F481566

General Info

Members Datasets Scaffolds Average Seq Length
804 373 1608 279

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0120821|Ga0373937_0120821_939_1859
Length 306
Sequence VIPSLPRSSAARFATAGYVAAFLVFLFVPLVVVAVFAFNDANYPAPPWRGFTLDWFLGGHGRTGLFTDVPLLGSVGTSVLVASWVTMLSVAVGTANAFLLERARFRGKSALSLLMLAPLVIPGVILGISILAFASRVAQFADDLWGIELDFLRPGLPLVVFGQFSYIVSIATLTIAARLKRFDGTLEDAAFNLGASRAAVLWTVILPYLRPALIGAAAISFLMSFENFNTTLMLVGSDPPLTVMMYGRMREGASPVLNAVSLLLMVASALIALALLRRSARPTGDAFATARDLSESNPRTGPPAPR

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
134 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
135 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
136 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
137 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
138 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
139 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
143 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
148 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
217 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
218 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
219 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
220 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
221 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
222 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
223 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
224 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
225 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
226 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
227 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
228 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
232 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
233 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
234 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
235 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
236 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
237 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
238 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
240 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
241 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
242 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
243 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
244 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
246 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
247 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
250 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
251 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
252 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
253 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
254 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
255 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
261 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
262 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
265 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
266 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
267 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
268 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
269 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
270 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
271 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
272 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
273 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
276 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
277 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
278 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
279 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
280 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
284 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
285 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
289 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
290 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
291 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
294 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
295 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
298 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
299 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
305 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
306 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
312 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
313 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
314 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
315 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
316 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
317 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
318 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
319 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
328 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
329 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
330 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
333 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
334 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
335 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
336 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
337 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
338 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
339 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
340 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
341 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
342 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
343 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
344 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
345 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
346 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
347 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
348 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
349 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
350 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
351 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
352 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
353 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
354 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
355 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
356 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
357 2508501050 Microvirga lupini Lut6 Isolate Nodule
358 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
359 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
360 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
361 2773857925 Microvirga vignae BR3299 Isolate Unclassified
362 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
363 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
364 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
365 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
366 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
367 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
368 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
369 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
370 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
371 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
372 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
373 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.89
Metatranscriptomes 0
Isolates 2.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.59
Nodule 0.62
Rhizoplane 3.36
Rhizosphere 81.09
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0120821 3300036401 Bacteria 2441
2 JGI24740J21852_10038698 3300001979 Bacteria 1461
3 JGI25155J39150_1000104 3300002704 Bacteria 45159
4 JGI25156J39149_1000089 3300002705 Bacteria 68168
5 JGI25154J39366_1000115 3300002738 Bacteria 68056
6 JGI25157J39369_1000118 3300002741 Bacteria 68168
7 JGI25159J45721_1006856 3300002987 Bacteria 3344
8 JGI25159J45721_1007148 3300002987 Bacteria 3239
9 JGI25151J46595_10018037 3300003187 Bacteria 3043
10 rootH1_10104496 3300003316 Bacteria 2132
11 rootH1_10122896 3300003323 Bacteria 2576
12 JGI25160J50197_1000281 3300003354 Bacteria 37019
13 JGI25161J50226_1000124 3300003374 Bacteria 56436
14 JGI25161J50226_1000228 3300003374 Bacteria 34378
