F481566
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 804 | 373 | 1608 | 279 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0120821|Ga0373937_0120821_939_1859 |
| Length | 306 |
| Sequence | VIPSLPRSSAARFATAGYVAAFLVFLFVPLVVVAVFAFNDANYPAPPWRGFTLDWFLGGHGRTGLFTDVPLLGSVGTSVLVASWVTMLSVAVGTANAFLLERARFRGKSALSLLMLAPLVIPGVILGISILAFASRVAQFADDLWGIELDFLRPGLPLVVFGQFSYIVSIATLTIAARLKRFDGTLEDAAFNLGASRAAVLWTVILPYLRPALIGAAAISFLMSFENFNTTLMLVGSDPPLTVMMYGRMREGASPVLNAVSLLLMVASALIALALLRRSARPTGDAFATARDLSESNPRTGPPAPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 13 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 103 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 134 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 137 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 217 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 218 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 219 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 220 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 221 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 222 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 223 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 224 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 225 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 226 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 227 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 228 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 229 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 230 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 232 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 233 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 234 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 235 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 236 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 237 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 246 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 247 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 249 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 250 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 251 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 252 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 253 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 255 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 256 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 257 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 303 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 304 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 305 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 306 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 309 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 310 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 311 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 312 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 313 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 314 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 315 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 316 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 317 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 318 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 334 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 335 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 342 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 343 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 344 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 345 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 346 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 347 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 348 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 349 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 350 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 351 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 352 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 353 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 354 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 355 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 356 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 357 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 358 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 359 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 360 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 361 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 362 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 363 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 364 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 365 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 366 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 367 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 368 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 369 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 370 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 371 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 372 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 373 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.89 |
| Metatranscriptomes | 0 |
| Isolates | 2.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.59 |
| Nodule | 0.62 |
| Rhizoplane | 3.36 |
| Rhizosphere | 81.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373937_0120821 | 3300036401 | Bacteria | 2441 |
| 2 | JGI24740J21852_10038698 | 3300001979 | Bacteria | 1461 |
| 3 | JGI25155J39150_1000104 | 3300002704 | Bacteria | 45159 |
| 4 | JGI25156J39149_1000089 | 3300002705 | Bacteria | 68168 |
| 5 | JGI25154J39366_1000115 | 3300002738 | Bacteria | 68056 |
| 6 | JGI25157J39369_1000118 | 3300002741 | Bacteria | 68168 |
| 7 | JGI25159J45721_1006856 | 3300002987 | Bacteria | 3344 |
| 8 | JGI25159J45721_1007148 | 3300002987 | Bacteria | 3239 |
| 9 | JGI25151J46595_10018037 | 3300003187 | Bacteria | 3043 |
| 10 | rootH1_10104496 | 3300003316 | Bacteria | 2132 |
| 11 | rootH1_10122896 | 3300003323 | Bacteria | 2576 |
| 12 | JGI25160J50197_1000281 | 3300003354 | Bacteria | 37019 |
| 13 | JGI25161J50226_1000124 | 3300003374 | Bacteria | 56436 |
| 14 | JGI25161J50226_1000228 | 3300003374 | Bacteria | 34378 |
| 15 | Ga0055537_1000218 | 3300003773 | Bacteria | 42281 |
| 16 | Ga0055524_1000119 | 3300003775 | Bacteria | 92710 |
| 17 | Ga0055536_1005225 | 3300003781 | Bacteria | 6404 |
| 18 | Ga0055534_1003730 | 3300003784 | Bacteria | 4697 |
| 19 | Ga0055530_10000322 | 3300003791 | Bacteria | 43322 |
| 20 | Ga0055540_1000058 | 3300003792 | Bacteria | 136015 |
| 21 | Ga0055531_10009332 | 3300003794 | Bacteria | 5026 |
| 22 | Ga0055543_1001000 | 3300004625 | Bacteria | 12685 |
| 23 | Ga0065715_10099762 | 3300005293 | Bacteria | 3374 |
| 24 | Ga0065715_10147158 | 3300005293 | Bacteria | 1774 |
| 25 | Ga0070676_10003660 | 3300005328 | Bacteria | 8048 |
| 26 | Ga0070676_10034239 | 3300005328 | Bacteria | 2916 |
| 27 | Ga0070676_10309324 | 3300005328 | Bacteria | 1074 |
| 28 | Ga0070683_100004502 | 3300005329 | Bacteria | 11501 |
| 29 | Ga0070690_100003236 | 3300005330 | Bacteria | 8886 |
| 30 | Ga0070690_100040565 | 3300005330 | Bacteria | 2944 |
| 31 | Ga0070690_100122346 | 3300005330 | Bacteria | 1748 |
| 32 | Ga0070670_100004913 | 3300005331 | Bacteria | 11248 |
| 33 | Ga0070670_100022011 | 3300005331 | Bacteria | 5485 |
| 34 | Ga0070670_100030016 | 3300005331 | Bacteria | 4682 |
| 35 | Ga0070670_100036607 | 3300005331 | Bacteria | 4223 |
| 36 | Ga0070670_100060219 | 3300005331 | Bacteria | 3259 |
| 37 | Ga0070670_100155119 | 3300005331 | Bacteria | 1983 |
| 38 | Ga0070670_100178796 | 3300005331 | Bacteria | 1842 |
| 39 | Ga0070670_100270446 | 3300005331 | Bacteria | 1483 |
| 40 | Ga0070677_10110452 | 3300005333 | Bacteria | 1226 |
| 41 | Ga0068869_100000933 | 3300005334 | Bacteria | 16873 |
| 42 | Ga0068869_100003186 | 3300005334 | Bacteria | 10022 |
| 43 | Ga0068869_100010839 | 3300005334 | Bacteria | 5960 |
| 44 | Ga0070666_10049714 | 3300005335 | Bacteria | 2819 |
| 45 | Ga0070666_10055020 | 3300005335 | Bacteria | 2685 |
| 46 | Ga0070666_10065337 | 3300005335 | Bacteria | 2469 |
| 47 | Ga0070666_10067255 | 3300005335 | Bacteria | 2433 |
| 48 | Ga0070666_10147063 | 3300005335 | Bacteria | 1643 |
| 49 | Ga0070666_10154017 | 3300005335 | Bacteria | 1604 |
| 50 | Ga0070666_10226210 | 3300005335 | Bacteria | 1320 |
| 51 | Ga0068868_100000470 | 3300005338 | Bacteria | 26845 |
| 52 | Ga0068868_100007161 | 3300005338 | Bacteria | 7927 |
| 53 | Ga0068868_100121216 | 3300005338 | Bacteria | 2133 |
| 54 | Ga0070660_100036746 | 3300005339 | Bacteria | 3711 |
| 55 | Ga0070689_100014621 | 3300005340 | Bacteria | 5705 |
| 56 | Ga0070689_100236119 | 3300005340 | Bacteria | 1504 |
| 57 | Ga0070689_100241066 | 3300005340 | Bacteria | 1489 |
| 58 | Ga0070687_100094805 | 3300005343 | Bacteria | 1658 |
| 59 | Ga0070661_100003664 | 3300005344 | Bacteria | 10585 |
| 60 | Ga0070661_100006249 | 3300005344 | Bacteria | 8218 |
| 61 | Ga0070661_100047127 | 3300005344 | Bacteria | 3154 |
| 62 | Ga0070661_100335257 | 3300005344 | Bacteria | 1184 |
| 63 | Ga0070668_100011167 | 3300005347 | Bacteria | 6687 |
| 64 | Ga0070668_100015214 | 3300005347 | Bacteria | 5748 |
| 65 | Ga0070668_100015517 | 3300005347 | Bacteria | 5695 |
| 66 | Ga0070668_100072219 | 3300005347 | Bacteria | 2689 |
| 67 | Ga0070668_100431472 | 3300005347 | Bacteria | 1130 |
| 68 | Ga0070669_100010514 | 3300005353 | Bacteria | 6573 |
| 69 | Ga0070669_100137109 | 3300005353 | Bacteria | 1883 |
| 70 | Ga0070669_100198138 | 3300005353 | Bacteria | 1579 |
| 71 | Ga0070669_100257717 | 3300005353 | Bacteria | 1391 |
| 72 | Ga0070669_100272948 | 3300005353 | Bacteria | 1353 |
| 73 | Ga0070669_100368236 | 3300005353 | Bacteria | 1170 |
| 74 | Ga0070675_100036643 | 3300005354 | Bacteria | 3993 |
| 75 | Ga0070675_100042544 | 3300005354 | Bacteria | 3711 |
| 76 | Ga0070675_100259003 | 3300005354 | Bacteria | 1524 |
| 77 | Ga0070671_100032084 | 3300005355 | Bacteria | 4343 |
| 78 | Ga0070671_100032238 | 3300005355 | Bacteria | 4333 |
| 79 | Ga0070671_100032541 | 3300005355 | Bacteria | 4311 |
| 80 | Ga0070671_100035903 | 3300005355 | Bacteria | 4108 |
