga0495592_0375978
1495 Ga0495629_0114030
1496 Ga0495641_0012114
1497 Ga0495651_0458719
1498 Ga0495653_0224419
1499 Ga0495580_0443288
1500 Ga0495582_0206792
1501 Ga0495664_0024623
1502 Ga0495610_0108444
1503 Ga0495618_0004563
1504 Ga0495628_0000042
1505 Ga0495630_0022398
1506 Ga0495630_0052706
1507 Ga0495663_0000564
1508 Ga0495666_0046772
1509 Ga0495652_0047434
1510 Ga0495652_0066622
1511 Ga0495640_0045708
1512 Ga0495640_0056175
1513 Ga0495586_0002436
1514 Ga0495586_0004253
1515 Ga0495598_0000356
1516 Ga0495598_0032446
1517 Ga0495621_0000389
1518 Ga0495621_0131303
1519 Ga0495645_0020490
1520 Ga0495668_0112363
1521 Ga0495634_0119264
1522 Ga0495634_0244028
1523 Ga0495599_0045099
1524 Ga0495658_0007587
1525 Ga0495658_0014788
1526 Ga0495669_0188376
1527 Ga0495613_0004554
1528 Ga0495624_0031700
1529 Ga0495636_0045462
1530 Ga0495674_0003775
1531 Ga0495672_0083295
1532 Ga0495684_0427787
1533 Ga0495614_0114427
1534 Ga0496102_0872152
1535 Ga0496104_0390471
1536 Ga0496104_0441127
1537 Ga0496104_0482277
1538 Ga0496110_0133586
1539 Ga0496110_0149430
1540 Ga0496110_0194284
1541 Ga0496110_0347630
1542 Ga0496112_0216087
1543 Ga0496112_0280047
1544 Ga0496112_0473156
1545 Ga0496113_0179342
1546 Ga0496113_0190488
1547 Ga0496114_0084095
1548 Ga0496115_0159387
1549 Ga0501291_012740
1550 Ga0501298_021689
1551 Ga0501299_009411
1552 Ga0501038_0083525
1553 Ga0501072_0383166
1554 Ga0501072_0535289
1555 Ga0501075_0321137
1556 Ga0501198_006491
1557 Ga0501202_017426
1558 Ga0501202_024827
1559 Ga0501207_004036
1560 Ga0501207_031555
1561 Ga0501208_007855
1562 Ga0501216_000457
1563 Ga0501216_039691
1564 Ga0501217_014590
1565 Ga0501217_022049
1566 Ga0501217_048016
1567 Ga0501223_016864
1568 Ga0501227_001051
1569 Ga0501227_046686
1570 Ga0501233_008087
1571 Ga0501239_018602
1572 Ga0501240_006135
1573 Ga0501249_016541
1574 Ga0501249_017482
1575 Ga0501257_018160
1576 Ga0501260_000597
1577 Ga0501225_0002911
1578 Ga0501225_0009704
1579 Ga0501234_003183
1580 Ga0501079_0172852
1581 Ga0501080_0026430
1582 Ga0501279_008181
1583 Ga0501035_0502808
1584 Ga0501212_003761
1585 Ga0501212_019577
1586 nmdc:mga05p37_181368_c1
1587 nmdc:mga05p37_24798_c1
1588 nmdc:mga05p37_343342_c1
1589 nmdc:mga05p37_351208_c1
1590 nmdc:mga05p37_600446_c1
1591 nmdc:mga05p37_65634_c1
1592 nmdc:mga05p37_663448_c1
1593 nmdc:mga05p37_79382_c1
1594 nmdc:mga05p37_98916_c1
1595 nmdc:mga09592_135250_c1
1596 nmdc:mga09592_96275_c1
1597 nmdc:mga0qj67_287075_c1
1598 nmdc:mga0qj67_539443_c1
1599 nmdc:mga06r32_133410_c1
1600 nmdc:mga06r32_690289_c1
1601 nmdc:mga08y16_183991_c1
1602 nmdc:mga08y16_20316_c1
1603 nmdc:mga08y16_5518_c1
1604 nmdc:mga08y16_8906_c1
1605 nmdc:mga0n895_228132_c1
1606 nmdc:mga0n895_415840_c1
1607 nmdc:mga0n895_455996_c1
1608 nmdc:mga0n895_694379_c1
1609 nmdc:mga0n895_8528_c1
1610 nmdc:mga0rr50_10199_c1
1611 nmdc:mga0a205_158003_c1
1612 nmdc:mga0a205_174264_c1
1613 nmdc:mga0a205_266503_c1
1614 nmdc:mga0a205_31488_c1
1615 nmdc:mga0a205_500501_c1
1616 nmdc:mga0a205_52839_c1
1617 nmdc:mga0a205_62094_c1
1618 Ga0495601_0212439
1619 Ga0495619_0318222
1620 2673164051

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

82

226

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8edw-assembly1.cif.gz_A cryo-em structure of human abca7 in bpl/ch nanodiscs 0.9582 6 229
8ee6-assembly1.cif.gz_A cryo-em structure of human abca7 in pe/ch nanodiscs 0.9512 6 229
7lkp-assembly1.cif.gz_A structure of atp-free human abca4 0.9475 5 226
5x40-assembly1.cif.gz_B structure of a cbio dimer bound with amppcp 0.9432 5 225
7tbw-assembly1.cif.gz_A the structure of atp-bound abca1 0.9421 1 228
ID Description Score Start End Superfamily
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9606 1 232 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9558 5 235 3.40.50.300
af_Q9VRG3_1356_1574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9545 6 216 3.40.50.300
af_P0A9R7_1_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.949 8 216 3.40.50.300
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9484 6 227 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0S7XAU1-F1-model_v4 ABC transporter domain-containing protein 0.9789 8 227 GO:0005524
GO:0016887
AF-A0A662IZ41-F1-model_v4 ABC transporter ATP-binding protein 0.9762 5 227 GO:0005524
GO:0016887
AF-N0BIY9-F1-model_v4 ABC-type multidrug transport system, ATPase component 0.9751 7 227 GO:0005524
GO:0016887
AF-A0A7C6ZR21-F1-model_v4 ABC transporter ATP-binding protein 0.9732 5 228 GO:0005524
GO:0016887
AF-A0A358SSP6-F1-model_v4 Multidrug ABC transporter ATP-binding protein 0.9732 8 226 GO:0005524
GO:0016887

Map