15 Ga0055537_1000218 3300003773 Bacteria 42281
16 Ga0055524_1000119 3300003775 Bacteria 92710
17 Ga0055536_1005225 3300003781 Bacteria 6404
18 Ga0055534_1003730 3300003784 Bacteria 4697
19 Ga0055530_10000322 3300003791 Bacteria 43322
20 Ga0055540_1000058 3300003792 Bacteria 136015
21 Ga0055531_10009332 3300003794 Bacteria 5026
22 Ga0055543_1001000 3300004625 Bacteria 12685
23 Ga0065715_10099762 3300005293 Bacteria 3374
24 Ga0065715_10147158 3300005293 Bacteria 1774
25 Ga0070676_10003660 3300005328 Bacteria 8048
26 Ga0070676_10034239 3300005328 Bacteria 2916
27 Ga0070676_10309324 3300005328 Bacteria 1074
28 Ga0070683_100004502 3300005329 Bacteria 11501
29 Ga0070690_100003236 3300005330 Bacteria 8886
30 Ga0070690_100040565 3300005330 Bacteria 2944
31 Ga0070690_100122346 3300005330 Bacteria 1748
32 Ga0070670_100004913 3300005331 Bacteria 11248
33 Ga0070670_100022011 3300005331 Bacteria 5485
34 Ga0070670_100030016 3300005331 Bacteria 4682
35 Ga0070670_100036607 3300005331 Bacteria 4223
36 Ga0070670_100060219 3300005331 Bacteria 3259
37 Ga0070670_100155119 3300005331 Bacteria 1983
38 Ga0070670_100178796 3300005331 Bacteria 1842
39 Ga0070670_100270446 3300005331 Bacteria 1483
40 Ga0070677_10110452 3300005333 Bacteria 1226
41 Ga0068869_100000933 3300005334 Bacteria 16873
42 Ga0068869_100003186 3300005334 Bacteria 10022
43 Ga0068869_100010839 3300005334 Bacteria 5960
44 Ga0070666_10049714 3300005335 Bacteria 2819
45 Ga0070666_10055020 3300005335 Bacteria 2685
46 Ga0070666_10065337 3300005335 Bacteria 2469
47 Ga0070666_10067255 3300005335 Bacteria 2433
48 Ga0070666_10147063 3300005335 Bacteria 1643
49 Ga0070666_10154017 3300005335 Bacteria 1604
50 Ga0070666_10226210 3300005335 Bacteria 1320
51 Ga0068868_100000470 3300005338 Bacteria 26845
52 Ga0068868_100007161 3300005338 Bacteria 7927
53 Ga0068868_100121216 3300005338 Bacteria 2133
54 Ga0070660_100036746 3300005339 Bacteria 3711
55 Ga0070689_100014621 3300005340 Bacteria 5705
56 Ga0070689_100236119 3300005340 Bacteria 1504
57 Ga0070689_100241066 3300005340 Bacteria 1489
58 Ga0070687_100094805 3300005343 Bacteria 1658
59 Ga0070661_100003664 3300005344 Bacteria 10585
60 Ga0070661_100006249 3300005344 Bacteria 8218
61 Ga0070661_100047127 3300005344 Bacteria 3154
62 Ga0070661_100335257 3300005344 Bacteria 1184
63 Ga0070668_100011167 3300005347 Bacteria 6687
64 Ga0070668_100015214 3300005347 Bacteria 5748
65 Ga0070668_100015517 3300005347 Bacteria 5695
66 Ga0070668_100072219 3300005347 Bacteria 2689
67 Ga0070668_100431472 3300005347 Bacteria 1130
68 Ga0070669_100010514 3300005353 Bacteria 6573
69 Ga0070669_100137109 3300005353 Bacteria 1883
70 Ga0070669_100198138 3300005353 Bacteria 1579
71 Ga0070669_100257717 3300005353 Bacteria 1391
72 Ga0070669_100272948 3300005353 Bacteria 1353
73 Ga0070669_100368236 3300005353 Bacteria 1170
74 Ga0070675_100036643 3300005354 Bacteria 3993
75 Ga0070675_100042544 3300005354 Bacteria 3711
76 Ga0070675_100259003 3300005354 Bacteria 1524
77 Ga0070671_100032084 3300005355 Bacteria 4343
78 Ga0070671_100032238 3300005355 Bacteria 4333
79 Ga0070671_100032541 3300005355 Bacteria 4311
80 Ga0070671_100035903 3300005355 Bacteria 4108
81 Ga0070671_100038582 3300005355 Bacteria 3964
82 Ga0070671_100049945 3300005355 Bacteria 3479
83 Ga0070671_100063396 3300005355 Bacteria 3078
84 Ga0070671_100179268 3300005355 Bacteria 1793
85 Ga0070674_100015365 3300005356 Bacteria 4778
86 Ga0070674_100147916 3300005356 Bacteria 1770
87 Ga0070674_100487899 3300005356 Bacteria 1024
88 Ga0070673_100008174 3300005364 Bacteria 6944
89 Ga0070673_100008978 3300005364 Bacteria 6687
90 Ga0070673_100012046 3300005364 Bacteria 5924
91 Ga0070673_100083349 3300005364 Bacteria 2597
92 Ga0070673_100223269 3300005364 Bacteria 1631
93 Ga0070673_100247622 3300005364 Bacteria 1552
94 Ga0070688_100027533 3300005365 Bacteria 3386
95 Ga0070688_100222594 3300005365 Bacteria 1330
96 Ga0070659_100002977 3300005366 Bacteria 12066
97 Ga0070659_100129241 3300005366 Bacteria 2050
98 Ga0070667_100002837 3300005367 Bacteria 14953
99 Ga0070667_100005881 3300005367 Bacteria 10221
100 Ga0070667_100044086 3300005367 Bacteria 3745
101 Ga0070667_100068471 3300005367 Bacteria 3020
102 Ga0070667_100167802 3300005367 Bacteria 1936
103 Ga0070667_100220825 3300005367 Bacteria 1687
104 Ga0070667_100353387 3300005367 Bacteria 1331
105 Ga0070667_100397591 3300005367 Bacteria 1254
106 Ga0070667_100603289 3300005367 Bacteria 1012
107 Ga0070667_100621638 3300005367 Bacteria 996
108 Ga0070709_10002492 3300005434 Bacteria 9966
109 Ga0070713_100000089 3300005436 Bacteria 57995
110 Ga0070710_10000978 3300005437 Bacteria 13579
111 Ga0070701_10231120 3300005438 Bacteria 1108
112 Ga0070701_10244046 3300005438 Bacteria 1082
113 Ga0070711_100004025 3300005439 Bacteria 8647
114 Ga0070711_100079914 3300005439 Bacteria 2327
115 Ga0070711_100124886 3300005439 Bacteria 1909
116 Ga0070705_100096050 3300005440 Bacteria 1860
117 Ga0070700_100324425 3300005441 Bacteria 1132
118 Ga0070694_100152881 3300005444 Bacteria 1687
119 Ga0070708_100000053 3300005445 Bacteria 77258
120 Ga0070708_100146132 3300005445 Bacteria 2196
121 Ga0070663_100000563 3300005455 Bacteria 19762
122 Ga0070663_100094378 3300005455 Bacteria 2221
123 Ga0070663_100341863 3300005455 Bacteria 1209
124 Ga0070678_100078264 3300005456 Bacteria 2497
125 Ga0070678_100100318 3300005456 Bacteria 2242
126 Ga0070678_100104916 3300005456 Bacteria 2199
127 Ga0070678_100156842 3300005456 Bacteria 1839
128 Ga0070662_100000493 3300005457 Bacteria 23501
129 Ga0070662_100098430 3300005457 Bacteria 2209
130 Ga0070681_10012370 3300005458 Bacteria 8463
131 Ga0068867_100002313 3300005459 Bacteria 13410
132 Ga0068867_100392524 3300005459 Bacteria 1168
133 Ga0070685_10001266 3300005466 Bacteria 13375
134 Ga0070685_10007358 3300005466 Bacteria 5631
135 Ga0070685_10185230 3300005466 Bacteria 1343
136 Ga0070706_100020939 3300005467 Bacteria 6020
137 Ga0070706_100024748 3300005467 Bacteria 5527
138 Ga0070706_100366213 3300005467 Bacteria 1343
139 Ga0070707_100025803 3300005468 Bacteria 5577
140 Ga0070699_100402353 3300005518 Bacteria 1238
141 Ga0070684_100022586 3300005535 Bacteria 5250
142 Ga0070697_100037673 3300005536 Bacteria 3906
143 Ga0068853_100003287 3300005539 Bacteria 12364
144 Ga0068853_100289820 3300005539 Bacteria 1511
145 Ga0068853_100322870 3300005539 Bacteria 1431
146 Ga0068853_100554314 3300005539 Bacteria 1089
147 Ga0068853_100588639 3300005539 Bacteria 1056
148 Ga0070672_100003389 3300005543 Bacteria 10332
149 Ga0070672_100016459 3300005543 Bacteria 5294
150 Ga0070672_100026315 3300005543 Bacteria 4327
151 Ga0070672_100122885 3300005543 Bacteria 2127
152 Ga0070672_100237354 3300005543 Bacteria 1533
153 Ga0070686_100001970 3300005544 Bacteria 11403
154 Ga0070695_100001102 3300005545 Bacteria 14768
155 Ga0070695_100083058 3300005545 Bacteria 2122
156 Ga0070695_100181428 3300005545 Bacteria 1492
157 Ga0070665_100003009 3300005548 Bacteria 18178
158 Ga0070665_100003275 3300005548 Bacteria 17374
159 Ga0070665_100014341 3300005548 Bacteria 7958
160 Ga0070665_100043553 3300005548 Bacteria 4510
161 Ga0070665_100049341 3300005548 Bacteria 4224
162 Ga0070665_100237600 3300005548 Bacteria 1823
163 Ga0070665_100503507 3300005548 Bacteria 1222
164 Ga0070665_100582131 3300005548 Bacteria 1132
165 Ga0070704_100029023 3300005549 Bacteria 3688
166 Ga0068855_100003372 3300005563 Bacteria 19564
167 Ga0068855_100096663 3300005563 Bacteria 3402
168 Ga0070664_100003982 3300005564 Bacteria 11881
169 Ga0068857_100092994 3300005577 Bacteria 2700
170 Ga0068854_100004404 3300005578 Bacteria 8888
171 Ga0068854_100010639 3300005578 Bacteria 5969
172 Ga0068854_100055051 3300005578 Bacteria 2863
173 Ga0068854_100180136 3300005578 Bacteria 1650
174 Ga0068854_100293408 3300005578 Bacteria 1313
175 Ga0068854_100509479 3300005578 Unclassified 1015
176 Ga0068856_100000282 3300005614 Bacteria 55434
177 Ga0068856_100114795 3300005614 Bacteria 2692
178 Ga0068856_100290769 3300005614 Bacteria 1651
179 Ga0070702_100005347 3300005615 Bacteria 5965
180 Ga0070702_100036198 3300005615 Bacteria 2732
181 Ga0068852_100000749 3300005616 Bacteria 21324
182 Ga0068852_100071156 3300005616 Bacteria 3053
183 Ga0068852_100076808 3300005616 Bacteria 2950
184 Ga0068859_100000120 3300005617 Bacteria 74447
185 Ga0068859_100005936 3300005617 Bacteria 12396
186 Ga0068859_100007348 3300005617 Bacteria 11178
