F481448

General Info

Members Datasets Scaffolds Average Seq Length
802 474 1604 188

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100366006|Ga0070682_1003660061
Length 219
Sequence MTTAELRSRIDQFSLRRADLDSRDRLTERHGAMRKLIYGMNLTLDGYIAAPGDDLGWSEPSDELFQWWSDRVGATGLALYGRKLWETMSSHWPSADQQPGATPAEIEFARRWRDMPKVVFSSTISTVDWNTRLVTGDAVTEITRLKAEDGGPIDIGGATLAAAAMRAGLIDEYVLATAPVLVGGGTPFFTALDNWVNLNLVETRTFPDGVVLTRYETRH

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
82 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
83 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
84 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
152 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
153 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
170 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
171 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
172 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
173 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
174 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
175 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
178 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
192 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
204 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
205 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
211 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
212 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
213 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
214 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
215 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
216 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
217 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
218 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
219 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
220 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
223 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
224 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
225 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
226 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
227 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
228 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
229 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
230 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
231 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
232 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
233 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
234 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
235 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
236 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
237 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
238 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
239 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
240 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
241 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
242 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
243 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
244 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
245 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
246 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
247 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
248 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
249 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
250 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
251 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
252 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
253 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
254 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
255 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
256 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
257 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
262 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
263 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
264 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
265 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
268 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
269 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
270 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
271 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
272 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
273 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
274 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
275 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
276 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
277 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
278 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
279 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
280 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
281 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
285 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
286 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
287 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
288 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
289 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
290 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
291 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
292 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
293 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
294 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
295 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
296 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
297 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
298 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
299 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
300 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
301 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
302 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
303 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
304 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
305 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
306 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
307 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
308 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
309 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
310 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
311 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
312 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
313 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
314 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
315 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
320 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
321 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
322 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
323 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
324 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
325 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
326 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
327 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
330 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
331 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
332 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
333 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
334 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
335 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
336 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
337 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
338 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
339 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
340 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
341 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
342 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
343 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
344 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
345 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
346 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
347 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
348 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
349 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
350 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
351 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
352 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
353 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
354 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
355 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
356 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
357 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
358 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
359 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
