F481596
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 805 | 439 | 750 | 145 |
Family's Representative Sequence
| Representative Sequence | 3300012502|Ga0157347_1001697|Ga0157347_10016972 |
| Length | 153 |
| Sequence | LFAFPQKKQKRSLSEQANEFRNINAFTDLTTYRLPPAGIVSILHRVSGVIMFLLLPFIIWMFDTSLSSDYSFAKFKAAFNSGLGFVPGWFIKLVALALIWAYLHHFIAGLRHLWMDVSHAAVTKEFGHTSAVFTLGASIILTLVLAAKLFGFY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 4 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 5 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 6 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 7 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 8 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 9 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 10 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 11 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 12 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 13 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 14 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 15 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 16 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 17 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 18 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 19 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 20 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 21 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 22 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 23 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 24 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 25 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 26 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 27 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 28 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 29 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 30 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 31 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 32 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 33 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 34 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 35 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 36 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 37 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 38 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 39 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 40 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 41 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 42 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 43 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 44 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 45 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 46 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 47 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 48 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 49 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 50 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 51 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 52 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 53 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 54 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 55 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 56 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 57 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 58 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 59 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 60 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 61 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 62 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 63 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 64 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 65 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 66 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 67 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 68 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 69 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 70 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 71 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 72 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 73 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 74 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 75 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 76 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 77 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 78 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 79 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 84 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 86 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 94 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 100 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 101 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 106 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 107 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 108 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 109 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 110 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 111 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 112 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 113 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 114 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 115 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 116 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 117 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 118 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 119 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 120 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 122 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 123 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 124 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 125 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 126 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 127 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 139 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 140 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 149 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 153 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 154 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 155 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 156 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 208 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 217 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 218 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 219 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 220 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 221 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 222 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 223 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 224 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 226 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 229 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 230 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 231 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 232 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 233 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 234 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 235 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 236 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 237 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 239 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 240 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 241 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 242 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 243 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 246 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 247 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 248 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 249 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 250 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 251 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 252 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 253 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 254 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 255 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 262 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 263 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 264 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 265 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 266 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 267 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 268 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 269 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 270 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 271 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 272 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 273 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 274 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 275 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 276 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 277 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 278 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 279 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 280 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 281 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 282 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 283 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 284 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 285 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 286 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 287 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 288 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 289 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 290 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 291 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 292 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 293 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 294 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 295 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 296 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 297 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 298 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 299 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 300 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 301 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 302 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 303 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 349 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 350 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 351 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 352 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 353 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 354 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 357 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 358 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 359 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 360 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 361 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 362 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 363 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 364 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 365 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 366 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 367 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 368 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 369 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 370 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 389 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 390 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 391 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 392 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 393 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 394 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 395 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 396 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 397 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 398 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 399 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 401 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 402 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 403 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 404 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 405 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 406 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 407 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 408 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 409 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 410 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 411 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 412 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 413 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 414 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 415 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 416 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 417 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 418 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 419 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 420 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 422 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 423 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 424 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 425 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 426 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 427 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 428 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 429 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 430 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 431 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 432 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 433 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 434 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 435 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 436 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 437 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.93 |
