F481596

General Info

Members Datasets Scaffolds Average Seq Length
805 439 750 145

Family's Representative Sequence

Representative Sequence 3300012502|Ga0157347_1001697|Ga0157347_10016972
Length 153
Sequence LFAFPQKKQKRSLSEQANEFRNINAFTDLTTYRLPPAGIVSILHRVSGVIMFLLLPFIIWMFDTSLSSDYSFAKFKAAFNSGLGFVPGWFIKLVALALIWAYLHHFIAGLRHLWMDVSHAAVTKEFGHTSAVFTLGASIILTLVLAAKLFGFY

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221570 Acidovorax sp. Root568 Isolate Unclassified
9 2643221596 Acidovorax sp. Root70 Isolate Unclassified
10 2643221609 Acidovorax sp. Root217 Isolate Unclassified
11 2643221611 Acidovorax sp. Root219 Isolate Unclassified
12 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
13 2643221652 Acidovorax sp. Root402 Isolate Unclassified
14 2643221658 Variovorax sp. Root411 Isolate Unclassified
15 2643221672 Variovorax sp. Root434 Isolate Unclassified
16 2643221683 Variovorax sp. Root473 Isolate Unclassified
17 2643221717 Acidovorax sp. Root267 Isolate Unclassified
18 2738541277 Variovorax sp. GV051 Isolate Unclassified
19 2738541307 Variovorax sp. GV008 Isolate Unclassified
20 2738543012 Acidovorax sp. CF301 Isolate Unclassified
21 2738543013 Variovorax sp. BT01 Isolate Unclassified
22 2738543019 Variovorax sp. GV040 Isolate Unclassified
23 2816332133 Acidovorax radicis 2721A Isolate Unclassified
24 2818991446 Variovorax sp. 1180 Isolate Unclassified
25 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
26 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
27 2842677519 Variovorax sp. R-72495 Isolate Unclassified
28 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
29 2842733646 Variovorax sp. R-72446 Isolate Unclassified
30 2842747753 Variovorax sp. R-72060 Isolate Unclassified
31 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
32 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
33 2885198086 Variovorax sp. 679 Isolate Unclassified
34 2885211737 Variovorax sp. 553 Isolate Unclassified
35 2899924645 Variovorax sp. 369 Isolate Unclassified
36 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
37 2904456579 Variovorax sp. 2002 Isolate Unclassified
38 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
39 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
40 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
41 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
42 2928037797 Variovorax sp. 1126 Isolate Unclassified
43 2928044640 Variovorax sp. 1128 Isolate Unclassified
44 2928051484 Variovorax sp. 1133 Isolate Unclassified
45 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
46 2928070936 Variovorax gossypii 1167 Isolate Unclassified
47 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
48 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
49 2929520902 Variovorax beijingensis 502 Isolate Unclassified
50 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
51 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
52 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
53 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
54 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
55 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
56 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
57 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
58 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
59 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
60 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
61 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
62 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
63 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
64 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
65 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
66 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
67 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
68 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
69 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
70 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
71 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
72 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
73 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
74 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
75 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
76 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
77 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
78 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
79 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
80 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
81 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
82 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
83 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
84 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
85 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
86 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
87 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
88 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
89 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
90 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
91 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
92 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
93 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
94 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
95 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
96 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
97 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
98 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
99 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
100 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
101 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
102 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
103 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
104 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
105 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
106 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
107 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
108 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
109 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
110 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
111 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
112 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
113 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
114 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
115 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
116 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
117 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
118 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
119 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
120 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
122 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
123 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
124 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
125 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
126 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
127 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
128 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
129 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
130 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
139 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
140 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
149 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
152 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
153 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
154 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
155 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
158 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
162 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
164 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
170 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
172 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
175 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
208 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
211 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
212 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
217 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
218 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
219 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
220 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
221 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
222 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
223 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
224 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
225 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
226 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
227 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
228 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
229 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
230 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
231 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
232 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
233 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
234 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
235 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
236 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
237 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
238 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
239 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
240 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
241 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
242 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
243 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
244 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
250 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
251 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
252 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
253 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
254 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
255 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
256 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
257 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
258 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
259 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
260 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
261 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
262 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
263 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
264 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
265 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
266 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
267 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
268 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
269 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
270 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
271 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
272 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
273 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
274 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
275 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
276 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
277 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
278 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
279 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
280 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
281 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
282 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
283 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
284 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
285 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
286 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
287 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
288 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
289 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
290 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
291 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
292 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
293 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
294 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
295 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
296 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
297 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
298 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
299 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
300 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
301 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
302 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
303 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
304 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
305 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