360 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
361 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
362 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
363 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
364 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
365 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
380 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
381 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
382 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
383 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
384 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
385 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
386 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
387 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
388 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
389 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
390 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
391 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
392 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
393 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
394 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
395 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
396 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
397 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
398 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
399 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
400 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
401 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
402 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
403 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
404 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
407 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
408 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
409 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
410 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
411 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
412 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
413 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
414 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
415 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
416 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
417 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
418 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
419 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
420 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
421 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
422 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
423 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
424 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
425 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
426 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
427 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
428 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
429 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
430 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
431 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
432 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
433 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
434 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
435 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
438 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
439 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
440 2501939600 Micromonospora sp. L5 Isolate Unclassified
441 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
442 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
443 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
444 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
445 2643221615 Nocardioides sp. Root224 Isolate Unclassified
446 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
447 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
448 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
449 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
450 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
451 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
452 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
453 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
454 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
455 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
456 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
457 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
458 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
459 2902582711 Micromonospora sp. AP08 Isolate Unclassified
460 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
461 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
462 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
463 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
464 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
465 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
466 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
467 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
468 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
469 649633069 Micromonospora sp. L5 Isolate Unclassified
470 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
471 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
472 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
473 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
474 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.39
Metatranscriptomes 1.25
Isolates 4.36

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 2.87
Nodule 0
Rhizoplane 8.85
Rhizosphere 79.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100366006 3300005337 Bacteria 1079
2 LJQas_1012816 3300000549 Bacteria 989
3 JGI24752J21851_1010684 3300001976 Bacteria 1198
4 JGI25406J46586_10011059 3300003203 Bacteria 3967
5 Ga0070658_10205606 3300005327 Bacteria 1662
6 Ga0070683_100404270 3300005329 Bacteria 1302
7 Ga0070670_100017544 3300005331 Bacteria 6141
8 Ga0068869_100072896 3300005334 Bacteria 2545
9 Ga0070682_100254970 3300005337 Bacteria 1267
10 Ga0070660_100128424 3300005339 Bacteria 2027
11 Ga0070692_10003115 3300005345 Bacteria 6647
12 Ga0070668_100001096 3300005347 Bacteria 19101
13 Ga0070668_100118529 3300005347 Bacteria 2113
14 Ga0070669_100532798 3300005353 Bacteria 977
15 Ga0070671_100009886 3300005355 Bacteria 7659
16 Ga0070673_100742233 3300005364 Bacteria 903
17 Ga0070659_100522500 3300005366 Bacteria 1013
18 Ga0070703_10022898 3300005406 Bacteria 1836
19 Ga0070709_10088269 3300005434 Bacteria 2039
20 Ga0070709_10155052 3300005434 Bacteria 1587
21 Ga0070709_10457531 3300005434 Bacteria 962
22 Ga0070714_100000003 3300005435 Bacteria 329743
23 Ga0070714_100158860 3300005435 Bacteria 2043
24 Ga0070714_100452803 3300005435 Bacteria 1219
25 Ga0070713_100002011 3300005436 Bacteria 13132
26 Ga0070710_10000108 3300005437 Bacteria 38929
27 Ga0070710_10023979 3300005437 Bacteria 3213
28 Ga0070701_10205466 3300005438 Bacteria 1167
29 Ga0070705_100347206 3300005440 Bacteria 1080
30 Ga0070694_100364134 3300005444 Bacteria 1123
31 Ga0070708_100005656 3300005445 Bacteria 9909
32 Ga0070678_100041810 3300005456 Bacteria 3252
33 Ga0070678_100735147 3300005456 Bacteria 891
34 Ga0070685_10006738 3300005466 Bacteria 5860
35 Ga0070698_100016771 3300005471 Bacteria 7726
36 Ga0070679_100151982 3300005530 Bacteria 2291
37 Ga0070697_100185456 3300005536 Bacteria 1764
38 Ga0068853_100101094 3300005539 Bacteria 2549
39 Ga0068853_100604531 3300005539 Bacteria 1041
40 Ga0070672_100175000 3300005543 Bacteria 1786
41 Ga0070695_100513509 3300005545 Bacteria 929
42 Ga0070665_100007299 3300005548 Bacteria 11243
43 Ga0070665_100656967 3300005548 Bacteria 1061
44 Ga0070704_100392939 3300005549 Bacteria 1181
45 Ga0068855_100189018 3300005563 Bacteria 2324
46 Ga0068857_100189198 3300005577 Bacteria 1874
47 Ga0068856_100259381 3300005614 Bacteria 1753
48 Ga0068856_100339649 3300005614 Bacteria 1520
49 Ga0068856_100351570 3300005614 Bacteria 1492
50 Ga0068856_100446187 3300005614 Bacteria 1314
51 Ga0070702_100390339 3300005615 Bacteria 992
52 Ga0068852_100368015 3300005616 Bacteria 1407
53 Ga0068852_100571455 3300005616 Bacteria 1132
54 Ga0068859_100210067 3300005617 Bacteria 2032
55 Ga0068864_100070559 3300005618 Bacteria 3040
56 Ga0068870_10000281 3300005840 Bacteria 18853
57 Ga0068863_100012148 3300005841 Bacteria 8319
58 Ga0068858_100943326 3300005842 Bacteria 844
59 Ga0068860_100483336 3300005843 Bacteria 1234
60 Ga0081455_10005427 3300005937 Bacteria 13988
61 Ga0081538_10080267 3300005981 Bacteria 1742
62 Ga0081540_1000634 3300005983 Bacteria 33445
63 Ga0081540_1043929 3300005983 Bacteria 2286
64 Ga0081539_10000421 3300005985 Bacteria 90163
65 Ga0081539_10000463 3300005985 Bacteria 86001
66 Ga0081539_10001814 3300005985 Bacteria 33764
67 Ga0081539_10305636 3300005985 Bacteria 682