| Metatranscriptomes | 2.11 |
| Isolates | 6.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.1 |
| Nodule | 1.12 |
| Rhizoplane | 4.47 |
| Rhizosphere | 57.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2102642 | 2162886007 | Bacteria | 1289 |
| 2 | JGI24740J21852_10008467 | 3300001979 | Bacteria | 4097 |
| 3 | JGI24739J22299_10011968 | 3300001989 | Bacteria | 3189 |
| 4 | JGI24739J22299_10045358 | 3300001989 | Bacteria | 1443 |
| 5 | JGI25158J39367_1001940 | 3300002739 | Bacteria | 3482 |
| 6 | JGI25152J39213_1013797 | 3300002773 | Bacteria | 1666 |
| 7 | JGI25159J45721_1002846 | 3300002987 | Bacteria | 6348 |
| 8 | JGI25159J45721_1022446 | 3300002987 | Bacteria | 1167 |
| 9 | JGI25151J46595_10010462 | 3300003187 | Bacteria | 4308 |
| 10 | JGI25151J46595_10017524 | 3300003187 | Bacteria | 3101 |
| 11 | rootH1_10001241 | 3300003316 | Bacteria | 2253 |
| 12 | rootH1_10001241 | 3300003323 | Bacteria | 4779 |
| 13 | Ga0006562J51391_1020771 | 3300003578 | Bacteria | 720 |
| 14 | Ga0055527_1016974 | 3300003760 | Bacteria | 783 |
| 15 | Ga0055535_1000915 | 3300003761 | Bacteria | 19915 |
| 16 | Ga0055542_1000901 | 3300003762 | Bacteria | 20265 |
| 17 | Ga0055537_1000434 | 3300003773 | Bacteria | 27009 |
| 18 | Ga0055537_1005360 | 3300003773 | Bacteria | 3453 |
| 19 | Ga0055536_1009331 | 3300003781 | Bacteria | 4069 |
| 20 | Ga0055536_1012171 | 3300003781 | Bacteria | 3216 |
| 21 | Ga0055536_1028385 | 3300003781 | Bacteria | 1526 |
| 22 | Ga0055534_1000642 | 3300003784 | Bacteria | 17763 |
| 23 | Ga0055534_1002585 | 3300003784 | Bacteria | 6190 |
| 24 | Ga0055534_1006069 | 3300003784 | Bacteria | 3110 |
| 25 | Ga0055528_1007422 | 3300003790 | Bacteria | 4852 |
| 26 | Ga0055528_1011740 | 3300003790 | Bacteria | 3453 |
| 27 | Ga0055530_10000766 | 3300003791 | Bacteria | 26764 |
| 28 | Ga0055540_1000627 | 3300003792 | Bacteria | 25032 |
| 29 | Ga0055540_1004190 | 3300003792 | Bacteria | 6638 |
| 30 | Ga0055540_1007670 | 3300003792 | Bacteria | 4024 |
| 31 | Ga0055540_1032059 | 3300003792 | Bacteria | 1202 |
| 32 | Ga0055540_1040650 | 3300003792 | Bacteria | 1006 |
| 33 | Ga0055531_10000886 | 3300003794 | Bacteria | 24459 |
| 34 | Ga0065165_1047188 | 3300005262 | Bacteria | 1245 |
| 35 | Ga0065714_10011357 | 3300005288 | Bacteria | 1955 |
| 36 | Ga0065714_10045960 | 3300005288 | Bacteria | 814 |
| 37 | Ga0065714_10142497 | 3300005288 | Bacteria | 1156 |
| 38 | Ga0065704_10102546 | 3300005289 | Bacteria | 2201 |
| 39 | Ga0065704_10105629 | 3300005289 | Bacteria | 2106 |
| 40 | Ga0065704_10604065 | 3300005289 | Bacteria | 605 |
| 41 | Ga0070658_10735766 | 3300005327 | Bacteria | 857 |
| 42 | Ga0070658_10973184 | 3300005327 | Bacteria | 738 |
| 43 | Ga0070676_10111818 | 3300005328 | Bacteria | 1702 |
| 44 | Ga0070676_10250317 | 3300005328 | Bacteria | 1182 |
| 45 | Ga0070670_100209538 | 3300005331 | Bacteria | 1694 |
| 46 | Ga0070677_10561824 | 3300005333 | Bacteria | 627 |
| 47 | Ga0068869_101489403 | 3300005334 | Bacteria | 601 |
| 48 | Ga0070666_10232948 | 3300005335 | Bacteria | 1301 |
| 49 | Ga0068868_100497494 | 3300005338 | Bacteria | 1067 |
| 50 | Ga0070660_100329236 | 3300005339 | Bacteria | 1256 |
| 51 | Ga0070661_100121297 | 3300005344 | Bacteria | 1958 |
| 52 | Ga0070668_100504378 | 3300005347 | Bacteria | 1048 |
| 53 | Ga0070669_100080492 | 3300005353 | Bacteria | 2425 |
| 54 | Ga0070669_100543598 | 3300005353 | Bacteria | 968 |
| 55 | Ga0070669_100737984 | 3300005353 | Bacteria | 834 |
| 56 | Ga0070671_101436938 | 3300005355 | Bacteria | 610 |
| 57 | Ga0070674_100140513 | 3300005356 | Bacteria | 1812 |
| 58 | Ga0070674_100463937 | 3300005356 | Bacteria | 1048 |
| 59 | Ga0070674_101317476 | 3300005356 | Bacteria | 644 |
| 60 | Ga0070673_100435635 | 3300005364 | Bacteria | 1177 |
| 61 | Ga0070688_100741620 | 3300005365 | Bacteria | 764 |
| 62 | Ga0070659_100892356 | 3300005366 | Bacteria | 777 |
| 63 | Ga0070659_100899088 | 3300005366 | Bacteria | 774 |
| 64 | Ga0070667_100781907 | 3300005367 | Bacteria | 886 |
| 65 | Ga0070663_100015443 | 3300005455 | Bacteria | 4930 |
| 66 | Ga0070678_100073651 | 3300005456 | Bacteria | 2564 |
| 67 | Ga0070678_100186951 | 3300005456 | Bacteria | 1700 |
| 68 | Ga0070678_102012601 | 3300005456 | Bacteria | 546 |
| 69 | Ga0070662_100027489 | 3300005457 | Bacteria | 3949 |
| 70 | Ga0070662_100586525 | 3300005457 | Bacteria | 937 |
| 71 | Ga0070662_101355771 | 3300005457 | Bacteria | 612 |
| 72 | Ga0068867_100193694 | 3300005459 | Bacteria | 1623 |
| 73 | Ga0068867_100786936 | 3300005459 | Unclassified | 847 |
| 74 | Ga0068867_100846419 | 3300005459 | Bacteria | 819 |
| 75 | Ga0068853_100116871 | 3300005539 | Bacteria | 2375 |
| 76 | Ga0068853_100171685 | 3300005539 | Bacteria | 1962 |
| 77 | Ga0068853_101038327 | 3300005539 | Bacteria | 789 |
| 78 | Ga0068853_101920814 | 3300005539 | Bacteria | 574 |
| 79 | Ga0070672_100022180 | 3300005543 | Bacteria | 4658 |
| 80 | Ga0070672_100953870 | 3300005543 | Bacteria | 759 |
| 81 | Ga0070686_101023726 | 3300005544 | Bacteria | 678 |
| 82 | Ga0070665_100027496 | 3300005548 | Bacteria | 5729 |
| 83 | Ga0070665_100128685 | 3300005548 | Bacteria | 2534 |
| 84 | Ga0070664_100480219 | 3300005564 | Bacteria | 1144 |
| 85 | Ga0068857_100125184 | 3300005577 | Bacteria | 2315 |
| 86 | Ga0068857_100279447 | 3300005577 | Bacteria | 1535 |
| 87 | Ga0068854_100119507 | 3300005578 | Bacteria | 1999 |
| 88 | Ga0068852_101065617 | 3300005616 | Bacteria | 828 |
| 89 | Ga0068864_100801114 | 3300005618 | Bacteria | 926 |
| 90 | Ga0068851_10046255 | 3300005834 | Bacteria | 2201 |
| 91 | Ga0068870_10661068 | 3300005840 | Bacteria | 717 |
| 92 | Ga0075365_10041456 | 3300006038 | Bacteria | 3007 |
| 93 | Ga0075368_10088634 | 3300006042 | Bacteria | 1264 |
| 94 | Ga0075363_100055360 | 3300006048 | Bacteria | 2124 |
| 95 | Ga0075364_10111408 | 3300006051 | Bacteria | 1827 |
| 96 | Ga0075432_10015748 | 3300006058 | Bacteria | 2580 |
| 97 | Ga0075362_10033318 | 3300006177 | Bacteria | 2240 |
| 98 | Ga0075367_10022549 | 3300006178 | Bacteria | 3533 |
| 99 | Ga0075367_10035248 | 3300006178 | Bacteria | 2895 |
| 100 | Ga0075367_10133846 | 3300006178 | Bacteria | 1533 |
| 101 | Ga0075367_10387785 | 3300006178 | Bacteria | 883 |
| 102 | Ga0075367_10430608 | 3300006178 | Bacteria | 835 |
| 103 | Ga0075367_10533822 | 3300006178 | Bacteria | 745 |
| 104 | Ga0075369_10065903 | 3300006186 | Bacteria | 1588 |
| 105 | Ga0075366_10007874 | 3300006195 | Bacteria | 5894 |
| 106 | Ga0075366_10009033 | 3300006195 | Bacteria | 5559 |
| 107 | Ga0075366_10032122 | 3300006195 | Bacteria | 3090 |
| 108 | Ga0075366_10046737 | 3300006195 | Bacteria | 2565 |
| 109 | Ga0075366_10056276 | 3300006195 | Bacteria | 2336 |
| 110 | Ga0075366_10106165 | 3300006195 | Bacteria | 1688 |
| 111 | Ga0075366_10131834 | 3300006195 | Bacteria | 1508 |
| 112 | Ga0075366_10147222 | 3300006195 | Bacteria | 1425 |
| 113 | Ga0075366_10251640 | 3300006195 | Bacteria | 1077 |
| 114 | Ga0075366_10469961 | 3300006195 | Bacteria | 776 |
| 115 | Ga0075366_10525961 | 3300006195 | Bacteria | 732 |
| 116 | Ga0097621_100199672 | 3300006237 | Bacteria | 1736 |
| 117 | Ga0075370_10003137 | 3300006353 | Bacteria | 7803 |
| 118 | Ga0075370_10006880 | 3300006353 | Bacteria | 5754 |
| 119 | Ga0075370_10010283 | 3300006353 | Bacteria | 4888 |
| 120 | Ga0075370_10043670 | 3300006353 | Bacteria | 2533 |
| 121 | Ga0075370_10082572 | 3300006353 | Bacteria | 1848 |
| 122 | Ga0075370_10240237 | 3300006353 | Bacteria | 1072 |
| 123 | Ga0075370_10337993 | 3300006353 | Bacteria | 898 |
| 124 | Ga0075370_10784864 | 3300006353 | Bacteria | 580 |
| 125 | Ga0075370_10837161 | 3300006353 | Bacteria | 561 |
| 126 | Ga0068871_100271477 | 3300006358 | Bacteria | 1482 |
| 127 | Ga0068871_101511774 | 3300006358 | Bacteria | 634 |
| 128 | Ga0075428_101379235 | 3300006844 | Bacteria | 740 |
| 129 | Ga0068865_100271368 | 3300006881 | Bacteria | 1347 |
| 130 | Ga0079104_1000352 | 3300006946 | Bacteria | 55479 |
| 131 | Ga0079104_1019560 | 3300006946 | Bacteria | 1889 |
| 132 | Ga0099826_10023210 | 3300006948 | Bacteria | 4626 |
| 133 | Ga0099826_10137953 | 3300006948 | Bacteria | 1413 |
| 134 | Ga0105251_10275993 | 3300009011 | Bacteria | 760 |
| 135 | Ga0105244_10007704 | 3300009036 | Bacteria | 6820 |
| 136 | Ga0105244_10140800 | 3300009036 | Bacteria | 1160 |
| 137 | Ga0105240_10675681 | 3300009093 | Bacteria | 1130 |
| 138 | Ga0105240_11802305 | 3300009093 | Bacteria | 638 |
| 139 | Ga0105245_10087717 | 3300009098 | Bacteria | 2856 |
| 140 | Ga0105245_10472172 | 3300009098 | Bacteria | 1266 |
| 141 | Ga0105245_10568229 | 3300009098 | Bacteria | 1157 |
| 142 | Ga0105243_10012218 | 3300009148 | Bacteria | 6492 |
| 143 | Ga0105243_10111039 | 3300009148 | Bacteria | 2294 |
| 144 | Ga0105243_10204752 | 3300009148 | Bacteria | 1733 |
| 145 | Ga0105243_10446579 | 3300009148 | Bacteria | 1212 |
| 146 | Ga0105243_10499014 | 3300009148 | Bacteria | 1153 |
| 147 | Ga0105242_10059133 | 3300009176 | Bacteria | 3144 |
| 148 | Ga0105242_10217332 | 3300009176 | Bacteria | 1706 |
| 149 | Ga0105242_10410867 | 3300009176 | Bacteria | 1266 |
| 150 | Ga0105242_10761921 | 3300009176 | Bacteria | 954 |
| 151 | Ga0105242_11939011 | 3300009176 | Bacteria | 630 |
| 152 | Ga0105242_12448149 | 3300009176 | Bacteria | 570 |
| 153 | Ga0105248_10260589 | 3300009177 | Bacteria | 1952 |
| 154 | Ga0105248_10328967 | 3300009177 | Bacteria | 1721 |
| 155 | Ga0105248_11029210 | 3300009177 | Unclassified | 930 |
| 156 | Ga0105248_11839395 | 3300009177 | Bacteria | 687 |
| 157 | Ga0105238_10249886 | 3300009551 | Bacteria | 1751 |
| 158 | Ga0105238_10445272 | 3300009551 | Bacteria | 1292 |
| 159 | Ga0105249_11520563 | 3300009553 | Bacteria | 742 |
| 160 | Ga0105239_10381641 | 3300010375 | Bacteria | 1593 |
| 161 | Ga0105246_10169215 | 3300011119 | Bacteria | 1672 |
| 162 | Ga0157347_1001697 | 3300012502 | Bacteria | 1779 |
| 163 | Ga0157339_1028301 | 3300012505 | Bacteria | 641 |
| 164 | Ga0157373_10186710 | 3300013100 | Bacteria | 1460 |
| 165 | Ga0157373_10238746 | 3300013100 | Bacteria | 1284 |
| 166 | Ga0157373_11324862 | 3300013100 | Bacteria | 546 |
| 167 | Ga0157371_10672575 | 3300013102 | Bacteria | 774 |
| 168 | Ga0157370_10034122 | 3300013104 | Bacteria | 4957 |
| 169 | Ga0157370_10145499 | 3300013104 | Bacteria | 2207 |
| 170 | Ga0157370_11439698 | 3300013104 | Bacteria | 620 |
| 171 | Ga0157369_10001553 | 3300013105 | Bacteria | 28084 |
| 172 | Ga0157378_10730720 | 3300013297 | Bacteria | 1011 |
| 173 | Ga0157378_10946539 | 3300013297 | Bacteria | 894 |
| 174 | Ga0157378_11820854 | 3300013297 | Bacteria | 657 |
| 175 | Ga0163162_10243785 | 3300013306 | Bacteria | 1928 |
| 176 | Ga0163162_10621430 | 3300013306 | Bacteria | 1205 |
| 177 | Ga0163162_11918623 | 3300013306 | Bacteria | 678 |
| 178 | Ga0157375_10462063 | 3300013308 | Bacteria | 1435 |
| 179 | Ga0157375_10568070 | 3300013308 | Bacteria | 1295 |
| 180 | Ga0157380_10235022 | 3300014326 | Bacteria | 1649 |
| 181 | Ga0182008_10003672 | 3300014497 | Bacteria | 9163 |
| 182 | Ga0182008_10007571 | 3300014497 | Bacteria | 5989 |
| 183 | Ga0182008_10024300 | 3300014497 | Bacteria | 3087 |
| 184 | Ga0182008_10042374 | 3300014497 | Bacteria | 2268 |
| 185 | Ga0182008_10117999 | 3300014497 | Bacteria | 1317 |
| 186 | Ga0182008_10126990 | 3300014497 | Bacteria | 1270 |
| 187 | Ga0182008_10267181 | 3300014497 | Bacteria | 886 |
| 188 | Ga0157377_10541755 | 3300014745 | Bacteria | 821 |
| 189 | Ga0157379_10015837 | 3300014968 | Bacteria | 6626 |
| 190 | Ga0157379_10931291 | 3300014968 | Bacteria | 825 |
| 191 | Ga0157376_10304247 | 3300014969 | Bacteria | 1510 |
| 192 | Ga0157376_10358955 | 3300014969 | Bacteria | 1397 |
| 193 | Ga0157376_10542338 | 3300014969 | Bacteria | 1150 |
| 194 | Ga0182006_1006815 | 3300015261 | Bacteria | 5271 |
| 195 | Ga0182006_1038851 | 3300015261 | Bacteria | 1881 |
| 196 | Ga0182006_1080934 | 3300015261 | Bacteria | 1185 |
| 197 | Ga0182007_10018708 | 3300015262 | Bacteria | 2505 |
| 198 | Ga0182007_10155895 | 3300015262 | Bacteria | 779 |
| 199 | Ga0182005_1233170 | 3300015265 | Bacteria | 564 |
| 200 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 201 | Ga0163161_10040028 | 3300017792 | Bacteria | 3366 |
| 202 | Ga0163161_10047665 | 3300017792 | Bacteria | 3094 |
| 203 | Ga0163161_10085111 | 3300017792 | Bacteria | 2332 |
| 204 | Ga0163161_10423851 | 3300017792 | Bacteria | 1071 |
| 205 | Ga0209436_116559 | 3300025208 | Bacteria | 1101 |
| 206 | Ga0209672_101606 | 3300025228 | Bacteria | 7554 |
| 207 | Ga0209147_100909 | 3300025229 | Bacteria | 13338 |
| 208 | Ga0209258_100009 | 3300025242 | Bacteria | 996276 |
| 209 | Ga0207425_1000361 | 3300025245 | Bacteria | 31481 |
| 210 | Ga0207425_1040224 | 3300025245 | Bacteria | 893 |
| 211 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 212 | Ga0209129_1000013 | 3300025258 | Bacteria | 524874 |
| 213 | Ga0209129_1003406 | 3300025258 | Bacteria | 6957 |
| 214 | Ga0209129_1022451 | 3300025258 | Bacteria | 1140 |
| 215 | Ga0209565_1000046 | 3300025263 | Bacteria | 226073 |
| 216 | Ga0209565_1002375 | 3300025263 | Bacteria | 6843 |
| 217 | Ga0209673_1000053 | 3300025273 | Bacteria | 279449 |
| 218 | Ga0209673_1000245 | 3300025273 | Bacteria | 103315 |
| 219 | Ga0209673_1003160 | 3300025273 | Bacteria | 10044 |
| 220 | Ga0209673_1090236 | 3300025273 | Bacteria | 680 |
| 221 | Ga0209130_1002075 | 3300025284 | Bacteria | 10806 |
| 222 | Ga0209130_1003101 | 3300025284 | Bacteria | 7418 |
| 223 | Ga0209130_1005537 | 3300025284 | Bacteria | 4345 |
| 224 | Ga0209675_1000010 | 3300025291 | Bacteria | 541927 |
| 225 | Ga0209675_1001188 | 3300025291 | Bacteria | 15806 |
| 226 | Ga0209675_1002968 | 3300025291 | Bacteria | 8356 |
| 227 | Ga0209676_1000108 | 3300025292 | Bacteria | 221168 |
| 228 | Ga0209676_1000939 | 3300025292 | Bacteria | 35879 |
| 229 | Ga0209676_1001659 | 3300025292 | Bacteria | 19383 |
| 230 | Ga0209676_1025250 | 3300025292 | Bacteria | 1909 |
| 231 | Ga0209025_1000972 | 3300025294 | Bacteria | 42974 |
| 232 | Ga0209025_1003456 | 3300025294 | Bacteria | 14922 |
| 233 | Ga0209025_1006031 | 3300025294 | Bacteria | 9594 |
| 234 | Ga0209025_1008558 | 3300025294 | Bacteria | 7341 |
| 235 | Ga0209025_1036750 | 3300025294 | Bacteria | 2187 |
| 236 | Ga0209025_1037753 | 3300025294 | Bacteria | 2136 |
| 237 | Ga0209025_1043546 | 3300025294 | Bacteria | 1890 |
| 238 | Ga0209564_1005295 | 3300025295 | Bacteria | 7433 |
| 239 | Ga0209564_1005299 | 3300025295 | Bacteria | 7432 |
| 240 | Ga0209564_1052293 | 3300025295 | Bacteria | 983 |
| 241 | Ga0209564_1060202 | 3300025295 | Bacteria | 854 |
| 242 | Ga0209758_1000067 | 3300025297 | Bacteria | 288575 |
| 243 | Ga0209758_1005404 | 3300025297 | Bacteria | 9869 |
| 244 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 245 | Ga0209050_1007827 | 3300025298 | Bacteria | 5874 |
| 246 | Ga0209050_1020859 | 3300025298 | Bacteria | 2417 |
| 247 | Ga0209050_1053439 | 3300025298 | Bacteria | 1004 |