| 81 | Ga0070671_100038582 | 3300005355 | Bacteria | 3964 |
| 82 | Ga0070671_100049945 | 3300005355 | Bacteria | 3479 |
| 83 | Ga0070671_100063396 | 3300005355 | Bacteria | 3078 |
| 84 | Ga0070671_100179268 | 3300005355 | Bacteria | 1793 |
| 85 | Ga0070674_100015365 | 3300005356 | Bacteria | 4778 |
| 86 | Ga0070674_100147916 | 3300005356 | Bacteria | 1770 |
| 87 | Ga0070674_100487899 | 3300005356 | Bacteria | 1024 |
| 88 | Ga0070673_100008174 | 3300005364 | Bacteria | 6944 |
| 89 | Ga0070673_100008978 | 3300005364 | Bacteria | 6687 |
| 90 | Ga0070673_100012046 | 3300005364 | Bacteria | 5924 |
| 91 | Ga0070673_100083349 | 3300005364 | Bacteria | 2597 |
| 92 | Ga0070673_100223269 | 3300005364 | Bacteria | 1631 |
| 93 | Ga0070673_100247622 | 3300005364 | Bacteria | 1552 |
| 94 | Ga0070688_100027533 | 3300005365 | Bacteria | 3386 |
| 95 | Ga0070688_100222594 | 3300005365 | Bacteria | 1330 |
| 96 | Ga0070659_100002977 | 3300005366 | Bacteria | 12066 |
| 97 | Ga0070659_100129241 | 3300005366 | Bacteria | 2050 |
| 98 | Ga0070667_100002837 | 3300005367 | Bacteria | 14953 |
| 99 | Ga0070667_100005881 | 3300005367 | Bacteria | 10221 |
| 100 | Ga0070667_100044086 | 3300005367 | Bacteria | 3745 |
| 101 | Ga0070667_100068471 | 3300005367 | Bacteria | 3020 |
| 102 | Ga0070667_100167802 | 3300005367 | Bacteria | 1936 |
| 103 | Ga0070667_100220825 | 3300005367 | Bacteria | 1687 |
| 104 | Ga0070667_100353387 | 3300005367 | Bacteria | 1331 |
| 105 | Ga0070667_100397591 | 3300005367 | Bacteria | 1254 |
| 106 | Ga0070667_100603289 | 3300005367 | Bacteria | 1012 |
| 107 | Ga0070667_100621638 | 3300005367 | Bacteria | 996 |
| 108 | Ga0070709_10002492 | 3300005434 | Bacteria | 9966 |
| 109 | Ga0070713_100000089 | 3300005436 | Bacteria | 57995 |
| 110 | Ga0070710_10000978 | 3300005437 | Bacteria | 13579 |
| 111 | Ga0070701_10231120 | 3300005438 | Bacteria | 1108 |
| 112 | Ga0070701_10244046 | 3300005438 | Bacteria | 1082 |
| 113 | Ga0070711_100004025 | 3300005439 | Bacteria | 8647 |
| 114 | Ga0070711_100079914 | 3300005439 | Bacteria | 2327 |
| 115 | Ga0070711_100124886 | 3300005439 | Bacteria | 1909 |
| 116 | Ga0070705_100096050 | 3300005440 | Bacteria | 1860 |
| 117 | Ga0070700_100324425 | 3300005441 | Bacteria | 1132 |
| 118 | Ga0070694_100152881 | 3300005444 | Bacteria | 1687 |
| 119 | Ga0070708_100000053 | 3300005445 | Bacteria | 77258 |
| 120 | Ga0070708_100146132 | 3300005445 | Bacteria | 2196 |
| 121 | Ga0070663_100000563 | 3300005455 | Bacteria | 19762 |
| 122 | Ga0070663_100094378 | 3300005455 | Bacteria | 2221 |
| 123 | Ga0070663_100341863 | 3300005455 | Bacteria | 1209 |
| 124 | Ga0070678_100078264 | 3300005456 | Bacteria | 2497 |
| 125 | Ga0070678_100100318 | 3300005456 | Bacteria | 2242 |
| 126 | Ga0070678_100104916 | 3300005456 | Bacteria | 2199 |
| 127 | Ga0070678_100156842 | 3300005456 | Bacteria | 1839 |
| 128 | Ga0070662_100000493 | 3300005457 | Bacteria | 23501 |
| 129 | Ga0070662_100098430 | 3300005457 | Bacteria | 2209 |
| 130 | Ga0070681_10012370 | 3300005458 | Bacteria | 8463 |
| 131 | Ga0068867_100002313 | 3300005459 | Bacteria | 13410 |
| 132 | Ga0068867_100392524 | 3300005459 | Bacteria | 1168 |
| 133 | Ga0070685_10001266 | 3300005466 | Bacteria | 13375 |
| 134 | Ga0070685_10007358 | 3300005466 | Bacteria | 5631 |
| 135 | Ga0070685_10185230 | 3300005466 | Bacteria | 1343 |
| 136 | Ga0070706_100020939 | 3300005467 | Bacteria | 6020 |
| 137 | Ga0070706_100024748 | 3300005467 | Bacteria | 5527 |
| 138 | Ga0070706_100366213 | 3300005467 | Bacteria | 1343 |
| 139 | Ga0070707_100025803 | 3300005468 | Bacteria | 5577 |
| 140 | Ga0070699_100402353 | 3300005518 | Bacteria | 1238 |
| 141 | Ga0070684_100022586 | 3300005535 | Bacteria | 5250 |
| 142 | Ga0070697_100037673 | 3300005536 | Bacteria | 3906 |
| 143 | Ga0068853_100003287 | 3300005539 | Bacteria | 12364 |
| 144 | Ga0068853_100289820 | 3300005539 | Bacteria | 1511 |
| 145 | Ga0068853_100322870 | 3300005539 | Bacteria | 1431 |
| 146 | Ga0068853_100554314 | 3300005539 | Bacteria | 1089 |
| 147 | Ga0068853_100588639 | 3300005539 | Bacteria | 1056 |
| 148 | Ga0070672_100003389 | 3300005543 | Bacteria | 10332 |
| 149 | Ga0070672_100016459 | 3300005543 | Bacteria | 5294 |
| 150 | Ga0070672_100026315 | 3300005543 | Bacteria | 4327 |
| 151 | Ga0070672_100122885 | 3300005543 | Bacteria | 2127 |
| 152 | Ga0070672_100237354 | 3300005543 | Bacteria | 1533 |
| 153 | Ga0070686_100001970 | 3300005544 | Bacteria | 11403 |
| 154 | Ga0070695_100001102 | 3300005545 | Bacteria | 14768 |
| 155 | Ga0070695_100083058 | 3300005545 | Bacteria | 2122 |
| 156 | Ga0070695_100181428 | 3300005545 | Bacteria | 1492 |
| 157 | Ga0070665_100003009 | 3300005548 | Bacteria | 18178 |
| 158 | Ga0070665_100003275 | 3300005548 | Bacteria | 17374 |
| 159 | Ga0070665_100014341 | 3300005548 | Bacteria | 7958 |
| 160 | Ga0070665_100043553 | 3300005548 | Bacteria | 4510 |
| 161 | Ga0070665_100049341 | 3300005548 | Bacteria | 4224 |
| 162 | Ga0070665_100237600 | 3300005548 | Bacteria | 1823 |
| 163 | Ga0070665_100503507 | 3300005548 | Bacteria | 1222 |
| 164 | Ga0070665_100582131 | 3300005548 | Bacteria | 1132 |
| 165 | Ga0070704_100029023 | 3300005549 | Bacteria | 3688 |
| 166 | Ga0068855_100003372 | 3300005563 | Bacteria | 19564 |
| 167 | Ga0068855_100096663 | 3300005563 | Bacteria | 3402 |
| 168 | Ga0070664_100003982 | 3300005564 | Bacteria | 11881 |
| 169 | Ga0068857_100092994 | 3300005577 | Bacteria | 2700 |
| 170 | Ga0068854_100004404 | 3300005578 | Bacteria | 8888 |
| 171 | Ga0068854_100010639 | 3300005578 | Bacteria | 5969 |
| 172 | Ga0068854_100055051 | 3300005578 | Bacteria | 2863 |
| 173 | Ga0068854_100180136 | 3300005578 | Bacteria | 1650 |
| 174 | Ga0068854_100293408 | 3300005578 | Bacteria | 1313 |
| 175 | Ga0068854_100509479 | 3300005578 | Unclassified | 1015 |
| 176 | Ga0068856_100000282 | 3300005614 | Bacteria | 55434 |
| 177 | Ga0068856_100114795 | 3300005614 | Bacteria | 2692 |
| 178 | Ga0068856_100290769 | 3300005614 | Bacteria | 1651 |
| 179 | Ga0070702_100005347 | 3300005615 | Bacteria | 5965 |
| 180 | Ga0070702_100036198 | 3300005615 | Bacteria | 2732 |
| 181 | Ga0068852_100000749 | 3300005616 | Bacteria | 21324 |
| 182 | Ga0068852_100071156 | 3300005616 | Bacteria | 3053 |
| 183 | Ga0068852_100076808 | 3300005616 | Bacteria | 2950 |
| 184 | Ga0068859_100000120 | 3300005617 | Bacteria | 74447 |
| 185 | Ga0068859_100005936 | 3300005617 | Bacteria | 12396 |
| 186 | Ga0068859_100007348 | 3300005617 | Bacteria | 11178 |
| 187 | Ga0068859_100035437 | 3300005617 | Bacteria | 5007 |
| 188 | Ga0068859_100046831 | 3300005617 | Bacteria | 4342 |
| 189 | Ga0068859_100052470 | 3300005617 | Bacteria | 4099 |
| 190 | Ga0068864_100004562 | 3300005618 | Bacteria | 11372 |
| 191 | Ga0068864_100007614 | 3300005618 | Bacteria | 8917 |
| 192 | Ga0068864_100008422 | 3300005618 | Bacteria | 8507 |
| 193 | Ga0068864_100014701 | 3300005618 | Bacteria | 6502 |
| 194 | Ga0068864_100023641 | 3300005618 | Bacteria | 5162 |
| 195 | Ga0068864_100086784 | 3300005618 | Bacteria | 2754 |
| 196 | Ga0068864_100452166 | 3300005618 | Bacteria | 1228 |
| 197 | Ga0068866_10001765 | 3300005718 | Bacteria | 9096 |
| 198 | Ga0068866_10023812 | 3300005718 | Bacteria | 2853 |
| 199 | Ga0068866_10154328 | 3300005718 | Bacteria | 1333 |
| 200 | Ga0068861_100000763 | 3300005719 | Bacteria | 19317 |
| 201 | Ga0068861_100066573 | 3300005719 | Bacteria | 2777 |
| 202 | Ga0068861_100069249 | 3300005719 | Bacteria | 2729 |
| 203 | Ga0068861_100272858 | 3300005719 | Bacteria | 1453 |
| 204 | Ga0068851_10003427 | 3300005834 | Bacteria | 7059 |
| 205 | Ga0068870_10000465 | 3300005840 | Bacteria | 15392 |
| 206 | Ga0068870_10088440 | 3300005840 | Bacteria | 1727 |
| 207 | Ga0068870_10173306 | 3300005840 | Bacteria | 1289 |
| 208 | Ga0068863_100002646 | 3300005841 | Bacteria | 17718 |
| 209 | Ga0068863_100004216 | 3300005841 | Bacteria | 14201 |
| 210 | Ga0068863_100026191 | 3300005841 | Bacteria | 5565 |
| 211 | Ga0068863_100095043 | 3300005841 | Bacteria | 2829 |
| 212 | Ga0068863_100125674 | 3300005841 | Bacteria | 2447 |
| 213 | Ga0068863_100133775 | 3300005841 | Bacteria | 2368 |
| 214 | Ga0068863_100240775 | 3300005841 | Bacteria | 1746 |
| 215 | Ga0068863_100530431 | 3300005841 | Unclassified | 1161 |
| 216 | Ga0068858_100001097 | 3300005842 | Bacteria | 28000 |
| 217 | Ga0068858_100002283 | 3300005842 | Bacteria | 19412 |
| 218 | Ga0068858_100013852 | 3300005842 | Bacteria | 7608 |
| 219 | Ga0068858_100020886 | 3300005842 | Bacteria | 6119 |
| 220 | Ga0068858_100050272 | 3300005842 | Bacteria | 3858 |
| 221 | Ga0068858_100085356 | 3300005842 | Bacteria | 2937 |
| 222 | Ga0068858_100132554 | 3300005842 | Bacteria | 2337 |
| 223 | Ga0068860_100002008 | 3300005843 | Bacteria | 21467 |
| 224 | Ga0068860_100011356 | 3300005843 | Bacteria | 8777 |
| 225 | Ga0068860_100018109 | 3300005843 | Bacteria | 6858 |
| 226 | Ga0068860_100025768 | 3300005843 | Bacteria | 5672 |
| 227 | Ga0068860_100194539 | 3300005843 | Bacteria | 1963 |
| 228 | Ga0068862_100010431 | 3300005844 | Bacteria | 7672 |
| 229 | Ga0068862_100020511 | 3300005844 | Bacteria | 5521 |
| 230 | Ga0068862_100163744 | 3300005844 | Bacteria | 1987 |
| 231 | Ga0068862_100174092 | 3300005844 | Bacteria | 1928 |
| 232 | Ga0081540_1007994 | 3300005983 | Bacteria | 7445 |
| 233 | Ga0081540_1059546 | 3300005983 | Bacteria | 1832 |
| 234 | Ga0081539_10000004 | 3300005985 | Bacteria | 555600 |
| 235 | Ga0070715_10043115 | 3300006163 | Bacteria | 1900 |
| 236 | Ga0070716_100034389 | 3300006173 | Bacteria | 2779 |
| 237 | Ga0070716_100390743 | 3300006173 | Bacteria | 997 |
| 238 | Ga0070712_100042431 | 3300006175 | Bacteria | 3128 |
| 239 | Ga0075366_10024347 | 3300006195 | Bacteria | 3531 |
| 240 | Ga0075366_10103195 | 3300006195 | Bacteria | 1712 |
| 241 | Ga0097621_100133962 | 3300006237 | Bacteria | 2111 |
| 242 | Ga0097621_100218566 | 3300006237 | Bacteria | 1660 |
| 243 | Ga0097621_100250147 | 3300006237 | Bacteria | 1552 |
| 244 | Ga0075370_10002093 | 3300006353 | Bacteria | 9095 |
| 245 | Ga0068871_100097933 | 3300006358 | Bacteria | 2453 |
| 246 | Ga0075428_100083500 | 3300006844 | Bacteria | 3485 |
| 247 | Ga0075433_10061907 | 3300006852 | Bacteria | 3278 |
| 248 | Ga0075434_100404126 | 3300006871 | Bacteria | 1387 |
| 249 | Ga0068865_100025970 | 3300006881 | Bacteria | 3858 |