187 Ga0068859_100035437 3300005617 Bacteria 5007
188 Ga0068859_100046831 3300005617 Bacteria 4342
189 Ga0068859_100052470 3300005617 Bacteria 4099
190 Ga0068864_100004562 3300005618 Bacteria 11372
191 Ga0068864_100007614 3300005618 Bacteria 8917
192 Ga0068864_100008422 3300005618 Bacteria 8507
193 Ga0068864_100014701 3300005618 Bacteria 6502
194 Ga0068864_100023641 3300005618 Bacteria 5162
195 Ga0068864_100086784 3300005618 Bacteria 2754
196 Ga0068864_100452166 3300005618 Bacteria 1228
197 Ga0068866_10001765 3300005718 Bacteria 9096
198 Ga0068866_10023812 3300005718 Bacteria 2853
199 Ga0068866_10154328 3300005718 Bacteria 1333
200 Ga0068861_100000763 3300005719 Bacteria 19317
201 Ga0068861_100066573 3300005719 Bacteria 2777
202 Ga0068861_100069249 3300005719 Bacteria 2729
203 Ga0068861_100272858 3300005719 Bacteria 1453
204 Ga0068851_10003427 3300005834 Bacteria 7059
205 Ga0068870_10000465 3300005840 Bacteria 15392
206 Ga0068870_10088440 3300005840 Bacteria 1727
207 Ga0068870_10173306 3300005840 Bacteria 1289
208 Ga0068863_100002646 3300005841 Bacteria 17718
209 Ga0068863_100004216 3300005841 Bacteria 14201
210 Ga0068863_100026191 3300005841 Bacteria 5565
211 Ga0068863_100095043 3300005841 Bacteria 2829
212 Ga0068863_100125674 3300005841 Bacteria 2447
213 Ga0068863_100133775 3300005841 Bacteria 2368
214 Ga0068863_100240775 3300005841 Bacteria 1746
215 Ga0068863_100530431 3300005841 Unclassified 1161
216 Ga0068858_100001097 3300005842 Bacteria 28000
217 Ga0068858_100002283 3300005842 Bacteria 19412
218 Ga0068858_100013852 3300005842 Bacteria 7608
219 Ga0068858_100020886 3300005842 Bacteria 6119
220 Ga0068858_100050272 3300005842 Bacteria 3858
221 Ga0068858_100085356 3300005842 Bacteria 2937
222 Ga0068858_100132554 3300005842 Bacteria 2337
223 Ga0068860_100002008 3300005843 Bacteria 21467
224 Ga0068860_100011356 3300005843 Bacteria 8777
225 Ga0068860_100018109 3300005843 Bacteria 6858
226 Ga0068860_100025768 3300005843 Bacteria 5672
227 Ga0068860_100194539 3300005843 Bacteria 1963
228 Ga0068862_100010431 3300005844 Bacteria 7672
229 Ga0068862_100020511 3300005844 Bacteria 5521
230 Ga0068862_100163744 3300005844 Bacteria 1987
231 Ga0068862_100174092 3300005844 Bacteria 1928
232 Ga0081540_1007994 3300005983 Bacteria 7445
233 Ga0081540_1059546 3300005983 Bacteria 1832
234 Ga0081539_10000004 3300005985 Bacteria 555600
235 Ga0070715_10043115 3300006163 Bacteria 1900
236 Ga0070716_100034389 3300006173 Bacteria 2779
237 Ga0070716_100390743 3300006173 Bacteria 997
238 Ga0070712_100042431 3300006175 Bacteria 3128
239 Ga0075366_10024347 3300006195 Bacteria 3531
240 Ga0075366_10103195 3300006195 Bacteria 1712
241 Ga0097621_100133962 3300006237 Bacteria 2111
242 Ga0097621_100218566 3300006237 Bacteria 1660
243 Ga0097621_100250147 3300006237 Bacteria 1552
244 Ga0075370_10002093 3300006353 Bacteria 9095
245 Ga0068871_100097933 3300006358 Bacteria 2453
246 Ga0075428_100083500 3300006844 Bacteria 3485
247 Ga0075433_10061907 3300006852 Bacteria 3278
248 Ga0075434_100404126 3300006871 Bacteria 1387
249 Ga0068865_100025970 3300006881 Bacteria 3858
250 Ga0068865_100250079 3300006881 Bacteria 1399
251 Ga0068865_100271951 3300006881 Bacteria 1346
252 Ga0097620_100000120 3300006931 Bacteria 74447
253 Ga0097620_100005938 3300006931 Bacteria 12396
254 Ga0097620_100007347 3300006931 Bacteria 11178
255 Ga0097620_100035434 3300006931 Bacteria 5007
256 Ga0097620_100046835 3300006931 Bacteria 4342
257 Ga0097620_100052471 3300006931 Bacteria 4099
258 Ga0079104_1018973 3300006946 Bacteria 1935
259 Ga0075435_100212434 3300007076 Bacteria 1642
260 Ga0099794_10020562 3300007265 Bacteria 2989
261 Ga0099795_10000002 3300007788 Bacteria 161112
262 Ga0105240_10023285 3300009093 Bacteria 8196
263 Ga0105240_10033897 3300009093 Bacteria 6593
264 Ga0111539_10439152 3300009094 Bacteria 1520
265 Ga0105245_10001088 3300009098 Bacteria 24634
266 Ga0105245_10213105 3300009098 Bacteria 1860
267 Ga0105247_10003310 3300009101 Bacteria 10556
268 Ga0105247_10006478 3300009101 Bacteria 7245
269 Ga0105247_10009360 3300009101 Bacteria 5948
270 Ga0105247_10190281 3300009101 Bacteria 1373
271 Ga0114129_10100375 3300009147 Bacteria 4005
272 Ga0114129_10179688 3300009147 Bacteria 2880
273 Ga0114129_11014234 3300009147 Bacteria 1044
274 Ga0105242_10007446 3300009176 Bacteria 8429
275 Ga0105242_10151634 3300009176 Bacteria 2021
276 Ga0105242_10401176 3300009176 Bacteria 1280
277 Ga0105242_10668393 3300009176 Bacteria 1012
278 Ga0105248_10000932 3300009177 Bacteria 32593
279 Ga0105248_10007614 3300009177 Bacteria 11897
280 Ga0105248_10012988 3300009177 Bacteria 9180
281 Ga0105248_10022317 3300009177 Bacteria 7019
282 Ga0105248_10358706 3300009177 Bacteria 1641
283 Ga0105248_10504849 3300009177 Bacteria 1363
284 Ga0105248_10650774 3300009177 Bacteria 1189
285 Ga0105248_10799851 3300009177 Bacteria 1064
286 Ga0105248_10897360 3300009177 Bacteria 1001
287 Ga0105237_10000529 3300009545 Bacteria 53671
288 Ga0105237_10025291 3300009545 Bacteria 6072
289 Ga0105237_10291255 3300009545 Bacteria 1635
290 Ga0105238_10001158 3300009551 Bacteria 26593
291 Ga0105238_10179733 3300009551 Bacteria 2093
292 Ga0105238_10220533 3300009551 Bacteria 1872
293 Ga0105238_10261123 3300009551 Bacteria 1711
294 Ga0105238_10672700 3300009551 Bacteria 1046
295 Ga0105249_10010730 3300009553 Bacteria 8048
296 Ga0105249_10040863 3300009553 Bacteria 4214
297 Ga0105249_10153769 3300009553 Bacteria 2217
298 Ga0105249_10299943 3300009553 Bacteria 1611
299 Ga0105249_10600388 3300009553 Bacteria 1155
300 Ga0099796_10000030 3300010159 Bacteria 32756
301 Ga0105239_10004965 3300010375 Bacteria 15709
302 Ga0105239_10238567 3300010375 Bacteria 2041
303 Ga0105246_10043837 3300011119 Bacteria 3037
304 Ga0157326_1002791 3300012513 Bacteria 1850
305 Ga0157373_10004123 3300013100 Bacteria 10959
306 Ga0157371_10002422 3300013102 Bacteria 17824
307 Ga0157370_10132141 3300013104 Bacteria 2328
308 Ga0157369_10029445 3300013105 Bacteria 6067
309 Ga0157369_10055066 3300013105 Bacteria 4294
310 Ga0157374_10357527 3300013296 Bacteria 1452
311 Ga0157378_10014175 3300013297 Bacteria 6975
312 Ga0157378_10017194 3300013297 Bacteria 6339
313 Ga0157378_10117243 3300013297 Bacteria 2449
314 Ga0163162_10002371 3300013306 Bacteria 17713
315 Ga0163162_10036504 3300013306 Bacteria 4899
316 Ga0163162_10071070 3300013306 Bacteria 3533
317 Ga0163162_10128514 3300013306 Bacteria 2642
318 Ga0163162_10262671 3300013306 Bacteria 1858
319 Ga0163162_10292831 3300013306 Bacteria 1759
320 Ga0157372_10005991 3300013307 Bacteria 12914
321 Ga0157372_10070381 3300013307 Bacteria 3936
322 Ga0157375_10034821 3300013308 Bacteria 4800
323 Ga0157375_10040657 3300013308 Bacteria 4484
324 Ga0157375_10209239 3300013308 Bacteria 2107
325 Ga0157375_10320504 3300013308 Bacteria 1715
326 Ga0157375_10788916 3300013308 Bacteria 1099
327 Ga0157375_11098472 3300013308 Bacteria 931
328 Ga0163163_10008221 3300014325 Bacteria 9259
329 Ga0163163_10042194 3300014325 Bacteria 4467
330 Ga0163163_10382021 3300014325 Bacteria 1466
331 Ga0163163_10486045 3300014325 Bacteria 1296
332 Ga0157380_10044789 3300014326 Bacteria 3469
333 Ga0157380_10252684 3300014326 Bacteria 1596
334 Ga0157377_10001646 3300014745 Bacteria 9747
335 Ga0157377_10021487 3300014745 Bacteria 3395
336 Ga0157379_10000415 3300014968 Bacteria 34568
337 Ga0157379_10002404 3300014968 Bacteria 15636
338 Ga0157379_10006726 3300014968 Bacteria 9932
339 Ga0157379_10029938 3300014968 Bacteria 4842
340 Ga0157379_10205071 3300014968 Bacteria 1783
341 Ga0157379_10275882 3300014968 Bacteria 1529
342 Ga0157379_10406014 3300014968 Bacteria 1253
343 Ga0157376_10049158 3300014969 Bacteria 3492
344 Ga0157376_10050310 3300014969 Bacteria 3457
345 Ga0157376_10070733 3300014969 Bacteria 2963
346 Ga0157376_10104373 3300014969 Bacteria 2483
347 Ga0157376_10348627 3300014969 Bacteria 1416
348 Ga0163161_10004923 3300017792 Bacteria 9293
349 Ga0163161_10008975 3300017792 Bacteria 6916
350 Ga0163161_10310378 3300017792 Bacteria 1244
351 Ga0213873_10019748 3300021358 Bacteria 1567
352 Ga0209435_100002 3300025206 Bacteria 794178
353 Ga0207425_1007536 3300025245 Bacteria 2863
354 Ga0207425_1015792 3300025245 Bacteria 1687
355 Ga0209646_1000001 3300025246 Bacteria 3092932
356 Ga0209026_1000001 3300025250 Bacteria 1228671
357 Ga0209759_1000001 3300025256 Bacteria 2799452
358 Ga0209565_1000043 3300025263 Bacteria 235332