| 248 | Ga0209256_1000077 | 3300025299 | Bacteria | 230410 |
| 249 | Ga0209256_1000673 | 3300025299 | Bacteria | 46238 |
| 250 | Ga0209256_1030279 | 3300025299 | Bacteria | 1496 |
| 251 | Ga0207426_1000101 | 3300025302 | Bacteria | 262096 |
| 252 | Ga0207426_1000129 | 3300025302 | Bacteria | 210930 |
| 253 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 254 | Ga0209051_1000486 | 3300025303 | Bacteria | 51268 |
| 255 | Ga0209051_1001944 | 3300025303 | Bacteria | 15917 |
| 256 | Ga0209051_1003369 | 3300025303 | Bacteria | 10515 |
| 257 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 258 | Ga0209257_1000713 | 3300025304 | Bacteria | 51427 |
| 259 | Ga0209257_1023311 | 3300025304 | Bacteria | 2179 |
| 260 | Ga0209257_1025850 | 3300025304 | Bacteria | 1995 |
| 261 | Ga0209257_1050773 | 3300025304 | Bacteria | 1172 |
| 262 | Ga0207656_10022267 | 3300025321 | Bacteria | 2540 |
| 263 | Ga0207655_1004198 | 3300025728 | Bacteria | 10329 |
| 264 | Ga0207655_1106512 | 3300025728 | Bacteria | 955 |
| 265 | Ga0207682_10021464 | 3300025893 | Bacteria | 2541 |
| 266 | Ga0207645_10008421 | 3300025907 | Bacteria | 7194 |
| 267 | Ga0207645_10204884 | 3300025907 | Bacteria | 1298 |
| 268 | Ga0207695_10138617 | 3300025913 | Bacteria | 2384 |
| 269 | Ga0207671_10398338 | 3300025914 | Bacteria | 1095 |
| 270 | Ga0207649_10097006 | 3300025920 | Bacteria | 1943 |
| 271 | Ga0207681_10007278 | 3300025923 | Bacteria | 6784 |
| 272 | Ga0207681_10065858 | 3300025923 | Bacteria | 2506 |
| 273 | Ga0207694_10673713 | 3300025924 | Bacteria | 872 |
| 274 | Ga0207650_10114185 | 3300025925 | Bacteria | 2095 |
| 275 | Ga0207650_10327441 | 3300025925 | Bacteria | 1256 |
| 276 | Ga0207659_10131250 | 3300025926 | Bacteria | 1934 |
| 277 | Ga0207687_10084406 | 3300025927 | Bacteria | 2302 |
| 278 | Ga0207687_10382893 | 3300025927 | Bacteria | 1153 |
| 279 | Ga0207687_10514604 | 3300025927 | Bacteria | 1000 |
| 280 | Ga0207644_11296688 | 3300025931 | Bacteria | 612 |
| 281 | Ga0207706_10086975 | 3300025933 | Bacteria | 2747 |
| 282 | Ga0207706_10725604 | 3300025933 | Bacteria | 848 |
| 283 | Ga0207686_10002907 | 3300025934 | Bacteria | 9238 |
| 284 | Ga0207686_10158559 | 3300025934 | Bacteria | 1583 |
| 285 | Ga0207686_10395459 | 3300025934 | Bacteria | 1051 |
| 286 | Ga0207709_10002996 | 3300025935 | Bacteria | 10268 |
| 287 | Ga0207709_10012695 | 3300025935 | Bacteria | 4643 |
| 288 | Ga0207709_10049858 | 3300025935 | Bacteria | 2557 |
| 289 | Ga0207709_10276942 | 3300025935 | Bacteria | 1237 |
| 290 | Ga0207709_10286880 | 3300025935 | Bacteria | 1218 |
| 291 | Ga0207691_10009910 | 3300025940 | Bacteria | 9146 |
| 292 | Ga0207711_10505536 | 3300025941 | Bacteria | 1126 |
| 293 | Ga0207711_10903555 | 3300025941 | Bacteria | 821 |
| 294 | Ga0207711_11477776 | 3300025941 | Bacteria | 622 |
| 295 | Ga0207711_11623034 | 3300025941 | Bacteria | 590 |
| 296 | Ga0207689_10018922 | 3300025942 | Bacteria | 5808 |
| 297 | Ga0207689_10232015 | 3300025942 | Bacteria | 1525 |
| 298 | Ga0207679_10019534 | 3300025945 | Bacteria | 4554 |
| 299 | Ga0207651_10267929 | 3300025960 | Bacteria | 1405 |
| 300 | Ga0207668_10102125 | 3300025972 | Bacteria | 2133 |
| 301 | Ga0207668_10395558 | 3300025972 | Bacteria | 1167 |
| 302 | Ga0207668_10910963 | 3300025972 | Bacteria | 783 |
| 303 | Ga0207668_11383279 | 3300025972 | Bacteria | 634 |
| 304 | Ga0207640_10575407 | 3300025981 | Bacteria | 950 |
| 305 | Ga0207639_10105322 | 3300026041 | Bacteria | 2288 |
| 306 | Ga0207639_10401897 | 3300026041 | Bacteria | 1234 |
| 307 | Ga0207639_10707467 | 3300026041 | Bacteria | 935 |
| 308 | Ga0207639_10900626 | 3300026041 | Bacteria | 827 |
| 309 | Ga0207678_10028113 | 3300026067 | Bacteria | 4910 |
| 310 | Ga0207648_10041681 | 3300026089 | Bacteria | 4032 |
| 311 | Ga0207648_10222017 | 3300026089 | Bacteria | 1680 |
| 312 | Ga0207648_10329343 | 3300026089 | Bacteria | 1373 |
| 313 | Ga0207648_10488717 | 3300026089 | Bacteria | 1125 |
| 314 | Ga0207648_10861484 | 3300026089 | Bacteria | 845 |
| 315 | Ga0207674_10020101 | 3300026116 | Bacteria | 7222 |
| 316 | Ga0207674_10372754 | 3300026116 | Bacteria | 1380 |
| 317 | Ga0207674_10560792 | 3300026116 | Bacteria | 1103 |
| 318 | Ga0207675_101088157 | 3300026118 | Unclassified | 819 |
| 319 | Ga0207675_101689278 | 3300026118 | Bacteria | 653 |
| 320 | Ga0207683_10042716 | 3300026121 | Bacteria | 3960 |
| 321 | Ga0207683_10344630 | 3300026121 | Bacteria | 1367 |
| 322 | Ga0207683_10473562 | 3300026121 | Bacteria | 1155 |
| 323 | Ga0207683_11045162 | 3300026121 | Bacteria | 758 |
| 324 | Ga0207698_10077776 | 3300026142 | Bacteria | 2661 |
| 325 | Ga0209281_1000454 | 3300027111 | Bacteria | 58234 |
| 326 | Ga0209969_1038395 | 3300027360 | Bacteria | 741 |
| 327 | Ga0209984_1008006 | 3300027424 | Bacteria | 1323 |
| 328 | Ga0209282_1005624 | 3300027666 | Bacteria | 7713 |
| 329 | Ga0209282_1189223 | 3300027666 | Bacteria | 958 |
| 330 | Ga0209282_1236474 | 3300027666 | Bacteria | 816 |
| 331 | Ga0209813_10021743 | 3300027866 | Bacteria | 1807 |
| 332 | Ga0209974_10014274 | 3300027876 | Bacteria | 2645 |
| 333 | Ga0268266_10217130 | 3300028379 | Bacteria | 1756 |
| 334 | Ga0268265_10297538 | 3300028380 | Bacteria | 1451 |
| 335 | Ga0268264_10194621 | 3300028381 | Bacteria | 1850 |
| 336 | Ga0307515_10000084 | 3300028794 | Bacteria | 221434 |
| 337 | Ga0307515_10000265 | 3300028794 | Bacteria | 129554 |
| 338 | Ga0307515_10001533 | 3300028794 | Bacteria | 51699 |
| 339 | Ga0307515_10002409 | 3300028794 | Bacteria | 40792 |
| 340 | Ga0307515_10006008 | 3300028794 | Bacteria | 24426 |
| 341 | Ga0307515_10060740 | 3300028794 | Bacteria | 5382 |
| 342 | Ga0307515_10276687 | 3300028794 | Bacteria | 1391 |
| 343 | Ga0307515_10615324 | 3300028794 | Bacteria | 697 |
| 344 | Ga0307512_10036360 | 3300030522 | Bacteria | 4178 |
| 345 | Ga0316177_1080873 | 3300030731 | Bacteria | 2097 |
| 346 | Ga0316179_1005100 | 3300030734 | Bacteria | 1991 |
| 347 | Ga0316178_1049689 | 3300030735 | Bacteria | 2655 |
| 348 | Ga0316183_1121951 | 3300030742 | Bacteria | 4193 |
| 349 | Ga0316183_1122991 | 3300030742 | Bacteria | 1554 |
| 350 | Ga0316181_1013012 | 3300030744 | Bacteria | 896 |
| 351 | Ga0316181_1140675 | 3300030744 | Bacteria | 1273 |
| 352 | Ga0316182_1117672 | 3300030745 | Bacteria | 2645 |
| 353 | Ga0316182_1372344 | 3300030745 | Bacteria | 1488 |
| 354 | Ga0265332_10000009 | 3300031238 | Bacteria | 295760 |
| 355 | Ga0265328_10012736 | 3300031239 | Bacteria | 3344 |
| 356 | Ga0265327_10000265 | 3300031251 | Bacteria | 103720 |
| 357 | Ga0265327_10006033 | 3300031251 | Bacteria | 9832 |
| 358 | Ga0265327_10013589 | 3300031251 | Bacteria | 5399 |
| 359 | Ga0265327_10416844 | 3300031251 | Bacteria | 582 |
| 360 | Ga0265316_10000807 | 3300031344 | Bacteria | 34580 |
| 361 | Ga0307513_10003195 | 3300031456 | Bacteria | 22371 |
| 362 | Ga0307513_10030898 | 3300031456 | Bacteria | 6076 |
| 363 | Ga0307513_10046229 | 3300031456 | Bacteria | 4749 |
| 364 | Ga0307513_10151665 | 3300031456 | Bacteria | 2225 |
| 365 | Ga0307513_10184416 | 3300031456 | Bacteria | 1946 |
| 366 | Ga0307513_10237417 | 3300031456 | Bacteria | 1631 |
| 367 | Ga0307509_10085882 | 3300031507 | Bacteria | 3237 |
| 368 | Ga0307509_10418108 | 3300031507 | Bacteria | 1042 |
| 369 | Ga0307408_100000212 | 3300031548 | Bacteria | 62138 |
| 370 | Ga0307408_100056587 | 3300031548 | Bacteria | 2844 |
| 371 | Ga0307408_100084823 | 3300031548 | Bacteria | 2377 |
| 372 | Ga0307408_100142864 | 3300031548 | Bacteria | 1880 |
| 373 | Ga0307408_100253587 | 3300031548 | Bacteria | 1452 |
| 374 | Ga0307408_100449462 | 3300031548 | Bacteria | 1117 |
| 375 | Ga0307408_100450042 | 3300031548 | Bacteria | 1117 |
| 376 | Ga0307408_100571338 | 3300031548 | Bacteria | 1000 |
| 377 | Ga0307408_101198026 | 3300031548 | Bacteria | 708 |
| 378 | Ga0307514_10000319 | 3300031649 | Bacteria | 115327 |
| 379 | Ga0307514_10047701 | 3300031649 | Bacteria | 3342 |
| 380 | Ga0307514_10167229 | 3300031649 | Bacteria | 1444 |
| 381 | Ga0307516_10001303 | 3300031730 | Bacteria | 34698 |
| 382 | Ga0307405_10089605 | 3300031731 | Bacteria | 2032 |
| 383 | Ga0307410_11099814 | 3300031852 | Bacteria | 689 |
| 384 | Ga0307406_10001770 | 3300031901 | Bacteria | 11820 |
| 385 | Ga0307406_10142959 | 3300031901 | Bacteria | 1696 |
| 386 | Ga0307407_10189449 | 3300031903 | Bacteria | 1370 |
| 387 | Ga0307412_10110281 | 3300031911 | Bacteria | 1963 |
| 388 | Ga0307412_10123758 | 3300031911 | Bacteria | 1866 |
| 389 | Ga0307412_10242213 | 3300031911 | Bacteria | 1395 |
| 390 | Ga0307412_10319026 | 3300031911 | Bacteria | 1235 |
| 391 | Ga0307412_10523539 | 3300031911 | Bacteria | 991 |
| 392 | Ga0307412_10601551 | 3300031911 | Bacteria | 931 |
| 393 | Ga0307409_100294255 | 3300031995 | Bacteria | 1507 |
| 394 | Ga0307409_100579626 | 3300031995 | Bacteria | 1106 |
| 395 | Ga0307409_101859435 | 3300031995 | Bacteria | 631 |
| 396 | Ga0307409_102504313 | 3300031995 | Bacteria | 545 |
| 397 | Ga0307416_100529199 | 3300032002 | Bacteria | 1248 |
| 398 | Ga0307416_101102156 | 3300032002 | Bacteria | 898 |
| 399 | Ga0307414_10310981 | 3300032004 | Bacteria | 1337 |
| 400 | Ga0307411_10191797 | 3300032005 | Bacteria | 1561 |
| 401 | Ga0307411_10485605 | 3300032005 | Bacteria | 1041 |
| 402 | Ga0307415_100799540 | 3300032126 | Bacteria | 861 |
| 403 | Ga0373955_0260624 | 3300035172 | Bacteria | 1041 |
| 404 | Ga0373931_0091312 | 3300035691 | Bacteria | 1697 |
| 405 | Ga0395900_0192655 | 3300037418 | Bacteria | 2067 |
| 406 | Ga0395900_0280588 | 3300037418 | Bacteria | 1658 |
| 407 | Ga0395898_0327717 | 3300037466 | Bacteria | 1460 |
| 408 | Ga0395898_0859572 | 3300037466 | Bacteria | 846 |
| 409 | Ga0395905_0000684 | 3300037471 | Bacteria | 44904 |
| 410 | Ga0395905_0088667 | 3300037471 | Bacteria | 2899 |
| 411 | Ga0395905_0794164 | 3300037471 | Bacteria | 849 |
| 412 | Ga0395905_0856731 | 3300037471 | Bacteria | 812 |
| 413 | Ga0395905_1111515 | 3300037471 | Bacteria | 694 |
| 414 | Ga0395901_0024228 | 3300038443 | Bacteria | 6227 |
| 415 | Ga0436365_1063264 | 3300039437 | Bacteria | 571 |
| 416 | Ga0436361_0475800 | 3300039447 | Bacteria | 11481 |
| 417 | Ga0439436_0008676 | 3300041404 | Bacteria | 3124 |
| 418 | Ga0439436_0020697 | 3300041404 | Bacteria | 1958 |
| 419 | Ga0439436_0061047 | 3300041404 | Bacteria | 1055 |
| 420 | Ga0439439_0014097 | 3300041406 | Bacteria | 1943 |
| 421 | Ga0439466_0009224 | 3300041411 | Bacteria | 3694 |
| 422 | Ga0439466_0024000 | 3300041411 | Bacteria | 2141 |
| 423 | Ga0439465_0014650 | 3300041413 | Bacteria | 2444 |
| 424 | Ga0451789_0105499 | 3300041443 | Bacteria | 1467 |
| 425 | Ga0451789_0429677 | 3300041443 | Bacteria | 711 |
| 426 | Ga0451791_1601473 | 3300041451 | Bacteria | 656 |
| 427 | Ga0451793_0935927 | 3300041452 | Bacteria | 671 |
| 428 | Ga0451800_0987865 | 3300041459 | Bacteria | 1383 |
| 429 | Ga0451802_1196336 | 3300041460 | Bacteria | 1513 |
| 430 | Ga0451807_0986316 | 3300041486 | Bacteria | 1399 |
| 431 | Ga0451807_2262088 | 3300041486 | Bacteria | 980 |
| 432 | Ga0451807_2369752 | 3300041486 | Bacteria | 1571 |
| 433 | Ga0451833_0165364 | 3300041491 | Bacteria | 725 |
| 434 | Ga0451833_0197438 | 3300041491 | Bacteria | 755 |
| 435 | Ga0451835_0341183 | 3300041492 | Bacteria | 535 |
| 436 | Ga0451837_0229797 | 3300041494 | Bacteria | 652 |
| 437 | Ga0451837_1274579 | 3300041494 | Bacteria | 806 |
| 438 | Ga0451839_0313766 | 3300041496 | Bacteria | 834 |
| 439 | Ga0451843_1265110 | 3300041509 | Bacteria | 864 |
| 440 | Ga0451853_0739295 | 3300041512 | Bacteria | 1082 |
| 441 | Ga0439431_0000653 | 3300041997 | Bacteria | 7381 |
| 442 | Ga0439431_0195562 | 3300041997 | Bacteria | 588 |
| 443 | Ga0439433_0007603 | 3300041999 | Bacteria | 2342 |
| 444 | Ga0439433_0015194 | 3300041999 | Bacteria | 1699 |
| 445 | Ga0439433_0104744 | 3300041999 | Bacteria | 704 |
| 446 | Ga0439442_007595 | 3300042002 | Bacteria | 2183 |
| 447 | Ga0439442_010111 | 3300042002 | Bacteria | 1910 |
| 448 | Ga0439442_048893 | 3300042002 | Bacteria | 891 |
| 449 | Ga0439445_0014046 | 3300042004 | Bacteria | 1945 |
| 450 | Ga0439445_0026402 | 3300042004 | Bacteria | 1487 |
| 451 | Ga0439445_0043375 | 3300042004 | Bacteria | 1200 |
| 452 | Ga0439448_0186251 | 3300042005 | Bacteria | 726 |
| 453 | Ga0439432_008521 | 3300042006 | Bacteria | 3598 |
| 454 | Ga0439432_015233 | 3300042006 | Bacteria | 2597 |
| 455 | Ga0439432_065536 | 3300042006 | Bacteria | 1113 |
| 456 | Ga0439449_0003558 | 3300042007 | Bacteria | 6051 |
| 457 | Ga0439449_0010488 | 3300042007 | Bacteria | 3500 |
| 458 | Ga0439449_0013502 | 3300042007 | Bacteria | 3073 |
| 459 | Ga0439449_0019230 | 3300042007 | Bacteria | 2560 |
| 460 | Ga0439452_004068 | 3300042010 | Bacteria | 4971 |
| 461 | Ga0439452_039693 | 3300042010 | Bacteria | 1113 |
| 462 | Ga0439455_0036889 | 3300042012 | Bacteria | 1238 |
| 463 | Ga0439457_062297 | 3300042014 | Bacteria | 845 |
| 464 | Ga0439462_0006627 | 3300042015 | Bacteria | 2883 |
| 465 | Ga0439462_0033034 | 3300042015 | Bacteria | 1371 |
| 466 | Ga0450911_000987 | 3300042115 | Bacteria | 7378 |
| 467 | Ga0450912_000270 | 3300042116 | Bacteria | 2315 |
| 468 | Ga0450915_007869 | 3300042119 | Bacteria | 704 |
| 469 | Ga0450919_005464 | 3300042121 | Bacteria | 1525 |
| 470 | Ga0450923_013370 | 3300042125 | Bacteria | 1508 |
| 471 | Ga0450897_009772 | 3300042128 | Bacteria | 913 |
| 472 | Ga0450894_034120 | 3300042131 | Bacteria | 717 |
| 473 | Ga0450895_013492 | 3300042132 | Bacteria | 717 |
| 474 | Ga0450896_034894 | 3300042133 | Bacteria | 771 |
| 475 | Ga0450896_052281 | 3300042133 | Bacteria | 653 |
| 476 | Ga0450899_002488 | 3300042135 | Bacteria | 1989 |
| 477 | Ga0450906_007435 | 3300042145 | Bacteria | 2164 |
| 478 | Ga0450906_007849 | 3300042145 | Bacteria | 2091 |
| 479 | Ga0450907_021420 | 3300042146 | Bacteria | 1087 |
| 480 | Ga0450910_006050 | 3300042147 | Bacteria | 1662 |
| 481 | Ga0450910_019376 | 3300042147 | Bacteria | 1021 |
| 482 | Ga0439446_0018615 | 3300042156 | Bacteria | 1947 |
| 483 | Ga0439458_0090855 | 3300042157 | Bacteria | 786 |
| 484 | Ga0450908_008969 | 3300042184 | Bacteria | 1866 |
| 485 | Ga0439434_0008577 | 3300042435 | Bacteria | 3000 |
| 486 | Ga0439434_0046306 | 3300042435 | Bacteria | 1342 |
| 487 | Ga0439435_0186508 | 3300042436 | Bacteria | 679 |
| 488 | Ga0450918_001307 | 3300042531 | Bacteria | 5032 |
| 489 | Ga0450893_0001916 | 3300042532 | Bacteria | 3229 |
| 490 | Ga0450893_0021580 | 3300042532 | Bacteria | 1112 |
| 491 | Ga0453683_0154118 | 3300044673 | Bacteria | 1452 |
| 492 | Ga0466965_0021670 | 3300044683 | Bacteria | 3095 |
| 493 | Ga0453684_0000279 | 3300044712 | Bacteria | 220016 |
| 494 | Ga0453684_0138148 | 3300044712 | Bacteria | 2914 |
| 495 | Ga0453684_0512651 | 3300044712 | Bacteria | 1326 |
| 496 | Ga0453684_0559836 | 3300044712 | Bacteria | 1258 |
| 497 | Ga0453684_1153969 | 3300044712 | Bacteria | 816 |
| 498 | Ga0466960_0168748 | 3300044901 | Bacteria | 1180 |
| 499 | Ga0451576_0034078 | 3300045051 | Bacteria | 5409 |