68 Ga0070717_10000824 3300006028 Bacteria 20452
69 Ga0070717_10932728 3300006028 Bacteria 790
70 Ga0075365_10181255 3300006038 Bacteria 1472
71 Ga0075365_10222386 3300006038 Bacteria 1325
72 Ga0075365_10362618 3300006038 Bacteria 1022
73 Ga0075368_10039766 3300006042 Bacteria 1845
74 Ga0075364_10391639 3300006051 Bacteria 948
75 Ga0075432_10008515 3300006058 Bacteria 3499
76 Ga0070715_10102264 3300006163 Bacteria 1338
77 Ga0070712_100012322 3300006175 Bacteria 5434
78 Ga0070712_100026629 3300006175 Bacteria 3854
79 Ga0070712_100577567 3300006175 Bacteria 949
80 Ga0075367_10000477 3300006178 Bacteria 14983
81 Ga0068871_100543437 3300006358 Bacteria 1051
82 Ga0075428_100095632 3300006844 Bacteria 3238
83 Ga0075428_100668261 3300006844 Bacteria 1107
84 Ga0075428_101079068 3300006844 Bacteria 848
85 Ga0075430_100912753 3300006846 Bacteria 723
86 Ga0075433_10186721 3300006852 Bacteria 1844
87 Ga0068865_100882857 3300006881 Bacteria 776
88 Ga0075436_100214979 3300006914 Bacteria 1363
89 Ga0097620_100210079 3300006931 Bacteria 2032
90 Ga0075435_100097635 3300007076 Bacteria 2431
91 Ga0099794_10057410 3300007265 Bacteria 1886
92 Ga0099795_10113905 3300007788 Bacteria 1075
93 Ga0105251_10091527 3300009011 Bacteria 1397
94 Ga0105244_10300483 3300009036 Bacteria 743
95 Ga0105240_10849236 3300009093 Bacteria 986
96 Ga0111539_11941873 3300009094 Bacteria 682
97 Ga0105245_10290088 3300009098 Bacteria 1602
98 Ga0114129_10019804 3300009147 Bacteria 9577
99 Ga0114129_10878186 3300009147 Bacteria 1138
100 Ga0105243_10138717 3300009148 Bacteria 2072
101 Ga0105243_10327273 3300009148 Bacteria 1398
102 Ga0105241_10024278 3300009174 Bacteria 4502
103 Ga0105241_10125458 3300009174 Bacteria 2072
104 Ga0105241_10638520 3300009174 Bacteria 966
105 Ga0105248_10363988 3300009177 Bacteria 1628
106 Ga0105237_10881443 3300009545 Bacteria 902
107 Ga0105249_10852325 3300009553 Bacteria 977
108 Ga0105239_10347023 3300010375 Bacteria 1676
109 Ga0105246_10007605 3300011119 Bacteria 6646
110 Ga0157340_1002957 3300012473 Bacteria 902
111 Ga0157347_1016783 3300012502 Bacteria 827
112 Ga0157339_1002388 3300012505 Bacteria 1263
113 Ga0157315_1013081 3300012508 Bacteria 775
114 Ga0157373_10244410 3300013100 Bacteria 1269
115 Ga0157371_10019764 3300013102 Bacteria 4962
116 Ga0157370_10057757 3300013104 Bacteria 3688
117 Ga0157370_10172569 3300013104 Bacteria 2010
118 Ga0157369_10004927 3300013105 Bacteria 15642
119 Ga0157369_10043792 3300013105 Bacteria 4877
120 Ga0157369_10072569 3300013105 Bacteria 3695
121 Ga0157369_10114880 3300013105 Bacteria 2859
122 Ga0157369_10163231 3300013105 Bacteria 2350
123 Ga0157369_10900422 3300013105 Bacteria 907
124 Ga0157374_11515629 3300013296 Bacteria 694
125 Ga0163162_10154757 3300013306 Bacteria 2412
126 Ga0157375_11010199 3300013308 Bacteria 971
127 Ga0157375_11207692 3300013308 Bacteria 887
128 Ga0163163_10905555 3300014325 Bacteria 945
129 Ga0157377_10099260 3300014745 Bacteria 1732
130 Ga0182006_1176231 3300015261 Bacteria 714
131 Ga0182005_1061451 3300015265 Bacteria 1026
132 Ga0197907_11507549 3300020069 Bacteria 714
133 Ga0206356_11343584 3300020070 Bacteria 733
134 Ga0206354_10818180 3300020081 Bacteria 1418
135 Ga0206354_11119920 3300020081 Bacteria 905
136 Ga0206353_10778901 3300020082 Bacteria 2205
137 Ga0206353_11075562 3300020082 Bacteria 991
138 Ga0154015_1611789 3300020610 Bacteria 1363
139 Ga0213875_10003875 3300021388 Bacteria 8379
140 Ga0213875_10035227 3300021388 Bacteria 2362
141 Ga0224712_10161041 3300022467 Bacteria 1001
142 Ga0207672_1004327 3300025223 Bacteria 806
143 Ga0207697_10141371 3300025315 Bacteria 1044
144 Ga0207692_10000299 3300025898 Bacteria 17129
145 Ga0207692_10223549 3300025898 Bacteria 1117
146 Ga0207647_10012243 3300025904 Bacteria 5978
147 Ga0207647_10027529 3300025904 Bacteria 3705
148 Ga0207699_10022749 3300025906 Bacteria 3402
149 Ga0207645_10075375 3300025907 Bacteria 2159
150 Ga0207643_10000120 3300025908 Bacteria 53357
151 Ga0207705_10078900 3300025909 Bacteria 2397
152 Ga0207684_10000005 3300025910 Bacteria 736617
153 Ga0207684_10152940 3300025910 Bacteria 1985
154 Ga0207654_10168540 3300025911 Bacteria 1420
155 Ga0207654_10266017 3300025911 Bacteria 1155
156 Ga0207693_10003816 3300025915 Bacteria 12832
157 Ga0207663_10060527 3300025916 Bacteria 2400
158 Ga0207660_10088318 3300025917 Bacteria 2292
159 Ga0207657_10038109 3300025919 Bacteria 4284
160 Ga0207657_10044336 3300025919 Bacteria 3910
161 Ga0207649_10002684 3300025920 Bacteria 9859
162 Ga0207652_10051467 3300025921 Bacteria 3531
163 Ga0207646_10000027 3300025922 Bacteria 235383
164 Ga0207646_10000775 3300025922 Bacteria 41389
165 Ga0207646_10053812 3300025922 Bacteria 3600
166 Ga0207650_10006900 3300025925 Bacteria 7744
167 Ga0207659_10035890 3300025926 Bacteria 3430
168 Ga0207687_10648722 3300025927 Bacteria 893
169 Ga0207700_10011644 3300025928 Bacteria 5621
170 Ga0207700_10048609 3300025928 Bacteria 3151
171 Ga0207700_10572065 3300025928 Bacteria 1004
172 Ga0207664_10000039 3300025929 Bacteria 164162
173 Ga0207664_10004792 3300025929 Bacteria 9194
174 Ga0207664_10068935 3300025929 Bacteria 2843
175 Ga0207664_10597986 3300025929 Bacteria 990
176 Ga0207709_10062387 3300025935 Bacteria 2333
177 Ga0207711_10399295 3300025941 Bacteria 1277
178 Ga0207661_10002759 3300025944 Bacteria 12093
179 Ga0207661_10242429 3300025944 Bacteria 1600
180 Ga0207661_10649779 3300025944 Bacteria 969
181 Ga0207679_10932208 3300025945 Bacteria 795
182 Ga0207667_10045431 3300025949 Bacteria 4652
183 Ga0207667_11042399 3300025949 Bacteria 803
184 Ga0207712_10557161 3300025961 Bacteria 987
185 Ga0207668_10030645 3300025972 Bacteria 3536
186 Ga0207640_10178959 3300025981 Bacteria 1588
187 Ga0207677_10117538 3300026023 Bacteria 1993
188 Ga0207677_10366125 3300026023 Bacteria 1212
189 Ga0207677_10515621 3300026023 Bacteria 1036
190 Ga0207703_10187562 3300026035 Bacteria 1829
191 Ga0207703_10923152 3300026035 Bacteria 836
192 Ga0207639_10067850 3300026041 Bacteria 2777
193 Ga0207639_10508998 3300026041 Bacteria 1101
194 Ga0207702_10039434 3300026078 Bacteria 3957
195 Ga0207648_10132925 3300026089 Bacteria 2190
196 Ga0207676_10004096 3300026095 Bacteria 10280
197 Ga0207676_10205383 3300026095 Bacteria 1744
198 Ga0207675_100044909 3300026118 Bacteria 4128
199 Ga0207683_10000311 3300026121 Bacteria 44062
200 Ga0209996_1018226 3300027395 Bacteria 973
201 Ga0209179_1099353 3300027512 Bacteria 647
202 Ga0209999_1047502 3300027543 Bacteria 808
203 Ga0210002_1061789 3300027617 Bacteria 654
204 Ga0209966_1042880 3300027695 Bacteria 947
205 Ga0209998_10056866 3300027717 Bacteria 915
206 Ga0209813_10015378 3300027866 Bacteria 2072
207 Ga0268266_10007730 3300028379 Bacteria 9652
208 Ga0268266_10708465 3300028379 Bacteria 970
209 Ga0307517_10002974 3300028786 Bacteria 26783
210 Ga0307515_10091953 3300028794 Bacteria 3782
211 Ga0307515_10218264 3300028794 Bacteria 1732
212 Ga0307515_10533367 3300028794 Bacteria 783
213 Ga0307512_10017480 3300030522 Bacteria 6579
214 Ga0307512_10018439 3300030522 Bacteria 6377
215 Ga0316183_1044442 3300030742 Bacteria 789
216 Ga0316182_1256671 3300030745 Bacteria 1001
217 Ga0307513_10100554 3300031456 Bacteria 2917
218 Ga0307513_10165752 3300031456 Bacteria 2094
219 Ga0307513_10362348 3300031456 Bacteria 1194
220 Ga0307509_10219401 3300031507 Bacteria 1717
221 Ga0307509_10249132 3300031507 Bacteria 1562
222 Ga0307408_100018391 3300031548 Bacteria 4691
223 Ga0307408_100038367 3300031548 Bacteria 3379
224 Ga0307408_100452892 3300031548 Bacteria 1113
225 Ga0307408_100648741 3300031548 Bacteria 943
226 Ga0307408_101138765 3300031548 Bacteria 725
227 Ga0307508_10012953 3300031616 Bacteria 7625
228 Ga0307508_10201658 3300031616 Bacteria 1590
229 Ga0307508_10285449 3300031616 Bacteria 1244
230 Ga0307516_10009915 3300031730 Bacteria 10556
231 Ga0307516_10233205 3300031730 Bacteria 1543
232 Ga0307516_10341573 3300031730 Bacteria 1164
233 Ga0307405_10095161 3300031731 Bacteria 1982
234 Ga0307405_10680556 3300031731 Bacteria 849
235 Ga0307413_10061076 3300031824 Bacteria 2323
236 Ga0307410_10025482 3300031852 Bacteria 3712
237 Ga0307410_10056908 3300031852 Bacteria 2661
238 Ga0307410_10221639 3300031852 Bacteria 1455
239 Ga0307410_10381994 3300031852 Bacteria 1133
240 Ga0307410_10745540 3300031852 Bacteria 829
241 Ga0307406_10450415 3300031901 Bacteria 1032
242 Ga0307406_10567925 3300031901 Bacteria 930
243 Ga0307407_10443620 3300031903 Bacteria 940
244 Ga0307407_10719344 3300031903 Bacteria 753
245 Ga0307407_10725567 3300031903 Bacteria 750
246 Ga0307412_10006283 3300031911 Bacteria 6708
247 Ga0307409_100078316 3300031995 Bacteria 2659
248 Ga0307409_100228251 3300031995 Bacteria 1685
249 Ga0307409_100311384 3300031995 Bacteria 1469
250 Ga0307416_100005290 3300032002 Bacteria 7908
251 Ga0307416_100009087 3300032002 Bacteria 6473
252 Ga0307416_100098942 3300032002 Bacteria 2531
253 Ga0307416_100724314 3300032002 Bacteria 1085
254 Ga0307411_10120605 3300032005 Bacteria 1896
255 Ga0307411_10176160 3300032005 Bacteria 1618
256 Ga0307415_100053938 3300032126 Bacteria 2742