359 Ga0209673_1000008 3300025273 Bacteria 626013
360 Ga0209130_1000276 3300025284 Bacteria 63841
361 Ga0209130_1000606 3300025284 Bacteria 34652
362 Ga0207673_1002411 3300025290 Bacteria 2133
363 Ga0209675_1000170 3300025291 Bacteria 78095
364 Ga0209675_1034291 3300025291 Bacteria 1168
365 Ga0209676_1000023 3300025292 Bacteria 589732
366 Ga0209676_1001474 3300025292 Bacteria 21818
367 Ga0209676_1014950 3300025292 Bacteria 2884
368 Ga0209025_1006123 3300025294 Bacteria 9487
369 Ga0209025_1030039 3300025294 Bacteria 2611
370 Ga0209025_1039291 3300025294 Bacteria 2066
371 Ga0209564_1009011 3300025295 Bacteria 4820
372 Ga0209758_1032079 3300025297 Bacteria 2141
373 Ga0209050_1000022 3300025298 Bacteria 565239
374 Ga0209256_1000001 3300025299 Bacteria 2166974
375 Ga0207426_1000424 3300025302 Bacteria 69170
376 Ga0207426_1002385 3300025302 Bacteria 12126
377 Ga0209051_1000013 3300025303 Bacteria 565239
378 Ga0209051_1048231 3300025303 Bacteria 1446
379 Ga0209257_1000042 3300025304 Bacteria 537149
380 Ga0209257_1007824 3300025304 Bacteria 6325
381 Ga0207697_10001107 3300025315 Bacteria 14856
382 Ga0207697_10041456 3300025315 Bacteria 1891
383 Ga0207697_10047209 3300025315 Bacteria 1775
384 Ga0207656_10014158 3300025321 Bacteria 3067
385 Ga0207682_10001279 3300025893 Bacteria 11559
386 Ga0207642_10072988 3300025899 Bacteria 1640
387 Ga0207710_10000498 3300025900 Bacteria 24454
388 Ga0207710_10014141 3300025900 Bacteria 3361
389 Ga0207688_10000412 3300025901 Bacteria 20074
390 Ga0207688_10086948 3300025901 Bacteria 1792
391 Ga0207680_10002034 3300025903 Bacteria 9470
392 Ga0207680_10021525 3300025903 Bacteria 3490
393 Ga0207680_10120199 3300025903 Bacteria 1717
394 Ga0207680_10126883 3300025903 Bacteria 1676
395 Ga0207680_10141052 3300025903 Bacteria 1597
396 Ga0207647_10067532 3300025904 Bacteria 2166
397 Ga0207647_10071413 3300025904 Bacteria 2094
398 Ga0207699_10022857 3300025906 Bacteria 3394
399 Ga0207645_10002807 3300025907 Bacteria 13531
400 Ga0207645_10052048 3300025907 Bacteria 2616
401 Ga0207645_10146441 3300025907 Bacteria 1540
402 Ga0207645_10192847 3300025907 Archaea 1339
403 Ga0207643_10000206 3300025908 Bacteria 41162
404 Ga0207643_10091798 3300025908 Bacteria 1771
405 Ga0207643_10206907 3300025908 Bacteria 1197
406 Ga0207705_10384792 3300025909 Bacteria 1084
407 Ga0207684_10013827 3300025910 Bacteria 6971
408 Ga0207684_10290102 3300025910 Bacteria 1411
409 Ga0207707_10021032 3300025912 Bacteria 5699
410 Ga0207695_10004136 3300025913 Bacteria 19925
411 Ga0207671_10004715 3300025914 Bacteria 12884
412 Ga0207671_10188441 3300025914 Bacteria 1608
413 Ga0207693_10001211 3300025915 Bacteria 23008
414 Ga0207662_10000767 3300025918 Bacteria 14737
415 Ga0207657_10006323 3300025919 Bacteria 12307
416 Ga0207657_10080921 3300025919 Bacteria 2729
417 Ga0207657_10456161 3300025919 Unclassified 1003
418 Ga0207649_10037376 3300025920 Bacteria 2933
419 Ga0207649_10046760 3300025920 Bacteria 2660
420 Ga0207646_10002427 3300025922 Bacteria 22002
421 Ga0207646_10097589 3300025922 Bacteria 2633
422 Ga0207681_10012555 3300025923 Bacteria 5229
423 Ga0207681_10049274 3300025923 Bacteria 2847
424 Ga0207681_10127492 3300025923 Bacteria 1876
425 Ga0207694_10020816 3300025924 Bacteria 4965
426 Ga0207694_10120076 3300025924 Bacteria 2098
427 Ga0207694_10524391 3300025924 Bacteria 993
428 Ga0207650_10004823 3300025925 Bacteria 9214
429 Ga0207650_10005403 3300025925 Bacteria 8719
430 Ga0207650_10006752 3300025925 Bacteria 7824
431 Ga0207650_10024908 3300025925 Unclassified 4259
432 Ga0207650_10026758 3300025925 Bacteria 4119
433 Ga0207650_10034009 3300025925 Bacteria 3695
434 Ga0207650_10045117 3300025925 Bacteria 3243
435 Ga0207650_10216269 3300025925 Bacteria 1541
436 Ga0207650_10253759 3300025925 Bacteria 1425
437 Ga0207659_10002376 3300025926 Bacteria 11206
438 Ga0207659_10002578 3300025926 Bacteria 10795
439 Ga0207659_10009413 3300025926 Bacteria 6103
440 Ga0207659_10173235 3300025926 Bacteria 1704
441 Ga0207687_10001135 3300025927 Bacteria 18126
442 Ga0207700_10000235 3300025928 Bacteria 33272
443 Ga0207664_10174274 3300025929 Bacteria 1843
444 Ga0207664_10566084 3300025929 Unclassified 1020
445 Ga0207644_10003360 3300025931 Bacteria 10327
446 Ga0207644_10008381 3300025931 Bacteria 6765
447 Ga0207644_10014036 3300025931 Bacteria 5355
448 Ga0207644_10021100 3300025931 Bacteria 4435
449 Ga0207644_10150955 3300025931 Bacteria 1798
450 Ga0207644_10168365 3300025931 Bacteria 1709
451 Ga0207644_10185059 3300025931 Bacteria 1635
452 Ga0207690_10002549 3300025932 Bacteria 11009
453 Ga0207690_10096180 3300025932 Bacteria 2105
454 Ga0207706_10002273 3300025933 Bacteria 18759
455 Ga0207706_10009405 3300025933 Bacteria 8972
456 Ga0207706_10117803 3300025933 Bacteria 2336
457 Ga0207706_10173396 3300025933 Bacteria 1895
458 Ga0207686_10017717 3300025934 Bacteria 4017
459 Ga0207686_10086001 3300025934 Bacteria 2064
460 Ga0207670_10047165 3300025936 Bacteria 2867
461 Ga0207669_10069012 3300025937 Bacteria 2210
462 Ga0207704_10018377 3300025938 Bacteria 3648
463 Ga0207665_10320282 3300025939 Bacteria 1163
464 Ga0207691_10003525 3300025940 Bacteria 15222
465 Ga0207691_10027310 3300025940 Bacteria 5352
466 Ga0207691_10028623 3300025940 Bacteria 5216
467 Ga0207691_10175562 3300025940 Bacteria 1874
468 Ga0207691_10274880 3300025940 Bacteria 1450
469 Ga0207711_10000875 3300025941 Bacteria 29095
470 Ga0207711_10008854 3300025941 Bacteria 8415
471 Ga0207711_10047956 3300025941 Bacteria 3654
472 Ga0207711_10067034 3300025941 Bacteria 3106
473 Ga0207711_10067232 3300025941 Bacteria 3102
474 Ga0207711_10086347 3300025941 Bacteria 2751
475 Ga0207711_10461545 3300025941 Bacteria 1183
476 Ga0207711_10531523 3300025941 Bacteria 1097
477 Ga0207689_10000368 3300025942 Bacteria 42563
478 Ga0207689_10000680 3300025942 Bacteria 32454
479 Ga0207689_10001762 3300025942 Bacteria 20417
480 Ga0207689_10017656 3300025942 Bacteria 6031
481 Ga0207689_10216603 3300025942 Bacteria 1582
482 Ga0207661_10043675 3300025944 Bacteria 3538
483 Ga0207679_10010864 3300025945 Bacteria 5870
484 Ga0207679_10055416 3300025945 Bacteria 2922
485 Ga0207679_10195594 3300025945 Bacteria 1685
486 Ga0207651_10018141 3300025960 Bacteria 4180
487 Ga0207651_10198094 3300025960 Bacteria 1607
488 Ga0207651_10207870 3300025960 Bacteria 1573
489 Ga0207651_10215563 3300025960 Bacteria 1548
490 Ga0207712_10006888 3300025961 Bacteria 7175
491 Ga0207712_10037084 3300025961 Bacteria 3324
492 Ga0207712_10361686 3300025961 Bacteria 1209
493 Ga0207668_10005456 3300025972 Bacteria 7489
494 Ga0207668_10023226 3300025972 Bacteria 3982
495 Ga0207668_10054274 3300025972 Bacteria 2781
496 Ga0207668_10066136 3300025972 Bacteria 2561
497 Ga0207668_10158483 3300025972 Bacteria 1761
498 Ga0207668_10240567 3300025972 Bacteria 1464
499 Ga0207668_10413991 3300025972 Bacteria 1143
500 Ga0207640_10002897 3300025981 Bacteria 9209
501 Ga0207640_10019277 3300025981 Bacteria 4027
502 Ga0207658_10025052 3300025986 Bacteria 4175
503 Ga0207658_10033583 3300025986 Bacteria 3661
504 Ga0207658_10206205 3300025986 Bacteria 1644
505 Ga0207658_10244519 3300025986 Bacteria 1522
506 Ga0207658_10338831 3300025986 Bacteria 1306
507 Ga0207658_10365929 3300025986 Bacteria 1259
508 Ga0207658_10402473 3300025986 Bacteria 1203
509 Ga0207677_10000161 3300026023 Bacteria 53405
510 Ga0207677_10033421 3300026023 Bacteria 3319
511 Ga0207703_10001193 3300026035 Bacteria 24452
512 Ga0207703_10002912 3300026035 Bacteria 14571
513 Ga0207703_10005544 3300026035 Bacteria 10129
514 Ga0207703_10021058 3300026035 Bacteria 5102
515 Ga0207703_10045656 3300026035 Bacteria 3525
516 Ga0207703_10225661 3300026035 Bacteria 1677
517 Ga0207703_10282288 3300026035 Bacteria 1508
518 Ga0207639_10002618 3300026041 Bacteria 12072
519 Ga0207639_10070923 3300026041 Bacteria 2724
520 Ga0207639_10112320 3300026041 Bacteria 2223
521 Ga0207639_10136167 3300026041 Bacteria 2040
522 Ga0207639_10582482 3300026041 Bacteria 1030
523 Ga0207678_10001429 3300026067 Bacteria 21902
524 Ga0207678_10019090 3300026067 Bacteria 6019
525 Ga0207708_10000801 3300026075 Bacteria 23675
526 Ga0207708_10313202 3300026075 Bacteria 1279
527 Ga0207702_10002331 3300026078 Bacteria 18139
528 Ga0207702_10414299 3300026078 Bacteria 1302
529 Ga0207641_10003390 3300026088 Bacteria 14137
530 Ga0207641_10017311 3300026088 Bacteria 5899
531 Ga0207641_10023876 3300026088 Bacteria 5040