| 500 | Ga0451576_0040679 | 3300045051 | Bacteria | 4917 |
| 501 | Ga0451576_0273823 | 3300045051 | Bacteria | 1765 |
| 502 | Ga0451576_0289315 | 3300045051 | Bacteria | 1713 |
| 503 | Ga0451576_1361369 | 3300045051 | Bacteria | 739 |
| 504 | Ga0495627_012911 | 3300046453 | Bacteria | 2949 |
| 505 | Ga0495627_072617 | 3300046453 | Bacteria | 1003 |
| 506 | Ga0495638_0046107 | 3300046460 | Bacteria | 2740 |
| 507 | Ga0495639_0040524 | 3300046475 | Bacteria | 2095 |
| 508 | Ga0495583_0187589 | 3300046506 | Bacteria | 844 |
| 509 | Ga0495610_0018506 | 3300046512 | Bacteria | 3931 |
| 510 | Ga0495610_0034365 | 3300046512 | Bacteria | 2612 |
| 511 | Ga0495610_0192671 | 3300046512 | Bacteria | 840 |
| 512 | Ga0495616_0027760 | 3300046513 | Bacteria | 3001 |
| 513 | Ga0495620_0021223 | 3300046515 | Bacteria | 3157 |
| 514 | Ga0495620_0141524 | 3300046515 | Bacteria | 940 |
| 515 | Ga0495630_0932356 | 3300046517 | Bacteria | 661 |
| 516 | Ga0495631_0019187 | 3300046518 | Bacteria | 3209 |
| 517 | Ga0495631_0376554 | 3300046518 | Bacteria | 604 |
| 518 | Ga0495637_0004432 | 3300046520 | Bacteria | 7277 |
| 519 | Ga0495637_0076588 | 3300046520 | Bacteria | 1340 |
| 520 | Ga0495643_0035021 | 3300046522 | Bacteria | 2766 |
| 521 | Ga0495643_0084710 | 3300046522 | Bacteria | 1645 |
| 522 | Ga0495648_0373022 | 3300046524 | Bacteria | 645 |
| 523 | Ga0495663_0055242 | 3300046525 | Bacteria | 1238 |
| 524 | Ga0495663_0156013 | 3300046525 | Bacteria | 781 |
| 525 | Ga0495666_0227473 | 3300046526 | Bacteria | 853 |
| 526 | Ga0495642_0036280 | 3300046528 | Bacteria | 1992 |
| 527 | Ga0495654_0022887 | 3300046530 | Bacteria | 3240 |
| 528 | Ga0495654_0051519 | 3300046530 | Bacteria | 2008 |
| 529 | Ga0495654_0061750 | 3300046530 | Bacteria | 1798 |
| 530 | Ga0495586_0710971 | 3300046535 | Bacteria | 580 |
| 531 | Ga0495598_0003877 | 3300046537 | Bacteria | 3205 |
| 532 | Ga0495598_0235324 | 3300046537 | Bacteria | 673 |
| 533 | Ga0495609_0174232 | 3300046538 | Bacteria | 907 |
| 534 | Ga0495621_0124571 | 3300046539 | Bacteria | 998 |
| 535 | Ga0495621_0163479 | 3300046539 | Bacteria | 881 |
| 536 | Ga0495597_0023877 | 3300046542 | Bacteria | 2826 |
| 537 | Ga0495645_0112520 | 3300046543 | Bacteria | 1925 |
| 538 | Ga0495622_0136565 | 3300046557 | Bacteria | 1115 |
| 539 | Ga0495656_0000916 | 3300046615 | Bacteria | 9534 |
| 540 | Ga0495656_0024649 | 3300046615 | Bacteria | 2378 |
| 541 | Ga0495656_0049212 | 3300046615 | Bacteria | 1794 |
| 542 | Ga0495656_0085697 | 3300046615 | Bacteria | 1431 |
| 543 | Ga0495625_0000411 | 3300046660 | Bacteria | 64917 |
| 544 | Ga0495625_0054874 | 3300046660 | Bacteria | 2844 |
| 545 | Ga0495625_0188068 | 3300046660 | Bacteria | 1369 |
| 546 | Ga0495635_0190540 | 3300046663 | Bacteria | 1392 |
| 547 | Ga0495635_0398671 | 3300046663 | Bacteria | 914 |
| 548 | Ga0495661_0141168 | 3300046665 | Bacteria | 1310 |
| 549 | Ga0495588_0021962 | 3300046674 | Bacteria | 3150 |
| 550 | Ga0495588_0093008 | 3300046674 | Bacteria | 1580 |
| 551 | Ga0495588_0107619 | 3300046674 | Bacteria | 1468 |
| 552 | Ga0495588_0109339 | 3300046674 | Bacteria | 1456 |
| 553 | Ga0495658_0180970 | 3300046683 | Bacteria | 1308 |
| 554 | Ga0495658_0263798 | 3300046683 | Bacteria | 1084 |
| 555 | Ga0495669_0162141 | 3300046684 | Bacteria | 1061 |
| 556 | Ga0495670_0119677 | 3300046691 | Bacteria | 1367 |
| 557 | Ga0495670_0329297 | 3300046691 | Bacteria | 820 |
| 558 | Ga0495671_0080973 | 3300046692 | Bacteria | 1591 |
| 559 | Ga0495600_0462552 | 3300046809 | Bacteria | 783 |
| 560 | Ga0495660_0189213 | 3300046810 | Bacteria | 990 |
| 561 | Ga0495636_0041036 | 3300047318 | Bacteria | 1920 |
| 562 | Ga0495636_0162488 | 3300047318 | Bacteria | 1007 |
| 563 | Ga0495676_0011078 | 3300047321 | Bacteria | 8149 |
| 564 | Ga0495677_0125377 | 3300047445 | Bacteria | 981 |
| 565 | Ga0495685_011191 | 3300047447 | Bacteria | 3023 |
| 566 | Ga0495681_0107646 | 3300047470 | Bacteria | 1211 |
| 567 | Ga0495681_0130840 | 3300047470 | Bacteria | 1068 |
| 568 | Ga0495681_0326489 | 3300047470 | Bacteria | 588 |
| 569 | Ga0495686_0007977 | 3300047472 | Bacteria | 7853 |
| 570 | Ga0495686_0130715 | 3300047472 | Bacteria | 1489 |
| 571 | Ga0495593_0009567 | 3300047673 | Bacteria | 5626 |
| 572 | Ga0495614_0014245 | 3300048089 | Bacteria | 3484 |
| 573 | Ga0495615_0007034 | 3300048090 | Bacteria | 2117 |
| 574 | Ga0495615_0030313 | 3300048090 | Bacteria | 1290 |
| 575 | Ga0495615_0036078 | 3300048090 | Bacteria | 1211 |
| 576 | Ga0496100_0061992 | 3300048903 | Bacteria | 2466 |
| 577 | Ga0496100_0416974 | 3300048903 | Bacteria | 1025 |
| 578 | Ga0496101_0019764 | 3300048904 | Bacteria | 4605 |
| 579 | Ga0496101_0070039 | 3300048904 | Bacteria | 2567 |
| 580 | Ga0496102_0018680 | 3300048905 | Bacteria | 6097 |
| 581 | Ga0496103_0075323 | 3300048906 | Bacteria | 2116 |
| 582 | Ga0496103_0176891 | 3300048906 | Bacteria | 1371 |
| 583 | Ga0496103_0867225 | 3300048906 | Bacteria | 567 |
| 584 | Ga0496104_0025765 | 3300048907 | Bacteria | 5423 |
| 585 | Ga0496105_0045065 | 3300048908 | Bacteria | 3639 |
| 586 | Ga0496106_0183839 | 3300048909 | Bacteria | 1660 |
| 587 | Ga0496107_0113937 | 3300048910 | Bacteria | 1989 |
| 588 | Ga0496108_0157127 | 3300048911 | Bacteria | 1964 |
| 589 | Ga0496108_0943113 | 3300048911 | Bacteria | 739 |
| 590 | Ga0496109_0123108 | 3300048912 | Bacteria | 2417 |
| 591 | Ga0496109_0161834 | 3300048912 | Bacteria | 2097 |
| 592 | Ga0496109_0355941 | 3300048912 | Bacteria | 1383 |
| 593 | Ga0496110_0019037 | 3300048913 | Bacteria | 5770 |
| 594 | Ga0496110_0215560 | 3300048913 | Bacteria | 1745 |
| 595 | Ga0496111_0094692 | 3300048914 | Bacteria | 2190 |
| 596 | Ga0496112_0763188 | 3300048915 | Bacteria | 893 |
| 597 | Ga0496114_0366673 | 3300048917 | Bacteria | 1274 |
| 598 | Ga0496114_0452769 | 3300048917 | Bacteria | 1137 |
| 599 | Ga0496114_1337304 | 3300048917 | Bacteria | 603 |
| 600 | Ga0496116_0027214 | 3300048919 | Bacteria | 4166 |
| 601 | Ga0496116_0042592 | 3300048919 | Bacteria | 3101 |
| 602 | Ga0496116_0225095 | 3300048919 | Bacteria | 957 |
| 603 | Ga0496117_0028416 | 3300048920 | Bacteria | 4331 |
| 604 | Ga0496117_0122036 | 3300048920 | Bacteria | 1598 |
| 605 | Ga0496117_0125747 | 3300048920 | Bacteria | 1565 |
| 606 | Ga0496118_0014920 | 3300048921 | Bacteria | 7232 |
| 607 | Ga0496118_0062819 | 3300048921 | Bacteria | 2737 |
| 608 | Ga0496118_0147818 | 3300048921 | Bacteria | 1476 |
| 609 | Ga0496119_0174593 | 3300048922 | Bacteria | 1132 |
| 610 | Ga0496121_0025381 | 3300048924 | Bacteria | 5625 |
| 611 | Ga0496121_0088556 | 3300048924 | Bacteria | 2426 |
| 612 | Ga0496122_0000998 | 3300048925 | Bacteria | 50283 |
| 613 | Ga0496122_0104621 | 3300048925 | Bacteria | 1880 |
| 614 | Ga0496122_0160871 | 3300048925 | Bacteria | 1369 |
| 615 | Ga0496122_0177963 | 3300048925 | Bacteria | 1273 |
| 616 | Ga0496122_0209278 | 3300048925 | Bacteria | 1131 |
| 617 | Ga0496123_0000045 | 3300048926 | Bacteria | 249294 |
| 618 | Ga0496123_0107769 | 3300048926 | Bacteria | 1602 |
| 619 | Ga0496123_0164464 | 3300048926 | Bacteria | 1179 |
| 620 | Ga0496124_0081035 | 3300048927 | Bacteria | 2669 |
| 621 | Ga0496124_0101887 | 3300048927 | Bacteria | 2325 |
| 622 | Ga0496124_0134721 | 3300048927 | Bacteria | 1957 |
| 623 | Ga0496124_0165449 | 3300048927 | Bacteria | 1719 |
| 624 | Ga0496125_0015577 | 3300048928 | Bacteria | 7342 |
| 625 | Ga0496125_0041048 | 3300048928 | Bacteria | 3960 |
| 626 | Ga0496125_0085816 | 3300048928 | Bacteria | 2384 |
| 627 | Ga0496125_0096632 | 3300048928 | Bacteria | 2192 |
| 628 | Ga0496125_0106796 | 3300048928 | Bacteria | 2042 |
| 629 | Ga0496125_0478351 | 3300048928 | Bacteria | 706 |
| 630 | Ga0496125_0566725 | 3300048928 | Bacteria | 626 |
| 631 | Ga0496126_0088477 | 3300048929 | Bacteria | 2728 |
| 632 | Ga0496126_0099168 | 3300048929 | Bacteria | 2552 |
| 633 | Ga0496126_0113187 | 3300048929 | Bacteria | 2362 |
| 634 | Ga0496126_0139641 | 3300048929 | Bacteria | 2087 |
| 635 | Ga0496126_0180552 | 3300048929 | Bacteria | 1793 |
| 636 | Ga0496126_0376422 | 3300048929 | Bacteria | 1157 |
| 637 | Ga0501308_010543 | 3300049128 | Bacteria | 1028 |
| 638 | Ga0501310_012827 | 3300049130 | Bacteria | 965 |
| 639 | Ga0501304_032348 | 3300049160 | Bacteria | 560 |
| 640 | Ga0501307_013324 | 3300049162 | Bacteria | 991 |
| 641 | Ga0501313_031979 | 3300049529 | Bacteria | 685 |
| 642 | Ga0501313_065079 | 3300049529 | Bacteria | 521 |
| 643 | Ga0501315_031735 | 3300049531 | Bacteria | 764 |
| 644 | Ga0501315_060434 | 3300049531 | Bacteria | 612 |
| 645 | Ga0501316_007310 | 3300049532 | Bacteria | 1196 |
| 646 | Ga0501317_024669 | 3300049533 | Bacteria | 838 |
| 647 | Ga0501323_003453 | 3300049539 | Bacteria | 1615 |
| 648 | Ga0501335_021047 | 3300049551 | Bacteria | 697 |
| 649 | Ga0501338_02098 | 3300049554 | Bacteria | 1119 |
| 650 | Ga0501032_0082781 | 3300049569 | Bacteria | 2135 |
| 651 | Ga0501034_0096457 | 3300049571 | Bacteria | 2953 |
| 652 | Ga0501039_0994098 | 3300049575 | Bacteria | 652 |
| 653 | Ga0501042_0594241 | 3300049578 | Bacteria | 805 |
| 654 | Ga0501043_0000004 | 3300049579 | Bacteria | 291085 |
| 655 | Ga0501046_0000050 | 3300049580 | Bacteria | 134922 |
| 656 | Ga0501046_0266612 | 3300049580 | Bacteria | 1257 |
| 657 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 658 | Ga0501227_084803 | 3300049665 | Bacteria | 833 |
| 659 | Ga0501240_047523 | 3300049673 | Bacteria | 729 |
| 660 | Ga0501243_110545 | 3300049675 | Bacteria | 562 |
| 661 | Ga0501249_011075 | 3300049679 | Bacteria | 1890 |
| 662 | Ga0501252_008040 | 3300049682 | Bacteria | 1206 |
| 663 | Ga0501257_093279 | 3300049686 | Bacteria | 785 |
| 664 | Ga0501225_0011298 | 3300049705 | Bacteria | 2514 |
| 665 | Ga0501241_042241 | 3300049758 | Bacteria | 886 |
| 666 | Ga0501262_001277 | 3300049759 | Bacteria | 2821 |
| 667 | Ga0501263_016226 | 3300049760 | Bacteria | 968 |
| 668 | Ga0501266_014342 | 3300049763 | Bacteria | 1038 |
| 669 | Ga0501045_0125712 | 3300049824 | Bacteria | 1905 |
| 670 | nmdc:mga03683_301186_c1 | 3300050489 | Bacteria | 752 |
| 671 | nmdc:mga03683_43356_c1 | 3300050489 | Bacteria | 1856 |
| 672 | nmdc:mga03683_44094_c1 | 3300050489 | Bacteria | 1842 |
| 673 | nmdc:mga03683_61087_c1 | 3300050489 | Bacteria | 1593 |
| 674 | nmdc:mga03683_61604_c1 | 3300050489 | Bacteria | 1587 |
| 675 | nmdc:mga03683_77870_c1 | 3300050489 | Bacteria | 1427 |
| 676 | nmdc:mga03n38_27623_c1 | 3300050490 | Bacteria | 2356 |
| 677 | nmdc:mga03n38_502617_c1 | 3300050490 | Bacteria | 680 |
| 678 | nmdc:mga03n38_624113_c1 | 3300050490 | Bacteria | 616 |
| 679 | nmdc:mga03n38_95731_c1 | 3300050490 | Bacteria | 1423 |
| 680 | nmdc:mga00v17_1002146_c1 | 3300050491 | Bacteria | 526 |
| 681 | nmdc:mga00v17_183968_c1 | 3300050491 | Bacteria | 1348 |
| 682 | nmdc:mga00v17_42026_c1 | 3300050491 | Bacteria | 2748 |
| 683 | nmdc:mga00v17_99319_c1 | 3300050491 | Bacteria | 1836 |
| 684 | nmdc:mga0yw44_1031058_c1 | 3300050492 | Bacteria | 557 |
| 685 | nmdc:mga0yw44_25707_c1 | 3300050492 | Bacteria | 3353 |
| 686 | nmdc:mga0yw44_610084_c1 | 3300050492 | Bacteria | 741 |
| 687 | nmdc:mga0k408_10048_c2 | 3300050493 | Bacteria | 4754 |
| 688 | nmdc:mga0k408_130843_c1 | 3300050493 | Bacteria | 1490 |
| 689 | nmdc:mga0k408_165009_c1 | 3300050493 | Bacteria | 1320 |
| 690 | nmdc:mga0k408_195670_c1 | 3300050493 | Bacteria | 1207 |
| 691 | nmdc:mga0k408_201301_c1 | 3300050493 | Bacteria | 1189 |
| 692 | nmdc:mga0k408_27833_c1 | 3300050493 | Bacteria | 3212 |
| 693 | nmdc:mga0k408_352379_c1 | 3300050493 | Bacteria | 877 |
| 694 | nmdc:mga0k408_47120_c1 | 3300050493 | Bacteria | 2491 |
| 695 | nmdc:mga0k408_684552_c1 | 3300050493 | Bacteria | 601 |
| 696 | nmdc:mga0k408_89217_c1 | 3300050493 | Bacteria | 1811 |
| 697 | nmdc:mga06z11_115105_c1 | 3300050494 | Bacteria | 1493 |
| 698 | nmdc:mga06z11_662416_c1 | 3300050494 | Bacteria | 636 |
| 699 | nmdc:mga07m45_19628_c1 | 3300050496 | Bacteria | 3664 |
| 700 | nmdc:mga07m45_229026_c1 | 3300050496 | Bacteria | 1081 |
| 701 | nmdc:mga07m45_24382_c2 | 3300050496 | Bacteria | 2726 |
| 702 | nmdc:mga07m45_259391_c1 | 3300050496 | Bacteria | 1011 |
| 703 | nmdc:mga07m45_280482_c1 | 3300050496 | Bacteria | 969 |
| 704 | nmdc:mga07m45_37266_c1 | 3300050496 | Bacteria | 2712 |
| 705 | nmdc:mga07m45_429736_c1 | 3300050496 | Bacteria | 766 |
| 706 | nmdc:mga07m45_4682_c1 | 3300050496 | Bacteria | 6717 |
| 707 | nmdc:mga07m45_4793_c2 | 3300050496 | Bacteria | 3320 |
| 708 | nmdc:mga07m45_529904_c1 | 3300050496 | Bacteria | 682 |
| 709 | nmdc:mga07m45_582161_c1 | 3300050496 | Bacteria | 647 |
| 710 | nmdc:mga0sz30_107357_c1 | 3300050516 | Bacteria | 1222 |
| 711 | Ga0500610_0065489 | 3300053079 | Bacteria | 1894 |
| 712 | Ga0500610_0137740 | 3300053079 | Bacteria | 1235 |
| 713 | Ga0500643_025657 | 3300053087 | Bacteria | 1856 |
| 714 | Ga0500643_146900 | 3300053087 | Bacteria | 633 |
| 715 | Ga0500646_0151901 | 3300053090 | Bacteria | 767 |
| 716 | Ga0500651_0000320 | 3300053093 | Bacteria | 27507 |
| 717 | Ga0500651_0387672 | 3300053093 | Bacteria | 787 |
| 718 | Ga0500566_0046927 | 3300053094 | Bacteria | 2480 |
| 719 | Ga0500562_037954 | 3300053108 | Bacteria | 1279 |
| 720 | Ga0500571_026066 | 3300053110 | Bacteria | 3237 |
| 721 | Ga0500593_018637 | 3300053117 | Bacteria | 3029 |
| 722 | Ga0500594_0005559 | 3300053118 | Bacteria | 2797 |
| 723 | Ga0500594_0030215 | 3300053118 | Bacteria | 1421 |
| 724 | Ga0500597_137695 | 3300053120 | Bacteria | 1053 |
| 725 | Ga0500607_037082 | 3300053121 | Bacteria | 2658 |
| 726 | Ga0500608_034047 | 3300053122 | Bacteria | 2426 |
| 727 | Ga0500608_058403 | 3300053122 | Bacteria | 1847 |
| 728 | Ga0500618_028274 | 3300053125 | Bacteria | 1329 |
| 729 | Ga0500655_006961 | 3300053133 | Bacteria | 2032 |
| 730 | Ga0500658_0028648 | 3300053134 | Bacteria | 2162 |
| 731 | Ga0500559_0059373 | 3300053136 | Bacteria | 1702 |
| 732 | Ga0500559_0061547 | 3300053136 | Bacteria | 1674 |
| 733 | Ga0500568_0005077 | 3300053139 | Bacteria | 6884 |
| 734 | Ga0500573_0144620 | 3300053140 | Bacteria | 1307 |
| 735 | Ga0500574_016583 | 3300053141 | Bacteria | 1782 |
| 736 | Ga0500590_043771 | 3300053148 | Bacteria | 2295 |
| 737 | Ga0500604_0205190 | 3300053151 | Bacteria | 678 |
| 738 | Ga0500616_0011974 | 3300053153 | Bacteria | 5095 |
| 739 | Ga0500616_0101655 | 3300053153 | Bacteria | 1404 |
| 740 | Ga0500622_0134370 | 3300053156 | Bacteria | 1186 |
| 741 | Ga0500627_0018087 | 3300053158 | Bacteria | 2783 |
| 742 | Ga0500634_0008569 | 3300053161 | Bacteria | 5120 |
| 743 | Ga0500570_044862 | 3300053724 | Bacteria | 2276 |
| 744 | Ga0500625_101117 | 3300053729 | Bacteria | 1208 |
| 745 | Ga0500645_000905 | 3300053730 | Bacteria | 17125 |
| 746 | Ga0590075_015079 | 3300059424 | Bacteria | 1894 |
| 747 | Ga0590075_082095 | 3300059424 | Bacteria | 835 |
| 748 | Ga0587077_033752 | 3300059493 | Bacteria | 990 |
| 749 | Ga0587068_018853 | 3300059641 | Bacteria | 1114 |