257 Ga0307510_10161576 3300033180 Bacteria 1836
258 Ga0373948_0068313 3300034817 Bacteria 792
259 Ga0373950_0034946 3300034818 Bacteria 944
260 Ga0373959_0005555 3300034820 Bacteria 2069
261 Ga0373938_0022456 3300034957 Bacteria 1289
262 Ga0373928_0023279 3300035084 Bacteria 1320
263 Ga0373929_0150640 3300035085 Bacteria 623
264 Ga0373934_0001240 3300035086 Bacteria 9285
265 Ga0373944_0169337 3300035089 Bacteria 778
266 Ga0373952_0041807 3300035092 Bacteria 1062
267 Ga0373923_0005379 3300035111 Bacteria 4345
268 Ga0373923_0126309 3300035111 Bacteria 1146
269 Ga0373923_0436631 3300035111 Bacteria 633
270 Ga0373932_0041298 3300035112 Bacteria 1332
271 Ga0373936_0000817 3300035113 Bacteria 11053
272 Ga0373936_0030144 3300035113 Bacteria 2139
273 Ga0373941_0037480 3300035115 Bacteria 1480
274 Ga0373945_0004642 3300035116 Bacteria 4377
275 Ga0373945_0035227 3300035116 Bacteria 1788
276 Ga0373953_0028064 3300035117 Bacteria 2167
277 Ga0373953_0323206 3300035117 Bacteria 674
278 Ga0373954_0017836 3300035118 Bacteria 3191
279 Ga0373954_0501670 3300035118 Bacteria 601
280 Ga0373956_0010805 3300035119 Bacteria 3749
281 Ga0373957_0001354 3300035120 Bacteria 6581
282 Ga0373943_0000179 3300035170 Bacteria 25212
283 Ga0373946_0000172 3300035171 Bacteria 19659
284 Ga0373955_0002566 3300035172 Bacteria 7934
285 Ga0373955_0101927 3300035172 Bacteria 1649
286 Ga0373955_0762509 3300035172 Bacteria 594
287 Ga0373942_0068757 3300035207 Bacteria 1029
288 Ga0373961_0270373 3300035241 Bacteria 620
289 Ga0373935_0000665 3300035692 Bacteria 18145
290 Ga0373935_0034343 3300035692 Bacteria 3160
291 Ga0373935_0167414 3300035692 Bacteria 1501
292 Ga0373933_0009898 3300035724 Bacteria 5219
293 Ga0373933_0028199 3300035724 Bacteria 3237
294 Ga0373947_0730703 3300035725 Bacteria 675
295 Ga0373947_0814317 3300035725 Bacteria 637
296 Ga0373937_0005538 3300036401 Bacteria 10828
297 Ga0373937_0149209 3300036401 Bacteria 2189
298 Ga0373937_1525767 3300036401 Bacteria 615
299 Ga0373925_0004295 3300037068 Bacteria 10802
300 Ga0373925_0012780 3300037068 Bacteria 6082
301 Ga0395899_0021077 3300037312 Bacteria 4942
302 Ga0395900_0089040 3300037418 Bacteria 3173
303 Ga0395900_0506034 3300037418 Bacteria 1157
304 Ga0395898_0024807 3300037466 Bacteria 6045
305 Ga0395898_0058606 3300037466 Bacteria 3748
306 Ga0395898_0058748 3300037466 Bacteria 3743
307 Ga0395898_0275709 3300037466 Bacteria 1604
308 Ga0395898_0539652 3300037466 Bacteria 1108
309 Ga0436364_0042522 3300037853 Bacteria 771
310 Ga0436364_0389462 3300037853 Bacteria 9741
311 Ga0436364_0646344 3300037853 Bacteria 1259
312 Ga0436364_0876723 3300037853 Bacteria 1023
313 Ga0436364_1075830 3300037853 Bacteria 3990
314 Ga0436364_1270575 3300037853 Bacteria 7151
315 Ga0395901_0005632 3300038443 Bacteria 12674
316 Ga0395901_0271340 3300038443 Bacteria 1764
317 Ga0242419_004293 3300038698 Bacteria 989
318 Ga0242422_03587 3300038699 Bacteria 1009
319 Ga0242420_095322 3300038996 Bacteria 628
320 Ga0436365_0014356 3300039437 Bacteria 1437
321 Ga0436365_0046929 3300039437 Bacteria 2868
322 Ga0436365_0128693 3300039437 Bacteria 676
323 Ga0436365_0243231 3300039437 Bacteria 4266
324 Ga0436360_1005885 3300039438 Bacteria 1177
325 Ga0436360_1033448 3300039438 Bacteria 1446
326 Ga0436363_0269211 3300039450 Bacteria 1625
327 Ga0436363_0353524 3300039450 Bacteria 1300
328 Ga0436363_0378516 3300039450 Bacteria 681
329 Ga0436363_0910161 3300039450 Bacteria 1919
330 Ga0436363_1193792 3300039450 Bacteria 890
331 Ga0436363_1671435 3300039450 Bacteria 854
332 Ga0436362_0053900 3300039453 Bacteria 941
333 Ga0436362_0479211 3300039453 Bacteria 729
334 Ga0436362_0999546 3300039453 Bacteria 756
335 Ga0439447_058592 3300041407 Bacteria 909
336 Ga0439461_0038408 3300041410 Bacteria 1026
337 Ga0451789_0641791 3300041443 Bacteria 3248
338 Ga0451791_0623639 3300041451 Bacteria 1910
339 Ga0451793_0894513 3300041452 Bacteria 6487
340 Ga0451797_0177632 3300041453 Bacteria 1098
341 Ga0451833_0746762 3300041491 Bacteria 882
342 Ga0451837_0741497 3300041494 Bacteria 1141
343 Ga0451839_0134433 3300041496 Bacteria 814
344 Ga0451839_0683113 3300041496 Bacteria 986
345 Ga0451839_0702160 3300041496 Bacteria 1519
346 Ga0451841_0493327 3300041498 Bacteria 1094
347 Ga0451849_0367077 3300041505 Bacteria 831
348 Ga0451853_1140793 3300041512 Bacteria 4419
349 Ga0439433_0081814 3300041999 Bacteria 786
350 Ga0439442_000063 3300042002 Bacteria 25468
351 Ga0439445_0057456 3300042004 Bacteria 1059
352 Ga0439449_0006717 3300042007 Bacteria 4392
353 Ga0439449_0107789 3300042007 Bacteria 1031
354 Ga0439450_056096 3300042008 Bacteria 944
355 Ga0439454_012352 3300042011 Bacteria 1157
356 Ga0439455_0133228 3300042012 Bacteria 701
357 Ga0439457_111279 3300042014 Bacteria 643
358 Ga0450920_000021 3300042122 Bacteria 17923
359 Ga0450920_008875 3300042122 Bacteria 1844
360 Ga0450888_007513 3300042126 Bacteria 1208
361 Ga0450898_089365 3300042134 Bacteria 634
362 Ga0450903_035907 3300042138 Bacteria 740
363 Ga0450907_000100 3300042146 Bacteria 33093
364 Ga0450908_025404 3300042184 Bacteria 1035
365 Ga0439434_0000027 3300042435 Bacteria 36673
366 Ga0439435_0137317 3300042436 Bacteria 776
367 Ga0439444_0033205 3300042437 Bacteria 979
368 Ga0439459_0025398 3300042438 Bacteria 1169
369 Ga0439464_0013712 3300042439 Bacteria 2174
370 Ga0439464_0123854 3300042439 Bacteria 797
371 Ga0439460_0151571 3300042461 Bacteria 773
372 Ga0450918_001013 3300042531 Bacteria 5838
373 Ga0451577_0827597 3300042876 Bacteria 835
374 Ga0439440_0002691 3300042993 Bacteria 3374
375 Ga0466969_0031531 3300044656 Bacteria 2697
376 Ga0466969_0036510 3300044656 Bacteria 2482
377 Ga0466969_0120202 3300044656 Bacteria 1223
378 Ga0466972_0264513 3300044658 Bacteria 804
379 Ga0466965_0003376 3300044683 Bacteria 6993
380 Ga0466965_0072103 3300044683 Bacteria 1738
381 Ga0466965_0468469 3300044683 Bacteria 703
382 Ga0466965_0487212 3300044683 Bacteria 690
383 Ga0466966_0012351 3300044684 Bacteria 5658
384 Ga0466966_0142492 3300044684 Bacteria 1464
385 Ga0466966_0210937 3300044684 Bacteria 1174
386 Ga0466966_0478784 3300044684 Bacteria 748
387 Ga0466961_0003492 3300044693 Bacteria 9801
388 Ga0466961_0072409 3300044693 Bacteria 2186
389 Ga0466961_0139455 3300044693 Bacteria 1519
390 Ga0466961_0683162 3300044693 Bacteria 615
391 Ga0466963_0061326 3300044694 Bacteria 2514
392 Ga0466963_0073036 3300044694 Bacteria 2312
393 Ga0466963_0231696 3300044694 Bacteria 1294
394 Ga0466963_0318929 3300044694 Bacteria 1093
395 Ga0466963_0459500 3300044694 Bacteria 898
396 Ga0466963_0472379 3300044694 Bacteria 885
397 Ga0466964_0085787 3300044706 Bacteria 1360
398 Ga0466964_0196199 3300044706 Bacteria 966
399 Ga0466971_0003304 3300044719 Bacteria 6888
400 Ga0466971_0006008 3300044719 Bacteria 5283
401 Ga0466971_0144147 3300044719 Bacteria 1110
402 Ga0466968_0106743 3300044735 Bacteria 1255
403 Ga0466970_0027864 3300044765 Bacteria 2966
404 Ga0466970_0190550 3300044765 Bacteria 1139
405 Ga0466970_0278127 3300044765 Bacteria 941
406 Ga0466970_0347754 3300044765 Bacteria 841
407 Ga0466957_0016225 3300044842 Bacteria 4356
408 Ga0466957_0499138 3300044842 Bacteria 843
409 Ga0466960_0003525 3300044901 Bacteria 6025
410 Ga0466960_0074819 3300044901 Bacteria 1693
411 Ga0466959_0004649 3300045049 Bacteria 9236
412 Ga0466959_0046495 3300045049 Bacteria 3193
413 Ga0451576_1547128 3300045051 Bacteria 688
414 Ga0466958_0009977 3300045836 Bacteria 5305
415 Ga0466958_0149245 3300045836 Bacteria 1474
416 Ga0466958_0194296 3300045836 Bacteria 1290
417 Ga0466958_0530495 3300045836 Bacteria 764
418 Ga0466967_0028188 3300045976 Bacteria 4685
419 Ga0466967_0043462 3300045976 Bacteria 3890
420 Ga0466967_0056256 3300045976 Bacteria 3468
421 Ga0466967_0060405 3300045976 Bacteria 3358
422 Ga0466967_0069228 3300045976 Bacteria 3153
423 Ga0466967_0169110 3300045976 Bacteria 2055
424 Ga0466967_0529859 3300045976 Bacteria 1158
425 Ga0466967_1635864 3300045976 Bacteria 641
426 Ga0466967_1904980 3300045976 Bacteria 591
427 Ga0495617_196495 3300046452 Bacteria 631
428 Ga0495592_0005695 3300046454 Bacteria 9216
429 Ga0495603_0001265 3300046455 Bacteria 14736
430 Ga0495590_0224462 3300046457 Bacteria 694
431 Ga0495591_130605 3300046458 Bacteria 609
432 Ga0495629_0002017 3300046459 Bacteria 15783
433 Ga0495629_0008866 3300046459 Bacteria 7396
434 Ga0495629_0067265 3300046459 Bacteria 2500
435 Ga0495629_0106888 3300046459 Bacteria 1952
436 Ga0495629_0325137 3300046459 Bacteria 1051
437 Ga0495651_0004948 3300046462 Bacteria 10181
438 Ga0495651_0034371 3300046462 Bacteria 3950
439 Ga0495651_0074358 3300046462 Bacteria 2578
440 Ga0495653_0001639 3300046463 Bacteria 17586
441 Ga0495653_0252247 3300046463 Bacteria 1170
442 Ga0495650_0000070 3300046471 Bacteria 258497
443 Ga0495580_0197385 3300046472 Bacteria 1387
444 Ga0495580_0219669 3300046472 Bacteria 1306
445 Ga0495605_0074131 3300046474 Bacteria 1602
446 Ga0495605_0279636 3300046474 Bacteria 709
447 Ga0495639_0051149 3300046475 Bacteria 1878
448 Ga0495639_0142836 3300046475 Bacteria 1151
449 Ga0495662_0011249 3300046476 Bacteria 4374
450 Ga0495664_0003031 3300046477 Bacteria 9097
451 Ga0495664_0244458 3300046477 Bacteria 1085
452 Ga0495584_0299025 3300046491 Bacteria 817
453 Ga0495596_0193870 3300046500 Bacteria 789
454 Ga0495607_0098555 3300046501 Bacteria 1569
455 Ga0495606_0036208 3300046507 Bacteria 3364
456 Ga0495608_0003948 3300046511 Bacteria 10662
457 Ga0495608_0005374 3300046511 Bacteria 9152
458 Ga0495608_0167736 3300046511 Bacteria 1393
459 Ga0495616_0015790 3300046513 Bacteria 4191
460 Ga0495616_0301457 3300046513 Bacteria 676
461 Ga0495618_0008325 3300046514 Bacteria 6279
462 Ga0495618_0018655 3300046514 Bacteria 4261
463 Ga0495618_0044117 3300046514 Bacteria 2812
464 Ga0495618_0048490 3300046514 Bacteria 2681
465 Ga0495618_0465788 3300046514 Bacteria 765
466 Ga0495628_0000830 3300046516 Bacteria 28667
467 Ga0495628_0095323 3300046516 Bacteria 2299
468 Ga0495630_0003819 3300046517 Bacteria 10513
469 Ga0495631_0221499 3300046518 Bacteria 807
470 Ga0495632_0085543 3300046519 Bacteria 1500
471 Ga0495637_0078606 3300046520 Bacteria 1318
472 Ga0495643_0022991 3300046522 Bacteria 3548
473 Ga0495644_0307812 3300046523 Bacteria 620
474 Ga0495663_0068650 3300046525 Bacteria 1125
475 Ga0495666_0097168 3300046526 Bacteria 1388
476 Ga0495642_0139089 3300046528 Bacteria 1047
477 Ga0495642_0344657 3300046528 Bacteria 654
478 Ga0495652_0017874 3300046529 Bacteria 6329
479 Ga0495652_0124593 3300046529 Bacteria 2049
480 Ga0495665_0034456 3300046531 Bacteria 2707
481 Ga0495665_0352745 3300046531 Bacteria 749
482 Ga0495640_0038370 3300046533 Bacteria 3369
483 Ga0495640_0070830 3300046533 Bacteria 2341
484 Ga0495640_0677572 3300046533 Bacteria 619
485 Ga0495640_0775281 3300046533 Bacteria 572
486 Ga0495586_0229362 3300046535 Bacteria 1056
487 Ga0495586_0412831 3300046535 Bacteria 777
488 Ga0495587_0020163 3300046536 Bacteria 4118
489 Ga0495598_0196502 3300046537 Bacteria 726
490 Ga0495609_0265415 3300046538 Bacteria 704
491 Ga0495597_0080587 3300046542 Bacteria 1392
492 Ga0495597_0250897 3300046542 Bacteria 695
493 Ga0495645_0021452 3300046543 Bacteria 4668
494 Ga0495633_0039185 3300046558 Bacteria 2262
495 Ga0495667_0000600 3300046559 Bacteria 22969
496 Ga0495667_0004267 3300046559 Bacteria 9635
497 Ga0495667_0132810 3300046559 Bacteria 1605
498 Ga0495656_0051189 3300046615 Bacteria 1767
499 Ga0495656_0266287 3300046615 Bacteria 869
500 Ga0495668_0015134 3300046616 Bacteria 4510
501 Ga0495634_0004129 3300046642 Bacteria 11499
502 Ga0495634_0043413 3300046642 Bacteria 3047
503 Ga0495634_0185892 3300046642 Bacteria 1298
504 Ga0495634_0731123 3300046642 Bacteria 567
505 Ga0495611_0346856 3300046648 Bacteria 681
506 Ga0495625_0033910 3300046660 Bacteria 3770
507 Ga0495635_0005309 3300046663 Bacteria 8966
508 Ga0495635_0012435 3300046663 Bacteria 5964
509 Ga0495635_0025730 3300046663 Bacteria 4099
510 Ga0495635_0195073 3300046663 Bacteria 1374
511 Ga0495659_0086205 3300046664 Bacteria 1199
512 Ga0495588_0084832 3300046674 Bacteria 1655
513 Ga0495657_0010264 3300046675 Bacteria 7048
514 Ga0495657_0010273 3300046675 Bacteria 7047
515 Ga0495657_0023734 3300046675 Bacteria 4379
516 Ga0495599_0007470 3300046678 Bacteria 6626
517 Ga0495623_0056542 3300046679 Bacteria 2469
518 Ga0495623_0069057 3300046679 Bacteria 2203
519 Ga0495646_0012905 3300046680 Bacteria 5312
520 Ga0495647_0236771 3300046681 Bacteria 809
521 Ga0495658_0436256 3300046683 Bacteria 836
522 Ga0495669_0209280 3300046684 Bacteria 933
523 Ga0495613_0002771 3300046689 Bacteria 13158
524 Ga0495613_0022666 3300046689 Bacteria 4678
525 Ga0495613_0183440 3300046689 Bacteria 1481
526 Ga0495624_0003591 3300046690 Bacteria 11483
527 Ga0495624_0008560 3300046690 Bacteria 7127
528 Ga0495670_0064442 3300046691 Bacteria 1846
529 Ga0495670_0528202 3300046691 Bacteria 641
530 Ga0495649_0065125 3300046694 Bacteria 1956
531 Ga0495589_0074546 3300046794 Bacteria 1655
532 Ga0495589_0137873 3300046794 Bacteria 1169
533 Ga0495600_0006991 3300046809 Bacteria 6888
534 Ga0495600_0071880 3300046809 Bacteria 2260
535 Ga0495600_0342319 3300046809 Bacteria 937
536 Ga0495600_0513123 3300046809 Bacteria 735
537 Ga0495660_0236042 3300046810 Bacteria 854
538 Ga0495581_0111346 3300047315 Bacteria 1592
539 Ga0495604_0005166 3300047317 Bacteria 10337
540 Ga0495604_0106487 3300047317 Bacteria 2051
541 Ga0495636_0003403 3300047318 Bacteria 6170
542 Ga0495636_0254806 3300047318 Bacteria 812
543 Ga0495674_0000515 3300047319 Bacteria 35520
544 Ga0495674_0033264 3300047319 Bacteria 4671
545 Ga0495672_0027598 3300047320 Bacteria 3605
546 Ga0495672_0112726 3300047320 Bacteria 1457
547 Ga0495672_0231973 3300047320 Bacteria 905
548 Ga0495676_0001771 3300047321 Bacteria 18865
549 Ga0495676_0006165 3300047321 Bacteria 11034
550 Ga0495680_0004361 3300047322 Bacteria 13553
551 Ga0495680_0011748 3300047322 Bacteria 7737
552 Ga0495680_0015619 3300047322 Bacteria 6545
553 Ga0495675_0019700 3300047444 Bacteria 4286
554 Ga0495675_0021055 3300047444 Bacteria 4151
555 Ga0495685_019924 3300047447 Bacteria 2305
556 Ga0495673_0238073 3300047469 Bacteria 668
557 Ga0495684_0019548 3300047471 Bacteria 5218
558 Ga0495684_0166346 3300047471 Bacteria 1642
559 Ga0495684_0213763 3300047471 Bacteria 1416
560 Ga0495684_0524694 3300047471 Bacteria 810
561 Ga0495593_0013855 3300047673 Bacteria 4593
562 Ga0495593_0014454 3300047673 Bacteria 4487
563 Ga0495602_0014842 3300048088 Bacteria 7888
564 Ga0495602_0366596 3300048088 Bacteria 1035
565 Ga0495614_0003912 3300048089 Bacteria 6691
566 Ga0495614_0091509 3300048089 Bacteria 1323
567 Ga0495614_0430586 3300048089 Bacteria 622
568 Ga0495615_0063920 3300048090 Bacteria 977
569 Ga0495626_0039304 3300048091 Bacteria 2240
570 Ga0495626_0202436 3300048091 Bacteria 813
571 Ga0496100_0914240 3300048903 Bacteria 689
572 Ga0496101_0045089 3300048904 Bacteria 3157
573 Ga0496101_0407203 3300048904 Bacteria 1071
574 Ga0496101_0491333 3300048904 Bacteria 969
575 Ga0496101_0648058 3300048904 Bacteria 834
576 Ga0496102_0000238 3300048905 Bacteria 72121
577 Ga0496102_0008999 3300048905 Bacteria 8570
578 Ga0496102_0015831 3300048905 Bacteria 6575
579 Ga0496102_0021374 3300048905 Bacteria 5723
580 Ga0496102_0044222 3300048905 Bacteria 4041
581 Ga0496102_0281033 3300048905 Bacteria 1569
582 Ga0496102_1072964 3300048905 Bacteria 725
583 Ga0496104_0013002 3300048907 Bacteria 7494
584 Ga0496104_0052484 3300048907 Bacteria 3851
585 Ga0496104_0900909 3300048907 Bacteria 789
586 Ga0496105_0038395 3300048908 Bacteria 3945
587 Ga0496105_0065724 3300048908 Bacteria 2993
588 Ga0496105_0088710 3300048908 Bacteria 2555
589 Ga0496105_0091960 3300048908 Bacteria 2505
590 Ga0496106_0019912 3300048909 Bacteria 4976
591 Ga0496106_0243610 3300048909 Bacteria 1437
592 Ga0496106_0397181 3300048909 Bacteria 1108
593 Ga0496107_0060026 3300048910 Bacteria 2752
594 Ga0496107_0368477 3300048910 Bacteria 1068
595 Ga0496108_0020355 3300048911 Bacteria 5453
596 Ga0496108_0059412 3300048911 Bacteria 3215
597 Ga0496108_0069104 3300048911 Bacteria 2981
598 Ga0496108_0457770 3300048911 Bacteria 1114
599 Ga0496109_0001418 3300048912 Bacteria 19886
600 Ga0496109_0003356 3300048912 Bacteria 13394
601 Ga0496109_0014879 3300048912 Bacteria 6770
602 Ga0496109_0019096 3300048912 Bacteria 6037
603 Ga0496109_0164638 3300048912 Bacteria 2078
604 Ga0496109_0166113 3300048912 Bacteria 2069
605 Ga0496109_0237603 3300048912 Bacteria 1714
606 Ga0496109_0391319 3300048912 Bacteria 1313
607 Ga0496109_0401717 3300048912 Bacteria 1294
608 Ga0496109_0584987 3300048912 Bacteria 1052
609 Ga0496109_0853853 3300048912 Bacteria 848
610 Ga0496110_0011587 3300048913 Bacteria 7228
611 Ga0496110_0024136 3300048913 Bacteria 5179
612 Ga0496110_0024704 3300048913 Bacteria 5124
613 Ga0496110_0027517 3300048913 Bacteria 4875
614 Ga0496110_0027535 3300048913 Bacteria 4873
615 Ga0496110_0236386 3300048913 Bacteria 1662
616 Ga0496110_1309784 3300048913 Bacteria 634
617 Ga0496111_0000581 3300048914 Bacteria 19141
618 Ga0496111_0001060 3300048914 Bacteria 15162
619 Ga0496111_0683446 3300048914 Bacteria 747
620 Ga0496112_0007617 3300048915 Bacteria 9624
621 Ga0496112_0056555 3300048915 Bacteria 3861
622 Ga0496112_0127923 3300048915 Bacteria 2511
623 Ga0496112_0134454 3300048915 Bacteria 2443
624 Ga0496112_0223740 3300048915 Bacteria 1837
625 Ga0496112_0447584 3300048915 Bacteria 1229
626 Ga0496113_0008551 3300048916 Bacteria 6675
627 Ga0496113_0020523 3300048916 Bacteria 4646
628 Ga0496113_0081390 3300048916 Bacteria 2482
629 Ga0496113_0206850 3300048916 Bacteria 1561
630 Ga0496113_0218337 3300048916 Bacteria 1519
631 Ga0496113_0247639 3300048916 Bacteria 1422
632 Ga0496113_0428030 3300048916 Bacteria 1063
633 Ga0496113_0462949 3300048916 Bacteria 1019
634 Ga0496113_0707096 3300048916 Bacteria 804
635 Ga0496114_0107468 3300048917 Bacteria 2388
636 Ga0496114_0200888 3300048917 Bacteria 1746
637 Ga0496115_0419778 3300048918 Bacteria 1084
638 Ga0496119_0171611 3300048922 Bacteria 1145
639 Ga0496121_0014397 3300048924 Bacteria 8397
640 Ga0496125_0001520 3300048928 Bacteria 33270
641 Ga0496126_0000055 3300048929 Bacteria 297958
642 Ga0496126_0042297 3300048929 Bacteria 4209
643 Ga0496126_0089761 3300048929 Bacteria 2705
644 Ga0495678_178882 3300049459 Bacteria 666
645 Ga0501290_037716 3300049513 Bacteria 714
646 Ga0501291_056830 3300049514 Bacteria 726
647 Ga0501294_034114 3300049517 Bacteria 606
648 Ga0501298_090074 3300049521 Bacteria 686
649 Ga0501031_0007035 3300049568 Bacteria 7343
650 Ga0501031_0220942 3300049568 Bacteria 1234
651 Ga0501031_0433027 3300049568 Bacteria 850
652 Ga0501031_0694329 3300049568 Bacteria 653
653 Ga0501032_0036534 3300049569 Bacteria 3352
654 Ga0501032_0470657 3300049569 Bacteria 804
655 Ga0501033_0016196 3300049570 Bacteria 5645
656 Ga0501033_0583718 3300049570 Bacteria 767
657 Ga0501036_0506640 3300049572 Bacteria 1004
658 Ga0501037_0011699 3300049573 Bacteria 6459
659 Ga0501037_0032324 3300049573 Bacteria 3864
660 Ga0501038_0116350 3300049574 Bacteria 2209
661 Ga0501038_0157585 3300049574 Bacteria 1848
662 Ga0501039_0026080 3300049575 Bacteria 4492
663 Ga0501039_0136188 3300049575 Bacteria 1928
664 Ga0501039_0517770 3300049575 Bacteria 936
665 Ga0501040_0004768 3300049576 Bacteria 8795
666 Ga0501040_0031536 3300049576 Bacteria 3583
667 Ga0501040_0204014 3300049576 Bacteria 1404
668 Ga0501040_0377844 3300049576 Bacteria 1016
669 Ga0501041_0134964 3300049577 Bacteria 1538
670 Ga0501041_0627771 3300049577 Bacteria 686
671 Ga0501042_0106347 3300049578 Bacteria 2019
672 Ga0501042_1110239 3300049578 Bacteria 576
673 Ga0501043_0008674 3300049579 Bacteria 8001
674 Ga0501046_0025087 3300049580 Bacteria 4882
675 Ga0501047_0179517 3300049581 Bacteria 1983
676 Ga0501047_0487963 3300049581 Bacteria 1059
677 Ga0501048_0010568 3300049582 Bacteria 6888
678 Ga0501048_0181621 3300049582 Bacteria 1491
679 Ga0501067_0018871 3300049583 Bacteria 3815
680 Ga0501068_0057494 3300049584 Bacteria 2358
681 Ga0501068_0171257 3300049584 Bacteria 1370
682 Ga0501069_0435214 3300049585 Bacteria 778
683 Ga0501070_0133156 3300049586 Bacteria 2053
684 Ga0501070_0656195 3300049586 Bacteria 832
685 Ga0501071_0001162 3300049587 Bacteria 14756
686 Ga0501071_0072245 3300049587 Bacteria 2516
687 Ga0501071_0091143 3300049587 Bacteria 2239
688 Ga0501072_0016723 3300049588 Bacteria 5635
689 Ga0501072_0168915 3300049588 Bacteria 1745
690 Ga0501073_0163520 3300049589 Bacteria 1541
691 Ga0501074_0144620 3300049590 Bacteria 1700
692 Ga0501074_0361723 3300049590 Bacteria 1030
693 Ga0501074_0600198 3300049590 Bacteria 778
694 Ga0501074_0629768 3300049590 Bacteria 758
695 Ga0501075_0426549 3300049591 Bacteria 1011
696 Ga0501077_0002148 3300049593 Bacteria 11910
697 Ga0501077_0024159 3300049593 Bacteria 3858
698 Ga0501077_0048627 3300049593 Bacteria 2695
699 Ga0501209_122433 3300049656 Bacteria 772
700 Ga0501233_074125 3300049668 Bacteria 867
701 Ga0501235_055826 3300049669 Bacteria 920
702 Ga0501243_090923 3300049675 Bacteria 605
703 Ga0501259_017380 3300049688 Bacteria 1246
704 Ga0501260_018329 3300049689 Bacteria 746
705 Ga0501221_119442 3300049704 Bacteria 672
706 Ga0501229_013354 3300049706 Bacteria 1055
707 Ga0501079_0036930 3300049741 Bacteria 3763
708 Ga0501079_0184110 3300049741 Bacteria 1630
709 Ga0501080_0013621 3300049742 Bacteria 7488
710 Ga0501080_1484481 3300049742 Bacteria 576
711 Ga0501081_0005988 3300049743 Bacteria 7872
712 Ga0501083_0005930 3300049744 Bacteria 8648
713 Ga0501083_0273982 3300049744 Bacteria 1098
714 Ga0501262_031958 3300049759 Bacteria 761
715 Ga0501266_026708 3300049763 Bacteria 809
716 Ga0501276_004925 3300049773 Bacteria 1015
717 Ga0501035_0161115 3300049822 Bacteria 1941
718 Ga0501035_0277250 3300049822 Bacteria 1418
719 Ga0501044_0016193 3300049823 Bacteria 8013
720 Ga0501045_0081730 3300049824 Bacteria 2382
721 Ga0501045_0332560 3300049824 Bacteria 1130
722 Ga0501045_0716260 3300049824 Bacteria 738
723 nmdc:mga0yw44_612588_c1 3300050492 Bacteria 740
724 nmdc:mga06z11_1431_c1 3300050494 Bacteria 8870
725 nmdc:mga04h51_18087_c1 3300050495 Bacteria 2071
726 nmdc:mga05p37_1576355_c1 3300050507 Bacteria 649
727 nmdc:mga05p37_1587141_c1 3300050507 Bacteria 646
728 nmdc:mga05p37_9348_c1 3300050507 Bacteria 11599
729 nmdc:mga06r32_1055209_c1 3300050510 Bacteria 763
730 nmdc:mga08y16_1059730_c1 3300050511 Bacteria 788
731 nmdc:mga0n895_499514_c1 3300050512 Bacteria 1226
732 nmdc:mga0n895_85633_c1 3300050512 Bacteria 3147
733 nmdc:mga0rr50_21065_c1 3300050513 Bacteria 4443
734 nmdc:mga0rr50_220576_c1 3300050513 Bacteria 1566
735 nmdc:mga0rr50_281287_c1 3300050513 Bacteria 1388
736 nmdc:mga08x19_206783_c1 3300050514 Bacteria 1347
737 nmdc:mga08x19_94230_c1 3300050514 Bacteria 1980
738 Ga0495601_0218560 3300053077 Bacteria 1244
739 Ga0495612_0006853 3300053078 Bacteria 4664
740 Ga0495612_0065581 3300053078 Bacteria 1508
741 Ga0495655_0002326 3300053083 Bacteria 3005
742 Ga0495595_0110669 3300053084 Bacteria 1331
743 Ga0495619_0006498 3300053085 Bacteria 7399
744 Ga0495619_0337223 3300053085 Bacteria 1043
745 Ga0500578_0282578 3300053086 Bacteria 989
746 Ga0500566_0358544 3300053094 Bacteria 665
747 Ga0500556_0001192 3300053104 Bacteria 12303
748 Ga0500569_002000 3300053109 Bacteria 3954
749 Ga0500652_135439 3300053131 Bacteria 1026
750 Ga0500568_0156030 3300053139 Bacteria 844
751 Ga0500573_0000024 3300053140 Bacteria 151713
752 Ga0500600_0016312 3300053149 Bacteria 4496
753 Ga0500616_0001840 3300053153 Bacteria 19217
754 Ga0500616_0062343 3300053153 Bacteria 1926
755 Ga0500633_0190832 3300053160 Bacteria 767
756 Ga0500634_0006806 3300053161 Bacteria 5566
757 Ga0500587_013918 3300053739 Bacteria 1018
758 Ga0501084_0033772 3300054114 Bacteria 4279
759 Ga0590077_024738 3300059426 Bacteria 1291
760 Ga0587088_077970 3300059508 Bacteria 704
761 Ga0587107_062135 3300059652 Bacteria 661
762 Ga0501082_0035247 3300060353 Bacteria 4313
763 Ga0466962_0000285 3300061719 Bacteria 21386
764 Ga0466962_0001997 3300061719 Bacteria 9634
765 Ga0530510_0009219 3300061734 Bacteria 6918
766 Ga0530510_0103864 3300061734 Bacteria 2078
767 Ga0530510_0431582 3300061734 Bacteria 995
768 2501945742 2501939600 Bacteria 6907073
769 2537898000 2537561592 Bacteria 4348607
770 2558910135 2558860112 Bacteria 9931328
771 2585314551 2582581314 Bacteria 11452267
772 2616900296 2616644941 Bacteria 8510691
773 2644089156 2643221615 Bacteria 5487866
774 2644319001 2643221657 Bacteria 5490246
775 2676478165 2675903058 Bacteria 6822861
776 2676489631 2675903060 Bacteria 10051191
777 2691512909 2690315906 Bacteria 4517044
778 2775656922 2775506735 Bacteria 4556596
779 2808877563 2808606366 Bacteria 4415912
780 2808896092 2808606371 Bacteria 4251511
781 2812321189 2811994871 Bacteria 4497550
782 2827631556 2827628540 Bacteria 6858585
783 2856858710 2856858025 Bacteria 7255264
784 2857484382 2857481737 Bacteria 4761446
785 2862178816 2862178590 Bacteria 8583590
786 2895883476 2895880812 Bacteria 11255272
787 2902585345 2902582711 Bacteria 6187705
788 2905927875 2905926851 Bacteria 4423176
789 2919394791 2919391150 Bacteria 4884741
790 2945959115 2945956166 Bacteria 5110334
791 2946071160 2946064051 Bacteria 8957905
792 2954009651 2954002825 Bacteria 9173742
793 2954385774 2954380949 Bacteria 10050426
794 2974317696 2974315732 Bacteria 4602776
795 2984525907 2984523437 Bacteria 4508481
796 3003002567 3002998708 Bacteria 11715108
797 649813108 649633069 Bacteria 6962533
798 8004021969 8004021418 Bacteria 4313954
799 8008491021 8008485437 Bacteria 7198341
800 8025530351 8025524527 Bacteria 7197316
801 8025534432 8025530807 Bacteria 8495698
802 8055175233 8055172936 Bacteria 9305943
803 Ga0070682_100366006
804 LJQas_1012816
805 JGI24752J21851_1010684
806 JGI25406J46586_10011059
807 Ga0070658_10205606
808 Ga0070683_100404270
809 Ga0070670_100017544
810 Ga0068869_100072896
811 Ga0070682_100254970
812 Ga0070660_100128424
813 Ga0070692_10003115
814 Ga0070668_100001096
815 Ga0070668_100118529
816 Ga0070669_100532798
817 Ga0070671_100009886
818 Ga0070673_100742233
819 Ga0070659_100522500
820 Ga0070703_10022898
821 Ga0070709_10088269
822 Ga0070709_10155052
823 Ga0070709_10457531
824 Ga0070714_100000003
825 Ga0070714_100158860
826 Ga0070714_100452803
827 Ga0070713_100002011
828 Ga0070710_10000108
829 Ga0070710_10023979
830 Ga0070701_10205466
831 Ga0070705_100347206
832 Ga0070694_100364134
833 Ga0070708_100005656
834 Ga0070678_100041810
835 Ga0070678_100735147
836 Ga0070685_10006738
837 Ga0070698_100016771
838 Ga0070679_100151982
839 Ga0070697_100185456
840 Ga0068853_100101094
841 Ga0068853_100604531
842 Ga0070672_100175000
843 Ga0070695_100513509
844 Ga0070665_100007299
845 Ga0070665_100656967
846 Ga0070704_100392939
847 Ga0068855_100189018
848 Ga0068857_100189198
849 Ga0068856_100259381
850 Ga0068856_100339649
851 Ga0068856_100351570
852 Ga0068856_100446187
853 Ga0070702_100390339
854 Ga0068852_100368015
855 Ga0068852_100571455
856 Ga0068859_100210067
857 Ga0068864_100070559
858 Ga0068870_10000281
859 Ga0068863_100012148
860 Ga0068858_100943326
861 Ga0068860_100483336
862 Ga0081455_10005427
863 Ga0081538_10080267
864 Ga0081540_1000634
865 Ga0081540_1043929
866 Ga0081539_10000421
867 Ga0081539_10000463
868 Ga0081539_10001814
869 Ga0081539_10305636
870 Ga0070717_10000824
871 Ga0070717_10932728
872 Ga0075365_10181255
873 Ga0075365_10222386
874 Ga0075365_10362618
875 Ga0075368_10039766
876 Ga0075364_10391639
877 Ga0075432_10008515
878 Ga0070715_10102264
879 Ga0070712_100012322
880 Ga0070712_100026629
881 Ga0070712_100577567
882 Ga0075367_10000477
883 Ga0068871_100543437
884 Ga0075428_100095632
885 Ga0075428_100668261
886 Ga0075428_101079068
887 Ga0075430_100912753
888 Ga0075433_10186721
889 Ga0068865_100882857
890 Ga0075436_100214979
891 Ga0097620_100210079
892 Ga0075435_100097635
893 Ga0099794_10057410
894 Ga0099795_10113905
895 Ga0105251_10091527
896 Ga0105244_10300483
897 Ga0105240_10849236
898 Ga0111539_11941873
899 Ga0105245_10290088
900 Ga0114129_10019804
901 Ga0114129_10878186
902 Ga0105243_10138717
903 Ga0105243_10327273
904 Ga0105241_10024278
905 Ga0105241_10125458
906 Ga0105241_10638520
907 Ga0105248_10363988
908 Ga0105237_10881443
909 Ga0105249_10852325
910 Ga0105239_10347023
911 Ga0105246_10007605
912 Ga0157340_1002957
913 Ga0157347_1016783
914 Ga0157339_1002388
915 Ga0157315_1013081
916 Ga0157373_10244410
917 Ga0157371_10019764
918 Ga0157370_10057757
919 Ga0157370_10172569
920 Ga0157369_10004927
921 Ga0157369_10043792
922 Ga0157369_10072569
923 Ga0157369_10114880
924 Ga0157369_10163231
925 Ga0157369_10900422
926 Ga0157374_11515629
927 Ga0163162_10154757
928 Ga0157375_11010199
929 Ga0157375_11207692
930 Ga0163163_10905555
931 Ga0157377_10099260
932 Ga0182006_1176231
933 Ga0182005_1061451
934 Ga0197907_11507549
935 Ga0206356_11343584
936 Ga0206354_10818180
937 Ga0206354_11119920
938 Ga0206353_10778901
939 Ga0206353_11075562
940 Ga0154015_1611789
941 Ga0213875_10003875
942 Ga0213875_10035227
943 Ga0224712_10161041
944 Ga0207672_1004327
945 Ga0207697_10141371
946 Ga0207692_10000299
947 Ga0207692_10223549
948 Ga0207647_10012243
949 Ga0207647_10027529
950 Ga0207699_10022749
951 Ga0207645_10075375
952 Ga0207643_10000120
953 Ga0207705_10078900
954 Ga0207684_10000005
955 Ga0207684_10152940
956 Ga0207654_10168540
957 Ga0207654_10266017
958 Ga0207693_10003816
959 Ga0207663_10060527
960 Ga0207660_10088318
961 Ga0207657_10038109
962 Ga0207657_10044336
963 Ga0207649_10002684
964 Ga0207652_10051467
965 Ga0207646_10000027
966 Ga0207646_10000775
967 Ga0207646_10053812
968 Ga0207650_10006900
969 Ga0207659_10035890
970 Ga0207687_10648722
971 Ga0207700_10011644
972 Ga0207700_10048609
973 Ga0207700_10572065
974 Ga0207664_10000039
975 Ga0207664_10004792
976 Ga0207664_10068935
977 Ga0207664_10597986
978 Ga0207709_10062387
979 Ga0207711_10399295
980 Ga0207661_10002759
981 Ga0207661_10242429
982 Ga0207661_10649779
983 Ga0207679_10932208
984 Ga0207667_10045431
985 Ga0207667_11042399
986 Ga0207712_10557161
987 Ga0207668_10030645
988 Ga0207640_10178959
989 Ga0207677_10117538
990 Ga0207677_10366125
991 Ga0207677_10515621
992 Ga0207703_10187562
993 Ga0207703_10923152
994 Ga0207639_10067850
995 Ga0207639_10508998
996 Ga0207702_10039434
997 Ga0207648_10132925
998 Ga0207676_10004096
999 Ga0207676_10205383
1000 Ga0207675_100044909
1001 Ga0207683_10000311
1002 Ga0209996_1018226
1003 Ga0209179_1099353
1004 Ga0209999_1047502
1005 Ga0210002_1061789
1006 Ga0209966_1042880
1007 Ga0209998_10056866
1008 Ga0209813_10015378
1009 Ga0268266_10007730
1010 Ga0268266_10708465
1011 Ga0307517_10002974
1012 Ga0307515_10091953
1013 Ga0307515_10218264
1014 Ga0307515_10533367
1015 Ga0307512_10017480
1016 Ga0307512_10018439
1017 Ga0316183_1044442
1018 Ga0316182_1256671
1019 Ga0307513_10100554
1020 Ga0307513_10165752
1021 Ga0307513_10362348
1022 Ga0307509_10219401
1023 Ga0307509_10249132
1024 Ga0307408_100018391
1025 Ga0307408_100038367
1026 Ga0307408_100452892
1027 Ga0307408_100648741
1028 Ga0307408_101138765
1029 Ga0307508_10012953
1030 Ga0307508_10201658
1031 Ga0307508_10285449
1032 Ga0307516_10009915
1033 Ga0307516_10233205
1034 Ga0307516_10341573
1035 Ga0307405_10095161
1036 Ga0307405_10680556
1037 Ga0307413_10061076
1038 Ga0307410_10025482
1039 Ga0307410_10056908
1040 Ga0307410_10221639
1041 Ga0307410_10381994
1042 Ga0307410_10745540
1043 Ga0307406_10450415
1044 Ga0307406_10567925
1045 Ga0307407_10443620
1046 Ga0307407_10719344
1047 Ga0307407_10725567
1048 Ga0307412_10006283
1049 Ga0307409_100078316
1050 Ga0307409_100228251
1051 Ga0307409_100311384
1052 Ga0307416_100005290
1053 Ga0307416_100009087
1054 Ga0307416_100098942
1055 Ga0307416_100724314
1056 Ga0307411_10120605
1057 Ga0307411_10176160
1058 Ga0307415_100053938
1059 Ga0307510_10161576
1060 Ga0373948_0068313
1061 Ga0373950_0034946
1062 Ga0373959_0005555
1063 Ga0373938_0022456
1064 Ga0373928_0023279
1065 Ga0373929_0150640
1066 Ga0373934_0001240
1067 Ga0373944_0169337
1068 Ga0373952_0041807
1069 Ga0373923_0005379
1070 Ga0373923_0126309
1071 Ga0373923_0436631
1072 Ga0373932_0041298
1073 Ga0373936_0000817
1074 Ga0373936_0030144
1075 Ga0373941_0037480
1076 Ga0373945_0004642
1077 Ga0373945_0035227
1078 Ga0373953_0028064
1079 Ga0373953_0323206
1080 Ga0373954_0017836
1081 Ga0373954_0501670
1082 Ga0373956_0010805
1083 Ga0373957_0001354
1084 Ga0373943_0000179
1085 Ga0373946_0000172
1086 Ga0373955_0002566
1087 Ga0373955_0101927
1088 Ga0373955_0762509
1089 Ga0373942_0068757
1090 Ga0373961_0270373
1091 Ga0373935_0000665
1092 Ga0373935_0034343
1093 Ga0373935_0167414
1094 Ga0373933_0009898
1095 Ga0373933_0028199
1096 Ga0373947_0730703
1097 Ga0373947_0814317
1098 Ga0373937_0005538
1099 Ga0373937_0149209
1100 Ga0373937_1525767
1101 Ga0373925_0004295
1102 Ga0373925_0012780
1103 Ga0395899_0021077
1104 Ga0395900_0089040
1105 Ga0395900_0506034
1106 Ga0395898_0024807
1107 Ga0395898_0058606
1108 Ga0395898_0058748
1109 Ga0395898_0275709
1110 Ga0395898_0539652
1111 Ga0436364_0042522
1112 Ga0436364_0389462
1113 Ga0436364_0646344
1114 Ga0436364_0876723
1115 Ga0436364_1075830
1116 Ga0436364_1270575
1117 Ga0395901_0005632
1118 Ga0395901_0271340
1119 Ga0242419_004293
1120 Ga0242422_03587
1121 Ga0242420_095322
1122 Ga0436365_0014356
1123 Ga0436365_0046929
1124 Ga0436365_0128693
1125 Ga0436365_0243231
1126 Ga0436360_1005885
1127 Ga0436360_1033448
1128 Ga0436363_0269211
1129 Ga0436363_0353524
1130 Ga0436363_0378516
1131 Ga0436363_0910161
1132 Ga0436363_1193792
1133 Ga0436363_1671435
1134 Ga0436362_0053900
1135 Ga0436362_0479211
1136 Ga0436362_0999546
1137 Ga0439447_058592
1138 Ga0439461_0038408
1139 Ga0451789_0641791
1140 Ga0451791_0623639
1141 Ga0451793_0894513
1142 Ga0451797_0177632
1143 Ga0451833_0746762
1144 Ga0451837_0741497
1145 Ga0451839_0134433
1146 Ga0451839_0683113
1147 Ga0451839_0702160
1148 Ga0451841_0493327
1149 Ga0451849_0367077
1150 Ga0451853_1140793
1151 Ga0439433_0081814
1152 Ga0439442_000063
1153 Ga0439445_0057456
1154 Ga0439449_0006717
1155 Ga0439449_0107789
1156 Ga0439450_056096
1157 Ga0439454_012352
1158 Ga0439455_0133228
1159 Ga0439457_111279
1160 Ga0450920_000021
1161 Ga0450920_008875
1162 Ga0450888_007513
1163 Ga0450898_089365
1164 Ga0450903_035907
1165 Ga0450907_000100
1166 Ga0450908_025404
1167 Ga0439434_0000027
1168 Ga0439435_0137317
1169 Ga0439444_0033205
1170 Ga0439459_0025398
1171 Ga0439464_0013712
1172 Ga0439464_0123854
1173 Ga0439460_0151571
1174 Ga0450918_001013
1175 Ga0451577_0827597
1176 Ga0439440_0002691
1177 Ga0466969_0031531
1178 Ga0466969_0036510
1179 Ga0466969_0120202
1180 Ga0466972_0264513
1181 Ga0466965_0003376
1182 Ga0466965_0072103
1183 Ga0466965_0468469
1184 Ga0466965_0487212
1185 Ga0466966_0012351
1186 Ga0466966_0142492
1187 Ga0466966_0210937
1188 Ga0466966_0478784
1189 Ga0466961_0003492
1190 Ga0466961_0072409
1191 Ga0466961_0139455
1192 Ga0466961_0683162
1193 Ga0466963_0061326
1194 Ga0466963_0073036
1195 Ga0466963_0231696
1196 Ga0466963_0318929
1197 Ga0466963_0459500
1198 Ga0466963_0472379
1199 Ga0466964_0085787
1200 Ga0466964_0196199
1201 Ga0466971_0003304
1202 Ga0466971_0006008
1203 Ga0466971_0144147
1204 Ga0466968_0106743
1205 Ga0466970_0027864
1206 Ga0466970_0190550
1207 Ga0466970_0278127
1208 Ga0466970_0347754
1209 Ga0466957_0016225
1210 Ga0466957_0499138
1211 Ga0466960_0003525
1212 Ga0466960_0074819
1213 Ga0466959_0004649
1214 Ga0466959_0046495
1215 Ga0451576_1547128
1216 Ga0466958_0009977
1217 Ga0466958_0149245
1218 Ga0466958_0194296
1219 Ga0466958_0530495
1220 Ga0466967_0028188
1221 Ga0466967_0043462
1222 Ga0466967_0056256
1223 Ga0466967_0060405
1224 Ga0466967_0069228
1225 Ga0466967_0169110
1226 Ga0466967_0529859
1227 Ga0466967_1635864
1228 Ga0466967_1904980
1229 Ga0495617_196495
1230 Ga0495592_0005695
1231 Ga0495603_0001265
1232 Ga0495590_0224462
1233 Ga0495591_130605
1234 Ga0495629_0002017
1235 Ga0495629_0008866
1236 Ga0495629_0067265
1237 Ga0495629_0106888
1238 Ga0495629_0325137
1239 Ga0495651_0004948
1240 Ga0495651_0034371
1241 Ga0495651_0074358
1242 Ga0495653_0001639
1243 Ga0495653_0252247
1244 Ga0495650_0000070
1245 Ga0495580_0197385
1246 Ga0495580_0219669
1247 Ga0495605_0074131
1248 Ga0495605_0279636
1249 Ga0495639_0051149
1250 Ga0495639_0142836
1251 Ga0495662_0011249
1252 Ga0495664_0003031
1253 Ga0495664_0244458
1254 Ga0495584_0299025
1255 Ga0495596_0193870
1256 Ga0495607_0098555