532 Ga0207641_10029023 3300026088 Bacteria 4573
533 Ga0207641_10062590 3300026088 Bacteria 3176
534 Ga0207641_10075154 3300026088 Bacteria 2917
535 Ga0207641_10112795 3300026088 Bacteria 2413
536 Ga0207641_10218908 3300026088 Bacteria 1764
537 Ga0207641_10237818 3300026088 Bacteria 1696
538 Ga0207641_10321739 3300026088 Bacteria 1467
539 Ga0207641_10343396 3300026088 Bacteria 1421
540 Ga0207641_10450222 3300026088 Unclassified 1244
541 Ga0207641_10871314 3300026088 Bacteria 893
542 Ga0207648_10001630 3300026089 Bacteria 24588
543 Ga0207648_10001959 3300026089 Bacteria 22498
544 Ga0207648_10004070 3300026089 Bacteria 15160
545 Ga0207676_10001760 3300026095 Bacteria 15873
546 Ga0207676_10008040 3300026095 Bacteria 7499
547 Ga0207676_10046754 3300026095 Bacteria 3350
548 Ga0207676_10061313 3300026095 Bacteria 2977
549 Ga0207676_10100434 3300026095 Bacteria 2397
550 Ga0207676_10571086 3300026095 Bacteria 1083
551 Ga0207674_10003863 3300026116 Bacteria 18259
552 Ga0207674_10177407 3300026116 Bacteria 2083
553 Ga0207675_100000757 3300026118 Bacteria 32124
554 Ga0207675_100005312 3300026118 Bacteria 12380
555 Ga0207675_100129459 3300026118 Bacteria 2393
556 Ga0207675_100170319 3300026118 Bacteria 2081
557 Ga0207675_100267936 3300026118 Bacteria 1657
558 Ga0207675_100362239 3300026118 Bacteria 1423
559 Ga0207683_10009125 3300026121 Bacteria 8452
560 Ga0207683_10054944 3300026121 Bacteria 3492
561 Ga0207683_10206189 3300026121 Bacteria 1788
562 Ga0207698_10024708 3300026142 Bacteria 4222
563 Ga0207698_10062152 3300026142 Bacteria 2915
564 Ga0207698_10136138 3300026142 Bacteria 2108
565 Ga0209179_1000003 3300027512 Bacteria 121837
566 Ga0268266_10005673 3300028379 Bacteria 11577
567 Ga0268266_10170633 3300028379 Bacteria 1974
568 Ga0268266_10210710 3300028379 Bacteria 1782
569 Ga0268266_10304527 3300028379 Bacteria 1487
570 Ga0268265_10044878 3300028380 Bacteria 3294
571 Ga0268265_10049853 3300028380 Bacteria 3151
572 Ga0268265_10088527 3300028380 Bacteria 2467
573 Ga0268265_10332070 3300028380 Bacteria 1381
574 Ga0268264_10000258 3300028381 Bacteria 95778
575 Ga0268264_10003622 3300028381 Bacteria 13287
576 Ga0268264_10009768 3300028381 Bacteria 7944
577 Ga0268264_10122032 3300028381 Bacteria 2298
578 Ga0307517_10004509 3300028786 Bacteria 21378
579 Ga0307517_10216160 3300028786 Bacteria 1172
580 Ga0307515_10001016 3300028794 Bacteria 64080
581 Ga0307515_10053221 3300028794 Bacteria 5979
582 Ga0307515_10164980 3300028794 Bacteria 2238
583 Ga0307511_10001781 3300030521 Bacteria 22660
584 Ga0307511_10068034 3300030521 Bacteria 2635
585 Ga0307512_10005868 3300030522 Bacteria 12635
586 Ga0265328_10001761 3300031239 Bacteria 9905
587 Ga0265316_10234693 3300031344 Bacteria 1350
588 Ga0307513_10000922 3300031456 Bacteria 42476
589 Ga0307513_10004915 3300031456 Bacteria 17749
590 Ga0307513_10125622 3300031456 Bacteria 2521
591 Ga0307509_10000001 3300031507 Bacteria 629324
592 Ga0307509_10002304 3300031507 Bacteria 31126
593 Ga0307509_10003211 3300031507 Bacteria 25285
594 Ga0307509_10006141 3300031507 Bacteria 16291
595 Ga0307509_10194056 3300031507 Bacteria 1877
596 Ga0307408_100006738 3300031548 Bacteria 7613
597 Ga0307408_100117948 3300031548 Bacteria 2051
598 Ga0307508_10000016 3300031616 Bacteria 206976
599 Ga0307508_10016926 3300031616 Bacteria 6633
600 Ga0307508_10293775 3300031616 Bacteria 1218
601 Ga0307514_10001309 3300031649 Bacteria 31946
602 Ga0307514_10025688 3300031649 Bacteria 4765
603 Ga0316576_10036226 3300031727 Bacteria 3527
604 Ga0307516_10134544 3300031730 Bacteria 2248
605 Ga0307406_10034132 3300031901 Bacteria 3119
606 Ga0307406_10380361 3300031901 Bacteria 1113
607 Ga0307412_10500034 3300031911 Bacteria 1012
608 Ga0307409_100120784 3300031995 Bacteria 2218
609 Ga0307416_100108583 3300032002 Bacteria 2438
610 Ga0307416_100258741 3300032002 Bacteria 1700
611 Ga0307414_10161151 3300032004 Bacteria 1782
612 Ga0307507_10161654 3300033179 Bacteria 1653
613 Ga0307510_10000016 3300033180 Bacteria 206932
614 Ga0307510_10000568 3300033180 Bacteria 37247
615 Ga0307510_10012936 3300033180 Bacteria 9905
616 Ga0373926_0064143 3300035083 Bacteria 1342
617 Ga0373928_0016749 3300035084 Bacteria 1502
618 Ga0373936_0004753 3300035113 Bacteria 5130
619 Ga0373936_0018803 3300035113 Bacteria 2672
620 Ga0373936_0116958 3300035113 Bacteria 1136
621 Ga0373953_0067817 3300035117 Bacteria 1468
622 Ga0373953_0137270 3300035117 Bacteria 1045
623 Ga0373956_0103046 3300035119 Bacteria 1325
624 Ga0373943_0013281 3300035170 Bacteria 3718
625 Ga0373943_0078450 3300035170 Bacteria 1688
626 Ga0373943_0191353 3300035170 Bacteria 1129
627 Ga0373955_0141964 3300035172 Bacteria 1409
628 Ga0373931_0006871 3300035691 Bacteria 5350
629 Ga0373935_0053884 3300035692 Bacteria 2560
630 Ga0373927_0010403 3300035695 Bacteria 6206
631 Ga0373927_0034726 3300035695 Bacteria 3279
632 Ga0373927_0088882 3300035695 Bacteria 2006
633 Ga0373937_0011674 3300036401 Bacteria 7706
634 Ga0373937_0028315 3300036401 Bacteria 5069
635 Ga0373937_0083406 3300036401 Bacteria 2957
636 Ga0373937_0146815 3300036401 Bacteria 2208
637 Ga0373937_0284079 3300036401 Bacteria 1563
638 Ga0316582_0094925 3300036647 Bacteria 1968
639 Ga0373925_0002445 3300037068 Bacteria 14880
640 Ga0373925_0005322 3300037068 Bacteria 9605
641 Ga0373925_0142682 3300037068 Bacteria 1875
642 Ga0373925_0200341 3300037068 Bacteria 1587
643 Ga0395905_0149896 3300037471 Bacteria 2194
644 Ga0436364_0547719 3300037853 Bacteria 1145
645 Ga0436365_1602820 3300039437 Bacteria 7901
646 Ga0436361_0553303 3300039447 Bacteria 4625
647 Ga0436361_1056758 3300039447 Bacteria 10385
648 Ga0436362_0168894 3300039453 Bacteria 1660
649 Ga0451802_0976333 3300041460 Bacteria 1017
650 Ga0451853_0743422 3300041512 Bacteria 1483
651 Ga0451577_0381942 3300042876 Bacteria 1278
652 Ga0453684_0012382 3300044712 Bacteria 14081
653 Ga0451576_0006570 3300045051 Bacteria 14226
654 Ga0495592_0000213 3300046454 Bacteria 49631
655 Ga0495629_0243276 3300046459 Bacteria 1238
656 Ga0495580_0006680 3300046472 Bacteria 9364
657 Ga0495580_0089445 3300046472 Bacteria 2144
658 Ga0495580_0092904 3300046472 Bacteria 2100
659 Ga0495582_0006300 3300046473 Bacteria 6603
660 Ga0495639_0001129 3300046475 Bacteria 12056
661 Ga0495664_0012864 3300046477 Bacteria 4741
662 Ga0495610_0006121 3300046512 Bacteria 8389
663 Ga0495618_0228327 3300046514 Bacteria 1173
664 Ga0495620_0022462 3300046515 Bacteria 3037
665 Ga0495628_0065184 3300046516 Bacteria 2851
666 Ga0495628_0104418 3300046516 Bacteria 2184
667 Ga0495628_0296422 3300046516 Bacteria 1198
668 Ga0495630_0128688 3300046517 Bacteria 1922
669 Ga0495631_0085017 3300046518 Bacteria 1363
670 Ga0495632_0049207 3300046519 Bacteria 2084
671 Ga0495648_0037763 3300046524 Bacteria 3099
672 Ga0495648_0056842 3300046524 Bacteria 2351
673 Ga0495640_0194584 3300046533 Bacteria 1288
674 Ga0495586_0082591 3300046535 Bacteria 1767
675 Ga0495587_0143098 3300046536 Bacteria 1364
676 Ga0495609_0048923 3300046538 Bacteria 1888
677 Ga0495621_0014269 3300046539 Bacteria 2512
678 Ga0495645_0008744 3300046543 Bacteria 7071
679 Ga0495645_0180266 3300046543 Bacteria 1448
680 Ga0495667_0103985 3300046559 Bacteria 1836
681 Ga0495634_0243949 3300046642 Bacteria 1101
682 Ga0495611_0021683 3300046648 Bacteria 2776
683 Ga0495625_0086310 3300046660 Bacteria 2177
684 Ga0495635_0001307 3300046663 Bacteria 16596
685 Ga0495588_0138147 3300046674 Bacteria 1287
686 Ga0495657_0091419 3300046675 Bacteria 1952
687 Ga0495647_0016198 3300046681 Bacteria 2621
688 Ga0495658_0385623 3300046683 Bacteria 892
689 Ga0495613_0009009 3300046689 Bacteria 7404
690 Ga0495613_0132690 3300046689 Bacteria 1783
691 Ga0495649_0001371 3300046694 Bacteria 18487
692 Ga0495600_0105695 3300046809 Bacteria 1834
693 Ga0495660_0008413 3300046810 Bacteria 6039
694 Ga0495581_0003182 3300047315 Bacteria 9396
695 Ga0495604_0128897 3300047317 Bacteria 1821
696 Ga0495676_0061762 3300047321 Bacteria 2929
697 Ga0495680_0041057 3300047322 Bacteria 3680
698 Ga0495687_021846 3300047443 Bacteria 3084
699 Ga0495687_060153 3300047443 Bacteria 1568
700 Ga0495675_0098967 3300047444 Bacteria 1826
701 Ga0495684_0080209 3300047471 Bacteria 2477
702 Ga0495686_0019493 3300047472 Bacteria 4531
703 Ga0495602_0287227 3300048088 Bacteria 1209
704 Ga0496100_0196506 3300048903 Bacteria 1468
705 Ga0496101_0059872 3300048904 Bacteria 2761
706 Ga0496101_0193331 3300048904 Bacteria 1571