| 750 | Ga0587072_192581 | 3300059643 | Bacteria | 514 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026118 | Ga0207675_101088157 | Ga0207675_1010881572 | 105 |
| 2 | 3300025304 | Ga0209257_1050773 | Ga0209257_10507733 | 125 |
| 3 | 3300005353 | Ga0070669_100543598 | Ga0070669_1005435982 | 127 |
| 4 | 3300006178 | Ga0075367_10133846 | Ga0075367_101338462 | 127 |
| 5 | 3300006353 | Ga0075370_10784864 | Ga0075370_107848642 | 127 |
| 6 | 3300006353 | Ga0075370_10837161 | Ga0075370_108371611 | 127 |
| 7 | 3300028794 | Ga0307515_10001533 | Ga0307515_1000153330 | 127 |
| 8 | 3300028794 | Ga0307515_10002409 | Ga0307515_1000240923 | 127 |
| 9 | 3300028794 | Ga0307515_10006008 | Ga0307515_1000600813 | 127 |
| 10 | 3300030522 | Ga0307512_10036360 | Ga0307512_100363602 | 127 |
| 11 | 3300031456 | Ga0307513_10046229 | Ga0307513_100462293 | 127 |
| 12 | 3300031507 | Ga0307509_10085882 | Ga0307509_100858822 | 127 |
| 13 | 3300031649 | Ga0307514_10167229 | Ga0307514_101672292 | 127 |
| 14 | 3300031730 | Ga0307516_10001303 | Ga0307516_100013036 | 127 |
| 15 | 3300041443 | Ga0451789_0105499 | Ga0451789_0105499_200_583 | 127 |
| 16 | 3300041443 | Ga0451789_0429677 | Ga0451789_0429677_161_544 | 127 |
| 17 | 3300041459 | Ga0451800_0987865 | Ga0451800_0987865_499_882 | 127 |
| 18 | 3300041460 | Ga0451802_1196336 | Ga0451802_1196336_315_698 | 127 |
| 19 | 3300041486 | Ga0451807_0986316 | Ga0451807_0986316_470_853 | 127 |
| 20 | 3300041494 | Ga0451837_0229797 | Ga0451837_0229797_25_408 | 127 |
| 21 | 3300041512 | Ga0451853_0739295 | Ga0451853_0739295_569_952 | 127 |
| 22 | 3300046512 | Ga0495610_0034365 | Ga0495610_0034365_610_993 | 127 |
| 23 | 3300046522 | Ga0495643_0035021 | Ga0495643_0035021_1163_1546 | 127 |
| 24 | 3300046683 | Ga0495658_0180970 | Ga0495658_0180970_38_421 | 127 |
| 25 | 3300047472 | Ga0495686_0007977 | Ga0495686_0007977_6279_6662 | 127 |
| 26 | 3300047472 | Ga0495686_0130715 | Ga0495686_0130715_213_596 | 127 |
| 27 | 3300049531 | Ga0501315_060434 | Ga0501315_060434_12_395 | 127 |
| 28 | 3300050489 | nmdc:mga03683_301186_c1 | nmdc:mga03683_301186_c1_318_701 | 127 |
| 29 | 3300050490 | nmdc:mga03n38_624113_c1 | nmdc:mga03n38_624113_c1_173_556 | 127 |
| 30 | 3300050496 | nmdc:mga07m45_529904_c1 | nmdc:mga07m45_529904_c1_57_440 | 127 |
| 31 | 3300050496 | nmdc:mga07m45_582161_c1 | nmdc:mga07m45_582161_c1_132_515 | 127 |
| 32 | 3300053093 | Ga0500651_0387672 | Ga0500651_0387672_296_679 | 127 |
| 33 | 3300053148 | Ga0500590_043771 | Ga0500590_043771_1305_1688 | 127 |
| 34 | 3300053724 | Ga0500570_044862 | Ga0500570_044862_699_1082 | 127 |
| 35 | 3300005331 | Ga0070670_100209538 | Ga0070670_1002095382 | 128 |
| 36 | 3300005543 | Ga0070672_100022180 | Ga0070672_1000221802 | 128 |
| 37 | 3300005618 | Ga0068864_100801114 | Ga0068864_1008011142 | 128 |
| 38 | 3300006881 | Ga0068865_100271368 | Ga0068865_1002713682 | 128 |
| 39 | 3300009098 | Ga0105245_10087717 | Ga0105245_100877173 | 128 |
| 40 | 3300009148 | Ga0105243_10204752 | Ga0105243_102047522 | 128 |
| 41 | 3300011119 | Ga0105246_10169215 | Ga0105246_101692153 | 128 |
| 42 | 3300014745 | Ga0157377_10541755 | Ga0157377_105417552 | 128 |
| 43 | 3300025907 | Ga0207645_10008421 | Ga0207645_100084219 | 128 |
| 44 | 3300025925 | Ga0207650_10114185 | Ga0207650_101141852 | 128 |
| 45 | 3300025927 | Ga0207687_10084406 | Ga0207687_100844063 | 128 |
| 46 | 3300025940 | Ga0207691_10009910 | Ga0207691_100099109 | 128 |
| 47 | 3300025942 | Ga0207689_10018922 | Ga0207689_100189225 | 128 |
| 48 | 3300025960 | Ga0207651_10267929 | Ga0207651_102679292 | 128 |
| 49 | 3300025972 | Ga0207668_10395558 | Ga0207668_103955582 | 128 |
| 50 | 3300026089 | Ga0207648_10041681 | Ga0207648_100416813 | 128 |
| 51 | 3300026116 | Ga0207674_10020101 | Ga0207674_100201019 | 128 |
| 52 | 3300026121 | Ga0207683_10473562 | Ga0207683_104735622 | 128 |
| 53 | 3300037471 | Ga0395905_0856731 | Ga0395905_0856731_171_557 | 128 |
| 54 | 3300048906 | Ga0496103_0867225 | Ga0496103_0867225_110_496 | 128 |
| 55 | 3300049569 | Ga0501032_0082781 | Ga0501032_0082781_434_820 | 128 |
| 56 | 3300049579 | Ga0501043_0000004 | Ga0501043_0000004_1146_1532 | 128 |
| 57 | 3300049580 | Ga0501046_0000050 | Ga0501046_0000050_78462_78848 | 128 |
| 58 | 3300049581 | Ga0501047_0000012 | Ga0501047_0000012_289984_290370 | 128 |
| 59 | 3300049824 | Ga0501045_0125712 | Ga0501045_0125712_490_876 | 128 |
| 60 | 3300005455 | Ga0070663_100015443 | Ga0070663_1000154435 | 129 |
| 61 | 3300009176 | Ga0105242_11939011 | Ga0105242_119390111 | 129 |
| 62 | 3300013297 | Ga0157378_10730720 | Ga0157378_107307203 | 129 |
| 63 | 3300026067 | Ga0207678_10028113 | Ga0207678_100281133 | 129 |
| 64 | 3300037471 | Ga0395905_1111515 | Ga0395905_1111515_194_583 | 129 |
| 65 | 3300031238 | Ga0265332_10000009 | Ga0265332_1000000984 | 132 |
| 66 | 3300042116 | Ga0450912_000270 | Ga0450912_000270_1739_2173 | 133 |
| 67 | 3300006042 | Ga0075368_10088634 | Ga0075368_100886342 | 135 |
| 68 | 3300006048 | Ga0075363_100055360 | Ga0075363_1000553602 | 135 |
| 69 | 3300006177 | Ga0075362_10033318 | Ga0075362_100333181 | 135 |
| 70 | 3300006178 | Ga0075367_10022549 | Ga0075367_100225494 | 135 |
| 71 | 3300006195 | Ga0075366_10106165 | Ga0075366_101061653 | 135 |
| 72 | 3300014497 | Ga0182008_10267181 | Ga0182008_102671812 | 135 |
| 73 | 3300050489 | nmdc:mga03683_61604_c1 | nmdc:mga03683_61604_c1_645_1079 | 135 |
| 74 | 3300050490 | nmdc:mga03n38_27623_c1 | nmdc:mga03n38_27623_c1_1394_1828 | 135 |
| 75 | 3300050492 | nmdc:mga0yw44_1031058_c1 | nmdc:mga0yw44_1031058_c1_97_531 | 135 |
| 76 | 3300050494 | nmdc:mga06z11_662416_c1 | nmdc:mga06z11_662416_c1_97_531 | 135 |
| 77 | 3300049575 | Ga0501039_0994098 | Ga0501039_0994098_195_608 | 136 |
| 78 | 3300049578 | Ga0501042_0594241 | Ga0501042_0594241_248_661 | 136 |
| 79 | 3300006946 | Ga0079104_1000352 | Ga0079104_100035244 | 138 |
| 80 | 3300027111 | Ga0209281_1000454 | Ga0209281_100045413 | 138 |
| 81 | 3300030734 | Ga0316179_1005100 | Ga0316179_10051002 | 138 |
| 82 | 3300050493 | nmdc:mga0k408_684552_c1 | nmdc:mga0k408_684552_c1_61_489 | 138 |
| 83 | iso_pu_bacteria | 2939631187 | 2939631894 | 138 |
| 84 | 3300031344 | Ga0265316_10000807 | Ga0265316_1000080720 | 139 |
| 85 | 3300045051 | Ga0451576_0289315 | Ga0451576_0289315_1111_1530 | 139 |
| 86 | 3300049580 | Ga0501046_0266612 | Ga0501046_0266612_635_1081 | 139 |
| 87 | iso_pu_bacteria | 2904479285 | 2904483492 | 139 |
| 88 | iso_pu_bacteria | 2919704043 | 2919707276 | 139 |
| 89 | 3300006178 | Ga0075367_10533822 | Ga0075367_105338222 | 140 |
| 90 | 3300006195 | Ga0075366_10007874 | Ga0075366_100078748 | 140 |
| 91 | 3300006195 | Ga0075366_10032122 | Ga0075366_100321223 | 140 |
| 92 | 3300014968 | Ga0157379_10015837 | Ga0157379_100158373 | 140 |
| 93 | 3300028381 | Ga0268264_10194621 | Ga0268264_101946213 | 140 |
| 94 | 3300028794 | Ga0307515_10060740 | Ga0307515_100607406 | 140 |
| 95 | 3300031456 | Ga0307513_10003195 | Ga0307513_1000319515 | 140 |
| 96 | 3300031507 | Ga0307509_10418108 | Ga0307509_104181082 | 140 |
| 97 | 3300044712 | Ga0453684_0138148 | Ga0453684_0138148_1599_2021 | 140 |
| 98 | 3300044712 | Ga0453684_1153969 | Ga0453684_1153969_252_674 | 140 |
| 99 | 3300045051 | Ga0451576_0034078 | Ga0451576_0034078_4375_4797 | 140 |
| 100 | 3300045051 | Ga0451576_0273823 | Ga0451576_0273823_587_1009 | 140 |
| 101 | 3300048912 | Ga0496109_0161834 | Ga0496109_0161834_1105_1539 | 140 |
| 102 | 3300050493 | nmdc:mga0k408_165009_c1 | nmdc:mga0k408_165009_c1_604_1026 | 140 |
| 103 | 3300050493 | nmdc:mga0k408_27833_c1 | nmdc:mga0k408_27833_c1_1983_2405 | 140 |
| 104 | 3300050494 | nmdc:mga06z11_115105_c1 | nmdc:mga06z11_115105_c1_751_1173 | 140 |
| 105 | iso_pu_bacteria | 2547132374 | 2548498095 | 140 |
| 106 | iso_pu_bacteria | 2643221570 | 2643867384 | 140 |
| 107 | iso_pu_bacteria | 2643221596 | 2643992117 | 140 |
| 108 | iso_pu_bacteria | 2643221609 | 2644057270 | 140 |
| 109 | iso_pu_bacteria | 2643221611 | 2644071907 | 140 |
| 110 | iso_pu_bacteria | 2643221652 | 2644295179 | 140 |
| 111 | iso_pu_bacteria | 2643221717 | 2644648621 | 140 |
| 112 | iso_pu_bacteria | 2738543012 | 2739246594 | 140 |
| 113 | iso_pu_bacteria | 2816332133 | 2816476101 | 140 |
| 114 | iso_pu_bacteria | 2842718218 | 2842719694 | 140 |
| 115 | iso_pu_bacteria | 2974320154 | 2974323766 | 140 |
| 116 | iso_pu_bacteria | 2990710928 | 2990713363 | 140 |
| 117 | 3300005327 | Ga0070658_10735766 | Ga0070658_107357661 | 141 |
| 118 | 3300005338 | Ga0068868_100497494 | Ga0068868_1004974942 | 141 |
| 119 | 3300005459 | Ga0068867_100786936 | Ga0068867_1007869361 | 141 |
| 120 | 3300005539 | Ga0068853_101920814 | Ga0068853_1019208141 | 141 |
| 121 | 3300005544 | Ga0070686_101023726 | Ga0070686_1010237261 | 141 |
| 122 | 3300009177 | Ga0105248_11029210 | Ga0105248_110292102 | 141 |
| 123 | 3300009177 | Ga0105248_11839395 | Ga0105248_118393951 | 141 |
| 124 | 3300012505 | Ga0157339_1028301 | Ga0157339_10283011 | 141 |
| 125 | 3300014968 | Ga0157379_10931291 | Ga0157379_109312911 | 141 |
| 126 | 3300025941 | Ga0207711_11477776 | Ga0207711_114777762 | 141 |
| 127 | 3300025941 | Ga0207711_11623034 | Ga0207711_116230341 | 141 |
| 128 | 3300026041 | Ga0207639_10707467 | Ga0207639_107074671 | 141 |
| 129 | 3300026089 | Ga0207648_10488717 | Ga0207648_104887172 | 141 |
| 130 | 3300026121 | Ga0207683_11045162 | Ga0207683_110451622 | 141 |
| 131 | 3300031548 | Ga0307408_100450042 | Ga0307408_1004500423 | 141 |
| 132 | 3300041452 | Ga0451793_0935927 | Ga0451793_0935927_17_463 | 141 |
| 133 | 3300048911 | Ga0496108_0157127 | Ga0496108_0157127_644_1072 | 141 |
| 134 | iso_pu_bacteria | 2881101125 | 2881105434 | 141 |
| 135 | 3300005289 | Ga0065704_10604065 | Ga0065704_106040651 | 142 |
| 136 | 3300006844 | Ga0075428_101379235 | Ga0075428_1013792351 | 142 |
| 137 | 3300015262 | Ga0182007_10155895 | Ga0182007_101558952 | 142 |
| 138 | 3300025925 | Ga0207650_10327441 | Ga0207650_103274412 | 142 |
| 139 | 3300042005 | Ga0439448_0186251 | Ga0439448_0186251_220_648 | 142 |
| 140 | 3300059493 | Ga0587077_033752 | Ga0587077_033752_282_710 | 142 |
| 141 | 3300005459 | Ga0068867_100846419 | Ga0068867_1008464191 | 143 |
| 142 | 3300031239 | Ga0265328_10012736 | Ga0265328_100127364 | 143 |
| 143 | 3300031251 | Ga0265327_10000265 | Ga0265327_1000026566 | 143 |
| 144 | 3300031251 | Ga0265327_10416844 | Ga0265327_104168441 | 143 |
| 145 | 3300037418 | Ga0395900_0280588 | Ga0395900_0280588_699_1130 | 143 |
| 146 | 3300037466 | Ga0395898_0327717 | Ga0395898_0327717_699_1130 | 143 |
| 147 | 3300037466 | Ga0395898_0859572 | Ga0395898_0859572_239_676 | 143 |
| 148 | 3300037471 | Ga0395905_0088667 | Ga0395905_0088667_688_1119 | 143 |
| 149 | 3300037471 | Ga0395905_0794164 | Ga0395905_0794164_256_693 | 143 |
| 150 | 3300038443 | Ga0395901_0024228 | Ga0395901_0024228_916_1347 | 143 |
| 151 | 3300039447 | Ga0436361_0475800 | Ga0436361_0475800_1786_2217 | 143 |
| 152 | 3300044712 | Ga0453684_0000279 | Ga0453684_0000279_93628_94059 | 143 |
| 153 | 3300045051 | Ga0451576_0040679 | Ga0451576_0040679_3585_4016 | 143 |
| 154 | 3300046528 | Ga0495642_0036280 | Ga0495642_0036280_368_799 | 143 |
| 155 | 3300046615 | Ga0495656_0024649 | Ga0495656_0024649_304_735 | 143 |
| 156 | 3300046615 | Ga0495656_0049212 | Ga0495656_0049212_1268_1699 | 143 |
| 157 | 3300046674 | Ga0495588_0107619 | Ga0495588_0107619_797_1228 | 143 |
| 158 | 3300046684 | Ga0495669_0162141 | Ga0495669_0162141_59_490 | 143 |
| 159 | 3300047318 | Ga0495636_0041036 | Ga0495636_0041036_141_572 | 143 |
| 160 | 3300047447 | Ga0495685_011191 | Ga0495685_011191_1088_1519 | 143 |
| 161 | 3300047470 | Ga0495681_0130840 | Ga0495681_0130840_166_597 | 143 |
| 162 | 3300048090 | Ga0495615_0030313 | Ga0495615_0030313_274_705 | 143 |
| 163 | 3300048090 | Ga0495615_0036078 | Ga0495615_0036078_244_675 | 143 |
| 164 | 3300048912 | Ga0496109_0355941 | Ga0496109_0355941_573_1004 | 143 |
| 165 | 3300048913 | Ga0496110_0215560 | Ga0496110_0215560_1290_1721 | 143 |
| 166 | 3300059424 | Ga0590075_015079 | Ga0590075_015079_21_452 | 143 |
| 167 | iso_pu_bacteria | 2738543013 | 2739248200 | 143 |
| 168 | 3300005289 | Ga0065704_10105629 | Ga0065704_101056292 | 144 |
| 169 | 3300005339 | Ga0070660_100329236 | Ga0070660_1003292363 | 144 |
| 170 | 3300005564 | Ga0070664_100480219 | Ga0070664_1004802193 | 144 |
| 171 | 3300006051 | Ga0075364_10111408 | Ga0075364_101114083 | 144 |
| 172 | 3300009036 | Ga0105244_10140800 | Ga0105244_101408002 | 144 |
| 173 | 3300009176 | Ga0105242_10059133 | Ga0105242_100591333 | 144 |
| 174 | 3300025728 | Ga0207655_1106512 | Ga0207655_11065122 | 144 |
| 175 | 3300025934 | Ga0207686_10002907 | Ga0207686_100029077 | 144 |
| 176 | 3300026089 | Ga0207648_10861484 | Ga0207648_108614842 | 144 |
| 177 | 3300027424 | Ga0209984_1008006 | Ga0209984_10080062 | 144 |
| 178 | 3300027866 | Ga0209813_10021743 | Ga0209813_100217431 | 144 |
| 179 | 3300027876 | Ga0209974_10014274 | Ga0209974_100142743 | 144 |
| 180 | 3300031548 | Ga0307408_100000212 | Ga0307408_10000021214 | 144 |
| 181 | 3300031548 | Ga0307408_100253587 | Ga0307408_1002535871 | 144 |
| 182 | 3300031548 | Ga0307408_100449462 | Ga0307408_1004494622 | 144 |
| 183 | 3300031901 | Ga0307406_10001770 | Ga0307406_100017703 | 144 |
| 184 | 3300031911 | Ga0307412_10110281 | Ga0307412_101102811 | 144 |
| 185 | 3300031911 | Ga0307412_10523539 | Ga0307412_105235392 | 144 |
| 186 | 3300031911 | Ga0307412_10601551 | Ga0307412_106015512 | 144 |
| 187 | 3300032002 | Ga0307416_101102156 | Ga0307416_1011021562 | 144 |
| 188 | 3300032005 | Ga0307411_10485605 | Ga0307411_104856052 | 144 |
| 189 | 3300037418 | Ga0395900_0192655 | Ga0395900_0192655_668_1102 | 144 |
| 190 | 3300037471 | Ga0395905_0000684 | Ga0395905_0000684_15525_15959 | 144 |
| 191 | 3300039437 | Ga0436365_1063264 | Ga0436365_1063264_83_517 | 144 |
| 192 | 3300041999 | Ga0439433_0104744 | Ga0439433_0104744_11_445 | 144 |
| 193 | 3300042007 | Ga0439449_0013502 | Ga0439449_0013502_1536_1970 | 144 |
| 194 | 3300042119 | Ga0450915_007869 | Ga0450915_007869_46_480 | 144 |
| 195 | 3300042532 | Ga0450893_0001916 | Ga0450893_0001916_1057_1491 | 144 |
| 196 | 3300044673 | Ga0453683_0154118 | Ga0453683_0154118_322_756 | 144 |
| 197 | 3300045051 | Ga0451576_1361369 | Ga0451576_1361369_47_481 | 144 |
| 198 | 3300046542 | Ga0495597_0023877 | Ga0495597_0023877_1839_2273 | 144 |
| 199 | 3300048925 | Ga0496122_0209278 | Ga0496122_0209278_464_898 | 144 |
| 200 | 3300048928 | Ga0496125_0085816 | Ga0496125_0085816_1243_1677 | 144 |
| 201 | 3300048929 | Ga0496126_0113187 | Ga0496126_0113187_1412_1846 | 144 |
| 202 | 3300048929 | Ga0496126_0376422 | Ga0496126_0376422_430_864 | 144 |
| 203 | 3300049529 | Ga0501313_031979 | Ga0501313_031979_236_670 | 144 |
| 204 | 3300050491 | nmdc:mga00v17_99319_c1 | nmdc:mga00v17_99319_c1_149_583 | 144 |
| 205 | 3300050493 | nmdc:mga0k408_201301_c1 | nmdc:mga0k408_201301_c1_674_1108 | 144 |
| 206 | 3300050496 | nmdc:mga07m45_259391_c1 | nmdc:mga07m45_259391_c1_28_462 | 144 |
| 207 | iso_pu_bacteria | 2513020051 | 2513227832 | 144 |