1257 Ga0495606_0036208
1258 Ga0495608_0003948
1259 Ga0495608_0005374
1260 Ga0495608_0167736
1261 Ga0495616_0015790
1262 Ga0495616_0301457
1263 Ga0495618_0008325
1264 Ga0495618_0018655
1265 Ga0495618_0044117
1266 Ga0495618_0048490
1267 Ga0495618_0465788
1268 Ga0495628_0000830
1269 Ga0495628_0095323
1270 Ga0495630_0003819
1271 Ga0495631_0221499
1272 Ga0495632_0085543
1273 Ga0495637_0078606
1274 Ga0495643_0022991
1275 Ga0495644_0307812
1276 Ga0495663_0068650
1277 Ga0495666_0097168
1278 Ga0495642_0139089
1279 Ga0495642_0344657
1280 Ga0495652_0017874
1281 Ga0495652_0124593
1282 Ga0495665_0034456
1283 Ga0495665_0352745
1284 Ga0495640_0038370
1285 Ga0495640_0070830
1286 Ga0495640_0677572
1287 Ga0495640_0775281
1288 Ga0495586_0229362
1289 Ga0495586_0412831
1290 Ga0495587_0020163
1291 Ga0495598_0196502
1292 Ga0495609_0265415
1293 Ga0495597_0080587
1294 Ga0495597_0250897
1295 Ga0495645_0021452
1296 Ga0495633_0039185
1297 Ga0495667_0000600
1298 Ga0495667_0004267
1299 Ga0495667_0132810
1300 Ga0495656_0051189
1301 Ga0495656_0266287
1302 Ga0495668_0015134
1303 Ga0495634_0004129
1304 Ga0495634_0043413
1305 Ga0495634_0185892
1306 Ga0495634_0731123
1307 Ga0495611_0346856
1308 Ga0495625_0033910
1309 Ga0495635_0005309
1310 Ga0495635_0012435
1311 Ga0495635_0025730
1312 Ga0495635_0195073
1313 Ga0495659_0086205
1314 Ga0495588_0084832
1315 Ga0495657_0010264
1316 Ga0495657_0010273
1317 Ga0495657_0023734
1318 Ga0495599_0007470
1319 Ga0495623_0056542
1320 Ga0495623_0069057
1321 Ga0495646_0012905
1322 Ga0495647_0236771
1323 Ga0495658_0436256
1324 Ga0495669_0209280
1325 Ga0495613_0002771
1326 Ga0495613_0022666
1327 Ga0495613_0183440
1328 Ga0495624_0003591
1329 Ga0495624_0008560
1330 Ga0495670_0064442
1331 Ga0495670_0528202
1332 Ga0495649_0065125
1333 Ga0495589_0074546
1334 Ga0495589_0137873
1335 Ga0495600_0006991
1336 Ga0495600_0071880
1337 Ga0495600_0342319
1338 Ga0495600_0513123
1339 Ga0495660_0236042
1340 Ga0495581_0111346
1341 Ga0495604_0005166
1342 Ga0495604_0106487
1343 Ga0495636_0003403
1344 Ga0495636_0254806
1345 Ga0495674_0000515
1346 Ga0495674_0033264
1347 Ga0495672_0027598
1348 Ga0495672_0112726
1349 Ga0495672_0231973
1350 Ga0495676_0001771
1351 Ga0495676_0006165
1352 Ga0495680_0004361
1353 Ga0495680_0011748
1354 Ga0495680_0015619
1355 Ga0495675_0019700
1356 Ga0495675_0021055
1357 Ga0495685_019924
1358 Ga0495673_0238073
1359 Ga0495684_0019548
1360 Ga0495684_0166346
1361 Ga0495684_0213763
1362 Ga0495684_0524694
1363 Ga0495593_0013855
1364 Ga0495593_0014454
1365 Ga0495602_0014842
1366 Ga0495602_0366596
1367 Ga0495614_0003912
1368 Ga0495614_0091509
1369 Ga0495614_0430586
1370 Ga0495615_0063920
1371 Ga0495626_0039304
1372 Ga0495626_0202436
1373 Ga0496100_0914240
1374 Ga0496101_0045089
1375 Ga0496101_0407203
1376 Ga0496101_0491333
1377 Ga0496101_0648058
1378 Ga0496102_0000238
1379 Ga0496102_0008999
1380 Ga0496102_0015831
1381 Ga0496102_0021374
1382 Ga0496102_0044222
1383 Ga0496102_0281033
1384 Ga0496102_1072964
1385 Ga0496104_0013002
1386 Ga0496104_0052484
1387 Ga0496104_0900909
1388 Ga0496105_0038395
1389 Ga0496105_0065724
1390 Ga0496105_0088710
1391 Ga0496105_0091960
1392 Ga0496106_0019912
1393 Ga0496106_0243610
1394 Ga0496106_0397181
1395 Ga0496107_0060026
1396 Ga0496107_0368477
1397 Ga0496108_0020355
1398 Ga0496108_0059412
1399 Ga0496108_0069104
1400 Ga0496108_0457770
1401 Ga0496109_0001418
1402 Ga0496109_0003356
1403 Ga0496109_0014879
1404 Ga0496109_0019096
1405 Ga0496109_0164638
1406 Ga0496109_0166113
1407 Ga0496109_0237603
1408 Ga0496109_0391319
1409 Ga0496109_0401717
1410 Ga0496109_0584987
1411 Ga0496109_0853853
1412 Ga0496110_0011587
1413 Ga0496110_0024136
1414 Ga0496110_0024704
1415 Ga0496110_0027517
1416 Ga0496110_0027535
1417 Ga0496110_0236386
1418 Ga0496110_1309784
1419 Ga0496111_0000581
1420 Ga0496111_0001060
1421 Ga0496111_0683446
1422 Ga0496112_0007617
1423 Ga0496112_0056555
1424 Ga0496112_0127923
1425 Ga0496112_0134454
1426 Ga0496112_0223740
1427 Ga0496112_0447584
1428 Ga0496113_0008551
1429 Ga0496113_0020523
1430 Ga0496113_0081390
1431 Ga0496113_0206850
1432 Ga0496113_0218337
1433 Ga0496113_0247639
1434 Ga0496113_0428030
1435 Ga0496113_0462949
1436 Ga0496113_0707096
1437 Ga0496114_0107468
1438 Ga0496114_0200888
1439 Ga0496115_0419778
1440 Ga0496119_0171611
1441 Ga0496121_0014397
1442 Ga0496125_0001520
1443 Ga0496126_0000055
1444 Ga0496126_0042297
1445 Ga0496126_0089761
1446 Ga0495678_178882
1447 Ga0501290_037716
1448 Ga0501291_056830
1449 Ga0501294_034114
1450 Ga0501298_090074
1451 Ga0501031_0007035
1452 Ga0501031_0220942
1453 Ga0501031_0433027
1454 Ga0501031_0694329
1455 Ga0501032_0036534
1456 Ga0501032_0470657
1457 Ga0501033_0016196
1458 Ga0501033_0583718
1459 Ga0501036_0506640
1460 Ga0501037_0011699
1461 Ga0501037_0032324
1462 Ga0501038_0116350
1463 Ga0501038_0157585
1464 Ga0501039_0026080
1465 Ga0501039_0136188
1466 Ga0501039_0517770
1467 Ga0501040_0004768
1468 Ga0501040_0031536
1469 Ga0501040_0204014
1470 Ga0501040_0377844
1471 Ga0501041_0134964
1472 Ga0501041_0627771
1473 Ga0501042_0106347
1474 Ga0501042_1110239
1475 Ga0501043_0008674
1476 Ga0501046_0025087
1477 Ga0501047_0179517
1478 Ga0501047_0487963
1479 Ga0501048_0010568
1480 Ga0501048_0181621
1481 Ga0501067_0018871
1482 Ga0501068_0057494
1483 Ga0501068_0171257
1484 Ga0501069_0435214
1485 Ga0501070_0133156
1486 Ga0501070_0656195
1487 Ga0501071_0001162
1488 Ga0501071_0072245
1489 Ga0501071_0091143
1490 Ga0501072_0016723
1491 Ga0501072_0168915
1492 Ga0501073_0163520
1493 Ga0501074_0144620
1494 Ga0501074_0361723
1495 Ga0501074_0600198
1496 Ga0501074_0629768
1497 Ga0501075_0426549
1498 Ga0501077_0002148
1499 Ga0501077_0024159
1500 Ga0501077_0048627
1501 Ga0501209_122433
1502 Ga0501233_074125
1503 Ga0501235_055826
1504 Ga0501243_090923
1505 Ga0501259_017380
1506 Ga0501260_018329
1507 Ga0501221_119442
1508 Ga0501229_013354
1509 Ga0501079_0036930
1510 Ga0501079_0184110
1511 Ga0501080_0013621
1512 Ga0501080_1484481
1513 Ga0501081_0005988
1514 Ga0501083_0005930
1515 Ga0501083_0273982
1516 Ga0501262_031958
1517 Ga0501266_026708
1518 Ga0501276_004925
1519 Ga0501035_0161115
1520 Ga0501035_0277250
1521 Ga0501044_0016193
1522 Ga0501045_0081730
1523 Ga0501045_0332560
1524 Ga0501045_0716260
1525 nmdc:mga0yw44_612588_c1
1526 nmdc:mga06z11_1431_c1
1527 nmdc:mga04h51_18087_c1
1528 nmdc:mga05p37_1576355_c1
1529 nmdc:mga05p37_1587141_c1
1530 nmdc:mga05p37_9348_c1
1531 nmdc:mga06r32_1055209_c1
1532 nmdc:mga08y16_1059730_c1
1533 nmdc:mga0n895_499514_c1
1534 nmdc:mga0n895_85633_c1
1535 nmdc:mga0rr50_21065_c1
1536 nmdc:mga0rr50_220576_c1
1537 nmdc:mga0rr50_281287_c1
1538 nmdc:mga08x19_206783_c1
1539 nmdc:mga08x19_94230_c1
1540 Ga0495601_0218560
1541 Ga0495612_0006853
1542 Ga0495612_0065581
1543 Ga0495655_0002326
1544 Ga0495595_0110669
1545 Ga0495619_0006498
1546 Ga0495619_0337223
1547 Ga0500578_0282578
1548 Ga0500566_0358544
1549 Ga0500556_0001192
1550 Ga0500569_002000
1551 Ga0500652_135439
1552 Ga0500568_0156030
1553 Ga0500573_0000024
1554 Ga0500600_0016312
1555 Ga0500616_0001840
1556 Ga0500616_0062343
1557 Ga0500633_0190832
1558 Ga0500634_0006806
1559 Ga0500587_013918
1560 Ga0501084_0033772
1561 Ga0590077_024738
1562 Ga0587088_077970
1563 Ga0587107_062135
1564 Ga0501082_0035247
1565 Ga0466962_0000285
1566 Ga0466962_0001997
1567 Ga0530510_0009219
1568 Ga0530510_0103864
1569 Ga0530510_0431582
1570 2501945742
1571 2537898000
1572 2558910135
1573 2585314551
1574 2616900296
1575 2644089156
1576 2644319001
1577 2676478165
1578 2676489631
1579 2691512909
1580 2775656922
1581 2808877563
1582 2808896092
1583 2812321189
1584 2827631556
1585 2856858710
1586 2857484382
1587 2862178816
1588 2895883476
1589 2902585345
1590 2905927875
1591 2919394791
1592 2945959115
1593 2946071160
1594 2954009651
1595 2954385774
1596 2974317696
1597 2984525907
1598 3003002567
1599 649813108
1600 8004021969
1601 8008491021
1602 8025530351
1603 8025534432
1604 8055175233

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

34

212

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8682 2 186
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8269 1 186
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8253 2 186
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8223 1 186
5mzq-assembly1.cif.gz_A x-ray structure of the m205w mutant of glic in complex with bromoform 0.8154 161 185
ID Description Score Start End Superfamily
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8675 2 183 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8624 2 183 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8241 4 184 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8208 1 186 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8163 1 186 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A536QKG7-F1-model_v4 Deaminase 0.9828 59 187 GO:0008703
GO:0009231
AF-A0A2V5DAX4-F1-model_v4 deleted 0.9767 1 187
AF-A0A2Z3VBA2-F1-model_v4 Deaminase 0.9766 1 187 GO:0008703
GO:0009231
AF-A0A536QKG7-F1-model_v4 Deaminase 0.9754 59 187 GO:0008703
GO:0009231
AF-A0A4R2KDW8-F1-model_v4 Dihydrofolate reductase 0.9726 1 187 GO:0008703
GO:0009231

Map