707 Ga0496102_0023903 3300048905 Bacteria 5432
708 Ga0496102_0268441 3300048905 Bacteria 1609
709 Ga0496102_0399500 3300048905 Bacteria 1292
710 Ga0496102_0438507 3300048905 Bacteria 1226
711 Ga0496104_0017893 3300048907 Bacteria 6461
712 Ga0496104_0191588 3300048907 Bacteria 1956
713 Ga0496104_0261726 3300048907 Bacteria 1642
714 Ga0496106_0004160 3300048909 Bacteria 10784
715 Ga0496106_0085083 3300048909 Bacteria 2434
716 Ga0496107_0001689 3300048910 Bacteria 13821
717 Ga0496107_0100898 3300048910 Bacteria 2116
718 Ga0496108_0011827 3300048911 Bacteria 7101
719 Ga0496108_0174692 3300048911 Bacteria 1859
720 Ga0496108_0202562 3300048911 Bacteria 1722
721 Ga0496108_0442035 3300048911 Bacteria 1136
722 Ga0496109_0018702 3300048912 Bacteria 6091
723 Ga0496109_0099189 3300048912 Bacteria 2701
724 Ga0496110_0005186 3300048913 Bacteria 10192
725 Ga0496110_0012457 3300048913 Bacteria 6993
726 Ga0496110_0290877 3300048913 Bacteria 1488
727 Ga0496112_0006113 3300048915 Bacteria 10523
728 Ga0496112_0028502 3300048915 Bacteria 5391
729 Ga0496113_0281011 3300048916 Bacteria 1331
730 Ga0496119_0003074 3300048922 Bacteria 17624
731 Ga0496120_0000146 3300048923 Bacteria 119164
732 Ga0496120_0080131 3300048923 Bacteria 1771
733 Ga0496121_0001394 3300048924 Bacteria 40889
734 Ga0496122_0018855 3300048925 Bacteria 6341
735 Ga0496123_0003048 3300048926 Bacteria 19280
736 Ga0496125_0002028 3300048928 Bacteria 27433
737 Ga0496125_0022664 3300048928 Bacteria 5825
738 Ga0496125_0034598 3300048928 Bacteria 4450
739 Ga0496125_0151092 3300048928 Bacteria 1595
740 Ga0496126_0230752 3300048929 Bacteria 1551
741 Ga0495682_0085515 3300049460 Bacteria 1133
742 Ga0501034_0582112 3300049571 Bacteria 1026
743 Ga0501034_0606213 3300049571 Bacteria 1000
744 Ga0501036_0059648 3300049572 Bacteria 3233
745 Ga0501037_0070807 3300049573 Bacteria 2537
746 Ga0501038_0067831 3300049574 Bacteria 3034
747 Ga0501038_0375826 3300049574 Bacteria 1103
748 Ga0501039_0022919 3300049575 Bacteria 4790
749 Ga0501042_0029607 3300049578 Bacteria 3862
750 Ga0501043_0366325 3300049579 Bacteria 1093
751 Ga0501047_0002078 3300049581 Bacteria 19164
752 Ga0501047_0169468 3300049581 Bacteria 2053
753 Ga0501069_0011576 3300049585 Bacteria 4675
754 Ga0501070_0132545 3300049586 Bacteria 2058
755 Ga0501075_0400538 3300049591 Bacteria 1046
756 Ga0501077_0164766 3300049593 Bacteria 1408
757 Ga0501035_0144846 3300049822 Bacteria 2064
758 Ga0501035_0155500 3300049822 Bacteria 1982
759 Ga0501035_0206100 3300049822 Bacteria 1684
760 Ga0501045_0131533 3300049824 Bacteria 1860
761 nmdc:mga0k408_2913_c1 3300050493 Bacteria 9066
762 nmdc:mga07m45_416_c1 3300050496 Bacteria 17644
763 nmdc:mga05p37_433905_c1 3300050507 Bacteria 1525
764 nmdc:mga05p37_660958_c1 3300050507 Bacteria 1168
765 nmdc:mga08y16_380282_c1 3300050511 Bacteria 1447
766 nmdc:mga0a205_9126_c1 3300050515 Bacteria 9051
767 Ga0495601_0294884 3300053077 Bacteria 1057
768 Ga0495612_0031459 3300053078 Bacteria 2140
769 Ga0495619_0010046 3300053085 Bacteria 5958
770 Ga0500644_0006593 3300053088 Bacteria 2983
771 Ga0500566_0182051 3300053094 Bacteria 1077
772 Ga0500650_0089437 3300053098 Bacteria 1441
773 Ga0500556_0000018 3300053104 Bacteria 188459
774 Ga0500593_005348 3300053117 Bacteria 5049
775 Ga0500595_040266 3300053119 Bacteria 1508
776 Ga0500614_032984 3300053123 Bacteria 1277
777 Ga0500618_024392 3300053125 Bacteria 1457
778 Ga0500559_0000236 3300053136 Bacteria 43881
779 Ga0500568_0014028 3300053139 Bacteria 3632
780 Ga0500619_019941 3300053154 Bacteria 1908
781 Ga0500622_0017749 3300053156 Bacteria 3785
782 Ga0500630_060302 3300053159 Bacteria 1814
783 Ga0500637_0007664 3300053178 Bacteria 5412
784 Ga0500645_000596 3300053730 Bacteria 23287
785 Ga0500645_001816 3300053730 Bacteria 10220
786 Ga0500645_018580 3300053730 Bacteria 2170
787 Ga0500661_013176 3300055283 Bacteria 1490
788 2508727656 2508501050 Bacteria 9633614
789 2509077358 2508501114 Bacteria 7082538
790 2510843636 2510461069 Bacteria 5505000
791 2511243004 2511231002 Bacteria 5042903
792 2774869158 2773857925 Bacteria 6472445
793 2776258384 2775506901 Bacteria 9631051
794 2835317460 2835312727 Bacteria 7413381
795 2837652039 2837651117 Bacteria 3772164
796 2837680040 2837678835 Bacteria 5252418
797 2840882090 2840878972 Bacteria 5483153
798 2882457612 2882456835 Bacteria 6863978
799 2884301219 2884298095 Bacteria 3823049
800 2894236163 2894232714 Bacteria 8834183
801 2899804768 2899803654 Bacteria 5577784
802 2919707739 2919704043 Bacteria 5560311
803 2989354410 2989349275 Bacteria 6349068
804 8054566951 8054563764 Bacteria 5592885
805 Ga0373937_0120821
806 JGI24740J21852_10038698
807 JGI25155J39150_1000104
808 JGI25156J39149_1000089
809 JGI25154J39366_1000115
810 JGI25157J39369_1000118
811 JGI25159J45721_1006856
812 JGI25159J45721_1007148
813 JGI25151J46595_10018037
814 rootH1_10104496
815 rootH1_10122896
816 JGI25160J50197_1000281
817 JGI25161J50226_1000124
818 JGI25161J50226_1000228
819 Ga0055537_1000218
820 Ga0055524_1000119
821 Ga0055536_1005225
822 Ga0055534_1003730
823 Ga0055530_10000322
824 Ga0055540_1000058
825 Ga0055531_10009332
826 Ga0055543_1001000
827 Ga0065715_10099762
828 Ga0065715_10147158
829 Ga0070676_10003660
830 Ga0070676_10034239
831 Ga0070676_10309324
832 Ga0070683_100004502
833 Ga0070690_100003236
834 Ga0070690_100040565
835 Ga0070690_100122346
836 Ga0070670_100004913
837 Ga0070670_100022011
838 Ga0070670_100030016
839 Ga0070670_100036607
840 Ga0070670_100060219
841 Ga0070670_100155119
842 Ga0070670_100178796
843 Ga0070670_100270446
844 Ga0070677_10110452
845 Ga0068869_100000933
846 Ga0068869_100003186
847 Ga0068869_100010839
848 Ga0070666_10049714
849 Ga0070666_10055020
850 Ga0070666_10065337
851 Ga0070666_10067255
852 Ga0070666_10147063
853 Ga0070666_10154017
854 Ga0070666_10226210
855 Ga0068868_100000470
856 Ga0068868_100007161
857 Ga0068868_100121216
858 Ga0070660_100036746
859 Ga0070689_100014621
860 Ga0070689_100236119
861 Ga0070689_100241066
862 Ga0070687_100094805
863 Ga0070661_100003664
864 Ga0070661_100006249
865 Ga0070661_100047127
866 Ga0070661_100335257
867 Ga0070668_100011167
868 Ga0070668_100015214
869 Ga0070668_100015517
870 Ga0070668_100072219
871 Ga0070668_100431472
872 Ga0070669_100010514
873 Ga0070669_100137109
874 Ga0070669_100198138
875 Ga0070669_100257717
876 Ga0070669_100272948
877 Ga0070669_100368236
878 Ga0070675_100036643
879 Ga0070675_100042544
880 Ga0070675_100259003
881 Ga0070671_100032084
882 Ga0070671_100032238
883 Ga0070671_100032541
884 Ga0070671_100035903
885 Ga0070671_100038582
886 Ga0070671_100049945
887 Ga0070671_100063396
888 Ga0070671_100179268
889 Ga0070674_100015365
890 Ga0070674_100147916
891 Ga0070674_100487899
892 Ga0070673_100008174
893 Ga0070673_100008978
894 Ga0070673_100012046
895 Ga0070673_100083349
896 Ga0070673_100223269
897 Ga0070673_100247622
898 Ga0070688_100027533
899 Ga0070688_100222594
900 Ga0070659_100002977
901 Ga0070659_100129241
902 Ga0070667_100002837
903 Ga0070667_100005881
904 Ga0070667_100044086
905 Ga0070667_100068471
906 Ga0070667_100167802
907 Ga0070667_100220825
908 Ga0070667_100353387
909 Ga0070667_100397591
910 Ga0070667_100603289
911 Ga0070667_100621638
912 Ga0070709_10002492
913 Ga0070713_100000089
914 Ga0070710_10000978
915 Ga0070701_10231120
916 Ga0070701_10244046
917 Ga0070711_100004025
918 Ga0070711_100079914
919 Ga0070711_100124886
920 Ga0070705_100096050
921 Ga0070700_100324425
922 Ga0070694_100152881
923 Ga0070708_100000053
924 Ga0070708_100146132
925 Ga0070663_100000563
926 Ga0070663_100094378
927 Ga0070663_100341863
928 Ga0070678_100078264
929 Ga0070678_100100318
930 Ga0070678_100104916
931 Ga0070678_100156842
932 Ga0070662_100000493
933 Ga0070662_100098430
934 Ga0070681_10012370
935 Ga0068867_100002313
936 Ga0068867_100392524
937 Ga0070685_10001266
938 Ga0070685_10007358
939 Ga0070685_10185230
940 Ga0070706_100020939
941 Ga0070706_100024748
942 Ga0070706_100366213
943 Ga0070707_100025803
944 Ga0070699_100402353
945 Ga0070684_100022586
946 Ga0070697_100037673
947 Ga0068853_100003287
948 Ga0068853_100289820
949 Ga0068853_100322870
950 Ga0068853_100554314
951 Ga0068853_100588639
952 Ga0070672_100003389
953 Ga0070672_100016459
954 Ga0070672_100026315
955 Ga0070672_100122885
956 Ga0070672_100237354
957 Ga0070686_100001970
958 Ga0070695_100001102
959 Ga0070695_100083058
960 Ga0070695_100181428
961 Ga0070665_100003009
962 Ga0070665_100003275
963 Ga0070665_100014341
964 Ga0070665_100043553
965 Ga0070665_100049341
966 Ga0070665_100237600
967 Ga0070665_100503507
968 Ga0070665_100582131
969 Ga0070704_100029023
970 Ga0068855_100003372
971 Ga0068855_100096663
972 Ga0070664_100003982
973 Ga0068857_100092994
974 Ga0068854_100004404
975 Ga0068854_100010639
976 Ga0068854_100055051
977 Ga0068854_100180136
978 Ga0068854_100293408
979 Ga0068854_100509479
980 Ga0068856_100000282
981 Ga0068856_100114795
982 Ga0068856_100290769
983 Ga0070702_100005347
984 Ga0070702_100036198
985 Ga0068852_100000749
986 Ga0068852_100071156
987 Ga0068852_100076808
988 Ga0068859_100000120
989 Ga0068859_100005936
990 Ga0068859_100007348
991 Ga0068859_100035437
992 Ga0068859_100046831
993 Ga0068859_100052470
994 Ga0068864_100004562
995 Ga0068864_100007614
996 Ga0068864_100008422
997 Ga0068864_100014701
998 Ga0068864_100023641
999 Ga0068864_100086784
1000 Ga0068864_100452166
1001 Ga0068866_10001765
1002 Ga0068866_10023812
1003 Ga0068866_10154328
1004 Ga0068861_100000763
1005 Ga0068861_100066573
1006 Ga0068861_100069249
1007 Ga0068861_100272858
1008 Ga0068851_10003427
1009 Ga0068870_10000465
1010 Ga0068870_10088440
1011 Ga0068870_10173306
1012 Ga0068863_100002646
1013 Ga0068863_100004216
1014 Ga0068863_100026191
1015 Ga0068863_100095043
1016 Ga0068863_100125674
1017 Ga0068863_100133775
1018 Ga0068863_100240775
1019 Ga0068863_100530431
1020 Ga0068858_100001097
1021 Ga0068858_100002283
1022 Ga0068858_100013852
1023 Ga0068858_100020886
1024 Ga0068858_100050272
1025 Ga0068858_100085356
1026 Ga0068858_100132554
1027 Ga0068860_100002008
1028 Ga0068860_100011356
1029 Ga0068860_100018109
1030 Ga0068860_100025768
1031 Ga0068860_100194539
1032 Ga0068862_100010431
1033 Ga0068862_100020511
1034 Ga0068862_100163744
1035 Ga0068862_100174092
1036 Ga0081540_1007994
1037 Ga0081540_1059546
1038 Ga0081539_10000004
1039 Ga0070715_10043115
1040 Ga0070716_100034389
1041 Ga0070716_100390743
1042 Ga0070712_100042431
1043 Ga0075366_10024347
1044 Ga0075366_10103195
1045 Ga0097621_100133962
1046 Ga0097621_100218566
1047 Ga0097621_100250147
1048 Ga0075370_10002093
1049 Ga0068871_100097933
1050 Ga0075428_100083500
1051 Ga0075433_10061907
1052 Ga0075434_100404126
1053 Ga0068865_100025970
1054 Ga0068865_100250079
1055 Ga0068865_100271951
1056 Ga0097620_100000120
1057 Ga0097620_100005938
1058 Ga0097620_100007347
1059 Ga0097620_100035434
1060 Ga0097620_100046835
1061 Ga0097620_100052471
1062 Ga0079104_1018973
1063 Ga0075435_100212434
1064 Ga0099794_10020562
1065 Ga0099795_10000002
1066 Ga0105240_10023285
1067 Ga0105240_10033897
1068 Ga0111539_10439152
1069 Ga0105245_10001088
1070 Ga0105245_10213105
1071 Ga0105247_10003310
1072 Ga0105247_10006478
1073 Ga0105247_10009360
1074 Ga0105247_10190281
1075 Ga0114129_10100375
1076 Ga0114129_10179688
1077 Ga0114129_11014234
1078 Ga0105242_10007446
1079 Ga0105242_10151634
1080 Ga0105242_10401176
1081 Ga0105242_10668393
1082 Ga0105248_10000932
1083 Ga0105248_10007614
1084 Ga0105248_10012988
1085 Ga0105248_10022317
1086 Ga0105248_10358706
1087 Ga0105248_10504849
1088 Ga0105248_10650774
1089 Ga0105248_10799851
1090 Ga0105248_10897360
1091 Ga0105237_10000529
1092 Ga0105237_10025291
1093 Ga0105237_10291255
1094 Ga0105238_10001158
1095 Ga0105238_10179733
1096 Ga0105238_10220533
1097 Ga0105238_10261123
1098 Ga0105238_10672700
1099 Ga0105249_10010730
1100 Ga0105249_10040863
1101 Ga0105249_10153769
1102 Ga0105249_10299943
1103 Ga0105249_10600388
1104 Ga0099796_10000030
1105 Ga0105239_10004965
1106 Ga0105239_10238567
1107 Ga0105246_10043837
1108 Ga0157326_1002791
1109 Ga0157373_10004123
1110 Ga0157371_10002422
1111 Ga0157370_10132141
1112 Ga0157369_10029445
1113 Ga0157369_10055066
1114 Ga0157374_10357527
1115 Ga0157378_10014175
1116 Ga0157378_10017194
1117 Ga0157378_10117243
1118 Ga0163162_10002371
1119 Ga0163162_10036504
1120 Ga0163162_10071070
1121 Ga0163162_10128514
1122 Ga0163162_10262671
1123 Ga0163162_10292831
1124 Ga0157372_10005991
1125 Ga0157372_10070381
1126 Ga0157375_10034821
1127 Ga0157375_10040657
1128 Ga0157375_10209239
1129 Ga0157375_10320504
1130 Ga0157375_10788916
1131 Ga0157375_11098472
1132 Ga0163163_10008221
1133 Ga0163163_10042194
1134 Ga0163163_10382021
1135 Ga0163163_10486045
1136 Ga0157380_10044789
1137 Ga0157380_10252684
1138 Ga0157377_10001646
1139 Ga0157377_10021487
1140 Ga0157379_10000415
1141 Ga0157379_10002404
1142 Ga0157379_10006726
1143 Ga0157379_10029938
1144 Ga0157379_10205071
1145 Ga0157379_10275882
1146 Ga0157379_10406014
1147 Ga0157376_10049158
1148 Ga0157376_10050310
1149 Ga0157376_10070733
1150 Ga0157376_10104373
1151 Ga0157376_10348627
1152 Ga0163161_10004923
1153 Ga0163161_10008975
1154 Ga0163161_10310378
1155 Ga0213873_10019748
1156 Ga0209435_100002
1157 Ga0207425_1007536
1158 Ga0207425_1015792
1159 Ga0209646_1000001
1160 Ga0209026_1000001
1161 Ga0209759_1000001
1162 Ga0209565_1000043
1163 Ga0209673_1000008
1164 Ga0209130_1000276
1165 Ga0209130_1000606
1166 Ga0207673_1002411
1167 Ga0209675_1000170
1168 Ga0209675_1034291
1169 Ga0209676_1000023
1170 Ga0209676_1001474
1171 Ga0209676_1014950
1172 Ga0209025_1006123
1173 Ga0209025_1030039
1174 Ga0209025_1039291
1175 Ga0209564_1009011
1176 Ga0209758_1032079
1177 Ga0209050_1000022
1178 Ga0209256_1000001
1179 Ga0207426_1000424
1180 Ga0207426_1002385
1181 Ga0209051_1000013
1182 Ga0209051_1048231
1183 Ga0209257_1000042
1184 Ga0209257_1007824
1185 Ga0207697_10001107
1186 Ga0207697_10041456
1187 Ga0207697_10047209
1188 Ga0207656_10014158
1189 Ga0207682_10001279
1190 Ga0207642_10072988
1191 Ga0207710_10000498
1192 Ga0207710_10014141
1193 Ga0207688_10000412
1194 Ga0207688_10086948
1195 Ga0207680_10002034
1196 Ga0207680_10021525
1197 Ga0207680_10120199
1198 Ga0207680_10126883
1199 Ga0207680_10141052
1200 Ga0207647_10067532
1201 Ga0207647_10071413
1202 Ga0207699_10022857
1203 Ga0207645_10002807
1204 Ga0207645_10052048
1205 Ga0207645_10146441
1206 Ga0207645_10192847
1207 Ga0207643_10000206
1208 Ga0207643_10091798
1209 Ga0207643_10206907
1210 Ga0207705_10384792
1211 Ga0207684_10013827
1212 Ga0207684_10290102
1213 Ga0207707_10021032
1214 Ga0207695_10004136
1215 Ga0207671_10004715
1216 Ga0207671_10188441
1217 Ga0207693_10001211
1218 Ga0207662_10000767
1219 Ga0207657_10006323
1220 Ga0207657_10080921
1221 Ga0207657_10456161
1222 Ga0207649_10037376
1223 Ga0207649_10046760
1224 Ga0207646_10002427
1225 Ga0207646_10097589
1226 Ga0207681_10012555
1227 Ga0207681_10049274
1228 Ga0207681_10127492
1229 Ga0207694_10020816
1230 Ga0207694_10120076
1231 Ga0207694_10524391
1232 Ga0207650_10004823
1233 Ga0207650_10005403
1234 Ga0207650_10006752
1235 Ga0207650_10024908
1236 Ga0207650_10026758
1237 Ga0207650_10034009
1238 Ga0207650_10045117
1239 Ga0207650_10216269
1240 Ga0207650_10253759
1241 Ga0207659_10002376
1242 Ga0207659_10002578
1243 Ga0207659_10009413
1244 Ga0207659_10173235
1245 Ga0207687_10001135
1246 Ga0207700_10000235
1247 Ga0207664_10174274
1248 Ga0207664_10566084
1249 Ga0207644_10003360
1250 Ga0207644_10008381
1251 Ga0207644_10014036
1252 Ga0207644_10021100
1253 Ga0207644_10150955
1254 Ga0207644_10168365
1255 Ga0207644_10185059
1256 Ga0207690_10002549
1257 Ga0207690_10096180
1258 Ga0207706_10002273
1259 Ga0207706_10009405
1260 Ga0207706_10117803
1261 Ga0207706_10173396
1262 Ga0207686_10017717
1263 Ga0207686_10086001
1264 Ga0207670_10047165
1265 Ga0207669_10069012
1266 Ga0207704_10018377
1267 Ga0207665_10320282
1268 Ga0207691_10003525
1269 Ga0207691_10027310
1270 Ga0207691_10028623
1271 Ga0207691_10175562
1272 Ga0207691_10274880
1273 Ga0207711_10000875
1274 Ga0207711_10008854
1275 Ga0207711_10047956
1276 Ga0207711_10067034
1277 Ga0207711_10067232
1278 Ga0207711_10086347
1279 Ga0207711_10461545
1280 Ga0207711_10531523
1281 Ga0207689_10000368
1282 Ga0207689_10000680
1283 Ga0207689_10001762
1284 Ga0207689_10017656
1285 Ga0207689_10216603
1286 Ga0207661_10043675
1287 Ga0207679_10010864
1288 Ga0207679_10055416
1289 Ga0207679_10195594
1290 Ga0207651_10018141
1291 Ga0207651_10198094
1292 Ga0207651_10207870
1293 Ga0207651_10215563
1294 Ga0207712_10006888
1295 Ga0207712_10037084
1296 Ga0207712_10361686
1297 Ga0207668_10005456
1298 Ga0207668_10023226
1299 Ga0207668_10054274
1300 Ga0207668_10066136
1301 Ga0207668_10158483
1302 Ga0207668_10240567
1303 Ga0207668_10413991
1304 Ga0207640_10002897
1305 Ga0207640_10019277
1306 Ga0207658_10025052
1307 Ga0207658_10033583
1308 Ga0207658_10206205
1309 Ga0207658_10244519
1310 Ga0207658_10338831
1311 Ga0207658_10365929
1312 Ga0207658_10402473
1313 Ga0207677_10000161
1314 Ga0207677_10033421
1315 Ga0207703_10001193
1316 Ga0207703_10002912
1317 Ga0207703_10005544
1318 Ga0207703_10021058
1319 Ga0207703_10045656
1320 Ga0207703_10225661
1321 Ga0207703_10282288
1322 Ga0207639_10002618
1323 Ga0207639_10070923
1324 Ga0207639_10112320
1325 Ga0207639_10136167
1326 Ga0207639_10582482
1327 Ga0207678_10001429
1328 Ga0207678_10019090
1329 Ga0207708_10000801
1330 Ga0207708_10313202
1331 Ga0207702_10002331
1332 Ga0207702_10414299
1333 Ga0207641_10003390
1334 Ga0207641_10017311
1335 Ga0207641_10023876
1336 Ga0207641_10029023
1337 Ga0207641_10062590
1338 Ga0207641_10075154
1339 Ga0207641_10112795
1340 Ga0207641_10218908
1341 Ga0207641_10237818
1342 Ga0207641_10321739
1343 Ga0207641_10343396
1344 Ga0207641_10450222
1345 Ga0207641_10871314
1346 Ga0207648_10001630
1347 Ga0207648_10001959
1348 Ga0207648_10004070
1349 Ga0207676_10001760
1350 Ga0207676_10008040
1351 Ga0207676_10046754
1352 Ga0207676_10061313
1353 Ga0207676_10100434
1354 Ga0207676_10571086
1355 Ga0207674_10003863
1356 Ga0207674_10177407
1357 Ga0207675_100000757
1358 Ga0207675_100005312
1359 Ga0207675_100129459
1360 Ga0207675_100170319
1361 Ga0207675_100267936
1362 Ga0207675_100362239
1363 Ga0207683_10009125
1364 Ga0207683_10054944
1365 Ga0207683_10206189
1366 Ga0207698_10024708
1367 Ga0207698_10062152
1368 Ga0207698_10136138
1369 Ga0209179_1000003
1370 Ga0268266_10005673
1371 Ga0268266_10170633
1372 Ga0268266_10210710
1373 Ga0268266_10304527
1374 Ga0268265_10044878
1375 Ga0268265_10049853
1376 Ga0268265_10088527
1377 Ga0268265_10332070
1378 Ga0268264_10000258
1379 Ga0268264_10003622
1380 Ga0268264_10009768
1381 Ga0268264_10122032
1382 Ga0307517_10004509
1383 Ga0307517_10216160
1384 Ga0307515_10001016
1385 Ga0307515_10053221
1386 Ga0307515_10164980
1387 Ga0307511_10001781
1388 Ga0307511_10068034
1389 Ga0307512_10005868
1390 Ga0265328_10001761
1391 Ga0265316_10234693
1392 Ga0307513_10000922
1393 Ga0307513_10004915
1394 Ga0307513_10125622
1395 Ga0307509_10000001
1396 Ga0307509_10002304
1397 Ga0307509_10003211
1398 Ga0307509_10006141
1399 Ga0307509_10194056
1400 Ga0307408_100006738
1401 Ga0307408_100117948
1402 Ga0307508_10000016
1403 Ga0307508_10016926
1404 Ga0307508_10293775
1405 Ga0307514_10001309
1406 Ga0307514_10025688
1407 Ga0316576_10036226
1408 Ga0307516_10134544
1409 Ga0307406_10034132
1410 Ga0307406_10380361
1411 Ga0307412_10500034
1412 Ga0307409_100120784
1413 Ga0307416_100108583
1414 Ga0307416_100258741
1415 Ga0307414_10161151
1416 Ga0307507_10161654
1417 Ga0307510_10000016
1418 Ga0307510_10000568
1419 Ga0307510_10012936
1420 Ga0373926_0064143
1421 Ga0373928_0016749
1422 Ga0373936_0004753
1423 Ga0373936_0018803
1424 Ga0373936_0116958
1425 Ga0373953_0067817
1426 Ga0373953_0137270
1427 Ga0373956_0103046
1428 Ga0373943_0013281
1429 Ga0373943_0078450
1430 Ga0373943_0191353
1431 Ga0373955_0141964
1432 Ga0373931_0006871
1433 Ga0373935_0053884
1434 Ga0373927_0010403
1435 Ga0373927_0034726
1436 Ga0373927_0088882
1437 Ga0373937_0011674
1438 Ga0373937_0028315
1439 Ga0373937_0083406
1440 Ga0373937_0146815
1441 Ga0373937_0284079
1442 Ga0316582_0094925
1443 Ga0373925_0002445
1444 Ga0373925_0005322
1445 Ga0373925_0142682
1446 Ga0373925_0200341
1447 Ga0395905_0149896
1448 Ga0436364_0547719
1449 Ga0436365_1602820
1450 Ga0436361_0553303
1451 Ga0436361_1056758
1452 Ga0436362_0168894
1453 Ga0451802_0976333
1454 Ga0451853_0743422
1455 Ga0451577_0381942
1456 Ga0453684_0012382
1457 Ga0451576_0006570
1458 Ga0495592_0000213
1459 Ga0495629_0243276
1460 Ga0495580_0006680
1461 Ga0495580_0089445
1462 Ga0495580_0092904
1463 Ga0495582_0006300
1464 Ga0495639_0001129
1465 Ga0495664_0012864
1466 Ga0495610_0006121
1467 Ga0495618_0228327
1468 Ga0495620_0022462
1469 Ga0495628_0065184
1470 Ga0495628_0104418
1471 Ga0495628_0296422
1472 Ga0495630_0128688
1473 Ga0495631_0085017
1474 Ga0495632_0049207
1475 Ga0495648_0037763
1476 Ga0495648_0056842
1477 Ga0495640_0194584
1478 Ga0495586_0082591
1479 Ga0495587_0143098
1480 Ga0495609_0048923
1481 Ga0495621_0014269
1482 Ga0495645_0008744
1483 Ga0495645_0180266
1484 Ga0495667_0103985
1485 Ga0495634_0243949
1486 Ga0495611_0021683
1487 Ga0495625_0086310
1488 Ga0495635_0001307
1489 Ga0495588_0138147
1490 Ga0495657_0091419
1491 Ga0495647_0016198
1492 Ga0495658_0385623
1493 Ga0495613_0009009
1494 Ga0495613_0132690
1495 Ga0495649_0001371
1496 Ga0495600_0105695
1497 Ga0495660_0008413
1498 Ga0495581_0003182
1499 Ga0495604_0128897
1500 Ga0495676_0061762
1501 Ga0495680_0041057
1502 Ga0495687_021846
1503 Ga0495687_060153
1504 Ga0495675_0098967
1505 Ga0495684_0080209
1506 Ga0495686_0019493
1507 Ga0495602_0287227
1508 Ga0496100_0196506
1509 Ga0496101_0059872
1510 Ga0496101_0193331
1511 Ga0496102_0023903
1512 Ga0496102_0268441
1513 Ga0496102_0399500
1514 Ga0496102_0438507
1515 Ga0496104_0017893
1516 Ga0496104_0191588
1517 Ga0496104_0261726
1518 Ga0496106_0004160
1519 Ga0496106_0085083
1520 Ga0496107_0001689
1521 Ga0496107_0100898
1522 Ga0496108_0011827
1523 Ga0496108_0174692
1524 Ga0496108_0202562
1525 Ga0496108_0442035
1526 Ga0496109_0018702
1527 Ga0496109_0099189
1528 Ga0496110_0005186
1529 Ga0496110_0012457
1530 Ga0496110_0290877
1531 Ga0496112_0006113
1532 Ga0496112_0028502
1533 Ga0496113_0281011
1534 Ga0496119_0003074
1535 Ga0496120_0000146
1536 Ga0496120_0080131
1537 Ga0496121_0001394
1538 Ga0496122_0018855
1539 Ga0496123_0003048
1540 Ga0496125_0002028
1541 Ga0496125_0022664
1542 Ga0496125_0034598
1543 Ga0496125_0151092
1544 Ga0496126_0230752
1545 Ga0495682_0085515
1546 Ga0501034_0582112
1547 Ga0501034_0606213
1548 Ga0501036_0059648
1549 Ga0501037_0070807
1550 Ga0501038_0067831
1551 Ga0501038_0375826
1552 Ga0501039_0022919
1553 Ga0501042_0029607
1554 Ga0501043_0366325
1555 Ga0501047_0002078
1556 Ga0501047_0169468
1557 Ga0501069_0011576
1558 Ga0501070_0132545
1559 Ga0501075_0400538
1560 Ga0501077_0164766
1561 Ga0501035_0144846
1562 Ga0501035_0155500
1563 Ga0501035_0206100
1564 Ga0501045_0131533
1565 nmdc:mga0k408_2913_c1
1566 nmdc:mga07m45_416_c1
1567 nmdc:mga05p37_433905_c1
1568 nmdc:mga05p37_660958_c1
1569 nmdc:mga08y16_380282_c1
1570 nmdc:mga0a205_9126_c1
1571 Ga0495601_0294884
1572 Ga0495612_0031459
1573 Ga0495619_0010046
1574 Ga0500644_0006593
1575 Ga0500566_0182051
1576 Ga0500650_0089437
1577 Ga0500556_0000018
1578 Ga0500593_005348
1579 Ga0500595_040266
1580 Ga0500614_032984
1581 Ga0500618_024392
1582 Ga0500559_0000236
1583 Ga0500568_0014028
1584 Ga0500619_019941
1585 Ga0500622_0017749
1586 Ga0500630_060302
1587 Ga0500637_0007664
1588 Ga0500645_000596
1589 Ga0500645_001816
1590 Ga0500645_018580
1591 Ga0500661_013176
1592 2508727656
1593 2509077358
1594 2510843636
1595 2511243004
1596 2774869158
1597 2776258384
1598 2835317460
1599 2837652039
1600 2837680040
1601 2840882090
1602 2882457612
1603 2884301219
1604 2894236163
1605 2899804768
1606 2919707739
1607 2989354410
1608 8054566951

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

87

281

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.7882 141 193
4xtc-assembly1.cif.gz_M crystal structure of bacterial alginate abc transporter in complex with alginate pentasaccharide-bound periplasmic protein 0.5501 147 247
3rlf-assembly1.cif.gz_F crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.5193 152 245
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.4843 145 253
2r6g-assembly1.cif.gz_G the crystal structure of the e. coli maltose transporter 0.395 7 193
ID Description Score Start End Superfamily
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.897 143 193 1.10.3720.10
af_P9WG05_32_321_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8375 142 193 1.10.3720.10
af_P07654_38_293_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7195 142 193 1.10.3720.10
af_Q58419_14_276_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7114 142 193 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6105 142 256 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7C3G7J3-F1-model_v4 ABC transporter permease 0.9035 1 95 GO:0005886
AF-A0A3D4ZGC0-F1-model_v4 ABC transporter permease 0.889 1 78 GO:0016020
AF-A0A7C3G7J3-F1-model_v4 ABC transporter permease 0.8864 1 95 GO:0005886
AF-A0A3D4ZGC0-F1-model_v4 ABC transporter permease 0.8689 1 78 GO:0016020
AF-A0A7C7PLA0-F1-model_v4 ABC transporter permease 0.8465 4 117 GO:0005886
GO:0055085

Map