| 208 | iso_pu_bacteria | 2599185214 | 2599628042 | 144 |
| 209 | iso_pu_bacteria | 2599185226 | 2599677906 | 144 |
| 210 | iso_pu_bacteria | 2599185227 | 2599684410 | 144 |
| 211 | iso_pu_bacteria | 2599185229 | 2599697554 | 144 |
| 212 | iso_pu_bacteria | 2643221628 | 2644162426 | 144 |
| 213 | iso_pu_bacteria | 2643221658 | 2644324595 | 144 |
| 214 | iso_pu_bacteria | 2643221672 | 2644396447 | 144 |
| 215 | iso_pu_bacteria | 2643221683 | 2644464522 | 144 |
| 216 | iso_pu_bacteria | 2738541277 | 2738719041 | 144 |
| 217 | iso_pu_bacteria | 2738541307 | 2738880062 | 144 |
| 218 | iso_pu_bacteria | 2738543019 | 2739281803 | 144 |
| 219 | iso_pu_bacteria | 2818991446 | 2819599527 | 144 |
| 220 | iso_pu_bacteria | 2831265667 | 2831271200 | 144 |
| 221 | iso_pu_bacteria | 2838054893 | 2838055788 | 144 |
| 222 | iso_pu_bacteria | 2842677519 | 2842682036 | 144 |
| 223 | iso_pu_bacteria | 2842733646 | 2842734339 | 144 |
| 224 | iso_pu_bacteria | 2842747753 | 2842749411 | 144 |
| 225 | iso_pu_bacteria | 2885192300 | 2885197924 | 144 |
| 226 | iso_pu_bacteria | 2885198086 | 2885200660 | 144 |
| 227 | iso_pu_bacteria | 2885211737 | 2885214557 | 144 |
| 228 | iso_pu_bacteria | 2899924645 | 2899928014 | 144 |
| 229 | iso_pu_bacteria | 2904449895 | 2904450489 | 144 |
| 230 | iso_pu_bacteria | 2904456579 | 2904456688 | 144 |
| 231 | iso_pu_bacteria | 2904541872 | 2904544466 | 144 |
| 232 | iso_pu_bacteria | 2919462493 | 2919462972 | 144 |
| 233 | iso_pu_bacteria | 2928037797 | 2928041879 | 144 |
| 234 | iso_pu_bacteria | 2928044640 | 2928049443 | 144 |
| 235 | iso_pu_bacteria | 2928051484 | 2928051881 | 144 |
| 236 | iso_pu_bacteria | 2928064002 | 2928065426 | 144 |
| 237 | iso_pu_bacteria | 2928070936 | 2928076475 | 144 |
| 238 | iso_pu_bacteria | 2928084124 | 2928086660 | 144 |
| 239 | iso_pu_bacteria | 2929160207 | 2929161964 | 144 |
| 240 | iso_pu_bacteria | 2929520902 | 2929521204 | 144 |
| 241 | iso_pu_bacteria | 2945909444 | 2945913626 | 144 |
| 242 | iso_pu_bacteria | 2945945610 | 2945949224 | 144 |
| 243 | iso_pu_bacteria | 2945972063 | 2945973267 | 144 |
| 244 | iso_pu_bacteria | 2945984333 | 2945990976 | 144 |
| 245 | iso_pu_bacteria | 2954767861 | 2954768588 | 144 |
| 246 | 3300005353 | Ga0070669_100080492 | Ga0070669_1000804923 | 145 |
| 247 | 3300005356 | Ga0070674_100140513 | Ga0070674_1001405133 | 145 |
| 248 | 3300005364 | Ga0070673_100435635 | Ga0070673_1004356352 | 145 |
| 249 | 3300005459 | Ga0068867_100193694 | Ga0068867_1001936942 | 145 |
| 250 | 3300005543 | Ga0070672_100953870 | Ga0070672_1009538702 | 145 |
| 251 | 3300009148 | Ga0105243_10499014 | Ga0105243_104990142 | 145 |
| 252 | 3300009177 | Ga0105248_10260589 | Ga0105248_102605893 | 145 |
| 253 | 3300014326 | Ga0157380_10235022 | Ga0157380_102350223 | 145 |
| 254 | 3300025923 | Ga0207681_10065858 | Ga0207681_100658583 | 145 |
| 255 | 3300025926 | Ga0207659_10131250 | Ga0207659_101312502 | 145 |
| 256 | 3300025935 | Ga0207709_10286880 | Ga0207709_102868802 | 145 |
| 257 | 3300025941 | Ga0207711_10505536 | Ga0207711_105055362 | 145 |
| 258 | 3300025972 | Ga0207668_10102125 | Ga0207668_101021252 | 145 |
| 259 | 3300026089 | Ga0207648_10329343 | Ga0207648_103293432 | 145 |
| 260 | 3300027360 | Ga0209969_1038395 | Ga0209969_10383952 | 145 |
| 261 | 3300031548 | Ga0307408_100084823 | Ga0307408_1000848233 | 145 |
| 262 | 3300031995 | Ga0307409_100579626 | Ga0307409_1005796263 | 145 |
| 263 | 3300031995 | Ga0307409_102504313 | Ga0307409_1025043131 | 145 |
| 264 | 3300032126 | Ga0307415_100799540 | Ga0307415_1007995401 | 145 |
| 265 | 3300046525 | Ga0495663_0156013 | Ga0495663_0156013_238_678 | 145 |
| 266 | 3300046537 | Ga0495598_0003877 | Ga0495598_0003877_128_568 | 145 |
| 267 | 3300046537 | Ga0495598_0235324 | Ga0495598_0235324_67_507 | 145 |
| 268 | 3300046539 | Ga0495621_0163479 | Ga0495621_0163479_121_561 | 145 |
| 269 | 3300049571 | Ga0501034_0096457 | Ga0501034_0096457_1897_2334 | 145 |
| 270 | 3300049673 | Ga0501240_047523 | Ga0501240_047523_149_586 | 145 |
| 271 | 3300049686 | Ga0501257_093279 | Ga0501257_093279_298_738 | 145 |
| 272 | 3300005840 | Ga0068870_10661068 | Ga0068870_106610682 | 146 |
| 273 | 3300012502 | Ga0157347_1001697 | Ga0157347_10016972 | 146 |
| 274 | 3300013104 | Ga0157370_10034122 | Ga0157370_100341225 | 146 |
| 275 | 3300014497 | Ga0182008_10117999 | Ga0182008_101179992 | 146 |
| 276 | 3300046453 | Ga0495627_012911 | Ga0495627_012911_1649_2179 | 146 |
| 277 | 3300046512 | Ga0495610_0192671 | Ga0495610_0192671_184_714 | 146 |
| 278 | 3300046515 | Ga0495620_0021223 | Ga0495620_0021223_942_1472 | 146 |
| 279 | 3300046520 | Ga0495637_0004432 | Ga0495637_0004432_5461_5991 | 146 |
| 280 | 3300046530 | Ga0495654_0061750 | Ga0495654_0061750_665_1195 | 146 |
| 281 | 3300046538 | Ga0495609_0174232 | Ga0495609_0174232_189_719 | 146 |
| 282 | 3300046660 | Ga0495625_0188068 | Ga0495625_0188068_230_760 | 146 |
| 283 | 3300046665 | Ga0495661_0141168 | Ga0495661_0141168_111_641 | 146 |
| 284 | 3300046674 | Ga0495588_0093008 | Ga0495588_0093008_666_1196 | 146 |
| 285 | 3300046691 | Ga0495670_0329297 | Ga0495670_0329297_69_599 | 146 |
| 286 | 3300046692 | Ga0495671_0080973 | Ga0495671_0080973_444_974 | 146 |
| 287 | 3300046810 | Ga0495660_0189213 | Ga0495660_0189213_380_910 | 146 |
| 288 | 3300047445 | Ga0495677_0125377 | Ga0495677_0125377_385_915 | 146 |
| 289 | 3300053079 | Ga0500610_0065489 | Ga0500610_0065489_435_965 | 146 |
| 290 | 3300053117 | Ga0500593_018637 | Ga0500593_018637_1226_1756 | 146 |
| 291 | 3300053158 | Ga0500627_0018087 | Ga0500627_0018087_713_1243 | 146 |
| 292 | 3300059424 | Ga0590075_082095 | Ga0590075_082095_114_554 | 146 |
| 293 | 3300002987 | JGI25159J45721_1022446 | JGI25159J45721_10224462 | 147 |
| 294 | 3300003781 | Ga0055536_1028385 | Ga0055536_10283853 | 147 |
| 295 | 3300003784 | Ga0055534_1002585 | Ga0055534_10025854 | 147 |
| 296 | 3300003792 | Ga0055540_1032059 | Ga0055540_10320592 | 147 |
| 297 | 3300005262 | Ga0065165_1047188 | Ga0065165_10471881 | 147 |
| 298 | 3300005335 | Ga0070666_10232948 | Ga0070666_102329482 | 147 |
| 299 | 3300005616 | Ga0068852_101065617 | Ga0068852_1010656172 | 147 |
| 300 | 3300025273 | Ga0209673_1090236 | Ga0209673_10902362 | 147 |
| 301 | 3300025284 | Ga0209130_1005537 | Ga0209130_10055374 | 147 |
| 302 | 3300025291 | Ga0209675_1001188 | Ga0209675_10011885 | 147 |
| 303 | 3300025291 | Ga0209675_1002968 | Ga0209675_10029689 | 147 |
| 304 | 3300025292 | Ga0209676_1025250 | Ga0209676_10252502 | 147 |
| 305 | 3300025294 | Ga0209025_1036750 | Ga0209025_10367503 | 147 |
| 306 | 3300025295 | Ga0209564_1060202 | Ga0209564_10602022 | 147 |
| 307 | 3300025298 | Ga0209050_1020859 | Ga0209050_10208593 | 147 |
| 308 | 3300025298 | Ga0209050_1053439 | Ga0209050_10534392 | 147 |
| 309 | 3300025304 | Ga0209257_1023311 | Ga0209257_10233113 | 147 |
| 310 | 3300028794 | Ga0307515_10000084 | Ga0307515_1000008473 | 147 |
| 311 | 3300031456 | Ga0307513_10030898 | Ga0307513_100308984 | 147 |
| 312 | 3300031649 | Ga0307514_10000319 | Ga0307514_1000031991 | 147 |
| 313 | 3300042004 | Ga0439445_0043375 | Ga0439445_0043375_684_1127 | 147 |
| 314 | 3300042006 | Ga0439432_065536 | Ga0439432_065536_95_538 | 147 |
| 315 | 3300042007 | Ga0439449_0019230 | Ga0439449_0019230_1336_1779 | 147 |
| 316 | 3300042157 | Ga0439458_0090855 | Ga0439458_0090855_24_467 | 147 |
| 317 | 3300044712 | Ga0453684_0512651 | Ga0453684_0512651_715_1158 | 147 |
| 318 | 3300044712 | Ga0453684_0559836 | Ga0453684_0559836_108_551 | 147 |
| 319 | 3300046530 | Ga0495654_0022887 | Ga0495654_0022887_996_1439 | 147 |
| 320 | 3300048919 | Ga0496116_0027214 | Ga0496116_0027214_2362_2805 | 147 |
| 321 | 3300048920 | Ga0496117_0125747 | Ga0496117_0125747_670_1113 | 147 |
| 322 | 3300048924 | Ga0496121_0088556 | Ga0496121_0088556_1454_1897 | 147 |
| 323 | 3300048925 | Ga0496122_0160871 | Ga0496122_0160871_430_873 | 147 |
| 324 | 3300048926 | Ga0496123_0107769 | Ga0496123_0107769_194_637 | 147 |
| 325 | 3300050491 | nmdc:mga00v17_1002146_c1 | nmdc:mga00v17_1002146_c1_19_462 | 147 |
| 326 | 3300053151 | Ga0500604_0205190 | Ga0500604_0205190_71_514 | 147 |
| 327 | 3300053729 | Ga0500625_101117 | Ga0500625_101117_206_649 | 147 |
| 328 | 3300059641 | Ga0587068_018853 | Ga0587068_018853_184_627 | 147 |
| 329 | 2162886007 | SwRhRL2b_contig_2102642 | SwRhRL2b_0540.00001200 | 148 |
| 330 | 3300001979 | JGI24740J21852_10008467 | JGI24740J21852_100084673 | 148 |
| 331 | 3300001989 | JGI24739J22299_10011968 | JGI24739J22299_100119683 | 148 |
| 332 | 3300001989 | JGI24739J22299_10045358 | JGI24739J22299_100453582 | 148 |
| 333 | 3300002739 | JGI25158J39367_1001940 | JGI25158J39367_10019402 | 148 |
| 334 | 3300002773 | JGI25152J39213_1013797 | JGI25152J39213_10137973 | 148 |
| 335 | 3300002987 | JGI25159J45721_1002846 | JGI25159J45721_10028466 | 148 |
| 336 | 3300003187 | JGI25151J46595_10010462 | JGI25151J46595_100104623 | 148 |
| 337 | 3300003187 | JGI25151J46595_10017524 | JGI25151J46595_100175243 | 148 |
| 338 | 3300003316 | rootH1_10001241 | rootH1_100012414 | 148 |
| 339 | 3300003578 | Ga0006562J51391_1020771 | Ga0006562J51391_10207711 | 148 |
| 340 | 3300003760 | Ga0055527_1016974 | Ga0055527_10169741 | 148 |
| 341 | 3300003761 | Ga0055535_1000915 | Ga0055535_10009157 | 148 |
| 342 | 3300003762 | Ga0055542_1000901 | Ga0055542_100090113 | 148 |
| 343 | 3300003773 | Ga0055537_1000434 | Ga0055537_100043416 | 148 |
| 344 | 3300003773 | Ga0055537_1005360 | Ga0055537_10053602 | 148 |
| 345 | 3300003781 | Ga0055536_1009331 | Ga0055536_10093313 | 148 |
| 346 | 3300003781 | Ga0055536_1012171 | Ga0055536_10121713 | 148 |
| 347 | 3300003784 | Ga0055534_1000642 | Ga0055534_100064210 | 148 |
| 348 | 3300003784 | Ga0055534_1006069 | Ga0055534_10060693 | 148 |
| 349 | 3300003790 | Ga0055528_1007422 | Ga0055528_10074225 | 148 |
| 350 | 3300003790 | Ga0055528_1011740 | Ga0055528_10117402 | 148 |
| 351 | 3300003791 | Ga0055530_10000766 | Ga0055530_1000076617 | 148 |
| 352 | 3300003792 | Ga0055540_1000627 | Ga0055540_100062720 | 148 |
| 353 | 3300003792 | Ga0055540_1004190 | Ga0055540_10041907 | 148 |
| 354 | 3300003792 | Ga0055540_1007670 | Ga0055540_10076704 | 148 |
| 355 | 3300003792 | Ga0055540_1040650 | Ga0055540_10406501 | 148 |
| 356 | 3300003794 | Ga0055531_10000886 | Ga0055531_100008863 | 148 |
| 357 | 3300005288 | Ga0065714_10011357 | Ga0065714_100113572 | 148 |
| 358 | 3300005288 | Ga0065714_10045960 | Ga0065714_100459602 | 148 |
| 359 | 3300005288 | Ga0065714_10142497 | Ga0065714_101424972 | 148 |
| 360 | 3300005289 | Ga0065704_10102546 | Ga0065704_101025462 | 148 |
| 361 | 3300005327 | Ga0070658_10973184 | Ga0070658_109731841 | 148 |
| 362 | 3300005328 | Ga0070676_10111818 | Ga0070676_101118182 | 148 |
| 363 | 3300005328 | Ga0070676_10250317 | Ga0070676_102503172 | 148 |
| 364 | 3300005333 | Ga0070677_10561824 | Ga0070677_105618241 | 148 |
| 365 | 3300005334 | Ga0068869_101489403 | Ga0068869_1014894031 | 148 |
| 366 | 3300005344 | Ga0070661_100121297 | Ga0070661_1001212973 | 148 |
| 367 | 3300005347 | Ga0070668_100504378 | Ga0070668_1005043781 | 148 |
| 368 | 3300005353 | Ga0070669_100737984 | Ga0070669_1007379842 | 148 |
| 369 | 3300005355 | Ga0070671_101436938 | Ga0070671_1014369381 | 148 |
| 370 | 3300005356 | Ga0070674_100463937 | Ga0070674_1004639372 | 148 |
| 371 | 3300005356 | Ga0070674_101317476 | Ga0070674_1013174762 | 148 |
| 372 | 3300005365 | Ga0070688_100741620 | Ga0070688_1007416202 | 148 |
| 373 | 3300005366 | Ga0070659_100892356 | Ga0070659_1008923561 | 148 |
| 374 | 3300005366 | Ga0070659_100899088 | Ga0070659_1008990881 | 148 |
| 375 | 3300005367 | Ga0070667_100781907 | Ga0070667_1007819072 | 148 |
| 376 | 3300005456 | Ga0070678_100073651 | Ga0070678_1000736512 | 148 |
| 377 | 3300005456 | Ga0070678_100186951 | Ga0070678_1001869511 | 148 |
| 378 | 3300005456 | Ga0070678_102012601 | Ga0070678_1020126011 | 148 |
| 379 | 3300005457 | Ga0070662_100027489 | Ga0070662_1000274891 | 148 |
| 380 | 3300005457 | Ga0070662_100586525 | Ga0070662_1005865252 | 148 |
| 381 | 3300005457 | Ga0070662_101355771 | Ga0070662_1013557711 | 148 |
| 382 | 3300005539 | Ga0068853_100116871 | Ga0068853_1001168713 | 148 |
| 383 | 3300005539 | Ga0068853_100171685 | Ga0068853_1001716851 | 148 |
| 384 | 3300005539 | Ga0068853_101038327 | Ga0068853_1010383271 | 148 |
| 385 | 3300005548 | Ga0070665_100027496 | Ga0070665_1000274965 | 148 |
| 386 | 3300005548 | Ga0070665_100128685 | Ga0070665_1001286853 | 148 |
| 387 | 3300005577 | Ga0068857_100125184 | Ga0068857_1001251843 | 148 |
| 388 | 3300005577 | Ga0068857_100279447 | Ga0068857_1002794472 | 148 |
| 389 | 3300005578 | Ga0068854_100119507 | Ga0068854_1001195072 | 148 |
| 390 | 3300005834 | Ga0068851_10046255 | Ga0068851_100462551 | 148 |
| 391 | 3300006038 | Ga0075365_10041456 | Ga0075365_100414563 | 148 |
| 392 | 3300006058 | Ga0075432_10015748 | Ga0075432_100157483 | 148 |
| 393 | 3300006178 | Ga0075367_10035248 | Ga0075367_100352484 | 148 |
| 394 | 3300006178 | Ga0075367_10387785 | Ga0075367_103877852 | 148 |
| 395 | 3300006178 | Ga0075367_10430608 | Ga0075367_104306081 | 148 |
| 396 | 3300006186 | Ga0075369_10065903 | Ga0075369_100659032 | 148 |
| 397 | 3300006195 | Ga0075366_10009033 | Ga0075366_100090335 | 148 |
| 398 | 3300006195 | Ga0075366_10046737 | Ga0075366_100467372 | 148 |
| 399 | 3300006195 | Ga0075366_10056276 | Ga0075366_100562763 | 148 |
| 400 | 3300006195 | Ga0075366_10131834 | Ga0075366_101318342 | 148 |
| 401 | 3300006195 | Ga0075366_10147222 | Ga0075366_101472223 | 148 |
| 402 | 3300006195 | Ga0075366_10251640 | Ga0075366_102516402 | 148 |
| 403 | 3300006195 | Ga0075366_10469961 | Ga0075366_104699612 | 148 |
| 404 | 3300006195 | Ga0075366_10525961 | Ga0075366_105259611 | 148 |
| 405 | 3300006237 | Ga0097621_100199672 | Ga0097621_1001996723 | 148 |
| 406 | 3300006353 | Ga0075370_10003137 | Ga0075370_100031377 | 148 |
| 407 | 3300006353 | Ga0075370_10006880 | Ga0075370_100068807 | 148 |
| 408 | 3300006353 | Ga0075370_10010283 | Ga0075370_100102836 | 148 |
| 409 | 3300006353 | Ga0075370_10043670 | Ga0075370_100436703 | 148 |
| 410 | 3300006353 | Ga0075370_10082572 | Ga0075370_100825723 | 148 |
| 411 | 3300006353 | Ga0075370_10240237 | Ga0075370_102402372 | 148 |
| 412 | 3300006353 | Ga0075370_10337993 | Ga0075370_103379932 | 148 |
| 413 | 3300006358 | Ga0068871_100271477 | Ga0068871_1002714772 | 148 |
| 414 | 3300006358 | Ga0068871_101511774 | Ga0068871_1015117742 | 148 |
| 415 | 3300006946 | Ga0079104_1019560 | Ga0079104_10195603 | 148 |
| 416 | 3300006948 | Ga0099826_10023210 | Ga0099826_100232105 | 148 |
| 417 | 3300006948 | Ga0099826_10137953 | Ga0099826_101379532 | 148 |
| 418 | 3300009011 | Ga0105251_10275993 | Ga0105251_102759931 | 148 |
| 419 | 3300009036 | Ga0105244_10007704 | Ga0105244_100077047 | 148 |
| 420 | 3300009093 | Ga0105240_10675681 | Ga0105240_106756811 | 148 |
| 421 | 3300009093 | Ga0105240_11802305 | Ga0105240_118023051 | 148 |
| 422 | 3300009098 | Ga0105245_10472172 | Ga0105245_104721723 | 148 |