| 250 | Ga0068865_100250079 | 3300006881 | Bacteria | 1399 |
| 251 | Ga0068865_100271951 | 3300006881 | Bacteria | 1346 |
| 252 | Ga0097620_100000120 | 3300006931 | Bacteria | 74447 |
| 253 | Ga0097620_100005938 | 3300006931 | Bacteria | 12396 |
| 254 | Ga0097620_100007347 | 3300006931 | Bacteria | 11178 |
| 255 | Ga0097620_100035434 | 3300006931 | Bacteria | 5007 |
| 256 | Ga0097620_100046835 | 3300006931 | Bacteria | 4342 |
| 257 | Ga0097620_100052471 | 3300006931 | Bacteria | 4099 |
| 258 | Ga0079104_1018973 | 3300006946 | Bacteria | 1935 |
| 259 | Ga0075435_100212434 | 3300007076 | Bacteria | 1642 |
| 260 | Ga0099794_10020562 | 3300007265 | Bacteria | 2989 |
| 261 | Ga0099795_10000002 | 3300007788 | Bacteria | 161112 |
| 262 | Ga0105240_10023285 | 3300009093 | Bacteria | 8196 |
| 263 | Ga0105240_10033897 | 3300009093 | Bacteria | 6593 |
| 264 | Ga0111539_10439152 | 3300009094 | Bacteria | 1520 |
| 265 | Ga0105245_10001088 | 3300009098 | Bacteria | 24634 |
| 266 | Ga0105245_10213105 | 3300009098 | Bacteria | 1860 |
| 267 | Ga0105247_10003310 | 3300009101 | Bacteria | 10556 |
| 268 | Ga0105247_10006478 | 3300009101 | Bacteria | 7245 |
| 269 | Ga0105247_10009360 | 3300009101 | Bacteria | 5948 |
| 270 | Ga0105247_10190281 | 3300009101 | Bacteria | 1373 |
| 271 | Ga0114129_10100375 | 3300009147 | Bacteria | 4005 |
| 272 | Ga0114129_10179688 | 3300009147 | Bacteria | 2880 |
| 273 | Ga0114129_11014234 | 3300009147 | Bacteria | 1044 |
| 274 | Ga0105242_10007446 | 3300009176 | Bacteria | 8429 |
| 275 | Ga0105242_10151634 | 3300009176 | Bacteria | 2021 |
| 276 | Ga0105242_10401176 | 3300009176 | Bacteria | 1280 |
| 277 | Ga0105242_10668393 | 3300009176 | Bacteria | 1012 |
| 278 | Ga0105248_10000932 | 3300009177 | Bacteria | 32593 |
| 279 | Ga0105248_10007614 | 3300009177 | Bacteria | 11897 |
| 280 | Ga0105248_10012988 | 3300009177 | Bacteria | 9180 |
| 281 | Ga0105248_10022317 | 3300009177 | Bacteria | 7019 |
| 282 | Ga0105248_10358706 | 3300009177 | Bacteria | 1641 |
| 283 | Ga0105248_10504849 | 3300009177 | Bacteria | 1363 |
| 284 | Ga0105248_10650774 | 3300009177 | Bacteria | 1189 |
| 285 | Ga0105248_10799851 | 3300009177 | Bacteria | 1064 |
| 286 | Ga0105248_10897360 | 3300009177 | Bacteria | 1001 |
| 287 | Ga0105237_10000529 | 3300009545 | Bacteria | 53671 |
| 288 | Ga0105237_10025291 | 3300009545 | Bacteria | 6072 |
| 289 | Ga0105237_10291255 | 3300009545 | Bacteria | 1635 |
| 290 | Ga0105238_10001158 | 3300009551 | Bacteria | 26593 |
| 291 | Ga0105238_10179733 | 3300009551 | Bacteria | 2093 |
| 292 | Ga0105238_10220533 | 3300009551 | Bacteria | 1872 |
| 293 | Ga0105238_10261123 | 3300009551 | Bacteria | 1711 |
| 294 | Ga0105238_10672700 | 3300009551 | Bacteria | 1046 |
| 295 | Ga0105249_10010730 | 3300009553 | Bacteria | 8048 |
| 296 | Ga0105249_10040863 | 3300009553 | Bacteria | 4214 |
| 297 | Ga0105249_10153769 | 3300009553 | Bacteria | 2217 |
| 298 | Ga0105249_10299943 | 3300009553 | Bacteria | 1611 |
| 299 | Ga0105249_10600388 | 3300009553 | Bacteria | 1155 |
| 300 | Ga0099796_10000030 | 3300010159 | Bacteria | 32756 |
| 301 | Ga0105239_10004965 | 3300010375 | Bacteria | 15709 |
| 302 | Ga0105239_10238567 | 3300010375 | Bacteria | 2041 |
| 303 | Ga0105246_10043837 | 3300011119 | Bacteria | 3037 |
| 304 | Ga0157326_1002791 | 3300012513 | Bacteria | 1850 |
| 305 | Ga0157373_10004123 | 3300013100 | Bacteria | 10959 |
| 306 | Ga0157371_10002422 | 3300013102 | Bacteria | 17824 |
| 307 | Ga0157370_10132141 | 3300013104 | Bacteria | 2328 |
| 308 | Ga0157369_10029445 | 3300013105 | Bacteria | 6067 |
| 309 | Ga0157369_10055066 | 3300013105 | Bacteria | 4294 |
| 310 | Ga0157374_10357527 | 3300013296 | Bacteria | 1452 |
| 311 | Ga0157378_10014175 | 3300013297 | Bacteria | 6975 |
| 312 | Ga0157378_10017194 | 3300013297 | Bacteria | 6339 |
| 313 | Ga0157378_10117243 | 3300013297 | Bacteria | 2449 |
| 314 | Ga0163162_10002371 | 3300013306 | Bacteria | 17713 |
| 315 | Ga0163162_10036504 | 3300013306 | Bacteria | 4899 |
| 316 | Ga0163162_10071070 | 3300013306 | Bacteria | 3533 |
| 317 | Ga0163162_10128514 | 3300013306 | Bacteria | 2642 |
| 318 | Ga0163162_10262671 | 3300013306 | Bacteria | 1858 |
| 319 | Ga0163162_10292831 | 3300013306 | Bacteria | 1759 |
| 320 | Ga0157372_10005991 | 3300013307 | Bacteria | 12914 |
| 321 | Ga0157372_10070381 | 3300013307 | Bacteria | 3936 |
| 322 | Ga0157375_10034821 | 3300013308 | Bacteria | 4800 |
| 323 | Ga0157375_10040657 | 3300013308 | Bacteria | 4484 |
| 324 | Ga0157375_10209239 | 3300013308 | Bacteria | 2107 |
| 325 | Ga0157375_10320504 | 3300013308 | Bacteria | 1715 |
| 326 | Ga0157375_10788916 | 3300013308 | Bacteria | 1099 |
| 327 | Ga0157375_11098472 | 3300013308 | Bacteria | 931 |
| 328 | Ga0163163_10008221 | 3300014325 | Bacteria | 9259 |
| 329 | Ga0163163_10042194 | 3300014325 | Bacteria | 4467 |
| 330 | Ga0163163_10382021 | 3300014325 | Bacteria | 1466 |
| 331 | Ga0163163_10486045 | 3300014325 | Bacteria | 1296 |
| 332 | Ga0157380_10044789 | 3300014326 | Bacteria | 3469 |
| 333 | Ga0157380_10252684 | 3300014326 | Bacteria | 1596 |
| 334 | Ga0157377_10001646 | 3300014745 | Bacteria | 9747 |
| 335 | Ga0157377_10021487 | 3300014745 | Bacteria | 3395 |
| 336 | Ga0157379_10000415 | 3300014968 | Bacteria | 34568 |
| 337 | Ga0157379_10002404 | 3300014968 | Bacteria | 15636 |
| 338 | Ga0157379_10006726 | 3300014968 | Bacteria | 9932 |
| 339 | Ga0157379_10029938 | 3300014968 | Bacteria | 4842 |
| 340 | Ga0157379_10205071 | 3300014968 | Bacteria | 1783 |
| 341 | Ga0157379_10275882 | 3300014968 | Bacteria | 1529 |
| 342 | Ga0157379_10406014 | 3300014968 | Bacteria | 1253 |
| 343 | Ga0157376_10049158 | 3300014969 | Bacteria | 3492 |
| 344 | Ga0157376_10050310 | 3300014969 | Bacteria | 3457 |
| 345 | Ga0157376_10070733 | 3300014969 | Bacteria | 2963 |
| 346 | Ga0157376_10104373 | 3300014969 | Bacteria | 2483 |
| 347 | Ga0157376_10348627 | 3300014969 | Bacteria | 1416 |
| 348 | Ga0163161_10004923 | 3300017792 | Bacteria | 9293 |
| 349 | Ga0163161_10008975 | 3300017792 | Bacteria | 6916 |
| 350 | Ga0163161_10310378 | 3300017792 | Bacteria | 1244 |
| 351 | Ga0213873_10019748 | 3300021358 | Bacteria | 1567 |
| 352 | Ga0209435_100002 | 3300025206 | Bacteria | 794178 |
| 353 | Ga0207425_1007536 | 3300025245 | Bacteria | 2863 |
| 354 | Ga0207425_1015792 | 3300025245 | Bacteria | 1687 |
| 355 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 356 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 357 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 358 | Ga0209565_1000043 | 3300025263 | Bacteria | 235332 |
| 359 | Ga0209673_1000008 | 3300025273 | Bacteria | 626013 |
| 360 | Ga0209130_1000276 | 3300025284 | Bacteria | 63841 |
| 361 | Ga0209130_1000606 | 3300025284 | Bacteria | 34652 |
| 362 | Ga0207673_1002411 | 3300025290 | Bacteria | 2133 |
| 363 | Ga0209675_1000170 | 3300025291 | Bacteria | 78095 |
| 364 | Ga0209675_1034291 | 3300025291 | Bacteria | 1168 |
| 365 | Ga0209676_1000023 | 3300025292 | Bacteria | 589732 |
| 366 | Ga0209676_1001474 | 3300025292 | Bacteria | 21818 |
| 367 | Ga0209676_1014950 | 3300025292 | Bacteria | 2884 |
| 368 | Ga0209025_1006123 | 3300025294 | Bacteria | 9487 |
| 369 | Ga0209025_1030039 | 3300025294 | Bacteria | 2611 |
| 370 | Ga0209025_1039291 | 3300025294 | Bacteria | 2066 |
| 371 | Ga0209564_1009011 | 3300025295 | Bacteria | 4820 |
| 372 | Ga0209758_1032079 | 3300025297 | Bacteria | 2141 |
| 373 | Ga0209050_1000022 | 3300025298 | Bacteria | 565239 |
| 374 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 375 | Ga0207426_1000424 | 3300025302 | Bacteria | 69170 |
| 376 | Ga0207426_1002385 | 3300025302 | Bacteria | 12126 |
| 377 | Ga0209051_1000013 | 3300025303 | Bacteria | 565239 |
| 378 | Ga0209051_1048231 | 3300025303 | Bacteria | 1446 |
| 379 | Ga0209257_1000042 | 3300025304 | Bacteria | 537149 |
| 380 | Ga0209257_1007824 | 3300025304 | Bacteria | 6325 |
| 381 | Ga0207697_10001107 | 3300025315 | Bacteria | 14856 |
| 382 | Ga0207697_10041456 | 3300025315 | Bacteria | 1891 |
| 383 | Ga0207697_10047209 | 3300025315 | Bacteria | 1775 |
| 384 | Ga0207656_10014158 | 3300025321 | Bacteria | 3067 |
| 385 | Ga0207682_10001279 | 3300025893 | Bacteria | 11559 |
| 386 | Ga0207642_10072988 | 3300025899 | Bacteria | 1640 |
| 387 | Ga0207710_10000498 | 3300025900 | Bacteria | 24454 |
| 388 | Ga0207710_10014141 | 3300025900 | Bacteria | 3361 |
| 389 | Ga0207688_10000412 | 3300025901 | Bacteria | 20074 |
| 390 | Ga0207688_10086948 | 3300025901 | Bacteria | 1792 |
| 391 | Ga0207680_10002034 | 3300025903 | Bacteria | 9470 |
| 392 | Ga0207680_10021525 | 3300025903 | Bacteria | 3490 |
| 393 | Ga0207680_10120199 | 3300025903 | Bacteria | 1717 |
| 394 | Ga0207680_10126883 | 3300025903 | Bacteria | 1676 |
| 395 | Ga0207680_10141052 | 3300025903 | Bacteria | 1597 |
| 396 | Ga0207647_10067532 | 3300025904 | Bacteria | 2166 |
| 397 | Ga0207647_10071413 | 3300025904 | Bacteria | 2094 |
| 398 | Ga0207699_10022857 | 3300025906 | Bacteria | 3394 |
| 399 | Ga0207645_10002807 | 3300025907 | Bacteria | 13531 |
| 400 | Ga0207645_10052048 | 3300025907 | Bacteria | 2616 |
| 401 | Ga0207645_10146441 | 3300025907 | Bacteria | 1540 |
| 402 | Ga0207645_10192847 | 3300025907 | Archaea | 1339 |
| 403 | Ga0207643_10000206 | 3300025908 | Bacteria | 41162 |
| 404 | Ga0207643_10091798 | 3300025908 | Bacteria | 1771 |
| 405 | Ga0207643_10206907 | 3300025908 | Bacteria | 1197 |
| 406 | Ga0207705_10384792 | 3300025909 | Bacteria | 1084 |
| 407 | Ga0207684_10013827 | 3300025910 | Bacteria | 6971 |
| 408 | Ga0207684_10290102 | 3300025910 | Bacteria | 1411 |
| 409 | Ga0207707_10021032 | 3300025912 | Bacteria | 5699 |
| 410 | Ga0207695_10004136 | 3300025913 | Bacteria | 19925 |
| 411 | Ga0207671_10004715 | 3300025914 | Bacteria | 12884 |
| 412 | Ga0207671_10188441 | 3300025914 | Bacteria | 1608 |
| 413 | Ga0207693_10001211 | 3300025915 | Bacteria | 23008 |
| 414 | Ga0207662_10000767 | 3300025918 | Bacteria | 14737 |
| 415 | Ga0207657_10006323 | 3300025919 | Bacteria | 12307 |
| 416 | Ga0207657_10080921 | 3300025919 | Bacteria | 2729 |
| 417 | Ga0207657_10456161 | 3300025919 | Unclassified | 1003 |
| 418 | Ga0207649_10037376 | 3300025920 | Bacteria | 2933 |
| 419 | Ga0207649_10046760 | 3300025920 | Bacteria | 2660 |
| 420 | Ga0207646_10002427 | 3300025922 | Bacteria | 22002 |