306 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
307 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
308 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
309 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
310 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
311 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
312 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
313 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
314 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
315 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
316 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
317 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
318 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
319 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
320 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
321 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
322 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
323 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
324 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
325 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
326 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
327 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
328 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
329 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
330 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
331 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
332 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
333 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
334 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
335 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
336 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
337 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
338 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
339 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
340 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
341 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
342 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
343 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
344 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
345 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
346 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
347 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
348 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
349 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
350 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
351 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
352 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
353 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
354 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
355 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
356 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
357 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
358 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
359 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
360 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
361 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
362 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
363 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
364 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
365 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
366 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
367 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
368 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
369 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
370 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
389 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
390 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
391 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
392 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
393 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
394 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
395 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
396 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
397 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
398 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
399 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
400 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
401 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
402 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
403 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
404 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
405 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
406 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
407 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
408 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
409 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
410 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
411 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
412 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
413 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
414 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
415 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
416 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
417 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
418 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
419 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
420 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
421 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
422 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
423 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
424 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
425 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
426 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
427 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
428 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
429 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
430 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
431 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
432 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
433 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
434 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
435 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
436 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
437 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.93
Metatranscriptomes 2.11
Isolates 6.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.1
Nodule 1.12
Rhizoplane 4.47
Rhizosphere 57.39
Stem 0
Stem Tuber 0
Unclassified 12.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2102642 2162886007 Bacteria 1289
2 JGI24740J21852_10008467 3300001979 Bacteria 4097
3 JGI24739J22299_10011968 3300001989 Bacteria 3189
4 JGI24739J22299_10045358 3300001989 Bacteria 1443
5 JGI25158J39367_1001940 3300002739 Bacteria 3482
6 JGI25152J39213_1013797 3300002773 Bacteria 1666
7 JGI25159J45721_1002846 3300002987 Bacteria 6348
8 JGI25159J45721_1022446 3300002987 Bacteria 1167
9 JGI25151J46595_10010462 3300003187 Bacteria 4308
10 JGI25151J46595_10017524 3300003187 Bacteria 3101
11 rootH1_10001241 3300003316 Bacteria 2253
12 rootH1_10001241 3300003323 Bacteria 4779
13 Ga0006562J51391_1020771 3300003578 Bacteria 720
14 Ga0055527_1016974 3300003760 Bacteria 783
15 Ga0055535_1000915 3300003761 Bacteria 19915
16 Ga0055542_1000901 3300003762 Bacteria 20265
17 Ga0055537_1000434 3300003773 Bacteria 27009
18 Ga0055537_1005360 3300003773 Bacteria 3453
19 Ga0055536_1009331 3300003781 Bacteria 4069
20 Ga0055536_1012171 3300003781 Bacteria 3216
21 Ga0055536_1028385 3300003781 Bacteria 1526
22 Ga0055534_1000642 3300003784 Bacteria 17763
23 Ga0055534_1002585 3300003784 Bacteria 6190
24 Ga0055534_1006069 3300003784 Bacteria 3110
25 Ga0055528_1007422 3300003790 Bacteria 4852
26 Ga0055528_1011740 3300003790 Bacteria 3453
27 Ga0055530_10000766 3300003791 Bacteria 26764
28 Ga0055540_1000627 3300003792 Bacteria 25032
29 Ga0055540_1004190 3300003792 Bacteria 6638
30 Ga0055540_1007670 3300003792 Bacteria 4024
31 Ga0055540_1032059 3300003792 Bacteria 1202
32 Ga0055540_1040650 3300003792 Bacteria 1006
33 Ga0055531_10000886 3300003794 Bacteria 24459
34 Ga0065165_1047188 3300005262 Bacteria 1245
35 Ga0065714_10011357 3300005288 Bacteria 1955
36 Ga0065714_10045960 3300005288 Bacteria 814
37 Ga0065714_10142497 3300005288 Bacteria 1156
38 Ga0065704_10102546 3300005289 Bacteria 2201
39 Ga0065704_10105629 3300005289 Bacteria 2106
40 Ga0065704_10604065 3300005289 Bacteria 605
41 Ga0070658_10735766 3300005327 Bacteria 857
42 Ga0070658_10973184 3300005327 Bacteria 738
43 Ga0070676_10111818 3300005328 Bacteria 1702
44 Ga0070676_10250317 3300005328 Bacteria 1182
45 Ga0070670_100209538 3300005331 Bacteria 1694
46 Ga0070677_10561824 3300005333 Bacteria 627
47 Ga0068869_101489403 3300005334 Bacteria 601
48 Ga0070666_10232948 3300005335 Bacteria 1301
49 Ga0068868_100497494 3300005338 Bacteria 1067
50 Ga0070660_100329236 3300005339 Bacteria 1256
51 Ga0070661_100121297 3300005344 Bacteria 1958
52 Ga0070668_100504378 3300005347 Bacteria 1048
53 Ga0070669_100080492 3300005353 Bacteria 2425
54 Ga0070669_100543598 3300005353 Bacteria 968
55 Ga0070669_100737984 3300005353 Bacteria 834
56 Ga0070671_101436938 3300005355 Bacteria 610
57 Ga0070674_100140513 3300005356 Bacteria 1812
58 Ga0070674_100463937 3300005356 Bacteria 1048
59 Ga0070674_101317476 3300005356 Bacteria 644
60 Ga0070673_100435635 3300005364 Bacteria 1177
61 Ga0070688_100741620 3300005365 Bacteria 764
62 Ga0070659_100892356 3300005366 Bacteria 777
63 Ga0070659_100899088 3300005366 Bacteria 774
64 Ga0070667_100781907 3300005367 Bacteria 886
65 Ga0070663_100015443 3300005455 Bacteria 4930
66 Ga0070678_100073651 3300005456 Bacteria 2564
67 Ga0070678_100186951 3300005456 Bacteria 1700
68 Ga0070678_102012601 3300005456 Bacteria 546
69 Ga0070662_100027489 3300005457 Bacteria 3949
70 Ga0070662_100586525 3300005457 Bacteria 937
71 Ga0070662_101355771 3300005457 Bacteria 612
72 Ga0068867_100193694 3300005459 Bacteria 1623
73 Ga0068867_100786936 3300005459 Unclassified 847
74 Ga0068867_100846419 3300005459 Bacteria 819
75 Ga0068853_100116871 3300005539 Bacteria 2375
76 Ga0068853_100171685 3300005539 Bacteria 1962
77 Ga0068853_101038327 3300005539 Bacteria 789
78 Ga0068853_101920814 3300005539 Bacteria 574
79 Ga0070672_100022180 3300005543 Bacteria 4658
80 Ga0070672_100953870 3300005543 Bacteria 759
81 Ga0070686_101023726 3300005544 Bacteria 678
82 Ga0070665_100027496 3300005548 Bacteria 5729
83 Ga0070665_100128685 3300005548 Bacteria 2534
84 Ga0070664_100480219 3300005564 Bacteria 1144
85 Ga0068857_100125184 3300005577 Bacteria 2315
86 Ga0068857_100279447 3300005577 Bacteria 1535
87 Ga0068854_100119507 3300005578 Bacteria 1999
88 Ga0068852_101065617 3300005616 Bacteria 828
89 Ga0068864_100801114 3300005618 Bacteria 926
90 Ga0068851_10046255 3300005834 Bacteria 2201
91 Ga0068870_10661068 3300005840 Bacteria 717
92 Ga0075365_10041456 3300006038 Bacteria 3007
93 Ga0075368_10088634 3300006042 Bacteria 1264
94 Ga0075363_100055360 3300006048 Bacteria 2124
95 Ga0075364_10111408 3300006051 Bacteria 1827
96 Ga0075432_10015748 3300006058 Bacteria 2580
97 Ga0075362_10033318 3300006177 Bacteria 2240
98 Ga0075367_10022549 3300006178 Bacteria 3533
99 Ga0075367_10035248 3300006178 Bacteria 2895
100 Ga0075367_10133846 3300006178 Bacteria 1533
101 Ga0075367_10387785 3300006178 Bacteria 883
102 Ga0075367_10430608 3300006178 Bacteria 835
103 Ga0075367_10533822 3300006178 Bacteria 745
104 Ga0075369_10065903 3300006186 Bacteria 1588
105 Ga0075366_10007874 3300006195 Bacteria 5894
106 Ga0075366_10009033 3300006195 Bacteria 5559
107 Ga0075366_10032122 3300006195 Bacteria 3090
108 Ga0075366_10046737 3300006195 Bacteria 2565
109 Ga0075366_10056276 3300006195 Bacteria 2336
110 Ga0075366_10106165 3300006195 Bacteria 1688
111 Ga0075366_10131834 3300006195 Bacteria 1508
112 Ga0075366_10147222 3300006195 Bacteria 1425
113 Ga0075366_10251640 3300006195 Bacteria 1077
114 Ga0075366_10469961 3300006195 Bacteria 776
115 Ga0075366_10525961 3300006195 Bacteria 732
116 Ga0097621_100199672 3300006237 Bacteria 1736
117 Ga0075370_10003137 3300006353 Bacteria 7803
118 Ga0075370_10006880 3300006353 Bacteria 5754
119 Ga0075370_10010283 3300006353 Bacteria 4888
120 Ga0075370_10043670 3300006353 Bacteria 2533
121 Ga0075370_10082572 3300006353 Bacteria 1848
122 Ga0075370_10240237 3300006353 Bacteria 1072
123 Ga0075370_10337993 3300006353 Bacteria 898
124 Ga0075370_10784864 3300006353 Bacteria 580
125 Ga0075370_10837161 3300006353 Bacteria 561
126 Ga0068871_100271477 3300006358 Bacteria 1482
127 Ga0068871_101511774 3300006358 Bacteria 634
128 Ga0075428_101379235 3300006844 Bacteria 740
129 Ga0068865_100271368 3300006881 Bacteria 1347
130 Ga0079104_1000352 3300006946 Bacteria 55479
131 Ga0079104_1019560 3300006946 Bacteria 1889
132 Ga0099826_10023210 3300006948 Bacteria 4626
133 Ga0099826_10137953 3300006948 Bacteria 1413
134 Ga0105251_10275993 3300009011 Bacteria 760