| 423 | 3300009098 | Ga0105245_10568229 | Ga0105245_105682292 | 148 |
| 424 | 3300009148 | Ga0105243_10012218 | Ga0105243_100122187 | 148 |
| 425 | 3300009148 | Ga0105243_10111039 | Ga0105243_101110392 | 148 |
| 426 | 3300009148 | Ga0105243_10446579 | Ga0105243_104465792 | 148 |
| 427 | 3300009176 | Ga0105242_10217332 | Ga0105242_102173323 | 148 |
| 428 | 3300009176 | Ga0105242_10410867 | Ga0105242_104108672 | 148 |
| 429 | 3300009176 | Ga0105242_10761921 | Ga0105242_107619212 | 148 |
| 430 | 3300009176 | Ga0105242_12448149 | Ga0105242_124481491 | 148 |
| 431 | 3300009177 | Ga0105248_10328967 | Ga0105248_103289672 | 148 |
| 432 | 3300009551 | Ga0105238_10249886 | Ga0105238_102498861 | 148 |
| 433 | 3300009551 | Ga0105238_10445272 | Ga0105238_104452722 | 148 |
| 434 | 3300009553 | Ga0105249_11520563 | Ga0105249_115205632 | 148 |
| 435 | 3300010375 | Ga0105239_10381641 | Ga0105239_103816412 | 148 |
| 436 | 3300013100 | Ga0157373_10186710 | Ga0157373_101867102 | 148 |
| 437 | 3300013100 | Ga0157373_10238746 | Ga0157373_102387462 | 148 |
| 438 | 3300013100 | Ga0157373_11324862 | Ga0157373_113248621 | 148 |
| 439 | 3300013102 | Ga0157371_10672575 | Ga0157371_106725752 | 148 |
| 440 | 3300013104 | Ga0157370_10145499 | Ga0157370_101454991 | 148 |
| 441 | 3300013104 | Ga0157370_11439698 | Ga0157370_114396981 | 148 |
| 442 | 3300013105 | Ga0157369_10001553 | Ga0157369_1000155315 | 148 |
| 443 | 3300013297 | Ga0157378_10946539 | Ga0157378_109465391 | 148 |
| 444 | 3300013297 | Ga0157378_11820854 | Ga0157378_118208541 | 148 |
| 445 | 3300013306 | Ga0163162_10243785 | Ga0163162_102437853 | 148 |
| 446 | 3300013306 | Ga0163162_10621430 | Ga0163162_106214302 | 148 |
| 447 | 3300013306 | Ga0163162_11918623 | Ga0163162_119186231 | 148 |
| 448 | 3300013308 | Ga0157375_10462063 | Ga0157375_104620631 | 148 |
| 449 | 3300013308 | Ga0157375_10568070 | Ga0157375_105680701 | 148 |
| 450 | 3300014497 | Ga0182008_10003672 | Ga0182008_100036728 | 148 |
| 451 | 3300014497 | Ga0182008_10007571 | Ga0182008_100075713 | 148 |
| 452 | 3300014497 | Ga0182008_10024300 | Ga0182008_100243003 | 148 |
| 453 | 3300014497 | Ga0182008_10042374 | Ga0182008_100423743 | 148 |
| 454 | 3300014497 | Ga0182008_10126990 | Ga0182008_101269902 | 148 |
| 455 | 3300014969 | Ga0157376_10304247 | Ga0157376_103042472 | 148 |
| 456 | 3300014969 | Ga0157376_10358955 | Ga0157376_103589552 | 148 |
| 457 | 3300014969 | Ga0157376_10542338 | Ga0157376_105423382 | 148 |
| 458 | 3300015261 | Ga0182006_1006815 | Ga0182006_10068157 | 148 |
| 459 | 3300015261 | Ga0182006_1038851 | Ga0182006_10388513 | 148 |
| 460 | 3300015261 | Ga0182006_1080934 | Ga0182006_10809342 | 148 |
| 461 | 3300015262 | Ga0182007_10018708 | Ga0182007_100187083 | 148 |
| 462 | 3300015265 | Ga0182005_1233170 | Ga0182005_12331701 | 148 |
| 463 | 3300015683 | Ga0183362_10001 | Ga0183362_1000193 | 148 |
| 464 | 3300017792 | Ga0163161_10040028 | Ga0163161_100400283 | 148 |
| 465 | 3300017792 | Ga0163161_10047665 | Ga0163161_100476653 | 148 |
| 466 | 3300017792 | Ga0163161_10085111 | Ga0163161_100851113 | 148 |
| 467 | 3300017792 | Ga0163161_10423851 | Ga0163161_104238513 | 148 |
| 468 | 3300025208 | Ga0209436_116559 | Ga0209436_1165591 | 148 |
| 469 | 3300025228 | Ga0209672_101606 | Ga0209672_1016062 | 148 |
| 470 | 3300025229 | Ga0209147_100909 | Ga0209147_1009098 | 148 |
| 471 | 3300025242 | Ga0209258_100009 | Ga0209258_100009657 | 148 |
| 472 | 3300025245 | Ga0207425_1000361 | Ga0207425_10003616 | 148 |
| 473 | 3300025245 | Ga0207425_1040224 | Ga0207425_10402241 | 148 |
| 474 | 3300025254 | Ga0209148_1000007 | Ga0209148_1000007657 | 148 |
| 475 | 3300025258 | Ga0209129_1000013 | Ga0209129_10000138 | 148 |
| 476 | 3300025258 | Ga0209129_1003406 | Ga0209129_10034063 | 148 |
| 477 | 3300025258 | Ga0209129_1022451 | Ga0209129_10224512 | 148 |
| 478 | 3300025263 | Ga0209565_1000046 | Ga0209565_100004610 | 148 |
| 479 | 3300025263 | Ga0209565_1002375 | Ga0209565_10023753 | 148 |
| 480 | 3300025273 | Ga0209673_1000053 | Ga0209673_100005368 | 148 |
| 481 | 3300025273 | Ga0209673_1000245 | Ga0209673_100024591 | 148 |
| 482 | 3300025273 | Ga0209673_1003160 | Ga0209673_10031607 | 148 |
| 483 | 3300025284 | Ga0209130_1002075 | Ga0209130_10020756 | 148 |
| 484 | 3300025284 | Ga0209130_1003101 | Ga0209130_10031016 | 148 |
| 485 | 3300025291 | Ga0209675_1000010 | Ga0209675_1000010349 | 148 |
| 486 | 3300025292 | Ga0209676_1000108 | Ga0209676_100010857 | 148 |
| 487 | 3300025292 | Ga0209676_1000939 | Ga0209676_100093931 | 148 |
| 488 | 3300025292 | Ga0209676_1001659 | Ga0209676_100165912 | 148 |
| 489 | 3300025294 | Ga0209025_1000972 | Ga0209025_100097232 | 148 |
| 490 | 3300025294 | Ga0209025_1003456 | Ga0209025_10034564 | 148 |
| 491 | 3300025294 | Ga0209025_1006031 | Ga0209025_10060317 | 148 |
| 492 | 3300025294 | Ga0209025_1008558 | Ga0209025_10085583 | 148 |
| 493 | 3300025294 | Ga0209025_1037753 | Ga0209025_10377533 | 148 |
| 494 | 3300025294 | Ga0209025_1043546 | Ga0209025_10435463 | 148 |
| 495 | 3300025295 | Ga0209564_1005295 | Ga0209564_10052956 | 148 |
| 496 | 3300025295 | Ga0209564_1005299 | Ga0209564_10052996 | 148 |
| 497 | 3300025295 | Ga0209564_1052293 | Ga0209564_10522932 | 148 |
| 498 | 3300025297 | Ga0209758_1000067 | Ga0209758_1000067247 | 148 |
| 499 | 3300025297 | Ga0209758_1005404 | Ga0209758_10054047 | 148 |
| 500 | 3300025298 | Ga0209050_1000002 | Ga0209050_1000002315 | 148 |
| 501 | 3300025298 | Ga0209050_1007827 | Ga0209050_10078273 | 148 |
| 502 | 3300025299 | Ga0209256_1000077 | Ga0209256_1000077250 | 148 |
| 503 | 3300025299 | Ga0209256_1000673 | Ga0209256_10006738 | 148 |
| 504 | 3300025299 | Ga0209256_1030279 | Ga0209256_10302792 | 148 |
| 505 | 3300025302 | Ga0207426_1000101 | Ga0207426_10001018 | 148 |
| 506 | 3300025302 | Ga0207426_1000129 | Ga0207426_10001298 | 148 |
| 507 | 3300025303 | Ga0209051_1000002 | Ga0209051_100000283 | 148 |
| 508 | 3300025303 | Ga0209051_1000486 | Ga0209051_10004863 | 148 |
| 509 | 3300025303 | Ga0209051_1001944 | Ga0209051_100194411 | 148 |
| 510 | 3300025303 | Ga0209051_1003369 | Ga0209051_10033696 | 148 |
| 511 | 3300025304 | Ga0209257_1000002 | Ga0209257_1000002224 | 148 |
| 512 | 3300025304 | Ga0209257_1000713 | Ga0209257_10007133 | 148 |
| 513 | 3300025304 | Ga0209257_1025850 | Ga0209257_10258502 | 148 |
| 514 | 3300025321 | Ga0207656_10022267 | Ga0207656_100222673 | 148 |
| 515 | 3300025728 | Ga0207655_1004198 | Ga0207655_10041985 | 148 |
| 516 | 3300025893 | Ga0207682_10021464 | Ga0207682_100214643 | 148 |
| 517 | 3300025907 | Ga0207645_10204884 | Ga0207645_102048842 | 148 |
| 518 | 3300025913 | Ga0207695_10138617 | Ga0207695_101386173 | 148 |
| 519 | 3300025914 | Ga0207671_10398338 | Ga0207671_103983382 | 148 |
| 520 | 3300025920 | Ga0207649_10097006 | Ga0207649_100970063 | 148 |
| 521 | 3300025923 | Ga0207681_10007278 | Ga0207681_100072787 | 148 |
| 522 | 3300025924 | Ga0207694_10673713 | Ga0207694_106737132 | 148 |
| 523 | 3300025927 | Ga0207687_10382893 | Ga0207687_103828932 | 148 |
| 524 | 3300025927 | Ga0207687_10514604 | Ga0207687_105146041 | 148 |
| 525 | 3300025931 | Ga0207644_11296688 | Ga0207644_112966881 | 148 |
| 526 | 3300025933 | Ga0207706_10086975 | Ga0207706_100869753 | 148 |
| 527 | 3300025933 | Ga0207706_10725604 | Ga0207706_107256041 | 148 |
| 528 | 3300025934 | Ga0207686_10158559 | Ga0207686_101585593 | 148 |
| 529 | 3300025934 | Ga0207686_10395459 | Ga0207686_103954592 | 148 |
| 530 | 3300025935 | Ga0207709_10002996 | Ga0207709_100029967 | 148 |
| 531 | 3300025935 | Ga0207709_10012695 | Ga0207709_100126952 | 148 |
| 532 | 3300025935 | Ga0207709_10049858 | Ga0207709_100498582 | 148 |
| 533 | 3300025935 | Ga0207709_10276942 | Ga0207709_102769422 | 148 |
| 534 | 3300025941 | Ga0207711_10903555 | Ga0207711_109035552 | 148 |
| 535 | 3300025942 | Ga0207689_10232015 | Ga0207689_102320152 | 148 |
| 536 | 3300025945 | Ga0207679_10019534 | Ga0207679_100195343 | 148 |
| 537 | 3300025972 | Ga0207668_10910963 | Ga0207668_109109632 | 148 |
| 538 | 3300025972 | Ga0207668_11383279 | Ga0207668_113832792 | 148 |
| 539 | 3300025981 | Ga0207640_10575407 | Ga0207640_105754071 | 148 |
| 540 | 3300026041 | Ga0207639_10105322 | Ga0207639_101053222 | 148 |
| 541 | 3300026041 | Ga0207639_10401897 | Ga0207639_104018971 | 148 |
| 542 | 3300026041 | Ga0207639_10900626 | Ga0207639_109006261 | 148 |
| 543 | 3300026089 | Ga0207648_10222017 | Ga0207648_102220173 | 148 |
| 544 | 3300026116 | Ga0207674_10372754 | Ga0207674_103727541 | 148 |
| 545 | 3300026116 | Ga0207674_10560792 | Ga0207674_105607922 | 148 |
| 546 | 3300026118 | Ga0207675_101689278 | Ga0207675_1016892782 | 148 |
| 547 | 3300026121 | Ga0207683_10042716 | Ga0207683_100427163 | 148 |
| 548 | 3300026121 | Ga0207683_10344630 | Ga0207683_103446302 | 148 |
| 549 | 3300026142 | Ga0207698_10077776 | Ga0207698_100777763 | 148 |
| 550 | 3300027666 | Ga0209282_1005624 | Ga0209282_10056245 | 148 |
| 551 | 3300027666 | Ga0209282_1189223 | Ga0209282_11892232 | 148 |
| 552 | 3300027666 | Ga0209282_1236474 | Ga0209282_12364741 | 148 |
| 553 | 3300028379 | Ga0268266_10217130 | Ga0268266_102171302 | 148 |
| 554 | 3300028380 | Ga0268265_10297538 | Ga0268265_102975383 | 148 |
| 555 | 3300028794 | Ga0307515_10000265 | Ga0307515_10000265110 | 148 |
| 556 | 3300028794 | Ga0307515_10276687 | Ga0307515_102766872 | 148 |
| 557 | 3300028794 | Ga0307515_10615324 | Ga0307515_106153242 | 148 |
| 558 | 3300030731 | Ga0316177_1080873 | Ga0316177_10808731 | 148 |
| 559 | 3300030735 | Ga0316178_1049689 | Ga0316178_10496893 | 148 |
| 560 | 3300030742 | Ga0316183_1121951 | Ga0316183_11219513 | 148 |
| 561 | 3300030742 | Ga0316183_1122991 | Ga0316183_11229912 | 148 |
| 562 | 3300030744 | Ga0316181_1013012 | Ga0316181_10130122 | 148 |
| 563 | 3300030744 | Ga0316181_1140675 | Ga0316181_11406753 | 148 |
| 564 | 3300030745 | Ga0316182_1117672 | Ga0316182_11176722 | 148 |
| 565 | 3300030745 | Ga0316182_1372344 | Ga0316182_13723442 | 148 |
| 566 | 3300031251 | Ga0265327_10006033 | Ga0265327_100060333 | 148 |
| 567 | 3300031251 | Ga0265327_10013589 | Ga0265327_100135896 | 148 |
| 568 | 3300031456 | Ga0307513_10151665 | Ga0307513_101516653 | 148 |
| 569 | 3300031456 | Ga0307513_10184416 | Ga0307513_101844162 | 148 |
| 570 | 3300031456 | Ga0307513_10237417 | Ga0307513_102374173 | 148 |
| 571 | 3300031548 | Ga0307408_100056587 | Ga0307408_1000565872 | 148 |
| 572 | 3300031548 | Ga0307408_100142864 | Ga0307408_1001428642 | 148 |
| 573 | 3300031548 | Ga0307408_100571338 | Ga0307408_1005713382 | 148 |
| 574 | 3300031548 | Ga0307408_101198026 | Ga0307408_1011980262 | 148 |
| 575 | 3300031649 | Ga0307514_10047701 | Ga0307514_100477013 | 148 |
| 576 | 3300031731 | Ga0307405_10089605 | Ga0307405_100896051 | 148 |
| 577 | 3300031852 | Ga0307410_11099814 | Ga0307410_110998142 | 148 |
| 578 | 3300031901 | Ga0307406_10142959 | Ga0307406_101429593 | 148 |
| 579 | 3300031903 | Ga0307407_10189449 | Ga0307407_101894492 | 148 |
| 580 | 3300031911 | Ga0307412_10123758 | Ga0307412_101237582 | 148 |
| 581 | 3300031911 | Ga0307412_10242213 | Ga0307412_102422132 | 148 |
| 582 | 3300031911 | Ga0307412_10319026 | Ga0307412_103190262 | 148 |
| 583 | 3300031995 | Ga0307409_100294255 | Ga0307409_1002942552 | 148 |
| 584 | 3300031995 | Ga0307409_101859435 | Ga0307409_1018594351 | 148 |
| 585 | 3300032002 | Ga0307416_100529199 | Ga0307416_1005291992 | 148 |
| 586 | 3300032004 | Ga0307414_10310981 | Ga0307414_103109811 | 148 |
| 587 | 3300032005 | Ga0307411_10191797 | Ga0307411_101917973 | 148 |
| 588 | 3300035172 | Ga0373955_0260624 | Ga0373955_0260624_35_481 | 148 |
| 589 | 3300035691 | Ga0373931_0091312 | Ga0373931_0091312_950_1396 | 148 |
| 590 | 3300041404 | Ga0439436_0008676 | Ga0439436_0008676_1201_1647 | 148 |
| 591 | 3300041404 | Ga0439436_0020697 | Ga0439436_0020697_680_1126 | 148 |
| 592 | 3300041404 | Ga0439436_0061047 | Ga0439436_0061047_356_802 | 148 |
| 593 | 3300041406 | Ga0439439_0014097 | Ga0439439_0014097_1120_1566 | 148 |
| 594 | 3300041411 | Ga0439466_0009224 | Ga0439466_0009224_107_553 | 148 |
| 595 | 3300041411 | Ga0439466_0024000 | Ga0439466_0024000_925_1371 | 148 |
| 596 | 3300041413 | Ga0439465_0014650 | Ga0439465_0014650_1640_2086 | 148 |
| 597 | 3300041451 | Ga0451791_1601473 | Ga0451791_1601473_122_568 | 148 |
| 598 | 3300041486 | Ga0451807_2262088 | Ga0451807_2262088_128_574 | 148 |
| 599 | 3300041486 | Ga0451807_2369752 | Ga0451807_2369752_387_833 | 148 |
| 600 | 3300041491 | Ga0451833_0165364 | Ga0451833_0165364_51_497 | 148 |
| 601 | 3300041491 | Ga0451833_0197438 | Ga0451833_0197438_292_738 | 148 |
| 602 | 3300041492 | Ga0451835_0341183 | Ga0451835_0341183_25_471 | 148 |
| 603 | 3300041494 | Ga0451837_1274579 | Ga0451837_1274579_16_462 | 148 |
| 604 | 3300041496 | Ga0451839_0313766 | Ga0451839_0313766_345_791 | 148 |
| 605 | 3300041509 | Ga0451843_1265110 | Ga0451843_1265110_381_827 | 148 |
| 606 | 3300041997 | Ga0439431_0000653 | Ga0439431_0000653_5831_6277 | 148 |
| 607 | 3300041997 | Ga0439431_0195562 | Ga0439431_0195562_91_537 | 148 |
| 608 | 3300041999 | Ga0439433_0007603 | Ga0439433_0007603_559_1005 | 148 |
| 609 | 3300041999 | Ga0439433_0015194 | Ga0439433_0015194_884_1330 | 148 |
| 610 | 3300042002 | Ga0439442_007595 | Ga0439442_007595_476_922 | 148 |
| 611 | 3300042002 | Ga0439442_010111 | Ga0439442_010111_681_1127 | 148 |
| 612 | 3300042002 | Ga0439442_048893 | Ga0439442_048893_401_847 | 148 |
| 613 | 3300042004 | Ga0439445_0014046 | Ga0439445_0014046_763_1209 | 148 |
| 614 | 3300042004 | Ga0439445_0026402 | Ga0439445_0026402_279_725 | 148 |
| 615 | 3300042006 | Ga0439432_008521 | Ga0439432_008521_1858_2304 | 148 |
| 616 | 3300042006 | Ga0439432_015233 | Ga0439432_015233_708_1154 | 148 |
| 617 | 3300042007 | Ga0439449_0003558 | Ga0439449_0003558_1979_2425 | 148 |
| 618 | 3300042007 | Ga0439449_0010488 | Ga0439449_0010488_557_1003 | 148 |
| 619 | 3300042010 | Ga0439452_004068 | Ga0439452_004068_3960_4406 | 148 |
| 620 | 3300042010 | Ga0439452_039693 | Ga0439452_039693_333_779 | 148 |
| 621 | 3300042012 | Ga0439455_0036889 | Ga0439455_0036889_210_656 | 148 |
| 622 | 3300042014 | Ga0439457_062297 | Ga0439457_062297_262_708 | 148 |
| 623 | 3300042015 | Ga0439462_0006627 | Ga0439462_0006627_836_1282 | 148 |
| 624 | 3300042015 | Ga0439462_0033034 | Ga0439462_0033034_506_952 | 148 |
| 625 | 3300042115 | Ga0450911_000987 | Ga0450911_000987_6220_6666 | 148 |
| 626 | 3300042121 | Ga0450919_005464 | Ga0450919_005464_359_805 | 148 |
| 627 | 3300042125 | Ga0450923_013370 | Ga0450923_013370_630_1076 | 148 |
| 628 | 3300042128 | Ga0450897_009772 | Ga0450897_009772_341_787 | 148 |
| 629 | 3300042131 | Ga0450894_034120 | Ga0450894_034120_224_670 | 148 |
| 630 | 3300042132 | Ga0450895_013492 | Ga0450895_013492_230_676 | 148 |
| 631 | 3300042133 | Ga0450896_034894 | Ga0450896_034894_110_556 | 148 |
| 632 | 3300042133 | Ga0450896_052281 | Ga0450896_052281_62_508 | 148 |
| 633 | 3300042135 | Ga0450899_002488 | Ga0450899_002488_558_1004 | 148 |
| 634 | 3300042145 | Ga0450906_007435 | Ga0450906_007435_1678_2124 | 148 |