| 421 | Ga0207646_10097589 | 3300025922 | Bacteria | 2633 |
| 422 | Ga0207681_10012555 | 3300025923 | Bacteria | 5229 |
| 423 | Ga0207681_10049274 | 3300025923 | Bacteria | 2847 |
| 424 | Ga0207681_10127492 | 3300025923 | Bacteria | 1876 |
| 425 | Ga0207694_10020816 | 3300025924 | Bacteria | 4965 |
| 426 | Ga0207694_10120076 | 3300025924 | Bacteria | 2098 |
| 427 | Ga0207694_10524391 | 3300025924 | Bacteria | 993 |
| 428 | Ga0207650_10004823 | 3300025925 | Bacteria | 9214 |
| 429 | Ga0207650_10005403 | 3300025925 | Bacteria | 8719 |
| 430 | Ga0207650_10006752 | 3300025925 | Bacteria | 7824 |
| 431 | Ga0207650_10024908 | 3300025925 | Unclassified | 4259 |
| 432 | Ga0207650_10026758 | 3300025925 | Bacteria | 4119 |
| 433 | Ga0207650_10034009 | 3300025925 | Bacteria | 3695 |
| 434 | Ga0207650_10045117 | 3300025925 | Bacteria | 3243 |
| 435 | Ga0207650_10216269 | 3300025925 | Bacteria | 1541 |
| 436 | Ga0207650_10253759 | 3300025925 | Bacteria | 1425 |
| 437 | Ga0207659_10002376 | 3300025926 | Bacteria | 11206 |
| 438 | Ga0207659_10002578 | 3300025926 | Bacteria | 10795 |
| 439 | Ga0207659_10009413 | 3300025926 | Bacteria | 6103 |
| 440 | Ga0207659_10173235 | 3300025926 | Bacteria | 1704 |
| 441 | Ga0207687_10001135 | 3300025927 | Bacteria | 18126 |
| 442 | Ga0207700_10000235 | 3300025928 | Bacteria | 33272 |
| 443 | Ga0207664_10174274 | 3300025929 | Bacteria | 1843 |
| 444 | Ga0207664_10566084 | 3300025929 | Unclassified | 1020 |
| 445 | Ga0207644_10003360 | 3300025931 | Bacteria | 10327 |
| 446 | Ga0207644_10008381 | 3300025931 | Bacteria | 6765 |
| 447 | Ga0207644_10014036 | 3300025931 | Bacteria | 5355 |
| 448 | Ga0207644_10021100 | 3300025931 | Bacteria | 4435 |
| 449 | Ga0207644_10150955 | 3300025931 | Bacteria | 1798 |
| 450 | Ga0207644_10168365 | 3300025931 | Bacteria | 1709 |
| 451 | Ga0207644_10185059 | 3300025931 | Bacteria | 1635 |
| 452 | Ga0207690_10002549 | 3300025932 | Bacteria | 11009 |
| 453 | Ga0207690_10096180 | 3300025932 | Bacteria | 2105 |
| 454 | Ga0207706_10002273 | 3300025933 | Bacteria | 18759 |
| 455 | Ga0207706_10009405 | 3300025933 | Bacteria | 8972 |
| 456 | Ga0207706_10117803 | 3300025933 | Bacteria | 2336 |
| 457 | Ga0207706_10173396 | 3300025933 | Bacteria | 1895 |
| 458 | Ga0207686_10017717 | 3300025934 | Bacteria | 4017 |
| 459 | Ga0207686_10086001 | 3300025934 | Bacteria | 2064 |
| 460 | Ga0207670_10047165 | 3300025936 | Bacteria | 2867 |
| 461 | Ga0207669_10069012 | 3300025937 | Bacteria | 2210 |
| 462 | Ga0207704_10018377 | 3300025938 | Bacteria | 3648 |
| 463 | Ga0207665_10320282 | 3300025939 | Bacteria | 1163 |
| 464 | Ga0207691_10003525 | 3300025940 | Bacteria | 15222 |
| 465 | Ga0207691_10027310 | 3300025940 | Bacteria | 5352 |
| 466 | Ga0207691_10028623 | 3300025940 | Bacteria | 5216 |
| 467 | Ga0207691_10175562 | 3300025940 | Bacteria | 1874 |
| 468 | Ga0207691_10274880 | 3300025940 | Bacteria | 1450 |
| 469 | Ga0207711_10000875 | 3300025941 | Bacteria | 29095 |
| 470 | Ga0207711_10008854 | 3300025941 | Bacteria | 8415 |
| 471 | Ga0207711_10047956 | 3300025941 | Bacteria | 3654 |
| 472 | Ga0207711_10067034 | 3300025941 | Bacteria | 3106 |
| 473 | Ga0207711_10067232 | 3300025941 | Bacteria | 3102 |
| 474 | Ga0207711_10086347 | 3300025941 | Bacteria | 2751 |
| 475 | Ga0207711_10461545 | 3300025941 | Bacteria | 1183 |
| 476 | Ga0207711_10531523 | 3300025941 | Bacteria | 1097 |
| 477 | Ga0207689_10000368 | 3300025942 | Bacteria | 42563 |
| 478 | Ga0207689_10000680 | 3300025942 | Bacteria | 32454 |
| 479 | Ga0207689_10001762 | 3300025942 | Bacteria | 20417 |
| 480 | Ga0207689_10017656 | 3300025942 | Bacteria | 6031 |
| 481 | Ga0207689_10216603 | 3300025942 | Bacteria | 1582 |
| 482 | Ga0207661_10043675 | 3300025944 | Bacteria | 3538 |
| 483 | Ga0207679_10010864 | 3300025945 | Bacteria | 5870 |
| 484 | Ga0207679_10055416 | 3300025945 | Bacteria | 2922 |
| 485 | Ga0207679_10195594 | 3300025945 | Bacteria | 1685 |
| 486 | Ga0207651_10018141 | 3300025960 | Bacteria | 4180 |
| 487 | Ga0207651_10198094 | 3300025960 | Bacteria | 1607 |
| 488 | Ga0207651_10207870 | 3300025960 | Bacteria | 1573 |
| 489 | Ga0207651_10215563 | 3300025960 | Bacteria | 1548 |
| 490 | Ga0207712_10006888 | 3300025961 | Bacteria | 7175 |
| 491 | Ga0207712_10037084 | 3300025961 | Bacteria | 3324 |
| 492 | Ga0207712_10361686 | 3300025961 | Bacteria | 1209 |
| 493 | Ga0207668_10005456 | 3300025972 | Bacteria | 7489 |
| 494 | Ga0207668_10023226 | 3300025972 | Bacteria | 3982 |
| 495 | Ga0207668_10054274 | 3300025972 | Bacteria | 2781 |
| 496 | Ga0207668_10066136 | 3300025972 | Bacteria | 2561 |
| 497 | Ga0207668_10158483 | 3300025972 | Bacteria | 1761 |
| 498 | Ga0207668_10240567 | 3300025972 | Bacteria | 1464 |
| 499 | Ga0207668_10413991 | 3300025972 | Bacteria | 1143 |
| 500 | Ga0207640_10002897 | 3300025981 | Bacteria | 9209 |
| 501 | Ga0207640_10019277 | 3300025981 | Bacteria | 4027 |
| 502 | Ga0207658_10025052 | 3300025986 | Bacteria | 4175 |
| 503 | Ga0207658_10033583 | 3300025986 | Bacteria | 3661 |
| 504 | Ga0207658_10206205 | 3300025986 | Bacteria | 1644 |
| 505 | Ga0207658_10244519 | 3300025986 | Bacteria | 1522 |
| 506 | Ga0207658_10338831 | 3300025986 | Bacteria | 1306 |
| 507 | Ga0207658_10365929 | 3300025986 | Bacteria | 1259 |
| 508 | Ga0207658_10402473 | 3300025986 | Bacteria | 1203 |
| 509 | Ga0207677_10000161 | 3300026023 | Bacteria | 53405 |
| 510 | Ga0207677_10033421 | 3300026023 | Bacteria | 3319 |
| 511 | Ga0207703_10001193 | 3300026035 | Bacteria | 24452 |
| 512 | Ga0207703_10002912 | 3300026035 | Bacteria | 14571 |
| 513 | Ga0207703_10005544 | 3300026035 | Bacteria | 10129 |
| 514 | Ga0207703_10021058 | 3300026035 | Bacteria | 5102 |
| 515 | Ga0207703_10045656 | 3300026035 | Bacteria | 3525 |
| 516 | Ga0207703_10225661 | 3300026035 | Bacteria | 1677 |
| 517 | Ga0207703_10282288 | 3300026035 | Bacteria | 1508 |
| 518 | Ga0207639_10002618 | 3300026041 | Bacteria | 12072 |
| 519 | Ga0207639_10070923 | 3300026041 | Bacteria | 2724 |
| 520 | Ga0207639_10112320 | 3300026041 | Bacteria | 2223 |
| 521 | Ga0207639_10136167 | 3300026041 | Bacteria | 2040 |
| 522 | Ga0207639_10582482 | 3300026041 | Bacteria | 1030 |
| 523 | Ga0207678_10001429 | 3300026067 | Bacteria | 21902 |
| 524 | Ga0207678_10019090 | 3300026067 | Bacteria | 6019 |
| 525 | Ga0207708_10000801 | 3300026075 | Bacteria | 23675 |
| 526 | Ga0207708_10313202 | 3300026075 | Bacteria | 1279 |
| 527 | Ga0207702_10002331 | 3300026078 | Bacteria | 18139 |
| 528 | Ga0207702_10414299 | 3300026078 | Bacteria | 1302 |
| 529 | Ga0207641_10003390 | 3300026088 | Bacteria | 14137 |
| 530 | Ga0207641_10017311 | 3300026088 | Bacteria | 5899 |
| 531 | Ga0207641_10023876 | 3300026088 | Bacteria | 5040 |
| 532 | Ga0207641_10029023 | 3300026088 | Bacteria | 4573 |
| 533 | Ga0207641_10062590 | 3300026088 | Bacteria | 3176 |
| 534 | Ga0207641_10075154 | 3300026088 | Bacteria | 2917 |
| 535 | Ga0207641_10112795 | 3300026088 | Bacteria | 2413 |
| 536 | Ga0207641_10218908 | 3300026088 | Bacteria | 1764 |
| 537 | Ga0207641_10237818 | 3300026088 | Bacteria | 1696 |
| 538 | Ga0207641_10321739 | 3300026088 | Bacteria | 1467 |
| 539 | Ga0207641_10343396 | 3300026088 | Bacteria | 1421 |
| 540 | Ga0207641_10450222 | 3300026088 | Unclassified | 1244 |
| 541 | Ga0207641_10871314 | 3300026088 | Bacteria | 893 |
| 542 | Ga0207648_10001630 | 3300026089 | Bacteria | 24588 |
| 543 | Ga0207648_10001959 | 3300026089 | Bacteria | 22498 |
| 544 | Ga0207648_10004070 | 3300026089 | Bacteria | 15160 |
| 545 | Ga0207676_10001760 | 3300026095 | Bacteria | 15873 |
| 546 | Ga0207676_10008040 | 3300026095 | Bacteria | 7499 |
| 547 | Ga0207676_10046754 | 3300026095 | Bacteria | 3350 |
| 548 | Ga0207676_10061313 | 3300026095 | Bacteria | 2977 |
| 549 | Ga0207676_10100434 | 3300026095 | Bacteria | 2397 |
| 550 | Ga0207676_10571086 | 3300026095 | Bacteria | 1083 |
| 551 | Ga0207674_10003863 | 3300026116 | Bacteria | 18259 |
| 552 | Ga0207674_10177407 | 3300026116 | Bacteria | 2083 |
| 553 | Ga0207675_100000757 | 3300026118 | Bacteria | 32124 |
| 554 | Ga0207675_100005312 | 3300026118 | Bacteria | 12380 |
| 555 | Ga0207675_100129459 | 3300026118 | Bacteria | 2393 |
| 556 | Ga0207675_100170319 | 3300026118 | Bacteria | 2081 |
| 557 | Ga0207675_100267936 | 3300026118 | Bacteria | 1657 |
| 558 | Ga0207675_100362239 | 3300026118 | Bacteria | 1423 |
| 559 | Ga0207683_10009125 | 3300026121 | Bacteria | 8452 |
| 560 | Ga0207683_10054944 | 3300026121 | Bacteria | 3492 |
| 561 | Ga0207683_10206189 | 3300026121 | Bacteria | 1788 |
| 562 | Ga0207698_10024708 | 3300026142 | Bacteria | 4222 |
| 563 | Ga0207698_10062152 | 3300026142 | Bacteria | 2915 |
| 564 | Ga0207698_10136138 | 3300026142 | Bacteria | 2108 |
| 565 | Ga0209179_1000003 | 3300027512 | Bacteria | 121837 |
| 566 | Ga0268266_10005673 | 3300028379 | Bacteria | 11577 |
| 567 | Ga0268266_10170633 | 3300028379 | Bacteria | 1974 |
| 568 | Ga0268266_10210710 | 3300028379 | Bacteria | 1782 |
| 569 | Ga0268266_10304527 | 3300028379 | Bacteria | 1487 |
| 570 | Ga0268265_10044878 | 3300028380 | Bacteria | 3294 |
| 571 | Ga0268265_10049853 | 3300028380 | Bacteria | 3151 |
| 572 | Ga0268265_10088527 | 3300028380 | Bacteria | 2467 |
| 573 | Ga0268265_10332070 | 3300028380 | Bacteria | 1381 |
| 574 | Ga0268264_10000258 | 3300028381 | Bacteria | 95778 |
| 575 | Ga0268264_10003622 | 3300028381 | Bacteria | 13287 |
| 576 | Ga0268264_10009768 | 3300028381 | Bacteria | 7944 |
| 577 | Ga0268264_10122032 | 3300028381 | Bacteria | 2298 |
| 578 | Ga0307517_10004509 | 3300028786 | Bacteria | 21378 |
| 579 | Ga0307517_10216160 | 3300028786 | Bacteria | 1172 |
| 580 | Ga0307515_10001016 | 3300028794 | Bacteria | 64080 |
| 581 | Ga0307515_10053221 | 3300028794 | Bacteria | 5979 |
| 582 | Ga0307515_10164980 | 3300028794 | Bacteria | 2238 |
| 583 | Ga0307511_10001781 | 3300030521 | Bacteria | 22660 |
| 584 | Ga0307511_10068034 | 3300030521 | Bacteria | 2635 |
| 585 | Ga0307512_10005868 | 3300030522 | Bacteria | 12635 |
| 586 | Ga0265328_10001761 | 3300031239 | Bacteria | 9905 |
| 587 | Ga0265316_10234693 | 3300031344 | Bacteria | 1350 |
| 588 | Ga0307513_10000922 | 3300031456 | Bacteria | 42476 |
| 589 | Ga0307513_10004915 | 3300031456 | Bacteria | 17749 |
| 590 | Ga0307513_10125622 | 3300031456 | Bacteria | 2521 |
| 591 | Ga0307509_10000001 | 3300031507 | Bacteria | 629324 |
| 592 | Ga0307509_10002304 | 3300031507 | Bacteria | 31126 |
| 593 | Ga0307509_10003211 | 3300031507 | Bacteria | 25285 |
| 594 | Ga0307509_10006141 | 3300031507 | Bacteria | 16291 |
| 595 | Ga0307509_10194056 | 3300031507 | Bacteria | 1877 |
| 596 | Ga0307408_100006738 | 3300031548 | Bacteria | 7613 |
| 597 | Ga0307408_100117948 | 3300031548 | Bacteria | 2051 |
| 598 | Ga0307508_10000016 | 3300031616 | Bacteria | 206976 |
| 599 | Ga0307508_10016926 | 3300031616 | Bacteria | 6633 |
| 600 | Ga0307508_10293775 | 3300031616 | Bacteria | 1218 |
| 601 | Ga0307514_10001309 | 3300031649 | Bacteria | 31946 |
| 602 | Ga0307514_10025688 | 3300031649 | Bacteria | 4765 |
| 603 | Ga0316576_10036226 | 3300031727 | Bacteria | 3527 |
| 604 | Ga0307516_10134544 | 3300031730 | Bacteria | 2248 |
| 605 | Ga0307406_10034132 | 3300031901 | Bacteria | 3119 |
| 606 | Ga0307406_10380361 | 3300031901 | Bacteria | 1113 |
| 607 | Ga0307412_10500034 | 3300031911 | Bacteria | 1012 |
| 608 | Ga0307409_100120784 | 3300031995 | Bacteria | 2218 |
| 609 | Ga0307416_100108583 | 3300032002 | Bacteria | 2438 |
| 610 | Ga0307416_100258741 | 3300032002 | Bacteria | 1700 |
| 611 | Ga0307414_10161151 | 3300032004 | Bacteria | 1782 |
| 612 | Ga0307507_10161654 | 3300033179 | Bacteria | 1653 |
| 613 | Ga0307510_10000016 | 3300033180 | Bacteria | 206932 |
| 614 | Ga0307510_10000568 | 3300033180 | Bacteria | 37247 |
| 615 | Ga0307510_10012936 | 3300033180 | Bacteria | 9905 |
| 616 | Ga0373926_0064143 | 3300035083 | Bacteria | 1342 |
| 617 | Ga0373928_0016749 | 3300035084 | Bacteria | 1502 |
| 618 | Ga0373936_0004753 | 3300035113 | Bacteria | 5130 |
| 619 | Ga0373936_0018803 | 3300035113 | Bacteria | 2672 |
| 620 | Ga0373936_0116958 | 3300035113 | Bacteria | 1136 |
| 621 | Ga0373953_0067817 | 3300035117 | Bacteria | 1468 |
| 622 | Ga0373953_0137270 | 3300035117 | Bacteria | 1045 |
| 623 | Ga0373956_0103046 | 3300035119 | Bacteria | 1325 |
| 624 | Ga0373943_0013281 | 3300035170 | Bacteria | 3718 |
| 625 | Ga0373943_0078450 | 3300035170 | Bacteria | 1688 |
| 626 | Ga0373943_0191353 | 3300035170 | Bacteria | 1129 |
| 627 | Ga0373955_0141964 | 3300035172 | Bacteria | 1409 |
| 628 | Ga0373931_0006871 | 3300035691 | Bacteria | 5350 |
| 629 | Ga0373935_0053884 | 3300035692 | Bacteria | 2560 |
| 630 | Ga0373927_0010403 | 3300035695 | Bacteria | 6206 |
| 631 | Ga0373927_0034726 | 3300035695 | Bacteria | 3279 |
| 632 | Ga0373927_0088882 | 3300035695 | Bacteria | 2006 |
| 633 | Ga0373937_0011674 | 3300036401 | Bacteria | 7706 |
| 634 | Ga0373937_0028315 | 3300036401 | Bacteria | 5069 |
| 635 | Ga0373937_0083406 | 3300036401 | Bacteria | 2957 |
| 636 | Ga0373937_0146815 | 3300036401 | Bacteria | 2208 |
| 637 | Ga0373937_0284079 | 3300036401 | Bacteria | 1563 |
| 638 | Ga0316582_0094925 | 3300036647 | Bacteria | 1968 |
| 639 | Ga0373925_0002445 | 3300037068 | Bacteria | 14880 |
| 640 | Ga0373925_0005322 | 3300037068 | Bacteria | 9605 |
| 641 | Ga0373925_0142682 | 3300037068 | Bacteria | 1875 |
| 642 | Ga0373925_0200341 | 3300037068 | Bacteria | 1587 |
| 643 | Ga0395905_0149896 | 3300037471 | Bacteria | 2194 |
| 644 | Ga0436364_0547719 | 3300037853 | Bacteria | 1145 |
| 645 | Ga0436365_1602820 | 3300039437 | Bacteria | 7901 |
| 646 | Ga0436361_0553303 | 3300039447 | Bacteria | 4625 |
| 647 | Ga0436361_1056758 | 3300039447 | Bacteria | 10385 |
| 648 | Ga0436362_0168894 | 3300039453 | Bacteria | 1660 |
| 649 | Ga0451802_0976333 | 3300041460 | Bacteria | 1017 |
| 650 | Ga0451853_0743422 | 3300041512 | Bacteria | 1483 |
| 651 | Ga0451577_0381942 | 3300042876 | Bacteria | 1278 |
| 652 | Ga0453684_0012382 | 3300044712 | Bacteria | 14081 |
| 653 | Ga0451576_0006570 | 3300045051 | Bacteria | 14226 |
| 654 | Ga0495592_0000213 | 3300046454 | Bacteria | 49631 |
| 655 | Ga0495629_0243276 | 3300046459 | Bacteria | 1238 |
| 656 | Ga0495580_0006680 | 3300046472 | Bacteria | 9364 |
| 657 | Ga0495580_0089445 | 3300046472 | Bacteria | 2144 |
| 658 | Ga0495580_0092904 | 3300046472 | Bacteria | 2100 |
| 659 | Ga0495582_0006300 | 3300046473 | Bacteria | 6603 |
| 660 | Ga0495639_0001129 | 3300046475 | Bacteria | 12056 |
| 661 | Ga0495664_0012864 | 3300046477 | Bacteria | 4741 |
| 662 | Ga0495610_0006121 | 3300046512 | Bacteria | 8389 |
| 663 | Ga0495618_0228327 | 3300046514 | Bacteria | 1173 |
| 664 | Ga0495620_0022462 | 3300046515 | Bacteria | 3037 |
| 665 | Ga0495628_0065184 | 3300046516 | Bacteria | 2851 |
| 666 | Ga0495628_0104418 | 3300046516 | Bacteria | 2184 |
| 667 | Ga0495628_0296422 | 3300046516 | Bacteria | 1198 |
| 668 | Ga0495630_0128688 | 3300046517 | Bacteria | 1922 |
| 669 | Ga0495631_0085017 | 3300046518 | Bacteria | 1363 |
| 670 | Ga0495632_0049207 | 3300046519 | Bacteria | 2084 |
| 671 | Ga0495648_0037763 | 3300046524 | Bacteria | 3099 |
| 672 | Ga0495648_0056842 | 3300046524 | Bacteria | 2351 |
| 673 | Ga0495640_0194584 | 3300046533 | Bacteria | 1288 |
| 674 | Ga0495586_0082591 | 3300046535 | Bacteria | 1767 |
| 675 | Ga0495587_0143098 | 3300046536 | Bacteria | 1364 |
| 676 | Ga0495609_0048923 | 3300046538 | Bacteria | 1888 |
| 677 | Ga0495621_0014269 | 3300046539 | Bacteria | 2512 |
| 678 | Ga0495645_0008744 | 3300046543 | Bacteria | 7071 |
| 679 | Ga0495645_0180266 | 3300046543 | Bacteria | 1448 |
| 680 | Ga0495667_0103985 | 3300046559 | Bacteria | 1836 |
| 681 | Ga0495634_0243949 | 3300046642 | Bacteria | 1101 |
| 682 | Ga0495611_0021683 | 3300046648 | Bacteria | 2776 |
| 683 | Ga0495625_0086310 | 3300046660 | Bacteria | 2177 |
| 684 | Ga0495635_0001307 | 3300046663 | Bacteria | 16596 |
| 685 | Ga0495588_0138147 | 3300046674 | Bacteria | 1287 |
| 686 | Ga0495657_0091419 | 3300046675 | Bacteria | 1952 |
| 687 | Ga0495647_0016198 | 3300046681 | Bacteria | 2621 |
| 688 | Ga0495658_0385623 | 3300046683 | Bacteria | 892 |
| 689 | Ga0495613_0009009 | 3300046689 | Bacteria | 7404 |
| 690 | Ga0495613_0132690 | 3300046689 | Bacteria | 1783 |
| 691 | Ga0495649_0001371 | 3300046694 | Bacteria | 18487 |
| 692 | Ga0495600_0105695 | 3300046809 | Bacteria | 1834 |
| 693 | Ga0495660_0008413 | 3300046810 | Bacteria | 6039 |
| 694 | Ga0495581_0003182 | 3300047315 | Bacteria | 9396 |
| 695 | Ga0495604_0128897 | 3300047317 | Bacteria | 1821 |
| 696 | Ga0495676_0061762 | 3300047321 | Bacteria | 2929 |
| 697 | Ga0495680_0041057 | 3300047322 | Bacteria | 3680 |
| 698 | Ga0495687_021846 | 3300047443 | Bacteria | 3084 |
| 699 | Ga0495687_060153 | 3300047443 | Bacteria | 1568 |
| 700 | Ga0495675_0098967 | 3300047444 | Bacteria | 1826 |
| 701 | Ga0495684_0080209 | 3300047471 | Bacteria | 2477 |
| 702 | Ga0495686_0019493 | 3300047472 | Bacteria | 4531 |
| 703 | Ga0495602_0287227 | 3300048088 | Bacteria | 1209 |
| 704 | Ga0496100_0196506 | 3300048903 | Bacteria | 1468 |
| 705 | Ga0496101_0059872 | 3300048904 | Bacteria | 2761 |
| 706 | Ga0496101_0193331 | 3300048904 | Bacteria | 1571 |
| 707 | Ga0496102_0023903 | 3300048905 | Bacteria | 5432 |
| 708 | Ga0496102_0268441 | 3300048905 | Bacteria | 1609 |
| 709 | Ga0496102_0399500 | 3300048905 | Bacteria | 1292 |
| 710 | Ga0496102_0438507 | 3300048905 | Bacteria | 1226 |
| 711 | Ga0496104_0017893 | 3300048907 | Bacteria | 6461 |
| 712 | Ga0496104_0191588 | 3300048907 | Bacteria | 1956 |
| 713 | Ga0496104_0261726 | 3300048907 | Bacteria | 1642 |
| 714 | Ga0496106_0004160 | 3300048909 | Bacteria | 10784 |
| 715 | Ga0496106_0085083 | 3300048909 | Bacteria | 2434 |
| 716 | Ga0496107_0001689 | 3300048910 | Bacteria | 13821 |
| 717 | Ga0496107_0100898 | 3300048910 | Bacteria | 2116 |
| 718 | Ga0496108_0011827 | 3300048911 | Bacteria | 7101 |
| 719 | Ga0496108_0174692 | 3300048911 | Bacteria | 1859 |
| 720 | Ga0496108_0202562 | 3300048911 | Bacteria | 1722 |
| 721 | Ga0496108_0442035 | 3300048911 | Bacteria | 1136 |
| 722 | Ga0496109_0018702 | 3300048912 | Bacteria | 6091 |
| 723 | Ga0496109_0099189 | 3300048912 | Bacteria | 2701 |
| 724 | Ga0496110_0005186 | 3300048913 | Bacteria | 10192 |
| 725 | Ga0496110_0012457 | 3300048913 | Bacteria | 6993 |
| 726 | Ga0496110_0290877 | 3300048913 | Bacteria | 1488 |
| 727 | Ga0496112_0006113 | 3300048915 | Bacteria | 10523 |
| 728 | Ga0496112_0028502 | 3300048915 | Bacteria | 5391 |
| 729 | Ga0496113_0281011 | 3300048916 | Bacteria | 1331 |
| 730 | Ga0496119_0003074 | 3300048922 | Bacteria | 17624 |
| 731 | Ga0496120_0000146 | 3300048923 | Bacteria | 119164 |
| 732 | Ga0496120_0080131 | 3300048923 | Bacteria | 1771 |
| 733 | Ga0496121_0001394 | 3300048924 | Bacteria | 40889 |
| 734 | Ga0496122_0018855 | 3300048925 | Bacteria | 6341 |
| 735 | Ga0496123_0003048 | 3300048926 | Bacteria | 19280 |
| 736 | Ga0496125_0002028 | 3300048928 | Bacteria | 27433 |
| 737 | Ga0496125_0022664 | 3300048928 | Bacteria | 5825 |
| 738 | Ga0496125_0034598 | 3300048928 | Bacteria | 4450 |
| 739 | Ga0496125_0151092 | 3300048928 | Bacteria | 1595 |
| 740 | Ga0496126_0230752 | 3300048929 | Bacteria | 1551 |
| 741 | Ga0495682_0085515 | 3300049460 | Bacteria | 1133 |
| 742 | Ga0501034_0582112 | 3300049571 | Bacteria | 1026 |
| 743 | Ga0501034_0606213 | 3300049571 | Bacteria | 1000 |
| 744 | Ga0501036_0059648 | 3300049572 | Bacteria | 3233 |
| 745 | Ga0501037_0070807 | 3300049573 | Bacteria | 2537 |
| 746 | Ga0501038_0067831 | 3300049574 | Bacteria | 3034 |
| 747 | Ga0501038_0375826 | 3300049574 | Bacteria | 1103 |
| 748 | Ga0501039_0022919 | 3300049575 | Bacteria | 4790 |
| 749 | Ga0501042_0029607 | 3300049578 | Bacteria | 3862 |
| 750 | Ga0501043_0366325 | 3300049579 | Bacteria | 1093 |
| 751 | Ga0501047_0002078 | 3300049581 | Bacteria | 19164 |
| 752 | Ga0501047_0169468 | 3300049581 | Bacteria | 2053 |
| 753 | Ga0501069_0011576 | 3300049585 | Bacteria | 4675 |
| 754 | Ga0501070_0132545 | 3300049586 | Bacteria | 2058 |
| 755 | Ga0501075_0400538 | 3300049591 | Bacteria | 1046 |
| 756 | Ga0501077_0164766 | 3300049593 | Bacteria | 1408 |
| 757 | Ga0501035_0144846 | 3300049822 | Bacteria | 2064 |
| 758 | Ga0501035_0155500 | 3300049822 | Bacteria | 1982 |
| 759 | Ga0501035_0206100 | 3300049822 | Bacteria | 1684 |
| 760 | Ga0501045_0131533 | 3300049824 | Bacteria | 1860 |
| 761 | nmdc:mga0k408_2913_c1 | 3300050493 | Bacteria | 9066 |
| 762 | nmdc:mga07m45_416_c1 | 3300050496 | Bacteria | 17644 |
| 763 | nmdc:mga05p37_433905_c1 | 3300050507 | Bacteria | 1525 |
| 764 | nmdc:mga05p37_660958_c1 | 3300050507 | Bacteria | 1168 |
| 765 | nmdc:mga08y16_380282_c1 | 3300050511 | Bacteria | 1447 |
| 766 | nmdc:mga0a205_9126_c1 | 3300050515 | Bacteria | 9051 |
| 767 | Ga0495601_0294884 | 3300053077 | Bacteria | 1057 |
| 768 | Ga0495612_0031459 | 3300053078 | Bacteria | 2140 |
| 769 | Ga0495619_0010046 | 3300053085 | Bacteria | 5958 |
| 770 | Ga0500644_0006593 | 3300053088 | Bacteria | 2983 |
| 771 | Ga0500566_0182051 | 3300053094 | Bacteria | 1077 |
| 772 | Ga0500650_0089437 | 3300053098 | Bacteria | 1441 |
| 773 | Ga0500556_0000018 | 3300053104 | Bacteria | 188459 |
| 774 | Ga0500593_005348 | 3300053117 | Bacteria | 5049 |
| 775 | Ga0500595_040266 | 3300053119 | Bacteria | 1508 |
| 776 | Ga0500614_032984 | 3300053123 | Bacteria | 1277 |
| 777 | Ga0500618_024392 | 3300053125 | Bacteria | 1457 |
| 778 | Ga0500559_0000236 | 3300053136 | Bacteria | 43881 |
| 779 | Ga0500568_0014028 | 3300053139 | Bacteria | 3632 |
| 780 | Ga0500619_019941 | 3300053154 | Bacteria | 1908 |
| 781 | Ga0500622_0017749 | 3300053156 | Bacteria | 3785 |
| 782 | Ga0500630_060302 | 3300053159 | Bacteria | 1814 |
| 783 | Ga0500637_0007664 | 3300053178 | Bacteria | 5412 |
| 784 | Ga0500645_000596 | 3300053730 | Bacteria | 23287 |
| 785 | Ga0500645_001816 | 3300053730 | Bacteria | 10220 |
| 786 | Ga0500645_018580 | 3300053730 | Bacteria | 2170 |
| 787 | Ga0500661_013176 | 3300055283 | Bacteria | 1490 |
| 788 | 2508727656 | 2508501050 | Bacteria | 9633614 |
| 789 | 2509077358 | 2508501114 | Bacteria | 7082538 |
| 790 | 2510843636 | 2510461069 | Bacteria | 5505000 |
| 791 | 2511243004 | 2511231002 | Bacteria | 5042903 |
| 792 | 2774869158 | 2773857925 | Bacteria | 6472445 |
| 793 | 2776258384 | 2775506901 | Bacteria | 9631051 |
| 794 | 2835317460 | 2835312727 | Bacteria | 7413381 |
| 795 | 2837652039 | 2837651117 | Bacteria | 3772164 |
| 796 | 2837680040 | 2837678835 | Bacteria | 5252418 |
| 797 | 2840882090 | 2840878972 | Bacteria | 5483153 |
| 798 | 2882457612 | 2882456835 | Bacteria | 6863978 |
| 799 | 2884301219 | 2884298095 | Bacteria | 3823049 |
| 800 | 2894236163 | 2894232714 | Bacteria | 8834183 |
| 801 | 2899804768 | 2899803654 | Bacteria | 5577784 |
| 802 | 2919707739 | 2919704043 | Bacteria | 5560311 |
| 803 | 2989354410 | 2989349275 | Bacteria | 6349068 |
| 804 | 8054566951 | 8054563764 | Bacteria | 5592885 |
| 805 | Ga0373937_0120821 | |||
| 806 | JGI24740J21852_10038698 | |||
| 807 | JGI25155J39150_1000104 | |||
| 808 | JGI25156J39149_1000089 | |||
| 809 | JGI25154J39366_1000115 | |||
| 810 | JGI25157J39369_1000118 | |||
| 811 | JGI25159J45721_1006856 | |||
| 812 | JGI25159J45721_1007148 | |||
| 813 | JGI25151J46595_10018037 | |||
| 814 | rootH1_10104496 | |||
| 815 | rootH1_10122896 | |||
| 816 | JGI25160J50197_1000281 | |||
| 817 | JGI25161J50226_1000124 | |||
| 818 | JGI25161J50226_1000228 | |||
| 819 | Ga0055537_1000218 | |||
| 820 | Ga0055524_1000119 | |||
| 821 | Ga0055536_1005225 | |||
| 822 | Ga0055534_1003730 | |||
| 823 | Ga0055530_10000322 | |||
| 824 | Ga0055540_1000058 | |||
| 825 | Ga0055531_10009332 | |||
| 826 | Ga0055543_1001000 | |||
| 827 | Ga0065715_10099762 | |||
| 828 | Ga0065715_10147158 | |||
| 829 | Ga0070676_10003660 | |||
| 830 | Ga0070676_10034239 | |||
| 831 | Ga0070676_10309324 | |||
| 832 | Ga0070683_100004502 | |||
| 833 | Ga0070690_100003236 | |||
| 834 | Ga0070690_100040565 | |||
| 835 | Ga0070690_100122346 | |||
| 836 | Ga0070670_100004913 | |||
| 837 | Ga0070670_100022011 | |||
| 838 | Ga0070670_100030016 | |||
| 839 | Ga0070670_100036607 | |||
| 840 | Ga0070670_100060219 | |||
| 841 | Ga0070670_100155119 | |||
| 842 | Ga0070670_100178796 | |||
| 843 | Ga0070670_100270446 | |||
| 844 | Ga0070677_10110452 | |||
| 845 | Ga0068869_100000933 | |||
| 846 | Ga0068869_100003186 | |||
| 847 | Ga0068869_100010839 | |||
| 848 | Ga0070666_10049714 | |||
| 849 | Ga0070666_10055020 | |||
| 850 | Ga0070666_10065337 | |||
| 851 | Ga0070666_10067255 | |||
| 852 | Ga0070666_10147063 | |||
| 853 | Ga0070666_10154017 | |||
| 854 | Ga0070666_10226210 | |||
| 855 | Ga0068868_100000470 | |||
| 856 | Ga0068868_100007161 | |||
| 857 | Ga0068868_100121216 | |||
| 858 | Ga0070660_100036746 | |||
| 859 | Ga0070689_100014621 | |||
| 860 | Ga0070689_100236119 | |||
| 861 | Ga0070689_100241066 | |||
| 862 | Ga0070687_100094805 | |||
| 863 | Ga0070661_100003664 | |||
| 864 | Ga0070661_100006249 | |||
| 865 | Ga0070661_100047127 | |||
| 866 | Ga0070661_100335257 | |||
| 867 | Ga0070668_100011167 | |||
| 868 | Ga0070668_100015214 | |||
| 869 | Ga0070668_100015517 | |||
| 870 | Ga0070668_100072219 | |||
| 871 | Ga0070668_100431472 | |||
| 872 | Ga0070669_100010514 | |||
| 873 | Ga0070669_100137109 | |||
| 874 | Ga0070669_100198138 | |||
| 875 | Ga0070669_100257717 | |||
| 876 | Ga0070669_100272948 | |||
| 877 | Ga0070669_100368236 | |||
| 878 | Ga0070675_100036643 | |||
| 879 | Ga0070675_100042544 | |||
| 880 | Ga0070675_100259003 | |||
| 881 | Ga0070671_100032084 | |||
| 882 | Ga0070671_100032238 | |||
| 883 | Ga0070671_100032541 | |||
| 884 | Ga0070671_100035903 | |||
| 885 | Ga0070671_100038582 | |||
| 886 | Ga0070671_100049945 | |||
| 887 | Ga0070671_100063396 | |||
| 888 | Ga0070671_100179268 | |||
| 889 | Ga0070674_100015365 | |||
| 890 | Ga0070674_100147916 | |||
| 891 | Ga0070674_100487899 | |||
| 892 | Ga0070673_100008174 | |||
| 893 | Ga0070673_100008978 | |||
| 894 | Ga0070673_100012046 | |||
| 895 | Ga0070673_100083349 | |||
| 896 | Ga0070673_100223269 | |||
| 897 | Ga0070673_100247622 | |||
| 898 | Ga0070688_100027533 | |||
| 899 | Ga0070688_100222594 | |||
| 900 | Ga0070659_100002977 | |||
| 901 | Ga0070659_100129241 | |||
| 902 | Ga0070667_100002837 | |||
| 903 | Ga0070667_100005881 | |||
| 904 | Ga0070667_100044086 | |||
| 905 | Ga0070667_100068471 | |||
| 906 | Ga0070667_100167802 | |||
| 907 | Ga0070667_100220825 | |||
| 908 | Ga0070667_100353387 | |||
| 909 | Ga0070667_100397591 | |||
| 910 | Ga0070667_100603289 | |||
| 911 | Ga0070667_100621638 | |||
| 912 | Ga0070709_10002492 | |||
| 913 | Ga0070713_100000089 | |||
| 914 | Ga0070710_10000978 | |||
| 915 | Ga0070701_10231120 | |||
| 916 | Ga0070701_10244046 | |||
| 917 | Ga0070711_100004025 | |||
| 918 | Ga0070711_100079914 | |||
| 919 | Ga0070711_100124886 | |||
| 920 | Ga0070705_100096050 | |||
| 921 | Ga0070700_100324425 | |||
| 922 | Ga0070694_100152881 | |||
| 923 | Ga0070708_100000053 | |||
| 924 | Ga0070708_100146132 | |||
| 925 | Ga0070663_100000563 | |||
| 926 | Ga0070663_100094378 | |||
| 927 | Ga0070663_100341863 | |||
| 928 | Ga0070678_100078264 | |||
| 929 | Ga0070678_100100318 | |||
| 930 | Ga0070678_100104916 | |||
| 931 | Ga0070678_100156842 | |||
| 932 | Ga0070662_100000493 | |||
| 933 | Ga0070662_100098430 | |||
| 934 | Ga0070681_10012370 | |||
| 935 | Ga0068867_100002313 | |||
| 936 | Ga0068867_100392524 | |||
| 937 | Ga0070685_10001266 | |||
| 938 | Ga0070685_10007358 | |||
| 939 | Ga0070685_10185230 | |||
| 940 | Ga0070706_100020939 | |||
| 941 | Ga0070706_100024748 | |||
| 942 | Ga0070706_100366213 | |||
| 943 | Ga0070707_100025803 | |||
| 944 | Ga0070699_100402353 | |||
| 945 | Ga0070684_100022586 | |||
| 946 | Ga0070697_100037673 | |||
| 947 | Ga0068853_100003287 | |||
| 948 | Ga0068853_100289820 | |||
| 949 | Ga0068853_100322870 | |||
| 950 | Ga0068853_100554314 | |||
| 951 | Ga0068853_100588639 | |||
| 952 | Ga0070672_100003389 | |||
| 953 | Ga0070672_100016459 | |||
| 954 | Ga0070672_100026315 | |||
| 955 | Ga0070672_100122885 | |||
| 956 | Ga0070672_100237354 | |||
| 957 | Ga0070686_100001970 | |||
| 958 | Ga0070695_100001102 | |||
| 959 | Ga0070695_100083058 | |||
| 960 | Ga0070695_100181428 | |||
| 961 | Ga0070665_100003009 | |||
| 962 | Ga0070665_100003275 | |||
| 963 | Ga0070665_100014341 | |||
| 964 | Ga0070665_100043553 | |||
| 965 | Ga0070665_100049341 | |||
| 966 | Ga0070665_100237600 | |||
| 967 | Ga0070665_100503507 | |||
| 968 | Ga0070665_100582131 | |||
| 969 | Ga0070704_100029023 | |||
| 970 | Ga0068855_100003372 | |||
| 971 | Ga0068855_100096663 | |||
| 972 | Ga0070664_100003982 | |||
| 973 | Ga0068857_100092994 | |||
| 974 | Ga0068854_100004404 | |||
| 975 | Ga0068854_100010639 | |||
| 976 | Ga0068854_100055051 | |||
| 977 | Ga0068854_100180136 | |||
| 978 | Ga0068854_100293408 | |||
| 979 | Ga0068854_100509479 | |||
| 980 | Ga0068856_100000282 | |||
| 981 | Ga0068856_100114795 | |||
| 982 | Ga0068856_100290769 | |||
| 983 | Ga0070702_100005347 | |||
| 984 | Ga0070702_100036198 | |||
| 985 | Ga0068852_100000749 | |||
| 986 | Ga0068852_100071156 | |||
| 987 | Ga0068852_100076808 | |||
| 988 | Ga0068859_100000120 | |||
| 989 | Ga0068859_100005936 | |||
| 990 | Ga0068859_100007348 | |||
| 991 | Ga0068859_100035437 | |||
| 992 | Ga0068859_100046831 | |||
| 993 | Ga0068859_100052470 | |||
| 994 | Ga0068864_100004562 | |||
| 995 | Ga0068864_100007614 | |||
| 996 | Ga0068864_100008422 | |||
| 997 | Ga0068864_100014701 | |||
| 998 | Ga0068864_100023641 | |||
| 999 | Ga0068864_100086784 | |||
| 1000 | Ga0068864_100452166 | |||
| 1001 | Ga0068866_10001765 | |||
| 1002 | Ga0068866_10023812 | |||
| 1003 | Ga0068866_10154328 | |||
| 1004 | Ga0068861_100000763 | |||
| 1005 | Ga0068861_100066573 | |||
| 1006 | Ga0068861_100069249 | |||
| 1007 | Ga0068861_100272858 | |||
| 1008 | Ga0068851_10003427 | |||
| 1009 | Ga0068870_10000465 | |||
| 1010 | Ga0068870_10088440 | |||
| 1011 | Ga0068870_10173306 | |||
| 1012 | Ga0068863_100002646 | |||
| 1013 | Ga0068863_100004216 | |||
| 1014 | Ga0068863_100026191 | |||
| 1015 | Ga0068863_100095043 | |||
| 1016 | Ga0068863_100125674 | |||
| 1017 | Ga0068863_100133775 | |||
| 1018 | Ga0068863_100240775 | |||
| 1019 | Ga0068863_100530431 | |||
| 1020 | Ga0068858_100001097 | |||
| 1021 | Ga0068858_100002283 | |||
| 1022 | Ga0068858_100013852 | |||
| 1023 | Ga0068858_100020886 | |||
| 1024 | Ga0068858_100050272 | |||
| 1025 | Ga0068858_100085356 | |||
| 1026 | Ga0068858_100132554 | |||
| 1027 | Ga0068860_100002008 | |||
| 1028 | Ga0068860_100011356 | |||
| 1029 | Ga0068860_100018109 | |||
| 1030 | Ga0068860_100025768 | |||
| 1031 | Ga0068860_100194539 | |||
| 1032 | Ga0068862_100010431 | |||
| 1033 | Ga0068862_100020511 | |||
| 1034 | Ga0068862_100163744 | |||
| 1035 | Ga0068862_100174092 | |||
| 1036 | Ga0081540_1007994 | |||
| 1037 | Ga0081540_1059546 | |||
| 1038 | Ga0081539_10000004 | |||
| 1039 | Ga0070715_10043115 | |||
| 1040 | Ga0070716_100034389 | |||
| 1041 | Ga0070716_100390743 | |||
| 1042 | Ga0070712_100042431 | |||
| 1043 | Ga0075366_10024347 | |||
| 1044 | Ga0075366_10103195 | |||
| 1045 | Ga0097621_100133962 | |||
| 1046 | Ga0097621_100218566 | |||
| 1047 | Ga0097621_100250147 | |||
| 1048 | Ga0075370_10002093 | |||
| 1049 | Ga0068871_100097933 | |||
| 1050 | Ga0075428_100083500 | |||
| 1051 | Ga0075433_10061907 | |||
| 1052 | Ga0075434_100404126 | |||
| 1053 | Ga0068865_100025970 | |||
| 1054 | Ga0068865_100250079 | |||
| 1055 | Ga0068865_100271951 | |||
| 1056 | Ga0097620_100000120 | |||
| 1057 | Ga0097620_100005938 | |||
| 1058 | Ga0097620_100007347 | |||
| 1059 | Ga0097620_100035434 | |||
| 1060 | Ga0097620_100046835 | |||
| 1061 | Ga0097620_100052471 | |||
| 1062 | Ga0079104_1018973 | |||
| 1063 | Ga0075435_100212434 | |||
| 1064 | Ga0099794_10020562 | |||
| 1065 | Ga0099795_10000002 | |||
| 1066 | Ga0105240_10023285 | |||
| 1067 | Ga0105240_10033897 | |||
| 1068 | Ga0111539_10439152 | |||
| 1069 | Ga0105245_10001088 | |||
| 1070 | Ga0105245_10213105 | |||
| 1071 | Ga0105247_10003310 | |||
| 1072 | Ga0105247_10006478 | |||
| 1073 | Ga0105247_10009360 | |||
| 1074 | Ga0105247_10190281 | |||
| 1075 | Ga0114129_10100375 | |||
| 1076 | Ga0114129_10179688 | |||
| 1077 | Ga0114129_11014234 | |||
| 1078 | Ga0105242_10007446 | |||
| 1079 | Ga0105242_10151634 | |||
| 1080 | Ga0105242_10401176 | |||
| 1081 | Ga0105242_10668393 | |||
| 1082 | Ga0105248_10000932 | |||
| 1083 | Ga0105248_10007614 | |||
| 1084 | Ga0105248_10012988 | |||
| 1085 | Ga0105248_10022317 | |||
| 1086 | Ga0105248_10358706 | |||
| 1087 | Ga0105248_10504849 | |||
| 1088 | Ga0105248_10650774 | |||
| 1089 | Ga0105248_10799851 | |||
| 1090 | Ga0105248_10897360 | |||
| 1091 | Ga0105237_10000529 | |||
| 1092 | Ga0105237_10025291 | |||
| 1093 | Ga0105237_10291255 | |||
| 1094 | Ga0105238_10001158 | |||
| 1095 | Ga0105238_10179733 | |||
| 1096 | Ga0105238_10220533 | |||
| 1097 | Ga0105238_10261123 | |||
| 1098 | Ga0105238_10672700 | |||
| 1099 | Ga0105249_10010730 | |||
| 1100 | Ga0105249_10040863 | |||
| 1101 | Ga0105249_10153769 | |||
| 1102 | Ga0105249_10299943 | |||
| 1103 | Ga0105249_10600388 | |||
| 1104 | Ga0099796_10000030 | |||
| 1105 | Ga0105239_10004965 | |||
| 1106 | Ga0105239_10238567 | |||
| 1107 | Ga0105246_10043837 | |||
| 1108 | Ga0157326_1002791 | |||
| 1109 | Ga0157373_10004123 | |||
| 1110 | Ga0157371_10002422 | |||
| 1111 | Ga0157370_10132141 | |||
| 1112 | Ga0157369_10029445 | |||
| 1113 | Ga0157369_10055066 | |||
| 1114 | Ga0157374_10357527 | |||
| 1115 | Ga0157378_10014175 | |||
| 1116 | Ga0157378_10017194 | |||
| 1117 | Ga0157378_10117243 | |||
| 1118 | Ga0163162_10002371 | |||
| 1119 | Ga0163162_10036504 | |||
| 1120 | Ga0163162_10071070 | |||
| 1121 | Ga0163162_10128514 | |||
| 1122 | Ga0163162_10262671 | |||
| 1123 | Ga0163162_10292831 | |||
| 1124 | Ga0157372_10005991 | |||
| 1125 | Ga0157372_10070381 | |||
| 1126 | Ga0157375_10034821 | |||
| 1127 | Ga0157375_10040657 | |||
| 1128 | Ga0157375_10209239 | |||
| 1129 | Ga0157375_10320504 | |||
| 1130 | Ga0157375_10788916 | |||
| 1131 | Ga0157375_11098472 | |||
| 1132 | Ga0163163_10008221 | |||
| 1133 | Ga0163163_10042194 | |||
| 1134 | Ga0163163_10382021 | |||
| 1135 | Ga0163163_10486045 | |||
| 1136 | Ga0157380_10044789 | |||
| 1137 | Ga0157380_10252684 | |||
| 1138 | Ga0157377_10001646 | |||
| 1139 | Ga0157377_10021487 | |||
| 1140 | Ga0157379_10000415 | |||
| 1141 | Ga0157379_10002404 | |||
| 1142 | Ga0157379_10006726 | |||
| 1143 | Ga0157379_10029938 | |||
| 1144 | Ga0157379_10205071 | |||
| 1145 | Ga0157379_10275882 | |||
| 1146 | Ga0157379_10406014 | |||
| 1147 | Ga0157376_10049158 | |||
| 1148 | Ga0157376_10050310 | |||
| 1149 | Ga0157376_10070733 | |||
| 1150 | Ga0157376_10104373 | |||
| 1151 | Ga0157376_10348627 | |||
| 1152 | Ga0163161_10004923 | |||
| 1153 | Ga0163161_10008975 | |||
| 1154 | Ga0163161_10310378 | |||
| 1155 | Ga0213873_10019748 | |||
| 1156 | Ga0209435_100002 | |||
| 1157 | Ga0207425_1007536 | |||
| 1158 | Ga0207425_1015792 | |||
| 1159 | Ga0209646_1000001 | |||
| 1160 | Ga0209026_1000001 | |||
| 1161 | Ga0209759_1000001 | |||
| 1162 | Ga0209565_1000043 | |||
| 1163 | Ga0209673_1000008 | |||
| 1164 | Ga0209130_1000276 | |||
| 1165 | Ga0209130_1000606 | |||
| 1166 | Ga0207673_1002411 | |||
| 1167 | Ga0209675_1000170 | |||
| 1168 | Ga0209675_1034291 | |||
| 1169 | Ga0209676_1000023 | |||
| 1170 | Ga0209676_1001474 | |||
| 1171 | Ga0209676_1014950 | |||
| 1172 | Ga0209025_1006123 | |||
| 1173 | Ga0209025_1030039 | |||
| 1174 | Ga0209025_1039291 | |||
| 1175 | Ga0209564_1009011 | |||
| 1176 | Ga0209758_1032079 | |||
| 1177 | Ga0209050_1000022 | |||
| 1178 | Ga0209256_1000001 | |||
| 1179 | Ga0207426_1000424 | |||
| 1180 | Ga0207426_1002385 | |||
| 1181 | Ga0209051_1000013 | |||
| 1182 | Ga0209051_1048231 | |||
| 1183 | Ga0209257_1000042 | |||
| 1184 | Ga0209257_1007824 | |||
| 1185 | Ga0207697_10001107 | |||
| 1186 | Ga0207697_10041456 | |||
| 1187 | Ga0207697_10047209 | |||
| 1188 | Ga0207656_10014158 | |||
| 1189 | Ga0207682_10001279 | |||
| 1190 | Ga0207642_10072988 | |||
| 1191 | Ga0207710_10000498 | |||
| 1192 | Ga0207710_10014141 | |||
| 1193 | Ga0207688_10000412 | |||
| 1194 | Ga0207688_10086948 | |||
| 1195 | Ga0207680_10002034 | |||
| 1196 | Ga0207680_10021525 | |||
| 1197 | Ga0207680_10120199 | |||
| 1198 | Ga0207680_10126883 | |||
| 1199 | Ga0207680_10141052 | |||
| 1200 | Ga0207647_10067532 | |||
| 1201 | Ga0207647_10071413 | |||
| 1202 | Ga0207699_10022857 | |||
| 1203 | Ga0207645_10002807 | |||
| 1204 | Ga0207645_10052048 | |||
| 1205 | Ga0207645_10146441 | |||
| 1206 | Ga0207645_10192847 | |||
| 1207 | Ga0207643_10000206 | |||
| 1208 | Ga0207643_10091798 | |||
| 1209 | Ga0207643_10206907 | |||
| 1210 | Ga0207705_10384792 | |||
| 1211 | Ga0207684_10013827 | |||
| 1212 | Ga0207684_10290102 | |||
| 1213 | Ga0207707_10021032 | |||
| 1214 | Ga0207695_10004136 | |||
| 1215 | Ga0207671_10004715 | |||
| 1216 | Ga0207671_10188441 | |||
| 1217 | Ga0207693_10001211 | |||
| 1218 | Ga0207662_10000767 | |||
| 1219 | Ga0207657_10006323 | |||
| 1220 | Ga0207657_10080921 | |||
| 1221 | Ga0207657_10456161 | |||
| 1222 | Ga0207649_10037376 | |||
| 1223 | Ga0207649_10046760 | |||
| 1224 | Ga0207646_10002427 | |||
| 1225 | Ga0207646_10097589 | |||
| 1226 | Ga0207681_10012555 | |||
| 1227 | Ga0207681_10049274 | |||
| 1228 | Ga0207681_10127492 | |||
| 1229 | Ga0207694_10020816 | |||
| 1230 | Ga0207694_10120076 | |||
| 1231 | Ga0207694_10524391 | |||
| 1232 | Ga0207650_10004823 | |||
| 1233 | Ga0207650_10005403 | |||
| 1234 | Ga0207650_10006752 | |||
| 1235 | Ga0207650_10024908 | |||
| 1236 | Ga0207650_10026758 | |||
| 1237 | Ga0207650_10034009 | |||
| 1238 | Ga0207650_10045117 | |||
| 1239 | Ga0207650_10216269 | |||
| 1240 | Ga0207650_10253759 | |||
| 1241 | Ga0207659_10002376 | |||
| 1242 | Ga0207659_10002578 | |||
| 1243 | Ga0207659_10009413 | |||
| 1244 | Ga0207659_10173235 | |||
| 1245 | Ga0207687_10001135 | |||
| 1246 | Ga0207700_10000235 | |||
| 1247 | Ga0207664_10174274 | |||
| 1248 | Ga0207664_10566084 | |||
| 1249 | Ga0207644_10003360 | |||
| 1250 | Ga0207644_10008381 | |||
| 1251 | Ga0207644_10014036 | |||
| 1252 | Ga0207644_10021100 | |||
| 1253 | Ga0207644_10150955 | |||
| 1254 | Ga0207644_10168365 | |||
| 1255 | Ga0207644_10185059 | |||
| 1256 | Ga0207690_10002549 | |||
| 1257 | Ga0207690_10096180 | |||
| 1258 | Ga0207706_10002273 | |||
| 1259 | Ga0207706_10009405 | |||
| 1260 | Ga0207706_10117803 | |||
| 1261 | Ga0207706_10173396 | |||
| 1262 | Ga0207686_10017717 | |||
| 1263 | Ga0207686_10086001 | |||
| 1264 | Ga0207670_10047165 | |||
| 1265 | Ga0207669_10069012 | |||
| 1266 | Ga0207704_10018377 | |||
| 1267 | Ga0207665_10320282 | |||
| 1268 | Ga0207691_10003525 | |||
| 1269 | Ga0207691_10027310 | |||
| 1270 | Ga0207691_10028623 | |||
| 1271 | Ga0207691_10175562 | |||
| 1272 | Ga0207691_10274880 | |||
| 1273 | Ga0207711_10000875 | |||
| 1274 | Ga0207711_10008854 | |||
| 1275 | Ga0207711_10047956 | |||
| 1276 | Ga0207711_10067034 | |||
| 1277 | Ga0207711_10067232 | |||
| 1278 | Ga0207711_10086347 | |||
| 1279 | Ga0207711_10461545 | |||
| 1280 | Ga0207711_10531523 | |||
| 1281 | Ga0207689_10000368 | |||
| 1282 | Ga0207689_10000680 | |||
| 1283 | Ga0207689_10001762 | |||
| 1284 | Ga0207689_10017656 | |||
| 1285 | Ga0207689_10216603 | |||
| 1286 | Ga0207661_10043675 | |||
| 1287 | Ga0207679_10010864 | |||
| 1288 | Ga0207679_10055416 | |||
| 1289 | Ga0207679_10195594 | |||
| 1290 | Ga0207651_10018141 | |||
| 1291 | Ga0207651_10198094 | |||
| 1292 | Ga0207651_10207870 | |||
| 1293 | Ga0207651_10215563 | |||
| 1294 | Ga0207712_10006888 | |||
| 1295 | Ga0207712_10037084 | |||
| 1296 | Ga0207712_10361686 | |||
| 1297 | Ga0207668_10005456 | |||
| 1298 | Ga0207668_10023226 | |||
| 1299 | Ga0207668_10054274 | |||
| 1300 | Ga0207668_10066136 | |||
| 1301 | Ga0207668_10158483 | |||
| 1302 | Ga0207668_10240567 | |||
| 1303 | Ga0207668_10413991 | |||
| 1304 | Ga0207640_10002897 | |||
| 1305 | Ga0207640_10019277 | |||
| 1306 | Ga0207658_10025052 | |||
| 1307 | Ga0207658_10033583 | |||
| 1308 | Ga0207658_10206205 | |||
| 1309 | Ga0207658_10244519 | |||
| 1310 | Ga0207658_10338831 | |||
| 1311 | Ga0207658_10365929 | |||
| 1312 | Ga0207658_10402473 | |||
| 1313 | Ga0207677_10000161 | |||
| 1314 | Ga0207677_10033421 | |||
| 1315 | Ga0207703_10001193 | |||
| 1316 | Ga0207703_10002912 | |||
| 1317 | Ga0207703_10005544 | |||
| 1318 | Ga0207703_10021058 | |||
| 1319 | Ga0207703_10045656 | |||
| 1320 | Ga0207703_10225661 | |||
| 1321 | Ga0207703_10282288 | |||
| 1322 | Ga0207639_10002618 | |||
| 1323 | Ga0207639_10070923 | |||
| 1324 | Ga0207639_10112320 | |||
| 1325 | Ga0207639_10136167 | |||
| 1326 | Ga0207639_10582482 | |||
| 1327 | Ga0207678_10001429 | |||
| 1328 | Ga0207678_10019090 | |||
| 1329 | Ga0207708_10000801 | |||
| 1330 | Ga0207708_10313202 | |||
| 1331 | Ga0207702_10002331 | |||
| 1332 | Ga0207702_10414299 | |||
| 1333 | Ga0207641_10003390 | |||
| 1334 | Ga0207641_10017311 | |||
| 1335 | Ga0207641_10023876 | |||
| 1336 | Ga0207641_10029023 | |||
| 1337 | Ga0207641_10062590 | |||
| 1338 | Ga0207641_10075154 | |||
| 1339 | Ga0207641_10112795 | |||
| 1340 | Ga0207641_10218908 | |||
| 1341 | Ga0207641_10237818 | |||
| 1342 | Ga0207641_10321739 | |||
| 1343 | Ga0207641_10343396 | |||
| 1344 | Ga0207641_10450222 | |||
| 1345 | Ga0207641_10871314 | |||
| 1346 | Ga0207648_10001630 | |||
| 1347 | Ga0207648_10001959 | |||
| 1348 | Ga0207648_10004070 | |||
| 1349 | Ga0207676_10001760 | |||
| 1350 | Ga0207676_10008040 | |||
| 1351 | Ga0207676_10046754 | |||
| 1352 | Ga0207676_10061313 | |||
| 1353 | Ga0207676_10100434 | |||
| 1354 | Ga0207676_10571086 | |||
| 1355 | Ga0207674_10003863 | |||
| 1356 | Ga0207674_10177407 | |||
| 1357 | Ga0207675_100000757 | |||
| 1358 | Ga0207675_100005312 | |||
| 1359 | Ga0207675_100129459 | |||
| 1360 | Ga0207675_100170319 | |||
| 1361 | Ga0207675_100267936 | |||
| 1362 | Ga0207675_100362239 | |||
| 1363 | Ga0207683_10009125 | |||
| 1364 | Ga0207683_10054944 | |||
| 1365 | Ga0207683_10206189 | |||
| 1366 | Ga0207698_10024708 | |||
| 1367 | Ga0207698_10062152 | |||
| 1368 | Ga0207698_10136138 | |||
| 1369 | Ga0209179_1000003 | |||
| 1370 | Ga0268266_10005673 | |||
| 1371 | Ga0268266_10170633 | |||
| 1372 | Ga0268266_10210710 | |||
| 1373 | Ga0268266_10304527 | |||
| 1374 | Ga0268265_10044878 | |||
| 1375 | Ga0268265_10049853 | |||
| 1376 | Ga0268265_10088527 | |||
| 1377 | Ga0268265_10332070 | |||
| 1378 | Ga0268264_10000258 | |||
| 1379 | Ga0268264_10003622 | |||
| 1380 | Ga0268264_10009768 | |||
| 1381 | Ga0268264_10122032 | |||
| 1382 | Ga0307517_10004509 | |||
| 1383 | Ga0307517_10216160 | |||
| 1384 | Ga0307515_10001016 | |||
| 1385 | Ga0307515_10053221 | |||
| 1386 | Ga0307515_10164980 | |||
| 1387 | Ga0307511_10001781 | |||
| 1388 | Ga0307511_10068034 | |||
| 1389 | Ga0307512_10005868 | |||
| 1390 | Ga0265328_10001761 | |||
| 1391 | Ga0265316_10234693 | |||
| 1392 | Ga0307513_10000922 | |||
| 1393 | Ga0307513_10004915 | |||
| 1394 | Ga0307513_10125622 | |||
| 1395 | Ga0307509_10000001 | |||
| 1396 | Ga0307509_10002304 | |||
| 1397 | Ga0307509_10003211 | |||
| 1398 | Ga0307509_10006141 | |||
| 1399 | Ga0307509_10194056 | |||
| 1400 | Ga0307408_100006738 | |||
| 1401 | Ga0307408_100117948 | |||
| 1402 | Ga0307508_10000016 | |||
| 1403 | Ga0307508_10016926 | |||
| 1404 | Ga0307508_10293775 | |||
| 1405 | Ga0307514_10001309 | |||
| 1406 | Ga0307514_10025688 | |||
| 1407 | Ga0316576_10036226 | |||
| 1408 | Ga0307516_10134544 | |||
| 1409 | Ga0307406_10034132 | |||
| 1410 | Ga0307406_10380361 | |||
| 1411 | Ga0307412_10500034 | |||
| 1412 | Ga0307409_100120784 | |||
| 1413 | Ga0307416_100108583 | |||
| 1414 | Ga0307416_100258741 | |||
| 1415 | Ga0307414_10161151 | |||
| 1416 | Ga0307507_10161654 | |||
| 1417 | Ga0307510_10000016 | |||
| 1418 | Ga0307510_10000568 | |||
| 1419 | Ga0307510_10012936 | |||
| 1420 | Ga0373926_0064143 | |||
| 1421 | Ga0373928_0016749 | |||
| 1422 | Ga0373936_0004753 | |||
| 1423 | Ga0373936_0018803 | |||
| 1424 | Ga0373936_0116958 | |||
| 1425 | Ga0373953_0067817 | |||
| 1426 | Ga0373953_0137270 | |||
| 1427 | Ga0373956_0103046 | |||
| 1428 | Ga0373943_0013281 | |||
| 1429 | Ga0373943_0078450 | |||
| 1430 | Ga0373943_0191353 | |||
| 1431 | Ga0373955_0141964 | |||
| 1432 | Ga0373931_0006871 | |||
| 1433 | Ga0373935_0053884 | |||
| 1434 | Ga0373927_0010403 | |||
| 1435 | Ga0373927_0034726 | |||
| 1436 | Ga0373927_0088882 | |||
| 1437 | Ga0373937_0011674 | |||
| 1438 | Ga0373937_0028315 | |||
| 1439 | Ga0373937_0083406 | |||
| 1440 | Ga0373937_0146815 | |||
| 1441 | Ga0373937_0284079 | |||
| 1442 | Ga0316582_0094925 | |||
| 1443 | Ga0373925_0002445 | |||
| 1444 | Ga0373925_0005322 | |||
| 1445 | Ga0373925_0142682 | |||
| 1446 | Ga0373925_0200341 | |||
| 1447 | Ga0395905_0149896 | |||
| 1448 | Ga0436364_0547719 | |||
| 1449 | Ga0436365_1602820 | |||
| 1450 | Ga0436361_0553303 | |||
| 1451 | Ga0436361_1056758 | |||
| 1452 | Ga0436362_0168894 | |||
| 1453 | Ga0451802_0976333 | |||
| 1454 | Ga0451853_0743422 | |||
| 1455 | Ga0451577_0381942 | |||
| 1456 | Ga0453684_0012382 | |||
| 1457 | Ga0451576_0006570 | |||
| 1458 | Ga0495592_0000213 | |||
| 1459 | Ga0495629_0243276 | |||
| 1460 | Ga0495580_0006680 | |||
| 1461 | Ga0495580_0089445 | |||
| 1462 | Ga0495580_0092904 | |||
| 1463 | Ga0495582_0006300 | |||
| 1464 | Ga0495639_0001129 | |||
| 1465 | Ga0495664_0012864 | |||
| 1466 | Ga0495610_0006121 | |||
| 1467 | Ga0495618_0228327 | |||
| 1468 | Ga0495620_0022462 | |||
| 1469 | Ga0495628_0065184 | |||
| 1470 | Ga0495628_0104418 | |||
| 1471 | Ga0495628_0296422 | |||
| 1472 | Ga0495630_0128688 | |||
| 1473 | Ga0495631_0085017 | |||
| 1474 | Ga0495632_0049207 | |||
| 1475 | Ga0495648_0037763 | |||
| 1476 | Ga0495648_0056842 | |||
| 1477 | Ga0495640_0194584 | |||
| 1478 | Ga0495586_0082591 | |||
| 1479 | Ga0495587_0143098 | |||
| 1480 | Ga0495609_0048923 | |||
| 1481 | Ga0495621_0014269 | |||
| 1482 | Ga0495645_0008744 | |||
| 1483 | Ga0495645_0180266 | |||
| 1484 | Ga0495667_0103985 | |||
| 1485 | Ga0495634_0243949 | |||
| 1486 | Ga0495611_0021683 | |||
| 1487 | Ga0495625_0086310 | |||
| 1488 | Ga0495635_0001307 | |||
| 1489 | Ga0495588_0138147 | |||
| 1490 | Ga0495657_0091419 | |||
| 1491 | Ga0495647_0016198 | |||
| 1492 | Ga0495658_0385623 | |||
| 1493 | Ga0495613_0009009 | |||
| 1494 | Ga0495613_0132690 | |||
| 1495 | Ga0495649_0001371 | |||
| 1496 | Ga0495600_0105695 | |||
| 1497 | Ga0495660_0008413 | |||
| 1498 | Ga0495581_0003182 | |||
| 1499 | Ga0495604_0128897 | |||
| 1500 | Ga0495676_0061762 | |||
| 1501 | Ga0495680_0041057 | |||
| 1502 | Ga0495687_021846 | |||
| 1503 | Ga0495687_060153 | |||
| 1504 | Ga0495675_0098967 | |||
| 1505 | Ga0495684_0080209 | |||
| 1506 | Ga0495686_0019493 | |||
| 1507 | Ga0495602_0287227 | |||
| 1508 | Ga0496100_0196506 | |||
| 1509 | Ga0496101_0059872 | |||
| 1510 | Ga0496101_0193331 | |||
| 1511 | Ga0496102_0023903 | |||
| 1512 | Ga0496102_0268441 | |||
| 1513 | Ga0496102_0399500 | |||
| 1514 | Ga0496102_0438507 | |||
| 1515 | Ga0496104_0017893 | |||
| 1516 | Ga0496104_0191588 | |||
| 1517 | Ga0496104_0261726 | |||
| 1518 | Ga0496106_0004160 | |||
| 1519 | Ga0496106_0085083 | |||
| 1520 | Ga0496107_0001689 | |||
| 1521 | Ga0496107_0100898 | |||
| 1522 | Ga0496108_0011827 | |||
| 1523 | Ga0496108_0174692 | |||
| 1524 | Ga0496108_0202562 | |||
| 1525 | Ga0496108_0442035 | |||
| 1526 | Ga0496109_0018702 | |||
| 1527 | Ga0496109_0099189 | |||
| 1528 | Ga0496110_0005186 | |||
| 1529 | Ga0496110_0012457 | |||
| 1530 | Ga0496110_0290877 | |||
| 1531 | Ga0496112_0006113 | |||
| 1532 | Ga0496112_0028502 | |||
| 1533 | Ga0496113_0281011 | |||
| 1534 | Ga0496119_0003074 | |||
| 1535 | Ga0496120_0000146 | |||
| 1536 | Ga0496120_0080131 | |||
| 1537 | Ga0496121_0001394 | |||
| 1538 | Ga0496122_0018855 | |||
| 1539 | Ga0496123_0003048 | |||
| 1540 | Ga0496125_0002028 | |||
| 1541 | Ga0496125_0022664 | |||
| 1542 | Ga0496125_0034598 | |||
| 1543 | Ga0496125_0151092 | |||
| 1544 | Ga0496126_0230752 | |||
| 1545 | Ga0495682_0085515 | |||
| 1546 | Ga0501034_0582112 | |||
| 1547 | Ga0501034_0606213 | |||
| 1548 | Ga0501036_0059648 | |||
| 1549 | Ga0501037_0070807 | |||
| 1550 | Ga0501038_0067831 | |||
| 1551 | Ga0501038_0375826 | |||
| 1552 | Ga0501039_0022919 | |||
| 1553 | Ga0501042_0029607 | |||
| 1554 | Ga0501043_0366325 | |||
| 1555 | Ga0501047_0002078 | |||
| 1556 | Ga0501047_0169468 | |||
| 1557 | Ga0501069_0011576 | |||
| 1558 | Ga0501070_0132545 | |||
| 1559 | Ga0501075_0400538 | |||
| 1560 | Ga0501077_0164766 | |||
| 1561 | Ga0501035_0144846 | |||
| 1562 | Ga0501035_0155500 | |||
| 1563 | Ga0501035_0206100 | |||
| 1564 | Ga0501045_0131533 | |||
| 1565 | nmdc:mga0k408_2913_c1 | |||
| 1566 | nmdc:mga07m45_416_c1 | |||
| 1567 | nmdc:mga05p37_433905_c1 | |||
| 1568 | nmdc:mga05p37_660958_c1 | |||
| 1569 | nmdc:mga08y16_380282_c1 | |||
| 1570 | nmdc:mga0a205_9126_c1 | |||
| 1571 | Ga0495601_0294884 | |||
| 1572 | Ga0495612_0031459 | |||
| 1573 | Ga0495619_0010046 | |||
| 1574 | Ga0500644_0006593 | |||
| 1575 | Ga0500566_0182051 | |||
| 1576 | Ga0500650_0089437 | |||
| 1577 | Ga0500556_0000018 | |||
| 1578 | Ga0500593_005348 | |||
| 1579 | Ga0500595_040266 | |||
| 1580 | Ga0500614_032984 | |||
| 1581 | Ga0500618_024392 | |||
| 1582 | Ga0500559_0000236 | |||
| 1583 | Ga0500568_0014028 | |||
| 1584 | Ga0500619_019941 | |||
| 1585 | Ga0500622_0017749 | |||
| 1586 | Ga0500630_060302 | |||
| 1587 | Ga0500637_0007664 | |||
| 1588 | Ga0500645_000596 | |||
| 1589 | Ga0500645_001816 | |||
| 1590 | Ga0500645_018580 | |||
| 1591 | Ga0500661_013176 | |||
| 1592 | 2508727656 | |||
| 1593 | 2509077358 | |||
| 1594 | 2510843636 | |||
| 1595 | 2511243004 | |||
| 1596 | 2774869158 | |||
| 1597 | 2776258384 | |||
| 1598 | 2835317460 | |||
| 1599 | 2837652039 | |||
| 1600 | 2837680040 | |||
| 1601 | 2840882090 | |||
| 1602 | 2882457612 | |||
| 1603 | 2884301219 | |||
| 1604 | 2894236163 | |||
| 1605 | 2899804768 | |||
| 1606 | 2919707739 | |||
| 1607 | 2989354410 | |||
| 1608 | 8054566951 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
87
281
0.84
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ahd-assembly1.cif.gz_A | opua (e190q) occluded | 0.7882 | 141 | 193 |
| 4xtc-assembly1.cif.gz_M | crystal structure of bacterial alginate abc transporter in complex with alginate pentasaccharide-bound periplasmic protein | 0.5501 | 147 | 247 |
| 3rlf-assembly1.cif.gz_F | crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp | 0.5193 | 152 | 245 |
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.4843 | 145 | 253 |
| 2r6g-assembly1.cif.gz_G | the crystal structure of the e. coli maltose transporter | 0.395 | 7 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.897 | 143 | 193 | 1.10.3720.10 |
| af_P9WG05_32_321_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8375 | 142 | 193 | 1.10.3720.10 |
| af_P07654_38_293_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7195 | 142 | 193 | 1.10.3720.10 |
| af_Q58419_14_276_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7114 | 142 | 193 | 1.10.3720.10 |
| af_O53484_49_294_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.6105 | 142 | 256 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C3G7J3-F1-model_v4 | ABC transporter permease | 0.9035 | 1 | 95 |
GO:0005886
|
| AF-A0A3D4ZGC0-F1-model_v4 | ABC transporter permease | 0.889 | 1 | 78 |
GO:0016020
|
| AF-A0A7C3G7J3-F1-model_v4 | ABC transporter permease | 0.8864 | 1 | 95 |
GO:0005886
|
| AF-A0A3D4ZGC0-F1-model_v4 | ABC transporter permease | 0.8689 | 1 | 78 |
GO:0016020
|
| AF-A0A7C7PLA0-F1-model_v4 | ABC transporter permease | 0.8465 | 4 | 117 |
GO:0005886
GO:0055085 |