135 Ga0105244_10007704 3300009036 Bacteria 6820
136 Ga0105244_10140800 3300009036 Bacteria 1160
137 Ga0105240_10675681 3300009093 Bacteria 1130
138 Ga0105240_11802305 3300009093 Bacteria 638
139 Ga0105245_10087717 3300009098 Bacteria 2856
140 Ga0105245_10472172 3300009098 Bacteria 1266
141 Ga0105245_10568229 3300009098 Bacteria 1157
142 Ga0105243_10012218 3300009148 Bacteria 6492
143 Ga0105243_10111039 3300009148 Bacteria 2294
144 Ga0105243_10204752 3300009148 Bacteria 1733
145 Ga0105243_10446579 3300009148 Bacteria 1212
146 Ga0105243_10499014 3300009148 Bacteria 1153
147 Ga0105242_10059133 3300009176 Bacteria 3144
148 Ga0105242_10217332 3300009176 Bacteria 1706
149 Ga0105242_10410867 3300009176 Bacteria 1266
150 Ga0105242_10761921 3300009176 Bacteria 954
151 Ga0105242_11939011 3300009176 Bacteria 630
152 Ga0105242_12448149 3300009176 Bacteria 570
153 Ga0105248_10260589 3300009177 Bacteria 1952
154 Ga0105248_10328967 3300009177 Bacteria 1721
155 Ga0105248_11029210 3300009177 Unclassified 930
156 Ga0105248_11839395 3300009177 Bacteria 687
157 Ga0105238_10249886 3300009551 Bacteria 1751
158 Ga0105238_10445272 3300009551 Bacteria 1292
159 Ga0105249_11520563 3300009553 Bacteria 742
160 Ga0105239_10381641 3300010375 Bacteria 1593
161 Ga0105246_10169215 3300011119 Bacteria 1672
162 Ga0157347_1001697 3300012502 Bacteria 1779
163 Ga0157339_1028301 3300012505 Bacteria 641
164 Ga0157373_10186710 3300013100 Bacteria 1460
165 Ga0157373_10238746 3300013100 Bacteria 1284
166 Ga0157373_11324862 3300013100 Bacteria 546
167 Ga0157371_10672575 3300013102 Bacteria 774
168 Ga0157370_10034122 3300013104 Bacteria 4957
169 Ga0157370_10145499 3300013104 Bacteria 2207
170 Ga0157370_11439698 3300013104 Bacteria 620
171 Ga0157369_10001553 3300013105 Bacteria 28084
172 Ga0157378_10730720 3300013297 Bacteria 1011
173 Ga0157378_10946539 3300013297 Bacteria 894
174 Ga0157378_11820854 3300013297 Bacteria 657
175 Ga0163162_10243785 3300013306 Bacteria 1928
176 Ga0163162_10621430 3300013306 Bacteria 1205
177 Ga0163162_11918623 3300013306 Bacteria 678
178 Ga0157375_10462063 3300013308 Bacteria 1435
179 Ga0157375_10568070 3300013308 Bacteria 1295
180 Ga0157380_10235022 3300014326 Bacteria 1649
181 Ga0182008_10003672 3300014497 Bacteria 9163
182 Ga0182008_10007571 3300014497 Bacteria 5989
183 Ga0182008_10024300 3300014497 Bacteria 3087
184 Ga0182008_10042374 3300014497 Bacteria 2268
185 Ga0182008_10117999 3300014497 Bacteria 1317
186 Ga0182008_10126990 3300014497 Bacteria 1270
187 Ga0182008_10267181 3300014497 Bacteria 886
188 Ga0157377_10541755 3300014745 Bacteria 821
189 Ga0157379_10015837 3300014968 Bacteria 6626
190 Ga0157379_10931291 3300014968 Bacteria 825
191 Ga0157376_10304247 3300014969 Bacteria 1510
192 Ga0157376_10358955 3300014969 Bacteria 1397
193 Ga0157376_10542338 3300014969 Bacteria 1150
194 Ga0182006_1006815 3300015261 Bacteria 5271
195 Ga0182006_1038851 3300015261 Bacteria 1881
196 Ga0182006_1080934 3300015261 Bacteria 1185
197 Ga0182007_10018708 3300015262 Bacteria 2505
198 Ga0182007_10155895 3300015262 Bacteria 779
199 Ga0182005_1233170 3300015265 Bacteria 564
200 Ga0183362_10001 3300015683 Bacteria 2046624
201 Ga0163161_10040028 3300017792 Bacteria 3366
202 Ga0163161_10047665 3300017792 Bacteria 3094
203 Ga0163161_10085111 3300017792 Bacteria 2332
204 Ga0163161_10423851 3300017792 Bacteria 1071
205 Ga0209436_116559 3300025208 Bacteria 1101
206 Ga0209672_101606 3300025228 Bacteria 7554
207 Ga0209147_100909 3300025229 Bacteria 13338
208 Ga0209258_100009 3300025242 Bacteria 996276
209 Ga0207425_1000361 3300025245 Bacteria 31481
210 Ga0207425_1040224 3300025245 Bacteria 893
211 Ga0209148_1000007 3300025254 Bacteria 1592273
212 Ga0209129_1000013 3300025258 Bacteria 524874
213 Ga0209129_1003406 3300025258 Bacteria 6957
214 Ga0209129_1022451 3300025258 Bacteria 1140
215 Ga0209565_1000046 3300025263 Bacteria 226073
216 Ga0209565_1002375 3300025263 Bacteria 6843
217 Ga0209673_1000053 3300025273 Bacteria 279449
218 Ga0209673_1000245 3300025273 Bacteria 103315
219 Ga0209673_1003160 3300025273 Bacteria 10044
220 Ga0209673_1090236 3300025273 Bacteria 680
221 Ga0209130_1002075 3300025284 Bacteria 10806
222 Ga0209130_1003101 3300025284 Bacteria 7418
223 Ga0209130_1005537 3300025284 Bacteria 4345
224 Ga0209675_1000010 3300025291 Bacteria 541927
225 Ga0209675_1001188 3300025291 Bacteria 15806
226 Ga0209675_1002968 3300025291 Bacteria 8356
227 Ga0209676_1000108 3300025292 Bacteria 221168
228 Ga0209676_1000939 3300025292 Bacteria 35879
229 Ga0209676_1001659 3300025292 Bacteria 19383
230 Ga0209676_1025250 3300025292 Bacteria 1909
231 Ga0209025_1000972 3300025294 Bacteria 42974
232 Ga0209025_1003456 3300025294 Bacteria 14922
233 Ga0209025_1006031 3300025294 Bacteria 9594
234 Ga0209025_1008558 3300025294 Bacteria 7341
235 Ga0209025_1036750 3300025294 Bacteria 2187
236 Ga0209025_1037753 3300025294 Bacteria 2136
237 Ga0209025_1043546 3300025294 Bacteria 1890
238 Ga0209564_1005295 3300025295 Bacteria 7433
239 Ga0209564_1005299 3300025295 Bacteria 7432
240 Ga0209564_1052293 3300025295 Bacteria 983
241 Ga0209564_1060202 3300025295 Bacteria 854
242 Ga0209758_1000067 3300025297 Bacteria 288575
243 Ga0209758_1005404 3300025297 Bacteria 9869
244 Ga0209050_1000002 3300025298 Bacteria 1792849
245 Ga0209050_1007827 3300025298 Bacteria 5874
246 Ga0209050_1020859 3300025298 Bacteria 2417
247 Ga0209050_1053439 3300025298 Bacteria 1004
248 Ga0209256_1000077 3300025299 Bacteria 230410
249 Ga0209256_1000673 3300025299 Bacteria 46238
250 Ga0209256_1030279 3300025299 Bacteria 1496
251 Ga0207426_1000101 3300025302 Bacteria 262096
252 Ga0207426_1000129 3300025302 Bacteria 210930
253 Ga0209051_1000002 3300025303 Bacteria 1631846
254 Ga0209051_1000486 3300025303 Bacteria 51268
255 Ga0209051_1001944 3300025303 Bacteria 15917
256 Ga0209051_1003369 3300025303 Bacteria 10515
257 Ga0209257_1000002 3300025304 Bacteria 1767052
258 Ga0209257_1000713 3300025304 Bacteria 51427
259 Ga0209257_1023311 3300025304 Bacteria 2179
260 Ga0209257_1025850 3300025304 Bacteria 1995
261 Ga0209257_1050773 3300025304 Bacteria 1172
262 Ga0207656_10022267 3300025321 Bacteria 2540
263 Ga0207655_1004198 3300025728 Bacteria 10329
264 Ga0207655_1106512 3300025728 Bacteria 955
265 Ga0207682_10021464 3300025893 Bacteria 2541
266 Ga0207645_10008421 3300025907 Bacteria 7194
267 Ga0207645_10204884 3300025907 Bacteria 1298
268 Ga0207695_10138617 3300025913 Bacteria 2384
269 Ga0207671_10398338 3300025914 Bacteria 1095
270 Ga0207649_10097006 3300025920 Bacteria 1943
271 Ga0207681_10007278 3300025923 Bacteria 6784
272 Ga0207681_10065858 3300025923 Bacteria 2506
273 Ga0207694_10673713 3300025924 Bacteria 872
274 Ga0207650_10114185 3300025925 Bacteria 2095
275 Ga0207650_10327441 3300025925 Bacteria 1256
276 Ga0207659_10131250 3300025926 Bacteria 1934
277 Ga0207687_10084406 3300025927 Bacteria 2302
278 Ga0207687_10382893 3300025927 Bacteria 1153
279 Ga0207687_10514604 3300025927 Bacteria 1000
280 Ga0207644_11296688 3300025931 Bacteria 612
281 Ga0207706_10086975 3300025933 Bacteria 2747
282 Ga0207706_10725604 3300025933 Bacteria 848
283 Ga0207686_10002907 3300025934 Bacteria 9238
284 Ga0207686_10158559 3300025934 Bacteria 1583
285 Ga0207686_10395459 3300025934 Bacteria 1051
286 Ga0207709_10002996 3300025935 Bacteria 10268
287 Ga0207709_10012695 3300025935 Bacteria 4643
288 Ga0207709_10049858 3300025935 Bacteria 2557
289 Ga0207709_10276942 3300025935 Bacteria 1237
290 Ga0207709_10286880 3300025935 Bacteria 1218
291 Ga0207691_10009910 3300025940 Bacteria 9146
292 Ga0207711_10505536 3300025941 Bacteria 1126
293 Ga0207711_10903555 3300025941 Bacteria 821
294 Ga0207711_11477776 3300025941 Bacteria 622
295 Ga0207711_11623034 3300025941 Bacteria 590
296 Ga0207689_10018922 3300025942 Bacteria 5808
297 Ga0207689_10232015 3300025942 Bacteria 1525
298 Ga0207679_10019534 3300025945 Bacteria 4554
299 Ga0207651_10267929 3300025960 Bacteria 1405
300 Ga0207668_10102125 3300025972 Bacteria 2133
301 Ga0207668_10395558 3300025972 Bacteria 1167
302 Ga0207668_10910963 3300025972 Bacteria 783
303 Ga0207668_11383279 3300025972 Bacteria 634
304 Ga0207640_10575407 3300025981 Bacteria 950
305 Ga0207639_10105322 3300026041 Bacteria 2288
306 Ga0207639_10401897 3300026041 Bacteria 1234
307 Ga0207639_10707467 3300026041 Bacteria 935
308 Ga0207639_10900626 3300026041 Bacteria 827
309 Ga0207678_10028113 3300026067 Bacteria 4910
310 Ga0207648_10041681 3300026089 Bacteria 4032
311 Ga0207648_10222017 3300026089 Bacteria 1680
312 Ga0207648_10329343 3300026089 Bacteria 1373
313 Ga0207648_10488717 3300026089 Bacteria 1125
314 Ga0207648_10861484 3300026089 Bacteria 845
315 Ga0207674_10020101 3300026116 Bacteria 7222
316 Ga0207674_10372754 3300026116 Bacteria 1380
317 Ga0207674_10560792 3300026116 Bacteria 1103
318 Ga0207675_101088157 3300026118 Unclassified 819
319 Ga0207675_101689278 3300026118 Bacteria 653
320 Ga0207683_10042716 3300026121 Bacteria 3960
321 Ga0207683_10344630 3300026121 Bacteria 1367
322 Ga0207683_10473562 3300026121 Bacteria 1155
323 Ga0207683_11045162 3300026121 Bacteria 758
324 Ga0207698_10077776 3300026142 Bacteria 2661
325 Ga0209281_1000454 3300027111 Bacteria 58234
326 Ga0209969_1038395 3300027360 Bacteria 741
327 Ga0209984_1008006 3300027424 Bacteria 1323
328 Ga0209282_1005624 3300027666 Bacteria 7713
329 Ga0209282_1189223 3300027666 Bacteria 958
330 Ga0209282_1236474 3300027666 Bacteria 816
331 Ga0209813_10021743 3300027866 Bacteria 1807
332 Ga0209974_10014274 3300027876 Bacteria 2645
333 Ga0268266_10217130 3300028379 Bacteria 1756
334 Ga0268265_10297538 3300028380 Bacteria 1451
335 Ga0268264_10194621 3300028381 Bacteria 1850
336 Ga0307515_10000084 3300028794 Bacteria 221434
337 Ga0307515_10000265 3300028794 Bacteria 129554
338 Ga0307515_10001533 3300028794 Bacteria 51699
339 Ga0307515_10002409 3300028794 Bacteria 40792
340 Ga0307515_10006008 3300028794 Bacteria 24426
341 Ga0307515_10060740 3300028794 Bacteria 5382
342 Ga0307515_10276687 3300028794 Bacteria 1391
343 Ga0307515_10615324 3300028794 Bacteria 697
344 Ga0307512_10036360 3300030522 Bacteria 4178
345 Ga0316177_1080873 3300030731 Bacteria 2097
346 Ga0316179_1005100 3300030734 Bacteria 1991
347 Ga0316178_1049689 3300030735 Bacteria 2655
348 Ga0316183_1121951 3300030742 Bacteria 4193
349 Ga0316183_1122991 3300030742 Bacteria 1554
350 Ga0316181_1013012 3300030744 Bacteria 896
351 Ga0316181_1140675 3300030744 Bacteria 1273
352 Ga0316182_1117672 3300030745 Bacteria 2645
353 Ga0316182_1372344 3300030745 Bacteria 1488
354 Ga0265332_10000009 3300031238 Bacteria 295760
355 Ga0265328_10012736 3300031239 Bacteria 3344
356 Ga0265327_10000265 3300031251 Bacteria 103720
357 Ga0265327_10006033 3300031251 Bacteria 9832
358 Ga0265327_10013589 3300031251 Bacteria 5399
359 Ga0265327_10416844 3300031251 Bacteria 582
360 Ga0265316_10000807 3300031344 Bacteria 34580
361 Ga0307513_10003195 3300031456 Bacteria 22371
362 Ga0307513_10030898 3300031456 Bacteria 6076
363 Ga0307513_10046229 3300031456 Bacteria 4749
364 Ga0307513_10151665 3300031456 Bacteria 2225
365 Ga0307513_10184416 3300031456 Bacteria 1946
366 Ga0307513_10237417 3300031456 Bacteria 1631
367 Ga0307509_10085882 3300031507 Bacteria 3237
368 Ga0307509_10418108 3300031507 Bacteria 1042
369 Ga0307408_100000212 3300031548 Bacteria 62138
370 Ga0307408_100056587 3300031548 Bacteria 2844
371 Ga0307408_100084823 3300031548 Bacteria 2377
372 Ga0307408_100142864 3300031548 Bacteria 1880
373 Ga0307408_100253587 3300031548 Bacteria 1452
374 Ga0307408_100449462 3300031548 Bacteria 1117
375 Ga0307408_100450042 3300031548 Bacteria 1117
376 Ga0307408_100571338 3300031548 Bacteria 1000
377 Ga0307408_101198026 3300031548 Bacteria 708
378 Ga0307514_10000319 3300031649 Bacteria 115327
379 Ga0307514_10047701 3300031649 Bacteria 3342
380 Ga0307514_10167229 3300031649 Bacteria 1444
381 Ga0307516_10001303 3300031730 Bacteria 34698
382 Ga0307405_10089605 3300031731 Bacteria 2032
383 Ga0307410_11099814 3300031852 Bacteria 689
384 Ga0307406_10001770 3300031901 Bacteria 11820
385 Ga0307406_10142959 3300031901 Bacteria 1696
386 Ga0307407_10189449 3300031903 Bacteria 1370
387 Ga0307412_10110281 3300031911 Bacteria 1963
388 Ga0307412_10123758 3300031911 Bacteria 1866
389 Ga0307412_10242213 3300031911 Bacteria 1395
390 Ga0307412_10319026 3300031911 Bacteria 1235
391 Ga0307412_10523539 3300031911 Bacteria 991
392 Ga0307412_10601551 3300031911 Bacteria 931
393 Ga0307409_100294255 3300031995 Bacteria 1507
394 Ga0307409_100579626 3300031995 Bacteria 1106
395 Ga0307409_101859435 3300031995 Bacteria 631
396 Ga0307409_102504313 3300031995 Bacteria 545
397 Ga0307416_100529199 3300032002 Bacteria 1248
398 Ga0307416_101102156 3300032002 Bacteria 898
399 Ga0307414_10310981 3300032004 Bacteria 1337
400 Ga0307411_10191797 3300032005 Bacteria 1561
401 Ga0307411_10485605 3300032005 Bacteria 1041
402 Ga0307415_100799540 3300032126 Bacteria 861
403 Ga0373955_0260624 3300035172 Bacteria 1041
404 Ga0373931_0091312 3300035691 Bacteria 1697
405 Ga0395900_0192655 3300037418 Bacteria 2067
406 Ga0395900_0280588 3300037418 Bacteria 1658
407 Ga0395898_0327717 3300037466 Bacteria 1460
408 Ga0395898_0859572 3300037466 Bacteria 846
409 Ga0395905_0000684 3300037471 Bacteria 44904
410 Ga0395905_0088667 3300037471 Bacteria 2899
411 Ga0395905_0794164 3300037471 Bacteria 849
412 Ga0395905_0856731 3300037471 Bacteria 812
413 Ga0395905_1111515 3300037471 Bacteria 694
414 Ga0395901_0024228 3300038443 Bacteria 6227
415 Ga0436365_1063264 3300039437 Bacteria 571
416 Ga0436361_0475800 3300039447 Bacteria 11481
417 Ga0439436_0008676 3300041404 Bacteria 3124
418 Ga0439436_0020697 3300041404 Bacteria 1958
419 Ga0439436_0061047 3300041404 Bacteria 1055
420 Ga0439439_0014097 3300041406 Bacteria 1943
421 Ga0439466_0009224 3300041411 Bacteria 3694
422 Ga0439466_0024000 3300041411 Bacteria 2141
423 Ga0439465_0014650 3300041413 Bacteria 2444
424 Ga0451789_0105499 3300041443 Bacteria 1467
425 Ga0451789_0429677 3300041443 Bacteria 711
426 Ga0451791_1601473 3300041451 Bacteria 656
427 Ga0451793_0935927 3300041452 Bacteria 671
428 Ga0451800_0987865 3300041459 Bacteria 1383
429 Ga0451802_1196336 3300041460 Bacteria 1513
430 Ga0451807_0986316 3300041486 Bacteria 1399
431 Ga0451807_2262088 3300041486 Bacteria 980
432 Ga0451807_2369752 3300041486 Bacteria 1571
433 Ga0451833_0165364 3300041491 Bacteria 725
434 Ga0451833_0197438 3300041491 Bacteria 755
435 Ga0451835_0341183 3300041492 Bacteria 535
436 Ga0451837_0229797 3300041494 Bacteria 652
437 Ga0451837_1274579 3300041494 Bacteria 806
438 Ga0451839_0313766 3300041496 Bacteria 834
439 Ga0451843_1265110 3300041509 Bacteria 864
440 Ga0451853_0739295 3300041512 Bacteria 1082
441 Ga0439431_0000653 3300041997 Bacteria 7381
442 Ga0439431_0195562 3300041997 Bacteria 588
443 Ga0439433_0007603 3300041999 Bacteria 2342
444 Ga0439433_0015194 3300041999 Bacteria 1699
445 Ga0439433_0104744 3300041999 Bacteria 704
446 Ga0439442_007595 3300042002 Bacteria 2183
447 Ga0439442_010111 3300042002 Bacteria 1910
448 Ga0439442_048893 3300042002 Bacteria 891
449 Ga0439445_0014046 3300042004 Bacteria 1945
450 Ga0439445_0026402 3300042004 Bacteria 1487
451 Ga0439445_0043375 3300042004 Bacteria 1200
452 Ga0439448_0186251 3300042005 Bacteria 726
453 Ga0439432_008521 3300042006 Bacteria 3598
454 Ga0439432_015233 3300042006 Bacteria 2597
455 Ga0439432_065536 3300042006 Bacteria 1113
456 Ga0439449_0003558 3300042007 Bacteria 6051
457 Ga0439449_0010488 3300042007 Bacteria 3500
458 Ga0439449_0013502 3300042007 Bacteria 3073
459 Ga0439449_0019230 3300042007 Bacteria 2560
460 Ga0439452_004068 3300042010 Bacteria 4971
461 Ga0439452_039693 3300042010 Bacteria 1113
462 Ga0439455_0036889 3300042012 Bacteria 1238
463 Ga0439457_062297 3300042014 Bacteria 845
464 Ga0439462_0006627 3300042015 Bacteria 2883
465 Ga0439462_0033034 3300042015 Bacteria 1371
466 Ga0450911_000987 3300042115 Bacteria 7378
467 Ga0450912_000270 3300042116 Bacteria 2315
468 Ga0450915_007869 3300042119 Bacteria 704
469 Ga0450919_005464 3300042121 Bacteria 1525
470 Ga0450923_013370 3300042125 Bacteria 1508
471 Ga0450897_009772 3300042128 Bacteria 913
472 Ga0450894_034120 3300042131 Bacteria 717
473 Ga0450895_013492 3300042132 Bacteria 717
474 Ga0450896_034894 3300042133 Bacteria 771
475 Ga0450896_052281 3300042133 Bacteria 653
476 Ga0450899_002488 3300042135 Bacteria 1989
477 Ga0450906_007435 3300042145 Bacteria 2164
478 Ga0450906_007849 3300042145 Bacteria 2091
479 Ga0450907_021420 3300042146 Bacteria 1087
480 Ga0450910_006050 3300042147 Bacteria 1662
481 Ga0450910_019376 3300042147 Bacteria 1021
482 Ga0439446_0018615 3300042156 Bacteria 1947
483 Ga0439458_0090855 3300042157 Bacteria 786
484 Ga0450908_008969 3300042184 Bacteria 1866
485 Ga0439434_0008577 3300042435 Bacteria 3000
486 Ga0439434_0046306 3300042435 Bacteria 1342
487 Ga0439435_0186508 3300042436 Bacteria 679
488 Ga0450918_001307 3300042531 Bacteria 5032
489 Ga0450893_0001916 3300042532 Bacteria 3229
490 Ga0450893_0021580 3300042532 Bacteria 1112
491 Ga0453683_0154118 3300044673 Bacteria 1452
492 Ga0466965_0021670 3300044683 Bacteria 3095
493 Ga0453684_0000279 3300044712 Bacteria 220016
494 Ga0453684_0138148 3300044712 Bacteria 2914
495 Ga0453684_0512651 3300044712 Bacteria 1326
496 Ga0453684_0559836 3300044712 Bacteria 1258
497 Ga0453684_1153969 3300044712 Bacteria 816
498 Ga0466960_0168748 3300044901 Bacteria 1180
499 Ga0451576_0034078 3300045051 Bacteria 5409
500 Ga0451576_0040679 3300045051 Bacteria 4917
501 Ga0451576_0273823 3300045051 Bacteria 1765
502 Ga0451576_0289315 3300045051 Bacteria 1713
503 Ga0451576_1361369 3300045051 Bacteria 739
504 Ga0495627_012911 3300046453 Bacteria 2949
505 Ga0495627_072617 3300046453 Bacteria 1003
506 Ga0495638_0046107 3300046460 Bacteria 2740
507 Ga0495639_0040524 3300046475 Bacteria 2095
508 Ga0495583_0187589 3300046506 Bacteria 844
509 Ga0495610_0018506 3300046512 Bacteria 3931
510 Ga0495610_0034365 3300046512 Bacteria 2612
511 Ga0495610_0192671 3300046512 Bacteria 840
512 Ga0495616_0027760 3300046513 Bacteria 3001
513 Ga0495620_0021223 3300046515 Bacteria 3157
514 Ga0495620_0141524 3300046515 Bacteria 940
515 Ga0495630_0932356 3300046517 Bacteria 661
516 Ga0495631_0019187 3300046518 Bacteria 3209
517 Ga0495631_0376554 3300046518 Bacteria 604
518 Ga0495637_0004432 3300046520 Bacteria 7277
519 Ga0495637_0076588 3300046520 Bacteria 1340
520 Ga0495643_0035021 3300046522 Bacteria 2766
521 Ga0495643_0084710 3300046522 Bacteria 1645
522 Ga0495648_0373022 3300046524 Bacteria 645
523 Ga0495663_0055242 3300046525 Bacteria 1238
524 Ga0495663_0156013 3300046525 Bacteria 781
525 Ga0495666_0227473 3300046526 Bacteria 853
526 Ga0495642_0036280 3300046528 Bacteria 1992
527 Ga0495654_0022887 3300046530 Bacteria 3240
528 Ga0495654_0051519 3300046530 Bacteria 2008
529 Ga0495654_0061750 3300046530 Bacteria 1798
530 Ga0495586_0710971 3300046535 Bacteria 580
531 Ga0495598_0003877 3300046537 Bacteria 3205
532 Ga0495598_0235324 3300046537 Bacteria 673
533 Ga0495609_0174232 3300046538 Bacteria 907
534 Ga0495621_0124571 3300046539 Bacteria 998
535 Ga0495621_0163479 3300046539 Bacteria 881
536 Ga0495597_0023877 3300046542 Bacteria 2826
537 Ga0495645_0112520 3300046543 Bacteria 1925
538 Ga0495622_0136565 3300046557 Bacteria 1115
539 Ga0495656_0000916 3300046615 Bacteria 9534
540 Ga0495656_0024649 3300046615 Bacteria 2378
541 Ga0495656_0049212 3300046615 Bacteria 1794
542 Ga0495656_0085697 3300046615 Bacteria 1431
543 Ga0495625_0000411 3300046660 Bacteria 64917
544 Ga0495625_0054874 3300046660 Bacteria 2844
545 Ga0495625_0188068 3300046660 Bacteria 1369
546 Ga0495635_0190540 3300046663 Bacteria 1392
547 Ga0495635_0398671 3300046663 Bacteria 914
548 Ga0495661_0141168 3300046665 Bacteria 1310
549 Ga0495588_0021962 3300046674 Bacteria 3150
550 Ga0495588_0093008 3300046674 Bacteria 1580
551 Ga0495588_0107619 3300046674 Bacteria 1468
552 Ga0495588_0109339 3300046674 Bacteria 1456
553 Ga0495658_0180970 3300046683 Bacteria 1308
554 Ga0495658_0263798 3300046683 Bacteria 1084
555 Ga0495669_0162141 3300046684 Bacteria 1061
556 Ga0495670_0119677 3300046691 Bacteria 1367
557 Ga0495670_0329297 3300046691 Bacteria 820
558 Ga0495671_0080973 3300046692 Bacteria 1591
559 Ga0495600_0462552 3300046809 Bacteria 783
560 Ga0495660_0189213 3300046810 Bacteria 990
561 Ga0495636_0041036 3300047318 Bacteria 1920
562 Ga0495636_0162488 3300047318 Bacteria 1007
563 Ga0495676_0011078 3300047321 Bacteria 8149
564 Ga0495677_0125377 3300047445 Bacteria 981
565 Ga0495685_011191 3300047447 Bacteria 3023
566 Ga0495681_0107646 3300047470 Bacteria 1211
567 Ga0495681_0130840 3300047470 Bacteria 1068
568 Ga0495681_0326489 3300047470 Bacteria 588
569 Ga0495686_0007977 3300047472 Bacteria 7853
570 Ga0495686_0130715 3300047472 Bacteria 1489
571 Ga0495593_0009567 3300047673 Bacteria 5626
572 Ga0495614_0014245 3300048089 Bacteria 3484
573 Ga0495615_0007034 3300048090 Bacteria 2117
574 Ga0495615_0030313 3300048090 Bacteria 1290
575 Ga0495615_0036078 3300048090 Bacteria 1211
576 Ga0496100_0061992 3300048903 Bacteria 2466
577 Ga0496100_0416974 3300048903 Bacteria 1025
578 Ga0496101_0019764 3300048904 Bacteria 4605
579 Ga0496101_0070039 3300048904 Bacteria 2567
580 Ga0496102_0018680 3300048905 Bacteria 6097
581 Ga0496103_0075323 3300048906 Bacteria 2116
582 Ga0496103_0176891 3300048906 Bacteria 1371
583 Ga0496103_0867225 3300048906 Bacteria 567
584 Ga0496104_0025765 3300048907 Bacteria 5423
585 Ga0496105_0045065 3300048908 Bacteria 3639
586 Ga0496106_0183839 3300048909 Bacteria 1660
587 Ga0496107_0113937 3300048910 Bacteria 1989
588 Ga0496108_0157127 3300048911 Bacteria 1964
589 Ga0496108_0943113 3300048911 Bacteria 739
590 Ga0496109_0123108 3300048912 Bacteria 2417
591 Ga0496109_0161834 3300048912 Bacteria 2097
592 Ga0496109_0355941 3300048912 Bacteria 1383
593 Ga0496110_0019037 3300048913 Bacteria 5770
594 Ga0496110_0215560 3300048913 Bacteria 1745
595 Ga0496111_0094692 3300048914 Bacteria 2190
596 Ga0496112_0763188 3300048915 Bacteria 893
597 Ga0496114_0366673 3300048917 Bacteria 1274
598 Ga0496114_0452769 3300048917 Bacteria 1137
599 Ga0496114_1337304 3300048917 Bacteria 603
600 Ga0496116_0027214 3300048919 Bacteria 4166
601 Ga0496116_0042592 3300048919 Bacteria 3101
602 Ga0496116_0225095 3300048919 Bacteria 957
603 Ga0496117_0028416 3300048920 Bacteria 4331
604 Ga0496117_0122036 3300048920 Bacteria 1598
605 Ga0496117_0125747 3300048920 Bacteria 1565
606 Ga0496118_0014920 3300048921 Bacteria 7232
607 Ga0496118_0062819 3300048921 Bacteria 2737
608 Ga0496118_0147818 3300048921 Bacteria 1476
609 Ga0496119_0174593 3300048922 Bacteria 1132
610 Ga0496121_0025381 3300048924 Bacteria 5625
611 Ga0496121_0088556 3300048924 Bacteria 2426
612 Ga0496122_0000998 3300048925 Bacteria 50283
613 Ga0496122_0104621 3300048925 Bacteria 1880
614 Ga0496122_0160871 3300048925 Bacteria 1369
615 Ga0496122_0177963 3300048925 Bacteria 1273
616 Ga0496122_0209278 3300048925 Bacteria 1131
617 Ga0496123_0000045 3300048926 Bacteria 249294
618 Ga0496123_0107769 3300048926 Bacteria 1602
619 Ga0496123_0164464 3300048926 Bacteria 1179
620 Ga0496124_0081035 3300048927 Bacteria 2669
621 Ga0496124_0101887 3300048927 Bacteria 2325
622 Ga0496124_0134721 3300048927 Bacteria 1957
623 Ga0496124_0165449 3300048927 Bacteria 1719
624 Ga0496125_0015577 3300048928 Bacteria 7342
625 Ga0496125_0041048 3300048928 Bacteria 3960
626 Ga0496125_0085816 3300048928 Bacteria 2384
627 Ga0496125_0096632 3300048928 Bacteria 2192
628 Ga0496125_0106796 3300048928 Bacteria 2042
629 Ga0496125_0478351 3300048928 Bacteria 706
630 Ga0496125_0566725 3300048928 Bacteria 626
631 Ga0496126_0088477 3300048929 Bacteria 2728
632 Ga0496126_0099168 3300048929 Bacteria 2552
633 Ga0496126_0113187 3300048929 Bacteria 2362
634 Ga0496126_0139641 3300048929 Bacteria 2087
635 Ga0496126_0180552 3300048929 Bacteria 1793
636 Ga0496126_0376422 3300048929 Bacteria 1157
637 Ga0501308_010543 3300049128 Bacteria 1028
638 Ga0501310_012827 3300049130 Bacteria 965
639 Ga0501304_032348 3300049160 Bacteria 560
640 Ga0501307_013324 3300049162 Bacteria 991
641 Ga0501313_031979 3300049529 Bacteria 685
642 Ga0501313_065079 3300049529 Bacteria 521
643 Ga0501315_031735 3300049531 Bacteria 764
644 Ga0501315_060434 3300049531 Bacteria 612
645 Ga0501316_007310 3300049532 Bacteria 1196
646 Ga0501317_024669 3300049533 Bacteria 838
647 Ga0501323_003453 3300049539 Bacteria 1615
648 Ga0501335_021047 3300049551 Bacteria 697
649 Ga0501338_02098 3300049554 Bacteria 1119
650 Ga0501032_0082781 3300049569 Bacteria 2135
651 Ga0501034_0096457 3300049571 Bacteria 2953
652 Ga0501039_0994098 3300049575 Bacteria 652
653 Ga0501042_0594241 3300049578 Bacteria 805
654 Ga0501043_0000004 3300049579 Bacteria 291085
655 Ga0501046_0000050 3300049580 Bacteria 134922
656 Ga0501046_0266612 3300049580 Bacteria 1257
657 Ga0501047_0000012 3300049581 Bacteria 368824
658 Ga0501227_084803 3300049665 Bacteria 833
659 Ga0501240_047523 3300049673 Bacteria 729
660 Ga0501243_110545 3300049675 Bacteria 562
661 Ga0501249_011075 3300049679 Bacteria 1890
662 Ga0501252_008040 3300049682 Bacteria 1206
663 Ga0501257_093279 3300049686 Bacteria 785
664 Ga0501225_0011298 3300049705 Bacteria 2514
665 Ga0501241_042241 3300049758 Bacteria 886
666 Ga0501262_001277 3300049759 Bacteria 2821
667 Ga0501263_016226 3300049760 Bacteria 968
668 Ga0501266_014342 3300049763 Bacteria 1038
669 Ga0501045_0125712 3300049824 Bacteria 1905
670 nmdc:mga03683_301186_c1 3300050489 Bacteria 752
671 nmdc:mga03683_43356_c1 3300050489 Bacteria 1856
672 nmdc:mga03683_44094_c1 3300050489 Bacteria 1842
673 nmdc:mga03683_61087_c1 3300050489 Bacteria 1593
674 nmdc:mga03683_61604_c1 3300050489 Bacteria 1587
675 nmdc:mga03683_77870_c1 3300050489 Bacteria 1427
676 nmdc:mga03n38_27623_c1 3300050490 Bacteria 2356
677 nmdc:mga03n38_502617_c1 3300050490 Bacteria 680
678 nmdc:mga03n38_624113_c1 3300050490 Bacteria 616
679 nmdc:mga03n38_95731_c1 3300050490 Bacteria 1423
680 nmdc:mga00v17_1002146_c1 3300050491 Bacteria 526
681 nmdc:mga00v17_183968_c1 3300050491 Bacteria 1348
682 nmdc:mga00v17_42026_c1 3300050491 Bacteria 2748
683 nmdc:mga00v17_99319_c1 3300050491 Bacteria 1836
684 nmdc:mga0yw44_1031058_c1 3300050492 Bacteria 557
685 nmdc:mga0yw44_25707_c1 3300050492 Bacteria 3353
686 nmdc:mga0yw44_610084_c1 3300050492 Bacteria 741
687 nmdc:mga0k408_10048_c2 3300050493 Bacteria 4754
688 nmdc:mga0k408_130843_c1 3300050493 Bacteria 1490
689 nmdc:mga0k408_165009_c1 3300050493 Bacteria 1320
690 nmdc:mga0k408_195670_c1 3300050493 Bacteria 1207
691 nmdc:mga0k408_201301_c1 3300050493 Bacteria 1189
692 nmdc:mga0k408_27833_c1 3300050493 Bacteria 3212
693 nmdc:mga0k408_352379_c1 3300050493 Bacteria 877
694 nmdc:mga0k408_47120_c1 3300050493 Bacteria 2491
695 nmdc:mga0k408_684552_c1 3300050493 Bacteria 601
696 nmdc:mga0k408_89217_c1 3300050493 Bacteria 1811
697 nmdc:mga06z11_115105_c1 3300050494 Bacteria 1493
698 nmdc:mga06z11_662416_c1 3300050494 Bacteria 636
699 nmdc:mga07m45_19628_c1 3300050496 Bacteria 3664
700 nmdc:mga07m45_229026_c1 3300050496 Bacteria 1081
701 nmdc:mga07m45_24382_c2 3300050496 Bacteria 2726
702 nmdc:mga07m45_259391_c1 3300050496 Bacteria 1011
703 nmdc:mga07m45_280482_c1 3300050496 Bacteria 969
704 nmdc:mga07m45_37266_c1 3300050496 Bacteria 2712
705 nmdc:mga07m45_429736_c1 3300050496 Bacteria 766
706 nmdc:mga07m45_4682_c1 3300050496 Bacteria 6717
707 nmdc:mga07m45_4793_c2 3300050496 Bacteria 3320
708 nmdc:mga07m45_529904_c1 3300050496 Bacteria 682
709 nmdc:mga07m45_582161_c1 3300050496 Bacteria 647
710 nmdc:mga0sz30_107357_c1 3300050516 Bacteria 1222
711 Ga0500610_0065489 3300053079 Bacteria 1894
712 Ga0500610_0137740 3300053079 Bacteria 1235
713 Ga0500643_025657 3300053087 Bacteria 1856
714 Ga0500643_146900 3300053087 Bacteria 633
715 Ga0500646_0151901 3300053090 Bacteria 767
716 Ga0500651_0000320 3300053093 Bacteria 27507
717 Ga0500651_0387672 3300053093 Bacteria 787
718 Ga0500566_0046927 3300053094 Bacteria 2480
719 Ga0500562_037954 3300053108 Bacteria 1279
720 Ga0500571_026066 3300053110 Bacteria 3237
721 Ga0500593_018637 3300053117 Bacteria 3029
722 Ga0500594_0005559 3300053118 Bacteria 2797
723 Ga0500594_0030215 3300053118 Bacteria 1421
724 Ga0500597_137695 3300053120 Bacteria 1053
725 Ga0500607_037082 3300053121 Bacteria 2658
726 Ga0500608_034047 3300053122 Bacteria 2426
727 Ga0500608_058403 3300053122 Bacteria 1847
728 Ga0500618_028274 3300053125 Bacteria 1329
729 Ga0500655_006961 3300053133 Bacteria 2032
730 Ga0500658_0028648 3300053134 Bacteria 2162
731 Ga0500559_0059373 3300053136 Bacteria 1702
732 Ga0500559_0061547 3300053136 Bacteria 1674
733 Ga0500568_0005077 3300053139 Bacteria 6884
734 Ga0500573_0144620 3300053140 Bacteria 1307
735 Ga0500574_016583 3300053141 Bacteria 1782
736 Ga0500590_043771 3300053148 Bacteria 2295
737 Ga0500604_0205190 3300053151 Bacteria 678
738 Ga0500616_0011974 3300053153 Bacteria 5095
739 Ga0500616_0101655 3300053153 Bacteria 1404
740 Ga0500622_0134370 3300053156 Bacteria 1186
741 Ga0500627_0018087 3300053158 Bacteria 2783
742 Ga0500634_0008569 3300053161 Bacteria 5120
743 Ga0500570_044862 3300053724 Bacteria 2276
744 Ga0500625_101117 3300053729 Bacteria 1208
745 Ga0500645_000905 3300053730 Bacteria 17125
746 Ga0590075_015079 3300059424 Bacteria 1894
747 Ga0590075_082095 3300059424 Bacteria 835
748 Ga0587077_033752 3300059493 Bacteria 990
749 Ga0587068_018853 3300059641 Bacteria 1114
750 Ga0587072_192581 3300059643 Bacteria 514

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_101088157 Ga0207675_1010881572 105
2 3300025304 Ga0209257_1050773 Ga0209257_10507733 125
3 3300005353 Ga0070669_100543598 Ga0070669_1005435982 127
4 3300006178 Ga0075367_10133846 Ga0075367_101338462 127
5 3300006353 Ga0075370_10784864 Ga0075370_107848642 127
6 3300006353 Ga0075370_10837161 Ga0075370_108371611 127
7 3300028794 Ga0307515_10001533 Ga0307515_1000153330 127
8 3300028794 Ga0307515_10002409 Ga0307515_1000240923 127
9 3300028794 Ga0307515_10006008 Ga0307515_1000600813 127
10 3300030522 Ga0307512_10036360 Ga0307512_100363602 127
11 3300031456 Ga0307513_10046229 Ga0307513_100462293 127
12 3300031507 Ga0307509_10085882 Ga0307509_100858822 127
13 3300031649 Ga0307514_10167229 Ga0307514_101672292 127
14 3300031730 Ga0307516_10001303 Ga0307516_100013036 127
15 3300041443 Ga0451789_0105499 Ga0451789_0105499_200_583 127
16 3300041443 Ga0451789_0429677 Ga0451789_0429677_161_544 127
17 3300041459 Ga0451800_0987865 Ga0451800_0987865_499_882 127
18 3300041460 Ga0451802_1196336 Ga0451802_1196336_315_698 127
19 3300041486 Ga0451807_0986316 Ga0451807_0986316_470_853 127
20 3300041494 Ga0451837_0229797 Ga0451837_0229797_25_408 127
21 3300041512 Ga0451853_0739295 Ga0451853_0739295_569_952 127
22 3300046512 Ga0495610_0034365 Ga0495610_0034365_610_993 127
23 3300046522 Ga0495643_0035021 Ga0495643_0035021_1163_1546 127
24 3300046683 Ga0495658_0180970 Ga0495658_0180970_38_421 127
25 3300047472 Ga0495686_0007977 Ga0495686_0007977_6279_6662 127
26 3300047472 Ga0495686_0130715 Ga0495686_0130715_213_596 127
27 3300049531 Ga0501315_060434 Ga0501315_060434_12_395 127
28 3300050489 nmdc:mga03683_301186_c1 nmdc:mga03683_301186_c1_318_701 127
29 3300050490 nmdc:mga03n38_624113_c1 nmdc:mga03n38_624113_c1_173_556 127
30 3300050496 nmdc:mga07m45_529904_c1 nmdc:mga07m45_529904_c1_57_440 127
31 3300050496 nmdc:mga07m45_582161_c1 nmdc:mga07m45_582161_c1_132_515 127
32 3300053093 Ga0500651_0387672 Ga0500651_0387672_296_679 127
33 3300053148 Ga0500590_043771 Ga0500590_043771_1305_1688 127
34 3300053724 Ga0500570_044862 Ga0500570_044862_699_1082 127
35 3300005331 Ga0070670_100209538 Ga0070670_1002095382 128
36 3300005543 Ga0070672_100022180 Ga0070672_1000221802 128
37 3300005618 Ga0068864_100801114 Ga0068864_1008011142 128
38 3300006881 Ga0068865_100271368 Ga0068865_1002713682 128
39 3300009098 Ga0105245_10087717 Ga0105245_100877173 128
40 3300009148 Ga0105243_10204752 Ga0105243_102047522 128
41 3300011119 Ga0105246_10169215 Ga0105246_101692153 128
42 3300014745 Ga0157377_10541755 Ga0157377_105417552 128
43 3300025907 Ga0207645_10008421 Ga0207645_100084219 128
44 3300025925 Ga0207650_10114185 Ga0207650_101141852 128
45 3300025927 Ga0207687_10084406 Ga0207687_100844063 128
46 3300025940 Ga0207691_10009910 Ga0207691_100099109 128
47 3300025942 Ga0207689_10018922 Ga0207689_100189225 128
48 3300025960 Ga0207651_10267929 Ga0207651_102679292 128
49 3300025972 Ga0207668_10395558 Ga0207668_103955582 128
50 3300026089 Ga0207648_10041681 Ga0207648_100416813 128
51 3300026116 Ga0207674_10020101 Ga0207674_100201019 128
52 3300026121 Ga0207683_10473562 Ga0207683_104735622 128
53 3300037471 Ga0395905_0856731 Ga0395905_0856731_171_557 128
54 3300048906 Ga0496103_0867225 Ga0496103_0867225_110_496 128
55 3300049569 Ga0501032_0082781 Ga0501032_0082781_434_820 128
56 3300049579 Ga0501043_0000004 Ga0501043_0000004_1146_1532 128
57 3300049580 Ga0501046_0000050 Ga0501046_0000050_78462_78848 128
58 3300049581 Ga0501047_0000012 Ga0501047_0000012_289984_290370 128
59 3300049824 Ga0501045_0125712 Ga0501045_0125712_490_876 128
60 3300005455 Ga0070663_100015443 Ga0070663_1000154435 129
61 3300009176 Ga0105242_11939011 Ga0105242_119390111 129
62 3300013297 Ga0157378_10730720 Ga0157378_107307203 129
63 3300026067 Ga0207678_10028113 Ga0207678_100281133 129
64 3300037471 Ga0395905_1111515 Ga0395905_1111515_194_583 129
65 3300031238 Ga0265332_10000009 Ga0265332_1000000984 132
66 3300042116 Ga0450912_000270 Ga0450912_000270_1739_2173 133
67 3300006042 Ga0075368_10088634 Ga0075368_100886342 135
68 3300006048 Ga0075363_100055360 Ga0075363_1000553602 135
69 3300006177 Ga0075362_10033318 Ga0075362_100333181 135
70 3300006178 Ga0075367_10022549 Ga0075367_100225494 135
71 3300006195 Ga0075366_10106165 Ga0075366_101061653 135
72 3300014497 Ga0182008_10267181 Ga0182008_102671812 135
73 3300050489 nmdc:mga03683_61604_c1 nmdc:mga03683_61604_c1_645_1079 135
74 3300050490 nmdc:mga03n38_27623_c1 nmdc:mga03n38_27623_c1_1394_1828 135
75 3300050492 nmdc:mga0yw44_1031058_c1 nmdc:mga0yw44_1031058_c1_97_531 135
76 3300050494 nmdc:mga06z11_662416_c1 nmdc:mga06z11_662416_c1_97_531 135
77 3300049575 Ga0501039_0994098 Ga0501039_0994098_195_608 136
78 3300049578 Ga0501042_0594241 Ga0501042_0594241_248_661 136
79 3300006946 Ga0079104_1000352 Ga0079104_100035244 138
80 3300027111 Ga0209281_1000454 Ga0209281_100045413 138
81 3300030734 Ga0316179_1005100 Ga0316179_10051002 138
82 3300050493 nmdc:mga0k408_684552_c1 nmdc:mga0k408_684552_c1_61_489 138
83 iso_pu_bacteria 2939631187 2939631894 138
84 3300031344 Ga0265316_10000807 Ga0265316_1000080720 139
85 3300045051 Ga0451576_0289315 Ga0451576_0289315_1111_1530 139
86 3300049580 Ga0501046_0266612 Ga0501046_0266612_635_1081 139
87 iso_pu_bacteria 2904479285 2904483492 139
88 iso_pu_bacteria 2919704043 2919707276 139
89 3300006178 Ga0075367_10533822 Ga0075367_105338222 140
90 3300006195 Ga0075366_10007874 Ga0075366_100078748 140
91 3300006195 Ga0075366_10032122 Ga0075366_100321223 140
92 3300014968 Ga0157379_10015837 Ga0157379_100158373 140
93 3300028381 Ga0268264_10194621 Ga0268264_101946213 140
94 3300028794 Ga0307515_10060740 Ga0307515_100607406 140
95 3300031456 Ga0307513_10003195 Ga0307513_1000319515 140
96 3300031507 Ga0307509_10418108 Ga0307509_104181082 140
97 3300044712 Ga0453684_0138148 Ga0453684_0138148_1599_2021 140
98 3300044712 Ga0453684_1153969 Ga0453684_1153969_252_674 140
99 3300045051 Ga0451576_0034078 Ga0451576_0034078_4375_4797 140
100 3300045051 Ga0451576_0273823 Ga0451576_0273823_587_1009 140
101 3300048912 Ga0496109_0161834 Ga0496109_0161834_1105_1539 140
102 3300050493 nmdc:mga0k408_165009_c1 nmdc:mga0k408_165009_c1_604_1026 140
103 3300050493 nmdc:mga0k408_27833_c1 nmdc:mga0k408_27833_c1_1983_2405 140
104 3300050494 nmdc:mga06z11_115105_c1 nmdc:mga06z11_115105_c1_751_1173 140
105 iso_pu_bacteria 2547132374 2548498095 140
106 iso_pu_bacteria 2643221570 2643867384 140
107 iso_pu_bacteria 2643221596 2643992117 140
108 iso_pu_bacteria 2643221609 2644057270 140
109 iso_pu_bacteria 2643221611 2644071907 140
110 iso_pu_bacteria 2643221652 2644295179 140
111 iso_pu_bacteria 2643221717 2644648621 140
112 iso_pu_bacteria 2738543012 2739246594 140
113 iso_pu_bacteria 2816332133 2816476101 140
114 iso_pu_bacteria 2842718218 2842719694 140
115 iso_pu_bacteria 2974320154 2974323766 140
116 iso_pu_bacteria 2990710928 2990713363 140
117 3300005327 Ga0070658_10735766 Ga0070658_107357661 141
118 3300005338 Ga0068868_100497494 Ga0068868_1004974942 141
119 3300005459 Ga0068867_100786936 Ga0068867_1007869361 141
120 3300005539 Ga0068853_101920814 Ga0068853_1019208141 141
121 3300005544 Ga0070686_101023726 Ga0070686_1010237261 141
122 3300009177 Ga0105248_11029210 Ga0105248_110292102 141
123 3300009177 Ga0105248_11839395 Ga0105248_118393951 141
124 3300012505 Ga0157339_1028301 Ga0157339_10283011 141
125 3300014968 Ga0157379_10931291 Ga0157379_109312911 141
126 3300025941 Ga0207711_11477776 Ga0207711_114777762 141
127 3300025941 Ga0207711_11623034 Ga0207711_116230341 141
128 3300026041 Ga0207639_10707467 Ga0207639_107074671 141
129 3300026089 Ga0207648_10488717 Ga0207648_104887172 141
130 3300026121 Ga0207683_11045162 Ga0207683_110451622 141
131 3300031548 Ga0307408_100450042 Ga0307408_1004500423 141
132 3300041452 Ga0451793_0935927 Ga0451793_0935927_17_463 141
133 3300048911 Ga0496108_0157127 Ga0496108_0157127_644_1072 141
134 iso_pu_bacteria 2881101125 2881105434 141
135 3300005289 Ga0065704_10604065 Ga0065704_106040651 142
136 3300006844 Ga0075428_101379235 Ga0075428_1013792351 142
137 3300015262 Ga0182007_10155895 Ga0182007_101558952 142
138 3300025925 Ga0207650_10327441 Ga0207650_103274412 142
139 3300042005 Ga0439448_0186251 Ga0439448_0186251_220_648 142
140 3300059493 Ga0587077_033752 Ga0587077_033752_282_710 142
141 3300005459 Ga0068867_100846419 Ga0068867_1008464191 143
142 3300031239 Ga0265328_10012736 Ga0265328_100127364 143
143 3300031251 Ga0265327_10000265 Ga0265327_1000026566 143
144 3300031251 Ga0265327_10416844 Ga0265327_104168441 143
145 3300037418 Ga0395900_0280588 Ga0395900_0280588_699_1130 143
146 3300037466 Ga0395898_0327717 Ga0395898_0327717_699_1130 143
147 3300037466 Ga0395898_0859572 Ga0395898_0859572_239_676 143
148 3300037471 Ga0395905_0088667 Ga0395905_0088667_688_1119 143
149 3300037471 Ga0395905_0794164 Ga0395905_0794164_256_693 143
150 3300038443 Ga0395901_0024228 Ga0395901_0024228_916_1347 143
151 3300039447 Ga0436361_0475800 Ga0436361_0475800_1786_2217 143
152 3300044712 Ga0453684_0000279 Ga0453684_0000279_93628_94059 143
153 3300045051 Ga0451576_0040679 Ga0451576_0040679_3585_4016 143
154 3300046528 Ga0495642_0036280 Ga0495642_0036280_368_799 143
155 3300046615 Ga0495656_0024649 Ga0495656_0024649_304_735 143
156 3300046615 Ga0495656_0049212 Ga0495656_0049212_1268_1699 143
157 3300046674 Ga0495588_0107619 Ga0495588_0107619_797_1228 143
158 3300046684 Ga0495669_0162141 Ga0495669_0162141_59_490 143
159 3300047318 Ga0495636_0041036 Ga0495636_0041036_141_572 143
160 3300047447 Ga0495685_011191 Ga0495685_011191_1088_1519 143
161 3300047470 Ga0495681_0130840 Ga0495681_0130840_166_597 143
162 3300048090 Ga0495615_0030313 Ga0495615_0030313_274_705 143
163 3300048090 Ga0495615_0036078 Ga0495615_0036078_244_675 143
164 3300048912 Ga0496109_0355941 Ga0496109_0355941_573_1004 143
165 3300048913 Ga0496110_0215560 Ga0496110_0215560_1290_1721 143
166 3300059424 Ga0590075_015079 Ga0590075_015079_21_452 143
167 iso_pu_bacteria 2738543013 2739248200 143
168 3300005289 Ga0065704_10105629 Ga0065704_101056292 144
169 3300005339 Ga0070660_100329236 Ga0070660_1003292363 144
170 3300005564 Ga0070664_100480219 Ga0070664_1004802193 144
171 3300006051 Ga0075364_10111408 Ga0075364_101114083 144
172 3300009036 Ga0105244_10140800 Ga0105244_101408002 144
173 3300009176 Ga0105242_10059133 Ga0105242_100591333 144
174 3300025728 Ga0207655_1106512 Ga0207655_11065122 144
175 3300025934 Ga0207686_10002907 Ga0207686_100029077 144
176 3300026089 Ga0207648_10861484 Ga0207648_108614842 144
177 3300027424 Ga0209984_1008006 Ga0209984_10080062 144
178 3300027866 Ga0209813_10021743 Ga0209813_100217431 144
179 3300027876 Ga0209974_10014274 Ga0209974_100142743 144
180 3300031548 Ga0307408_100000212 Ga0307408_10000021214 144
181 3300031548 Ga0307408_100253587 Ga0307408_1002535871 144
182 3300031548 Ga0307408_100449462 Ga0307408_1004494622 144
183 3300031901 Ga0307406_10001770 Ga0307406_100017703 144
184 3300031911 Ga0307412_10110281 Ga0307412_101102811 144
185 3300031911 Ga0307412_10523539 Ga0307412_105235392 144
186 3300031911 Ga0307412_10601551 Ga0307412_106015512 144
187 3300032002 Ga0307416_101102156 Ga0307416_1011021562 144
188 3300032005 Ga0307411_10485605 Ga0307411_104856052 144
189 3300037418 Ga0395900_0192655 Ga0395900_0192655_668_1102 144
190 3300037471 Ga0395905_0000684 Ga0395905_0000684_15525_15959 144
191 3300039437 Ga0436365_1063264 Ga0436365_1063264_83_517 144
192 3300041999 Ga0439433_0104744 Ga0439433_0104744_11_445 144
193 3300042007 Ga0439449_0013502 Ga0439449_0013502_1536_1970 144
194 3300042119 Ga0450915_007869 Ga0450915_007869_46_480 144
195 3300042532 Ga0450893_0001916 Ga0450893_0001916_1057_1491 144
196 3300044673 Ga0453683_0154118 Ga0453683_0154118_322_756 144
197 3300045051 Ga0451576_1361369 Ga0451576_1361369_47_481 144
198 3300046542 Ga0495597_0023877 Ga0495597_0023877_1839_2273 144
199 3300048925 Ga0496122_0209278 Ga0496122_0209278_464_898 144
200 3300048928 Ga0496125_0085816 Ga0496125_0085816_1243_1677 144
201 3300048929 Ga0496126_0113187 Ga0496126_0113187_1412_1846 144
202 3300048929 Ga0496126_0376422 Ga0496126_0376422_430_864 144
203 3300049529 Ga0501313_031979 Ga0501313_031979_236_670 144
204 3300050491 nmdc:mga00v17_99319_c1 nmdc:mga00v17_99319_c1_149_583 144
205 3300050493 nmdc:mga0k408_201301_c1 nmdc:mga0k408_201301_c1_674_1108 144
206 3300050496 nmdc:mga07m45_259391_c1 nmdc:mga07m45_259391_c1_28_462 144
207 iso_pu_bacteria 2513020051 2513227832 144
208 iso_pu_bacteria 2599185214 2599628042 144
209 iso_pu_bacteria 2599185226 2599677906 144
210 iso_pu_bacteria 2599185227 2599684410 144
211 iso_pu_bacteria 2599185229 2599697554 144
212 iso_pu_bacteria 2643221628 2644162426 144
213 iso_pu_bacteria 2643221658 2644324595 144
214 iso_pu_bacteria 2643221672 2644396447 144
215 iso_pu_bacteria 2643221683 2644464522 144
216 iso_pu_bacteria 2738541277 2738719041 144
217 iso_pu_bacteria 2738541307 2738880062 144
218 iso_pu_bacteria 2738543019 2739281803 144
219 iso_pu_bacteria 2818991446 2819599527 144
220 iso_pu_bacteria 2831265667 2831271200 144
221 iso_pu_bacteria 2838054893 2838055788 144
222 iso_pu_bacteria 2842677519 2842682036 144
223 iso_pu_bacteria 2842733646 2842734339 144
224 iso_pu_bacteria 2842747753 2842749411 144
225 iso_pu_bacteria 2885192300 2885197924 144
226 iso_pu_bacteria 2885198086 2885200660 144
227 iso_pu_bacteria 2885211737 2885214557 144
228 iso_pu_bacteria 2899924645 2899928014 144
229 iso_pu_bacteria 2904449895 2904450489 144
230 iso_pu_bacteria 2904456579 2904456688 144
231 iso_pu_bacteria 2904541872 2904544466 144
232 iso_pu_bacteria 2919462493 2919462972 144
233 iso_pu_bacteria 2928037797 2928041879 144
234 iso_pu_bacteria 2928044640 2928049443 144
235 iso_pu_bacteria 2928051484 2928051881 144
236 iso_pu_bacteria 2928064002 2928065426 144
237 iso_pu_bacteria 2928070936 2928076475 144
238 iso_pu_bacteria 2928084124 2928086660 144
239 iso_pu_bacteria 2929160207 2929161964 144
240 iso_pu_bacteria 2929520902 2929521204 144
241 iso_pu_bacteria 2945909444 2945913626 144
242 iso_pu_bacteria 2945945610 2945949224 144
243 iso_pu_bacteria 2945972063 2945973267 144
244 iso_pu_bacteria 2945984333 2945990976 144
245 iso_pu_bacteria 2954767861 2954768588 144
246 3300005353 Ga0070669_100080492 Ga0070669_1000804923 145
247 3300005356 Ga0070674_100140513 Ga0070674_1001405133 145
248 3300005364 Ga0070673_100435635 Ga0070673_1004356352 145
249 3300005459 Ga0068867_100193694 Ga0068867_1001936942 145
250 3300005543 Ga0070672_100953870 Ga0070672_1009538702 145
251 3300009148 Ga0105243_10499014 Ga0105243_104990142 145
252 3300009177 Ga0105248_10260589 Ga0105248_102605893 145
253 3300014326 Ga0157380_10235022 Ga0157380_102350223 145
254 3300025923 Ga0207681_10065858 Ga0207681_100658583 145
255 3300025926 Ga0207659_10131250 Ga0207659_101312502 145
256 3300025935 Ga0207709_10286880 Ga0207709_102868802 145
257 3300025941 Ga0207711_10505536 Ga0207711_105055362 145
258 3300025972 Ga0207668_10102125 Ga0207668_101021252 145
259 3300026089 Ga0207648_10329343 Ga0207648_103293432 145
260 3300027360 Ga0209969_1038395 Ga0209969_10383952 145
261 3300031548 Ga0307408_100084823 Ga0307408_1000848233 145
262 3300031995 Ga0307409_100579626 Ga0307409_1005796263 145
263 3300031995 Ga0307409_102504313 Ga0307409_1025043131 145
264 3300032126 Ga0307415_100799540 Ga0307415_1007995401 145
265 3300046525 Ga0495663_0156013 Ga0495663_0156013_238_678 145
266 3300046537 Ga0495598_0003877 Ga0495598_0003877_128_568 145
267 3300046537 Ga0495598_0235324 Ga0495598_0235324_67_507 145
268 3300046539 Ga0495621_0163479 Ga0495621_0163479_121_561 145
269 3300049571 Ga0501034_0096457 Ga0501034_0096457_1897_2334 145
270 3300049673 Ga0501240_047523 Ga0501240_047523_149_586 145
271 3300049686 Ga0501257_093279 Ga0501257_093279_298_738 145
272 3300005840 Ga0068870_10661068 Ga0068870_106610682 146
273 3300012502 Ga0157347_1001697 Ga0157347_10016972 146
274 3300013104 Ga0157370_10034122 Ga0157370_100341225 146
275 3300014497 Ga0182008_10117999 Ga0182008_101179992 146
276 3300046453 Ga0495627_012911 Ga0495627_012911_1649_2179 146
277 3300046512 Ga0495610_0192671 Ga0495610_0192671_184_714 146
278 3300046515 Ga0495620_0021223 Ga0495620_0021223_942_1472 146
279 3300046520 Ga0495637_0004432 Ga0495637_0004432_5461_5991 146
280 3300046530 Ga0495654_0061750 Ga0495654_0061750_665_1195 146
281 3300046538 Ga0495609_0174232 Ga0495609_0174232_189_719 146
282 3300046660 Ga0495625_0188068 Ga0495625_0188068_230_760 146
283 3300046665 Ga0495661_0141168 Ga0495661_0141168_111_641 146
284 3300046674 Ga0495588_0093008 Ga0495588_0093008_666_1196 146
285 3300046691 Ga0495670_0329297 Ga0495670_0329297_69_599 146
286 3300046692 Ga0495671_0080973 Ga0495671_0080973_444_974 146
287 3300046810 Ga0495660_0189213 Ga0495660_0189213_380_910 146
288 3300047445 Ga0495677_0125377 Ga0495677_0125377_385_915 146
289 3300053079 Ga0500610_0065489 Ga0500610_0065489_435_965 146
290 3300053117 Ga0500593_018637 Ga0500593_018637_1226_1756 146
291 3300053158 Ga0500627_0018087 Ga0500627_0018087_713_1243 146
292 3300059424 Ga0590075_082095 Ga0590075_082095_114_554 146
293 3300002987 JGI25159J45721_1022446 JGI25159J45721_10224462 147
294 3300003781 Ga0055536_1028385 Ga0055536_10283853 147
295 3300003784 Ga0055534_1002585 Ga0055534_10025854 147
296 3300003792 Ga0055540_1032059 Ga0055540_10320592 147
297 3300005262 Ga0065165_1047188 Ga0065165_10471881 147
298 3300005335 Ga0070666_10232948 Ga0070666_102329482 147
299 3300005616 Ga0068852_101065617 Ga0068852_1010656172 147
300 3300025273 Ga0209673_1090236 Ga0209673_10902362 147
301 3300025284 Ga0209130_1005537 Ga0209130_10055374 147
302 3300025291 Ga0209675_1001188 Ga0209675_10011885 147
303 3300025291 Ga0209675_1002968 Ga0209675_10029689 147
304 3300025292 Ga0209676_1025250 Ga0209676_10252502 147
305 3300025294 Ga0209025_1036750 Ga0209025_10367503 147
306 3300025295 Ga0209564_1060202 Ga0209564_10602022 147
307 3300025298 Ga0209050_1020859 Ga0209050_10208593 147
308 3300025298 Ga0209050_1053439 Ga0209050_10534392 147
309 3300025304 Ga0209257_1023311 Ga0209257_10233113 147
310 3300028794 Ga0307515_10000084 Ga0307515_1000008473 147
311 3300031456 Ga0307513_10030898 Ga0307513_100308984 147
312 3300031649 Ga0307514_10000319 Ga0307514_1000031991 147
313 3300042004 Ga0439445_0043375 Ga0439445_0043375_684_1127 147
314 3300042006 Ga0439432_065536 Ga0439432_065536_95_538 147
315 3300042007 Ga0439449_0019230 Ga0439449_0019230_1336_1779 147
316 3300042157 Ga0439458_0090855 Ga0439458_0090855_24_467 147
317 3300044712 Ga0453684_0512651 Ga0453684_0512651_715_1158 147
318 3300044712 Ga0453684_0559836 Ga0453684_0559836_108_551 147
319 3300046530 Ga0495654_0022887 Ga0495654_0022887_996_1439 147
320 3300048919 Ga0496116_0027214 Ga0496116_0027214_2362_2805 147
321 3300048920 Ga0496117_0125747 Ga0496117_0125747_670_1113 147
322 3300048924 Ga0496121_0088556 Ga0496121_0088556_1454_1897 147
323 3300048925 Ga0496122_0160871 Ga0496122_0160871_430_873 147
324 3300048926 Ga0496123_0107769 Ga0496123_0107769_194_637 147
325 3300050491 nmdc:mga00v17_1002146_c1 nmdc:mga00v17_1002146_c1_19_462 147
326 3300053151 Ga0500604_0205190 Ga0500604_0205190_71_514 147
327 3300053729 Ga0500625_101117 Ga0500625_101117_206_649 147
328 3300059641 Ga0587068_018853 Ga0587068_018853_184_627 147
329 2162886007 SwRhRL2b_contig_2102642 SwRhRL2b_0540.00001200 148
330 3300001979 JGI24740J21852_10008467 JGI24740J21852_100084673 148
331 3300001989 JGI24739J22299_10011968 JGI24739J22299_100119683 148
332 3300001989 JGI24739J22299_10045358 JGI24739J22299_100453582 148
333 3300002739 JGI25158J39367_1001940 JGI25158J39367_10019402 148
334 3300002773 JGI25152J39213_1013797 JGI25152J39213_10137973 148
335 3300002987 JGI25159J45721_1002846 JGI25159J45721_10028466 148
336 3300003187 JGI25151J46595_10010462 JGI25151J46595_100104623 148
337 3300003187 JGI25151J46595_10017524 JGI25151J46595_100175243 148
338 3300003316 rootH1_10001241 rootH1_100012414 148
339 3300003578 Ga0006562J51391_1020771 Ga0006562J51391_10207711 148
340 3300003760 Ga0055527_1016974 Ga0055527_10169741 148
341 3300003761 Ga0055535_1000915 Ga0055535_10009157 148
342 3300003762 Ga0055542_1000901 Ga0055542_100090113 148
343 3300003773 Ga0055537_1000434 Ga0055537_100043416 148
344 3300003773 Ga0055537_1005360 Ga0055537_10053602 148
345 3300003781 Ga0055536_1009331 Ga0055536_10093313 148
346 3300003781 Ga0055536_1012171 Ga0055536_10121713 148
347 3300003784 Ga0055534_1000642 Ga0055534_100064210 148
348 3300003784 Ga0055534_1006069 Ga0055534_10060693 148
349 3300003790 Ga0055528_1007422 Ga0055528_10074225 148
350 3300003790 Ga0055528_1011740 Ga0055528_10117402 148
351 3300003791 Ga0055530_10000766 Ga0055530_1000076617 148
352 3300003792 Ga0055540_1000627 Ga0055540_100062720 148
353 3300003792 Ga0055540_1004190 Ga0055540_10041907 148
354 3300003792 Ga0055540_1007670 Ga0055540_10076704 148
355 3300003792 Ga0055540_1040650 Ga0055540_10406501 148
356 3300003794 Ga0055531_10000886 Ga0055531_100008863 148
357 3300005288 Ga0065714_10011357 Ga0065714_100113572 148
358 3300005288 Ga0065714_10045960 Ga0065714_100459602 148
359 3300005288 Ga0065714_10142497 Ga0065714_101424972 148
360 3300005289 Ga0065704_10102546 Ga0065704_101025462 148
361 3300005327 Ga0070658_10973184 Ga0070658_109731841 148
362 3300005328 Ga0070676_10111818 Ga0070676_101118182 148
363 3300005328 Ga0070676_10250317 Ga0070676_102503172 148
364 3300005333 Ga0070677_10561824 Ga0070677_105618241 148
365 3300005334 Ga0068869_101489403 Ga0068869_1014894031 148
366 3300005344 Ga0070661_100121297 Ga0070661_1001212973 148
367 3300005347 Ga0070668_100504378 Ga0070668_1005043781 148
368 3300005353 Ga0070669_100737984 Ga0070669_1007379842 148
369 3300005355 Ga0070671_101436938 Ga0070671_1014369381 148
370 3300005356 Ga0070674_100463937 Ga0070674_1004639372 148
371 3300005356 Ga0070674_101317476 Ga0070674_1013174762 148
372 3300005365 Ga0070688_100741620 Ga0070688_1007416202 148
373 3300005366 Ga0070659_100892356 Ga0070659_1008923561 148
374 3300005366 Ga0070659_100899088 Ga0070659_1008990881 148
375 3300005367 Ga0070667_100781907 Ga0070667_1007819072 148
376 3300005456 Ga0070678_100073651 Ga0070678_1000736512 148
377 3300005456 Ga0070678_100186951 Ga0070678_1001869511 148
378 3300005456 Ga0070678_102012601 Ga0070678_1020126011 148
379 3300005457 Ga0070662_100027489 Ga0070662_1000274891 148
380 3300005457 Ga0070662_100586525 Ga0070662_1005865252 148
381 3300005457 Ga0070662_101355771 Ga0070662_1013557711 148
382 3300005539 Ga0068853_100116871 Ga0068853_1001168713 148
383 3300005539 Ga0068853_100171685 Ga0068853_1001716851 148
384 3300005539 Ga0068853_101038327 Ga0068853_1010383271 148
385 3300005548 Ga0070665_100027496 Ga0070665_1000274965 148
386 3300005548 Ga0070665_100128685 Ga0070665_1001286853 148
387 3300005577 Ga0068857_100125184 Ga0068857_1001251843 148
388 3300005577 Ga0068857_100279447 Ga0068857_1002794472 148
389 3300005578 Ga0068854_100119507 Ga0068854_1001195072 148
390 3300005834 Ga0068851_10046255 Ga0068851_100462551 148
391 3300006038 Ga0075365_10041456 Ga0075365_100414563 148
392 3300006058 Ga0075432_10015748 Ga0075432_100157483 148
393 3300006178 Ga0075367_10035248 Ga0075367_100352484 148
394 3300006178 Ga0075367_10387785 Ga0075367_103877852 148
395 3300006178 Ga0075367_10430608 Ga0075367_104306081 148
396 3300006186 Ga0075369_10065903 Ga0075369_100659032 148
397 3300006195 Ga0075366_10009033 Ga0075366_100090335 148
398 3300006195 Ga0075366_10046737 Ga0075366_100467372 148
399 3300006195 Ga0075366_10056276 Ga0075366_100562763 148
400 3300006195 Ga0075366_10131834 Ga0075366_101318342 148
401 3300006195 Ga0075366_10147222 Ga0075366_101472223 148
402 3300006195 Ga0075366_10251640 Ga0075366_102516402 148
403 3300006195 Ga0075366_10469961 Ga0075366_104699612 148
404 3300006195 Ga0075366_10525961 Ga0075366_105259611 148
405 3300006237 Ga0097621_100199672 Ga0097621_1001996723 148
406 3300006353 Ga0075370_10003137 Ga0075370_100031377 148
407 3300006353 Ga0075370_10006880 Ga0075370_100068807 148
408 3300006353 Ga0075370_10010283 Ga0075370_100102836 148
409 3300006353 Ga0075370_10043670 Ga0075370_100436703 148
410 3300006353 Ga0075370_10082572 Ga0075370_100825723 148
411 3300006353 Ga0075370_10240237 Ga0075370_102402372 148
412 3300006353 Ga0075370_10337993 Ga0075370_103379932 148
413 3300006358 Ga0068871_100271477 Ga0068871_1002714772 148
414 3300006358 Ga0068871_101511774 Ga0068871_1015117742 148
415 3300006946 Ga0079104_1019560 Ga0079104_10195603 148
416 3300006948 Ga0099826_10023210 Ga0099826_100232105 148
417 3300006948 Ga0099826_10137953 Ga0099826_101379532 148
418 3300009011 Ga0105251_10275993 Ga0105251_102759931 148
419 3300009036 Ga0105244_10007704 Ga0105244_100077047 148
420 3300009093 Ga0105240_10675681 Ga0105240_106756811 148
421 3300009093 Ga0105240_11802305 Ga0105240_118023051 148
422 3300009098 Ga0105245_10472172 Ga0105245_104721723 148
423 3300009098 Ga0105245_10568229 Ga0105245_105682292 148
424 3300009148 Ga0105243_10012218 Ga0105243_100122187 148
425 3300009148 Ga0105243_10111039 Ga0105243_101110392 148
426 3300009148 Ga0105243_10446579 Ga0105243_104465792 148
427 3300009176 Ga0105242_10217332 Ga0105242_102173323 148
428 3300009176 Ga0105242_10410867 Ga0105242_104108672 148
429 3300009176 Ga0105242_10761921 Ga0105242_107619212 148
430 3300009176 Ga0105242_12448149 Ga0105242_124481491 148
431 3300009177 Ga0105248_10328967 Ga0105248_103289672 148
432 3300009551 Ga0105238_10249886 Ga0105238_102498861 148
433 3300009551 Ga0105238_10445272 Ga0105238_104452722 148
434 3300009553 Ga0105249_11520563 Ga0105249_115205632 148
435 3300010375 Ga0105239_10381641 Ga0105239_103816412 148
436 3300013100 Ga0157373_10186710 Ga0157373_101867102 148
437 3300013100 Ga0157373_10238746 Ga0157373_102387462 148
438 3300013100 Ga0157373_11324862 Ga0157373_113248621 148
439 3300013102 Ga0157371_10672575 Ga0157371_106725752 148
440 3300013104 Ga0157370_10145499 Ga0157370_101454991 148
441 3300013104 Ga0157370_11439698 Ga0157370_114396981 148
442 3300013105 Ga0157369_10001553 Ga0157369_1000155315 148
443 3300013297 Ga0157378_10946539 Ga0157378_109465391 148
444 3300013297 Ga0157378_11820854 Ga0157378_118208541 148
445 3300013306 Ga0163162_10243785 Ga0163162_102437853 148
446 3300013306 Ga0163162_10621430 Ga0163162_106214302 148
447 3300013306 Ga0163162_11918623 Ga0163162_119186231 148
448 3300013308 Ga0157375_10462063 Ga0157375_104620631 148
449 3300013308 Ga0157375_10568070 Ga0157375_105680701 148
450 3300014497 Ga0182008_10003672 Ga0182008_100036728 148
451 3300014497 Ga0182008_10007571 Ga0182008_100075713 148
452 3300014497 Ga0182008_10024300 Ga0182008_100243003 148
453 3300014497 Ga0182008_10042374 Ga0182008_100423743 148
454 3300014497 Ga0182008_10126990 Ga0182008_101269902 148
455 3300014969 Ga0157376_10304247 Ga0157376_103042472 148
456 3300014969 Ga0157376_10358955 Ga0157376_103589552 148
457 3300014969 Ga0157376_10542338 Ga0157376_105423382 148
458 3300015261 Ga0182006_1006815 Ga0182006_10068157 148
459 3300015261 Ga0182006_1038851 Ga0182006_10388513 148
460 3300015261 Ga0182006_1080934 Ga0182006_10809342 148
461 3300015262 Ga0182007_10018708 Ga0182007_100187083 148
462 3300015265 Ga0182005_1233170 Ga0182005_12331701 148
463 3300015683 Ga0183362_10001 Ga0183362_1000193 148
464 3300017792 Ga0163161_10040028 Ga0163161_100400283 148
465 3300017792 Ga0163161_10047665 Ga0163161_100476653 148
466 3300017792 Ga0163161_10085111 Ga0163161_100851113 148
467 3300017792 Ga0163161_10423851 Ga0163161_104238513 148
468 3300025208 Ga0209436_116559 Ga0209436_1165591 148
469 3300025228 Ga0209672_101606 Ga0209672_1016062 148
470 3300025229 Ga0209147_100909 Ga0209147_1009098 148
471 3300025242 Ga0209258_100009 Ga0209258_100009657 148
472 3300025245 Ga0207425_1000361 Ga0207425_10003616 148
473 3300025245 Ga0207425_1040224 Ga0207425_10402241 148
474 3300025254 Ga0209148_1000007 Ga0209148_1000007657 148
475 3300025258 Ga0209129_1000013 Ga0209129_10000138 148
476 3300025258 Ga0209129_1003406 Ga0209129_10034063 148
477 3300025258 Ga0209129_1022451 Ga0209129_10224512 148
478 3300025263 Ga0209565_1000046 Ga0209565_100004610 148
479 3300025263 Ga0209565_1002375 Ga0209565_10023753 148
480 3300025273 Ga0209673_1000053 Ga0209673_100005368 148
481 3300025273 Ga0209673_1000245 Ga0209673_100024591 148
482 3300025273 Ga0209673_1003160 Ga0209673_10031607 148
483 3300025284 Ga0209130_1002075 Ga0209130_10020756 148
484 3300025284 Ga0209130_1003101 Ga0209130_10031016 148
485 3300025291 Ga0209675_1000010 Ga0209675_1000010349 148
486 3300025292 Ga0209676_1000108 Ga0209676_100010857 148
487 3300025292 Ga0209676_1000939 Ga0209676_100093931 148
488 3300025292 Ga0209676_1001659 Ga0209676_100165912 148
489 3300025294 Ga0209025_1000972 Ga0209025_100097232 148
490 3300025294 Ga0209025_1003456 Ga0209025_10034564 148
491 3300025294 Ga0209025_1006031 Ga0209025_10060317 148
492 3300025294 Ga0209025_1008558 Ga0209025_10085583 148
493 3300025294 Ga0209025_1037753 Ga0209025_10377533 148
494 3300025294 Ga0209025_1043546 Ga0209025_10435463 148
495 3300025295 Ga0209564_1005295 Ga0209564_10052956 148
496 3300025295 Ga0209564_1005299 Ga0209564_10052996 148
497 3300025295 Ga0209564_1052293 Ga0209564_10522932 148
498 3300025297 Ga0209758_1000067 Ga0209758_1000067247 148
499 3300025297 Ga0209758_1005404 Ga0209758_10054047 148
500 3300025298 Ga0209050_1000002 Ga0209050_1000002315 148
501 3300025298 Ga0209050_1007827 Ga0209050_10078273 148
502 3300025299 Ga0209256_1000077 Ga0209256_1000077250 148
503 3300025299 Ga0209256_1000673 Ga0209256_10006738 148
504 3300025299 Ga0209256_1030279 Ga0209256_10302792 148
505 3300025302 Ga0207426_1000101 Ga0207426_10001018 148
506 3300025302 Ga0207426_1000129 Ga0207426_10001298 148
507 3300025303 Ga0209051_1000002 Ga0209051_100000283 148
508 3300025303 Ga0209051_1000486 Ga0209051_10004863 148
509 3300025303 Ga0209051_1001944 Ga0209051_100194411 148
510 3300025303 Ga0209051_1003369 Ga0209051_10033696 148
511 3300025304 Ga0209257_1000002 Ga0209257_1000002224 148
512 3300025304 Ga0209257_1000713 Ga0209257_10007133 148
513 3300025304 Ga0209257_1025850 Ga0209257_10258502 148
514 3300025321 Ga0207656_10022267 Ga0207656_100222673 148
515 3300025728 Ga0207655_1004198 Ga0207655_10041985 148
516 3300025893 Ga0207682_10021464 Ga0207682_100214643 148
517 3300025907 Ga0207645_10204884 Ga0207645_102048842 148
518 3300025913 Ga0207695_10138617 Ga0207695_101386173 148
519 3300025914 Ga0207671_10398338 Ga0207671_103983382 148
520 3300025920 Ga0207649_10097006 Ga0207649_100970063 148
521 3300025923 Ga0207681_10007278 Ga0207681_100072787 148
522 3300025924 Ga0207694_10673713 Ga0207694_106737132 148
523 3300025927 Ga0207687_10382893 Ga0207687_103828932 148
524 3300025927 Ga0207687_10514604 Ga0207687_105146041 148
525 3300025931 Ga0207644_11296688 Ga0207644_112966881 148
526 3300025933 Ga0207706_10086975 Ga0207706_100869753 148
527 3300025933 Ga0207706_10725604 Ga0207706_107256041 148
528 3300025934 Ga0207686_10158559 Ga0207686_101585593 148
529 3300025934 Ga0207686_10395459 Ga0207686_103954592 148
530 3300025935 Ga0207709_10002996 Ga0207709_100029967 148
531 3300025935 Ga0207709_10012695 Ga0207709_100126952 148
532 3300025935 Ga0207709_10049858 Ga0207709_100498582 148
533 3300025935 Ga0207709_10276942 Ga0207709_102769422 148
534 3300025941 Ga0207711_10903555 Ga0207711_109035552 148
535 3300025942 Ga0207689_10232015 Ga0207689_102320152 148
536 3300025945 Ga0207679_10019534 Ga0207679_100195343 148
537 3300025972 Ga0207668_10910963 Ga0207668_109109632 148
538 3300025972 Ga0207668_11383279 Ga0207668_113832792 148
539 3300025981 Ga0207640_10575407 Ga0207640_105754071 148
540 3300026041 Ga0207639_10105322 Ga0207639_101053222 148
541 3300026041 Ga0207639_10401897 Ga0207639_104018971 148
542 3300026041 Ga0207639_10900626 Ga0207639_109006261 148
543 3300026089 Ga0207648_10222017 Ga0207648_102220173 148
544 3300026116 Ga0207674_10372754 Ga0207674_103727541 148
545 3300026116 Ga0207674_10560792 Ga0207674_105607922 148
546 3300026118 Ga0207675_101689278 Ga0207675_1016892782 148
547 3300026121 Ga0207683_10042716 Ga0207683_100427163 148
548 3300026121 Ga0207683_10344630 Ga0207683_103446302 148
549 3300026142 Ga0207698_10077776 Ga0207698_100777763 148
550 3300027666 Ga0209282_1005624 Ga0209282_10056245 148
551 3300027666 Ga0209282_1189223 Ga0209282_11892232 148
552 3300027666 Ga0209282_1236474 Ga0209282_12364741 148
553 3300028379 Ga0268266_10217130 Ga0268266_102171302 148
554 3300028380 Ga0268265_10297538 Ga0268265_102975383 148
555 3300028794 Ga0307515_10000265 Ga0307515_10000265110 148
556 3300028794 Ga0307515_10276687 Ga0307515_102766872 148
557 3300028794 Ga0307515_10615324 Ga0307515_106153242 148
558 3300030731 Ga0316177_1080873 Ga0316177_10808731 148
559 3300030735 Ga0316178_1049689 Ga0316178_10496893 148
560 3300030742 Ga0316183_1121951 Ga0316183_11219513 148
561 3300030742 Ga0316183_1122991 Ga0316183_11229912 148
562 3300030744 Ga0316181_1013012 Ga0316181_10130122 148
563 3300030744 Ga0316181_1140675 Ga0316181_11406753 148
564 3300030745 Ga0316182_1117672 Ga0316182_11176722 148
565 3300030745 Ga0316182_1372344 Ga0316182_13723442 148
566 3300031251 Ga0265327_10006033 Ga0265327_100060333 148
567 3300031251 Ga0265327_10013589 Ga0265327_100135896 148
568 3300031456 Ga0307513_10151665 Ga0307513_101516653 148
569 3300031456 Ga0307513_10184416 Ga0307513_101844162 148
570 3300031456 Ga0307513_10237417 Ga0307513_102374173 148
571 3300031548 Ga0307408_100056587 Ga0307408_1000565872 148
572 3300031548 Ga0307408_100142864 Ga0307408_1001428642 148
573 3300031548 Ga0307408_100571338 Ga0307408_1005713382 148
574 3300031548 Ga0307408_101198026 Ga0307408_1011980262 148
575 3300031649 Ga0307514_10047701 Ga0307514_100477013 148
576 3300031731 Ga0307405_10089605 Ga0307405_100896051 148
577 3300031852 Ga0307410_11099814 Ga0307410_110998142 148
578 3300031901 Ga0307406_10142959 Ga0307406_101429593 148
579 3300031903 Ga0307407_10189449 Ga0307407_101894492 148
580 3300031911 Ga0307412_10123758 Ga0307412_101237582 148
581 3300031911 Ga0307412_10242213 Ga0307412_102422132 148
582 3300031911 Ga0307412_10319026 Ga0307412_103190262 148
583 3300031995 Ga0307409_100294255 Ga0307409_1002942552 148
584 3300031995 Ga0307409_101859435 Ga0307409_1018594351 148
585 3300032002 Ga0307416_100529199 Ga0307416_1005291992 148
586 3300032004 Ga0307414_10310981 Ga0307414_103109811 148
587 3300032005 Ga0307411_10191797 Ga0307411_101917973 148
588 3300035172 Ga0373955_0260624 Ga0373955_0260624_35_481 148
589 3300035691 Ga0373931_0091312 Ga0373931_0091312_950_1396 148
590 3300041404 Ga0439436_0008676 Ga0439436_0008676_1201_1647 148
591 3300041404 Ga0439436_0020697 Ga0439436_0020697_680_1126 148
592 3300041404 Ga0439436_0061047 Ga0439436_0061047_356_802 148
593 3300041406 Ga0439439_0014097 Ga0439439_0014097_1120_1566 148
594 3300041411 Ga0439466_0009224 Ga0439466_0009224_107_553 148
595 3300041411 Ga0439466_0024000 Ga0439466_0024000_925_1371 148
596 3300041413 Ga0439465_0014650 Ga0439465_0014650_1640_2086 148
597 3300041451 Ga0451791_1601473 Ga0451791_1601473_122_568 148
598 3300041486 Ga0451807_2262088 Ga0451807_2262088_128_574 148
599 3300041486 Ga0451807_2369752 Ga0451807_2369752_387_833 148
600 3300041491 Ga0451833_0165364 Ga0451833_0165364_51_497 148
601 3300041491 Ga0451833_0197438 Ga0451833_0197438_292_738 148
602 3300041492 Ga0451835_0341183 Ga0451835_0341183_25_471 148
603 3300041494 Ga0451837_1274579 Ga0451837_1274579_16_462 148
604 3300041496 Ga0451839_0313766 Ga0451839_0313766_345_791 148
605 3300041509 Ga0451843_1265110 Ga0451843_1265110_381_827 148
606 3300041997 Ga0439431_0000653 Ga0439431_0000653_5831_6277 148
607 3300041997 Ga0439431_0195562 Ga0439431_0195562_91_537 148
608 3300041999 Ga0439433_0007603 Ga0439433_0007603_559_1005 148
609 3300041999 Ga0439433_0015194 Ga0439433_0015194_884_1330 148
610 3300042002 Ga0439442_007595 Ga0439442_007595_476_922 148
611 3300042002 Ga0439442_010111 Ga0439442_010111_681_1127 148
612 3300042002 Ga0439442_048893 Ga0439442_048893_401_847 148
613 3300042004 Ga0439445_0014046 Ga0439445_0014046_763_1209 148
614 3300042004 Ga0439445_0026402 Ga0439445_0026402_279_725 148
615 3300042006 Ga0439432_008521 Ga0439432_008521_1858_2304 148
616 3300042006 Ga0439432_015233 Ga0439432_015233_708_1154 148
617 3300042007 Ga0439449_0003558 Ga0439449_0003558_1979_2425 148
618 3300042007 Ga0439449_0010488 Ga0439449_0010488_557_1003 148
619 3300042010 Ga0439452_004068 Ga0439452_004068_3960_4406 148
620 3300042010 Ga0439452_039693 Ga0439452_039693_333_779 148
621 3300042012 Ga0439455_0036889 Ga0439455_0036889_210_656 148
622 3300042014 Ga0439457_062297 Ga0439457_062297_262_708 148
623 3300042015 Ga0439462_0006627 Ga0439462_0006627_836_1282 148
624 3300042015 Ga0439462_0033034 Ga0439462_0033034_506_952 148
625 3300042115 Ga0450911_000987 Ga0450911_000987_6220_6666 148
626 3300042121 Ga0450919_005464 Ga0450919_005464_359_805 148
627 3300042125 Ga0450923_013370 Ga0450923_013370_630_1076 148
628 3300042128 Ga0450897_009772 Ga0450897_009772_341_787 148
629 3300042131 Ga0450894_034120 Ga0450894_034120_224_670 148
630 3300042132 Ga0450895_013492 Ga0450895_013492_230_676 148
631 3300042133 Ga0450896_034894 Ga0450896_034894_110_556 148
632 3300042133 Ga0450896_052281 Ga0450896_052281_62_508 148
633 3300042135 Ga0450899_002488 Ga0450899_002488_558_1004 148
634 3300042145 Ga0450906_007435 Ga0450906_007435_1678_2124 148
635 3300042145 Ga0450906_007849 Ga0450906_007849_176_622 148
636 3300042146 Ga0450907_021420 Ga0450907_021420_280_726 148
637 3300042147 Ga0450910_006050 Ga0450910_006050_978_1424 148
638 3300042147 Ga0450910_019376 Ga0450910_019376_61_507 148
639 3300042156 Ga0439446_0018615 Ga0439446_0018615_960_1406 148
640 3300042184 Ga0450908_008969 Ga0450908_008969_664_1110 148
641 3300042435 Ga0439434_0008577 Ga0439434_0008577_1921_2367 148
642 3300042435 Ga0439434_0046306 Ga0439434_0046306_694_1140 148
643 3300042436 Ga0439435_0186508 Ga0439435_0186508_74_520 148
644 3300042531 Ga0450918_001307 Ga0450918_001307_1333_1779 148
645 3300042532 Ga0450893_0021580 Ga0450893_0021580_192_638 148
646 3300044683 Ga0466965_0021670 Ga0466965_0021670_640_1086 148
647 3300044901 Ga0466960_0168748 Ga0466960_0168748_290_736 148
648 3300046453 Ga0495627_072617 Ga0495627_072617_149_595 148
649 3300046460 Ga0495638_0046107 Ga0495638_0046107_1682_2128 148
650 3300046475 Ga0495639_0040524 Ga0495639_0040524_491_937 148
651 3300046506 Ga0495583_0187589 Ga0495583_0187589_311_757 148
652 3300046512 Ga0495610_0018506 Ga0495610_0018506_2857_3303 148
653 3300046513 Ga0495616_0027760 Ga0495616_0027760_1837_2283 148
654 3300046515 Ga0495620_0141524 Ga0495620_0141524_208_654 148
655 3300046517 Ga0495630_0932356 Ga0495630_0932356_11_457 148
656 3300046518 Ga0495631_0019187 Ga0495631_0019187_1087_1533 148
657 3300046518 Ga0495631_0376554 Ga0495631_0376554_104_550 148
658 3300046520 Ga0495637_0076588 Ga0495637_0076588_140_586 148
659 3300046522 Ga0495643_0084710 Ga0495643_0084710_605_1051 148
660 3300046524 Ga0495648_0373022 Ga0495648_0373022_49_495 148
661 3300046525 Ga0495663_0055242 Ga0495663_0055242_479_925 148
662 3300046526 Ga0495666_0227473 Ga0495666_0227473_197_643 148
663 3300046530 Ga0495654_0051519 Ga0495654_0051519_1385_1831 148
664 3300046535 Ga0495586_0710971 Ga0495586_0710971_93_539 148
665 3300046539 Ga0495621_0124571 Ga0495621_0124571_255_701 148
666 3300046543 Ga0495645_0112520 Ga0495645_0112520_694_1140 148
667 3300046557 Ga0495622_0136565 Ga0495622_0136565_47_493 148
668 3300046615 Ga0495656_0000916 Ga0495656_0000916_3742_4188 148
669 3300046615 Ga0495656_0085697 Ga0495656_0085697_725_1171 148
670 3300046660 Ga0495625_0000411 Ga0495625_0000411_60372_60818 148
671 3300046660 Ga0495625_0054874 Ga0495625_0054874_772_1218 148
672 3300046663 Ga0495635_0190540 Ga0495635_0190540_263_709 148
673 3300046663 Ga0495635_0398671 Ga0495635_0398671_118_564 148
674 3300046674 Ga0495588_0021962 Ga0495588_0021962_1095_1541 148
675 3300046674 Ga0495588_0109339 Ga0495588_0109339_336_782 148
676 3300046683 Ga0495658_0263798 Ga0495658_0263798_98_544 148
677 3300046691 Ga0495670_0119677 Ga0495670_0119677_414_860 148
678 3300046809 Ga0495600_0462552 Ga0495600_0462552_319_765 148
679 3300047318 Ga0495636_0162488 Ga0495636_0162488_479_925 148
680 3300047321 Ga0495676_0011078 Ga0495676_0011078_7288_7734 148
681 3300047470 Ga0495681_0107646 Ga0495681_0107646_239_685 148
682 3300047470 Ga0495681_0326489 Ga0495681_0326489_91_537 148
683 3300047673 Ga0495593_0009567 Ga0495593_0009567_2932_3378 148
684 3300048089 Ga0495614_0014245 Ga0495614_0014245_1335_1781 148
685 3300048090 Ga0495615_0007034 Ga0495615_0007034_124_570 148
686 3300048903 Ga0496100_0061992 Ga0496100_0061992_1312_1758 148
687 3300048903 Ga0496100_0416974 Ga0496100_0416974_395_841 148
688 3300048904 Ga0496101_0019764 Ga0496101_0019764_1253_1699 148
689 3300048904 Ga0496101_0070039 Ga0496101_0070039_1212_1658 148
690 3300048905 Ga0496102_0018680 Ga0496102_0018680_5297_5743 148
691 3300048906 Ga0496103_0075323 Ga0496103_0075323_1447_1893 148
692 3300048906 Ga0496103_0176891 Ga0496103_0176891_547_993 148
693 3300048907 Ga0496104_0025765 Ga0496104_0025765_2396_2842 148
694 3300048908 Ga0496105_0045065 Ga0496105_0045065_1891_2337 148
695 3300048909 Ga0496106_0183839 Ga0496106_0183839_747_1193 148
696 3300048910 Ga0496107_0113937 Ga0496107_0113937_97_543 148
697 3300048911 Ga0496108_0943113 Ga0496108_0943113_39_485 148
698 3300048912 Ga0496109_0123108 Ga0496109_0123108_1556_2002 148
699 3300048913 Ga0496110_0019037 Ga0496110_0019037_5204_5650 148
700 3300048914 Ga0496111_0094692 Ga0496111_0094692_564_1010 148
701 3300048915 Ga0496112_0763188 Ga0496112_0763188_355_801 148
702 3300048917 Ga0496114_0366673 Ga0496114_0366673_744_1190 148
703 3300048917 Ga0496114_0452769 Ga0496114_0452769_269_715 148
704 3300048917 Ga0496114_1337304 Ga0496114_1337304_137_583 148
705 3300048919 Ga0496116_0042592 Ga0496116_0042592_926_1372 148
706 3300048919 Ga0496116_0225095 Ga0496116_0225095_97_543 148
707 3300048920 Ga0496117_0028416 Ga0496117_0028416_1194_1640 148
708 3300048920 Ga0496117_0122036 Ga0496117_0122036_773_1219 148
709 3300048921 Ga0496118_0014920 Ga0496118_0014920_3137_3583 148
710 3300048921 Ga0496118_0062819 Ga0496118_0062819_1605_2051 148
711 3300048921 Ga0496118_0147818 Ga0496118_0147818_400_846 148
712 3300048922 Ga0496119_0174593 Ga0496119_0174593_386_832 148
713 3300048924 Ga0496121_0025381 Ga0496121_0025381_1838_2284 148
714 3300048925 Ga0496122_0000998 Ga0496122_0000998_1772_2218 148
715 3300048925 Ga0496122_0104621 Ga0496122_0104621_1265_1711 148
716 3300048925 Ga0496122_0177963 Ga0496122_0177963_568_1014 148
717 3300048926 Ga0496123_0000045 Ga0496123_0000045_1710_2156 148
718 3300048926 Ga0496123_0164464 Ga0496123_0164464_395_841 148
719 3300048927 Ga0496124_0081035 Ga0496124_0081035_506_952 148
720 3300048927 Ga0496124_0101887 Ga0496124_0101887_1113_1559 148
721 3300048927 Ga0496124_0134721 Ga0496124_0134721_477_923 148
722 3300048927 Ga0496124_0165449 Ga0496124_0165449_509_955 148
723 3300048928 Ga0496125_0015577 Ga0496125_0015577_663_1109 148
724 3300048928 Ga0496125_0041048 Ga0496125_0041048_2111_2557 148
725 3300048928 Ga0496125_0096632 Ga0496125_0096632_965_1411 148
726 3300048928 Ga0496125_0106796 Ga0496125_0106796_687_1133 148
727 3300048928 Ga0496125_0478351 Ga0496125_0478351_175_621 148
728 3300048928 Ga0496125_0566725 Ga0496125_0566725_73_519 148
729 3300048929 Ga0496126_0088477 Ga0496126_0088477_825_1271 148
730 3300048929 Ga0496126_0099168 Ga0496126_0099168_370_816 148
731 3300048929 Ga0496126_0139641 Ga0496126_0139641_1265_1711 148
732 3300048929 Ga0496126_0180552 Ga0496126_0180552_41_487 148
733 3300049128 Ga0501308_010543 Ga0501308_010543_140_586 148
734 3300049130 Ga0501310_012827 Ga0501310_012827_101_547 148
735 3300049160 Ga0501304_032348 Ga0501304_032348_60_506 148
736 3300049162 Ga0501307_013324 Ga0501307_013324_306_752 148
737 3300049529 Ga0501313_065079 Ga0501313_065079_39_485 148
738 3300049531 Ga0501315_031735 Ga0501315_031735_294_740 148
739 3300049532 Ga0501316_007310 Ga0501316_007310_65_511 148
740 3300049533 Ga0501317_024669 Ga0501317_024669_148_594 148
741 3300049539 Ga0501323_003453 Ga0501323_003453_298_744 148
742 3300049551 Ga0501335_021047 Ga0501335_021047_230_676 148
743 3300049554 Ga0501338_02098 Ga0501338_02098_420_866 148
744 3300049665 Ga0501227_084803 Ga0501227_084803_237_683 148
745 3300049675 Ga0501243_110545 Ga0501243_110545_64_510 148
746 3300049679 Ga0501249_011075 Ga0501249_011075_749_1195 148
747 3300049682 Ga0501252_008040 Ga0501252_008040_16_462 148
748 3300049705 Ga0501225_0011298 Ga0501225_0011298_1514_1960 148
749 3300049758 Ga0501241_042241 Ga0501241_042241_72_518 148
750 3300049759 Ga0501262_001277 Ga0501262_001277_855_1301 148
751 3300049760 Ga0501263_016226 Ga0501263_016226_416_862 148
752 3300049763 Ga0501266_014342 Ga0501266_014342_420_866 148
753 3300050489 nmdc:mga03683_43356_c1 nmdc:mga03683_43356_c1_74_520 148
754 3300050489 nmdc:mga03683_44094_c1 nmdc:mga03683_44094_c1_689_1135 148
755 3300050489 nmdc:mga03683_61087_c1 nmdc:mga03683_61087_c1_66_512 148
756 3300050489 nmdc:mga03683_77870_c1 nmdc:mga03683_77870_c1_698_1144 148
757 3300050490 nmdc:mga03n38_502617_c1 nmdc:mga03n38_502617_c1_31_477 148
758 3300050490 nmdc:mga03n38_95731_c1 nmdc:mga03n38_95731_c1_65_511 148
759 3300050491 nmdc:mga00v17_183968_c1 nmdc:mga00v17_183968_c1_83_529 148
760 3300050491 nmdc:mga00v17_42026_c1 nmdc:mga00v17_42026_c1_1919_2365 148
761 3300050492 nmdc:mga0yw44_25707_c1 nmdc:mga0yw44_25707_c1_1821_2267 148
762 3300050492 nmdc:mga0yw44_610084_c1 nmdc:mga0yw44_610084_c1_92_538 148
763 3300050493 nmdc:mga0k408_10048_c2 nmdc:mga0k408_10048_c2_3245_3691 148
764 3300050493 nmdc:mga0k408_130843_c1 nmdc:mga0k408_130843_c1_693_1139 148
765 3300050493 nmdc:mga0k408_195670_c1 nmdc:mga0k408_195670_c1_642_1088 148
766 3300050493 nmdc:mga0k408_352379_c1 nmdc:mga0k408_352379_c1_153_599 148
767 3300050493 nmdc:mga0k408_47120_c1 nmdc:mga0k408_47120_c1_1747_2193 148
768 3300050493 nmdc:mga0k408_89217_c1 nmdc:mga0k408_89217_c1_1225_1671 148
769 3300050496 nmdc:mga07m45_19628_c1 nmdc:mga07m45_19628_c1_1285_1731 148
770 3300050496 nmdc:mga07m45_229026_c1 nmdc:mga07m45_229026_c1_238_684 148
771 3300050496 nmdc:mga07m45_24382_c2 nmdc:mga07m45_24382_c2_573_1019 148
772 3300050496 nmdc:mga07m45_280482_c1 nmdc:mga07m45_280482_c1_81_527 148
773 3300050496 nmdc:mga07m45_37266_c1 nmdc:mga07m45_37266_c1_290_736 148
774 3300050496 nmdc:mga07m45_429736_c1 nmdc:mga07m45_429736_c1_25_471 148
775 3300050496 nmdc:mga07m45_4682_c1 nmdc:mga07m45_4682_c1_5706_6152 148
776 3300050496 nmdc:mga07m45_4793_c2 nmdc:mga07m45_4793_c2_1711_2157 148
777 3300050516 nmdc:mga0sz30_107357_c1 nmdc:mga0sz30_107357_c1_642_1088 148
778 3300053079 Ga0500610_0137740 Ga0500610_0137740_178_624 148
779 3300053087 Ga0500643_025657 Ga0500643_025657_1127_1573 148
780 3300053087 Ga0500643_146900 Ga0500643_146900_175_621 148
781 3300053090 Ga0500646_0151901 Ga0500646_0151901_262_708 148
782 3300053093 Ga0500651_0000320 Ga0500651_0000320_10561_11007 148
783 3300053094 Ga0500566_0046927 Ga0500566_0046927_824_1270 148
784 3300053108 Ga0500562_037954 Ga0500562_037954_538_984 148
785 3300053110 Ga0500571_026066 Ga0500571_026066_1449_1895 148
786 3300053118 Ga0500594_0005559 Ga0500594_0005559_1600_2046 148
787 3300053118 Ga0500594_0030215 Ga0500594_0030215_822_1268 148
788 3300053120 Ga0500597_137695 Ga0500597_137695_47_493 148
789 3300053121 Ga0500607_037082 Ga0500607_037082_1668_2114 148
790 3300053122 Ga0500608_034047 Ga0500608_034047_1228_1674 148
791 3300053122 Ga0500608_058403 Ga0500608_058403_368_814 148
792 3300053125 Ga0500618_028274 Ga0500618_028274_511_957 148
793 3300053133 Ga0500655_006961 Ga0500655_006961_712_1158 148
794 3300053134 Ga0500658_0028648 Ga0500658_0028648_1235_1681 148
795 3300053136 Ga0500559_0059373 Ga0500559_0059373_740_1186 148
796 3300053136 Ga0500559_0061547 Ga0500559_0061547_206_652 148
797 3300053139 Ga0500568_0005077 Ga0500568_0005077_5542_5988 148
798 3300053140 Ga0500573_0144620 Ga0500573_0144620_267_713 148
799 3300053141 Ga0500574_016583 Ga0500574_016583_115_561 148
800 3300053153 Ga0500616_0011974 Ga0500616_0011974_1832_2278 148
801 3300053153 Ga0500616_0101655 Ga0500616_0101655_801_1247 148
802 3300053156 Ga0500622_0134370 Ga0500622_0134370_595_1041 148
803 3300053161 Ga0500634_0008569 Ga0500634_0008569_3738_4184 148
804 3300053730 Ga0500645_000905 Ga0500645_000905_15616_16062 148
805 3300059643 Ga0587072_192581 Ga0587072_192581_38_484 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

21

145

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wu2-assembly3.cif.gz_K crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant 0.9072 16 144
2wdv-assembly1.cif.gz_C e. coli succinate:quinone oxidoreductase (sqr) with an empty quinone- binding pocket 0.9064 16 143
6wu6-assembly1.cif.gz_C succinate-coenzyme q reductase 0.8989 26 144
2wu2-assembly3.cif.gz_K crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant 0.8863 16 144
2wdv-assembly1.cif.gz_C e. coli succinate:quinone oxidoreductase (sqr) with an empty quinone- binding pocket 0.8854 16 143
ID Description Score Start End Superfamily
2wdrC00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.9069 16 144 1.20.1300.10
2ws3C00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.9064 16 143 1.20.1300.10
2wdvK00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.9062 16 143 1.20.1300.10
2wdrC00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.886 16 144 1.20.1300.10
2ws3C00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8854 16 143 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A257W811-F1-model_v4 deleted 0.9939 70 148
AF-A0A7Y0BIE3-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9885 23 148 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-A0A7Y0BIE3-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9808 23 148 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-A0A5C9CSF0-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9777 46 148 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-A0A257W811-F1-model_v4 deleted 0.9695 70 148

Feature Viewer

pLDDT pTM Quality
91.66 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map