| 635 | 3300042145 | Ga0450906_007849 | Ga0450906_007849_176_622 | 148 |
| 636 | 3300042146 | Ga0450907_021420 | Ga0450907_021420_280_726 | 148 |
| 637 | 3300042147 | Ga0450910_006050 | Ga0450910_006050_978_1424 | 148 |
| 638 | 3300042147 | Ga0450910_019376 | Ga0450910_019376_61_507 | 148 |
| 639 | 3300042156 | Ga0439446_0018615 | Ga0439446_0018615_960_1406 | 148 |
| 640 | 3300042184 | Ga0450908_008969 | Ga0450908_008969_664_1110 | 148 |
| 641 | 3300042435 | Ga0439434_0008577 | Ga0439434_0008577_1921_2367 | 148 |
| 642 | 3300042435 | Ga0439434_0046306 | Ga0439434_0046306_694_1140 | 148 |
| 643 | 3300042436 | Ga0439435_0186508 | Ga0439435_0186508_74_520 | 148 |
| 644 | 3300042531 | Ga0450918_001307 | Ga0450918_001307_1333_1779 | 148 |
| 645 | 3300042532 | Ga0450893_0021580 | Ga0450893_0021580_192_638 | 148 |
| 646 | 3300044683 | Ga0466965_0021670 | Ga0466965_0021670_640_1086 | 148 |
| 647 | 3300044901 | Ga0466960_0168748 | Ga0466960_0168748_290_736 | 148 |
| 648 | 3300046453 | Ga0495627_072617 | Ga0495627_072617_149_595 | 148 |
| 649 | 3300046460 | Ga0495638_0046107 | Ga0495638_0046107_1682_2128 | 148 |
| 650 | 3300046475 | Ga0495639_0040524 | Ga0495639_0040524_491_937 | 148 |
| 651 | 3300046506 | Ga0495583_0187589 | Ga0495583_0187589_311_757 | 148 |
| 652 | 3300046512 | Ga0495610_0018506 | Ga0495610_0018506_2857_3303 | 148 |
| 653 | 3300046513 | Ga0495616_0027760 | Ga0495616_0027760_1837_2283 | 148 |
| 654 | 3300046515 | Ga0495620_0141524 | Ga0495620_0141524_208_654 | 148 |
| 655 | 3300046517 | Ga0495630_0932356 | Ga0495630_0932356_11_457 | 148 |
| 656 | 3300046518 | Ga0495631_0019187 | Ga0495631_0019187_1087_1533 | 148 |
| 657 | 3300046518 | Ga0495631_0376554 | Ga0495631_0376554_104_550 | 148 |
| 658 | 3300046520 | Ga0495637_0076588 | Ga0495637_0076588_140_586 | 148 |
| 659 | 3300046522 | Ga0495643_0084710 | Ga0495643_0084710_605_1051 | 148 |
| 660 | 3300046524 | Ga0495648_0373022 | Ga0495648_0373022_49_495 | 148 |
| 661 | 3300046525 | Ga0495663_0055242 | Ga0495663_0055242_479_925 | 148 |
| 662 | 3300046526 | Ga0495666_0227473 | Ga0495666_0227473_197_643 | 148 |
| 663 | 3300046530 | Ga0495654_0051519 | Ga0495654_0051519_1385_1831 | 148 |
| 664 | 3300046535 | Ga0495586_0710971 | Ga0495586_0710971_93_539 | 148 |
| 665 | 3300046539 | Ga0495621_0124571 | Ga0495621_0124571_255_701 | 148 |
| 666 | 3300046543 | Ga0495645_0112520 | Ga0495645_0112520_694_1140 | 148 |
| 667 | 3300046557 | Ga0495622_0136565 | Ga0495622_0136565_47_493 | 148 |
| 668 | 3300046615 | Ga0495656_0000916 | Ga0495656_0000916_3742_4188 | 148 |
| 669 | 3300046615 | Ga0495656_0085697 | Ga0495656_0085697_725_1171 | 148 |
| 670 | 3300046660 | Ga0495625_0000411 | Ga0495625_0000411_60372_60818 | 148 |
| 671 | 3300046660 | Ga0495625_0054874 | Ga0495625_0054874_772_1218 | 148 |
| 672 | 3300046663 | Ga0495635_0190540 | Ga0495635_0190540_263_709 | 148 |
| 673 | 3300046663 | Ga0495635_0398671 | Ga0495635_0398671_118_564 | 148 |
| 674 | 3300046674 | Ga0495588_0021962 | Ga0495588_0021962_1095_1541 | 148 |
| 675 | 3300046674 | Ga0495588_0109339 | Ga0495588_0109339_336_782 | 148 |
| 676 | 3300046683 | Ga0495658_0263798 | Ga0495658_0263798_98_544 | 148 |
| 677 | 3300046691 | Ga0495670_0119677 | Ga0495670_0119677_414_860 | 148 |
| 678 | 3300046809 | Ga0495600_0462552 | Ga0495600_0462552_319_765 | 148 |
| 679 | 3300047318 | Ga0495636_0162488 | Ga0495636_0162488_479_925 | 148 |
| 680 | 3300047321 | Ga0495676_0011078 | Ga0495676_0011078_7288_7734 | 148 |
| 681 | 3300047470 | Ga0495681_0107646 | Ga0495681_0107646_239_685 | 148 |
| 682 | 3300047470 | Ga0495681_0326489 | Ga0495681_0326489_91_537 | 148 |
| 683 | 3300047673 | Ga0495593_0009567 | Ga0495593_0009567_2932_3378 | 148 |
| 684 | 3300048089 | Ga0495614_0014245 | Ga0495614_0014245_1335_1781 | 148 |
| 685 | 3300048090 | Ga0495615_0007034 | Ga0495615_0007034_124_570 | 148 |
| 686 | 3300048903 | Ga0496100_0061992 | Ga0496100_0061992_1312_1758 | 148 |
| 687 | 3300048903 | Ga0496100_0416974 | Ga0496100_0416974_395_841 | 148 |
| 688 | 3300048904 | Ga0496101_0019764 | Ga0496101_0019764_1253_1699 | 148 |
| 689 | 3300048904 | Ga0496101_0070039 | Ga0496101_0070039_1212_1658 | 148 |
| 690 | 3300048905 | Ga0496102_0018680 | Ga0496102_0018680_5297_5743 | 148 |
| 691 | 3300048906 | Ga0496103_0075323 | Ga0496103_0075323_1447_1893 | 148 |
| 692 | 3300048906 | Ga0496103_0176891 | Ga0496103_0176891_547_993 | 148 |
| 693 | 3300048907 | Ga0496104_0025765 | Ga0496104_0025765_2396_2842 | 148 |
| 694 | 3300048908 | Ga0496105_0045065 | Ga0496105_0045065_1891_2337 | 148 |
| 695 | 3300048909 | Ga0496106_0183839 | Ga0496106_0183839_747_1193 | 148 |
| 696 | 3300048910 | Ga0496107_0113937 | Ga0496107_0113937_97_543 | 148 |
| 697 | 3300048911 | Ga0496108_0943113 | Ga0496108_0943113_39_485 | 148 |
| 698 | 3300048912 | Ga0496109_0123108 | Ga0496109_0123108_1556_2002 | 148 |
| 699 | 3300048913 | Ga0496110_0019037 | Ga0496110_0019037_5204_5650 | 148 |
| 700 | 3300048914 | Ga0496111_0094692 | Ga0496111_0094692_564_1010 | 148 |
| 701 | 3300048915 | Ga0496112_0763188 | Ga0496112_0763188_355_801 | 148 |
| 702 | 3300048917 | Ga0496114_0366673 | Ga0496114_0366673_744_1190 | 148 |
| 703 | 3300048917 | Ga0496114_0452769 | Ga0496114_0452769_269_715 | 148 |
| 704 | 3300048917 | Ga0496114_1337304 | Ga0496114_1337304_137_583 | 148 |
| 705 | 3300048919 | Ga0496116_0042592 | Ga0496116_0042592_926_1372 | 148 |
| 706 | 3300048919 | Ga0496116_0225095 | Ga0496116_0225095_97_543 | 148 |
| 707 | 3300048920 | Ga0496117_0028416 | Ga0496117_0028416_1194_1640 | 148 |
| 708 | 3300048920 | Ga0496117_0122036 | Ga0496117_0122036_773_1219 | 148 |
| 709 | 3300048921 | Ga0496118_0014920 | Ga0496118_0014920_3137_3583 | 148 |
| 710 | 3300048921 | Ga0496118_0062819 | Ga0496118_0062819_1605_2051 | 148 |
| 711 | 3300048921 | Ga0496118_0147818 | Ga0496118_0147818_400_846 | 148 |
| 712 | 3300048922 | Ga0496119_0174593 | Ga0496119_0174593_386_832 | 148 |
| 713 | 3300048924 | Ga0496121_0025381 | Ga0496121_0025381_1838_2284 | 148 |
| 714 | 3300048925 | Ga0496122_0000998 | Ga0496122_0000998_1772_2218 | 148 |
| 715 | 3300048925 | Ga0496122_0104621 | Ga0496122_0104621_1265_1711 | 148 |
| 716 | 3300048925 | Ga0496122_0177963 | Ga0496122_0177963_568_1014 | 148 |
| 717 | 3300048926 | Ga0496123_0000045 | Ga0496123_0000045_1710_2156 | 148 |
| 718 | 3300048926 | Ga0496123_0164464 | Ga0496123_0164464_395_841 | 148 |
| 719 | 3300048927 | Ga0496124_0081035 | Ga0496124_0081035_506_952 | 148 |
| 720 | 3300048927 | Ga0496124_0101887 | Ga0496124_0101887_1113_1559 | 148 |
| 721 | 3300048927 | Ga0496124_0134721 | Ga0496124_0134721_477_923 | 148 |
| 722 | 3300048927 | Ga0496124_0165449 | Ga0496124_0165449_509_955 | 148 |
| 723 | 3300048928 | Ga0496125_0015577 | Ga0496125_0015577_663_1109 | 148 |
| 724 | 3300048928 | Ga0496125_0041048 | Ga0496125_0041048_2111_2557 | 148 |
| 725 | 3300048928 | Ga0496125_0096632 | Ga0496125_0096632_965_1411 | 148 |
| 726 | 3300048928 | Ga0496125_0106796 | Ga0496125_0106796_687_1133 | 148 |
| 727 | 3300048928 | Ga0496125_0478351 | Ga0496125_0478351_175_621 | 148 |
| 728 | 3300048928 | Ga0496125_0566725 | Ga0496125_0566725_73_519 | 148 |
| 729 | 3300048929 | Ga0496126_0088477 | Ga0496126_0088477_825_1271 | 148 |
| 730 | 3300048929 | Ga0496126_0099168 | Ga0496126_0099168_370_816 | 148 |
| 731 | 3300048929 | Ga0496126_0139641 | Ga0496126_0139641_1265_1711 | 148 |
| 732 | 3300048929 | Ga0496126_0180552 | Ga0496126_0180552_41_487 | 148 |
| 733 | 3300049128 | Ga0501308_010543 | Ga0501308_010543_140_586 | 148 |
| 734 | 3300049130 | Ga0501310_012827 | Ga0501310_012827_101_547 | 148 |
| 735 | 3300049160 | Ga0501304_032348 | Ga0501304_032348_60_506 | 148 |
| 736 | 3300049162 | Ga0501307_013324 | Ga0501307_013324_306_752 | 148 |
| 737 | 3300049529 | Ga0501313_065079 | Ga0501313_065079_39_485 | 148 |
| 738 | 3300049531 | Ga0501315_031735 | Ga0501315_031735_294_740 | 148 |
| 739 | 3300049532 | Ga0501316_007310 | Ga0501316_007310_65_511 | 148 |
| 740 | 3300049533 | Ga0501317_024669 | Ga0501317_024669_148_594 | 148 |
| 741 | 3300049539 | Ga0501323_003453 | Ga0501323_003453_298_744 | 148 |
| 742 | 3300049551 | Ga0501335_021047 | Ga0501335_021047_230_676 | 148 |
| 743 | 3300049554 | Ga0501338_02098 | Ga0501338_02098_420_866 | 148 |
| 744 | 3300049665 | Ga0501227_084803 | Ga0501227_084803_237_683 | 148 |
| 745 | 3300049675 | Ga0501243_110545 | Ga0501243_110545_64_510 | 148 |
| 746 | 3300049679 | Ga0501249_011075 | Ga0501249_011075_749_1195 | 148 |
| 747 | 3300049682 | Ga0501252_008040 | Ga0501252_008040_16_462 | 148 |
| 748 | 3300049705 | Ga0501225_0011298 | Ga0501225_0011298_1514_1960 | 148 |
| 749 | 3300049758 | Ga0501241_042241 | Ga0501241_042241_72_518 | 148 |
| 750 | 3300049759 | Ga0501262_001277 | Ga0501262_001277_855_1301 | 148 |
| 751 | 3300049760 | Ga0501263_016226 | Ga0501263_016226_416_862 | 148 |
| 752 | 3300049763 | Ga0501266_014342 | Ga0501266_014342_420_866 | 148 |
| 753 | 3300050489 | nmdc:mga03683_43356_c1 | nmdc:mga03683_43356_c1_74_520 | 148 |
| 754 | 3300050489 | nmdc:mga03683_44094_c1 | nmdc:mga03683_44094_c1_689_1135 | 148 |
| 755 | 3300050489 | nmdc:mga03683_61087_c1 | nmdc:mga03683_61087_c1_66_512 | 148 |
| 756 | 3300050489 | nmdc:mga03683_77870_c1 | nmdc:mga03683_77870_c1_698_1144 | 148 |
| 757 | 3300050490 | nmdc:mga03n38_502617_c1 | nmdc:mga03n38_502617_c1_31_477 | 148 |
| 758 | 3300050490 | nmdc:mga03n38_95731_c1 | nmdc:mga03n38_95731_c1_65_511 | 148 |
| 759 | 3300050491 | nmdc:mga00v17_183968_c1 | nmdc:mga00v17_183968_c1_83_529 | 148 |
| 760 | 3300050491 | nmdc:mga00v17_42026_c1 | nmdc:mga00v17_42026_c1_1919_2365 | 148 |
| 761 | 3300050492 | nmdc:mga0yw44_25707_c1 | nmdc:mga0yw44_25707_c1_1821_2267 | 148 |
| 762 | 3300050492 | nmdc:mga0yw44_610084_c1 | nmdc:mga0yw44_610084_c1_92_538 | 148 |
| 763 | 3300050493 | nmdc:mga0k408_10048_c2 | nmdc:mga0k408_10048_c2_3245_3691 | 148 |
| 764 | 3300050493 | nmdc:mga0k408_130843_c1 | nmdc:mga0k408_130843_c1_693_1139 | 148 |
| 765 | 3300050493 | nmdc:mga0k408_195670_c1 | nmdc:mga0k408_195670_c1_642_1088 | 148 |
| 766 | 3300050493 | nmdc:mga0k408_352379_c1 | nmdc:mga0k408_352379_c1_153_599 | 148 |
| 767 | 3300050493 | nmdc:mga0k408_47120_c1 | nmdc:mga0k408_47120_c1_1747_2193 | 148 |
| 768 | 3300050493 | nmdc:mga0k408_89217_c1 | nmdc:mga0k408_89217_c1_1225_1671 | 148 |
| 769 | 3300050496 | nmdc:mga07m45_19628_c1 | nmdc:mga07m45_19628_c1_1285_1731 | 148 |
| 770 | 3300050496 | nmdc:mga07m45_229026_c1 | nmdc:mga07m45_229026_c1_238_684 | 148 |
| 771 | 3300050496 | nmdc:mga07m45_24382_c2 | nmdc:mga07m45_24382_c2_573_1019 | 148 |
| 772 | 3300050496 | nmdc:mga07m45_280482_c1 | nmdc:mga07m45_280482_c1_81_527 | 148 |
| 773 | 3300050496 | nmdc:mga07m45_37266_c1 | nmdc:mga07m45_37266_c1_290_736 | 148 |
| 774 | 3300050496 | nmdc:mga07m45_429736_c1 | nmdc:mga07m45_429736_c1_25_471 | 148 |
| 775 | 3300050496 | nmdc:mga07m45_4682_c1 | nmdc:mga07m45_4682_c1_5706_6152 | 148 |
| 776 | 3300050496 | nmdc:mga07m45_4793_c2 | nmdc:mga07m45_4793_c2_1711_2157 | 148 |
| 777 | 3300050516 | nmdc:mga0sz30_107357_c1 | nmdc:mga0sz30_107357_c1_642_1088 | 148 |
| 778 | 3300053079 | Ga0500610_0137740 | Ga0500610_0137740_178_624 | 148 |
| 779 | 3300053087 | Ga0500643_025657 | Ga0500643_025657_1127_1573 | 148 |
| 780 | 3300053087 | Ga0500643_146900 | Ga0500643_146900_175_621 | 148 |
| 781 | 3300053090 | Ga0500646_0151901 | Ga0500646_0151901_262_708 | 148 |
| 782 | 3300053093 | Ga0500651_0000320 | Ga0500651_0000320_10561_11007 | 148 |
| 783 | 3300053094 | Ga0500566_0046927 | Ga0500566_0046927_824_1270 | 148 |
| 784 | 3300053108 | Ga0500562_037954 | Ga0500562_037954_538_984 | 148 |
| 785 | 3300053110 | Ga0500571_026066 | Ga0500571_026066_1449_1895 | 148 |
| 786 | 3300053118 | Ga0500594_0005559 | Ga0500594_0005559_1600_2046 | 148 |
| 787 | 3300053118 | Ga0500594_0030215 | Ga0500594_0030215_822_1268 | 148 |
| 788 | 3300053120 | Ga0500597_137695 | Ga0500597_137695_47_493 | 148 |
| 789 | 3300053121 | Ga0500607_037082 | Ga0500607_037082_1668_2114 | 148 |
| 790 | 3300053122 | Ga0500608_034047 | Ga0500608_034047_1228_1674 | 148 |
| 791 | 3300053122 | Ga0500608_058403 | Ga0500608_058403_368_814 | 148 |
| 792 | 3300053125 | Ga0500618_028274 | Ga0500618_028274_511_957 | 148 |
| 793 | 3300053133 | Ga0500655_006961 | Ga0500655_006961_712_1158 | 148 |
| 794 | 3300053134 | Ga0500658_0028648 | Ga0500658_0028648_1235_1681 | 148 |
| 795 | 3300053136 | Ga0500559_0059373 | Ga0500559_0059373_740_1186 | 148 |
| 796 | 3300053136 | Ga0500559_0061547 | Ga0500559_0061547_206_652 | 148 |
| 797 | 3300053139 | Ga0500568_0005077 | Ga0500568_0005077_5542_5988 | 148 |
| 798 | 3300053140 | Ga0500573_0144620 | Ga0500573_0144620_267_713 | 148 |
| 799 | 3300053141 | Ga0500574_016583 | Ga0500574_016583_115_561 | 148 |
| 800 | 3300053153 | Ga0500616_0011974 | Ga0500616_0011974_1832_2278 | 148 |
| 801 | 3300053153 | Ga0500616_0101655 | Ga0500616_0101655_801_1247 | 148 |
| 802 | 3300053156 | Ga0500622_0134370 | Ga0500622_0134370_595_1041 | 148 |
| 803 | 3300053161 | Ga0500634_0008569 | Ga0500634_0008569_3738_4184 | 148 |
| 804 | 3300053730 | Ga0500645_000905 | Ga0500645_000905_15616_16062 | 148 |
| 805 | 3300059643 | Ga0587072_192581 | Ga0587072_192581_38_484 | 148 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wu2-assembly3.cif.gz_K | crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant | 0.9072 | 16 | 144 |
| 2wdv-assembly1.cif.gz_C | e. coli succinate:quinone oxidoreductase (sqr) with an empty quinone- binding pocket | 0.9064 | 16 | 143 |
| 6wu6-assembly1.cif.gz_C | succinate-coenzyme q reductase | 0.8989 | 26 | 144 |
| 2wu2-assembly3.cif.gz_K | crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant | 0.8863 | 16 | 144 |
| 2wdv-assembly1.cif.gz_C | e. coli succinate:quinone oxidoreductase (sqr) with an empty quinone- binding pocket | 0.8854 | 16 | 143 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2wdrC00 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.9069 | 16 | 144 | 1.20.1300.10 |
| 2ws3C00 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.9064 | 16 | 143 | 1.20.1300.10 |
| 2wdvK00 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.9062 | 16 | 143 | 1.20.1300.10 |
| 2wdrC00 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.886 | 16 | 144 | 1.20.1300.10 |
| 2ws3C00 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.8854 | 16 | 143 | 1.20.1300.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257W811-F1-model_v4 | deleted | 0.9939 | 70 | 148 |
|
| AF-A0A7Y0BIE3-F1-model_v4 | Succinate dehydrogenase cytochrome b556 subunit | 0.9885 | 23 | 148 |
GO:0006099
GO:0009055 GO:0016020 GO:0046872 |
| AF-A0A7Y0BIE3-F1-model_v4 | Succinate dehydrogenase cytochrome b556 subunit | 0.9808 | 23 | 148 |
GO:0006099
GO:0009055 GO:0016020 GO:0046872 |
| AF-A0A5C9CSF0-F1-model_v4 | Succinate dehydrogenase cytochrome b556 subunit | 0.9777 | 46 | 148 |
GO:0006099
GO:0009055 GO:0016020 GO:0046872 |
| AF-A0A257W811-F1-model_v4 | deleted | 0.9695 | 70 | 148 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar