F481421

General Info

Members Datasets Scaffolds Average Seq Length
801 359 1602 122

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0444384|Ga0373947_0444384_254_688
Length 131
Sequence MTRRPARAEDDAQGKTDKGKGTPMRTKSVISLTTGLEDAERVTVAFLVAVTKEAVRLVTGGVARAQACEGCPPLEDLVARYDAAGGRYLVCPICFDARHLDKGDLLANAELGGTVPMWEWIGDEPANTFSY

Samples

Sample ID Description Type Environment
1 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
177 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
178 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
179 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
180 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
181 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
182 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
185 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
186 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
189 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
190 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
191 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
208 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
209 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
210 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
214 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
215 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
216 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
217 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
218 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
230 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
231 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
232 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
233 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
234 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
235 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
236 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
237 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
238 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
239 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
240 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
241 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
242 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
243 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
246 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
247 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
248 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
249 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
250 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
251 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
252 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
265 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
266 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
267 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
268 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
272 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
273 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
274 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
275 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
279 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
280 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
281 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
282 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
283 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
284 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
285 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
286 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
287 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
288 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
289 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
290 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
291 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
292 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
306 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
307 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
308 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
309 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
310 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
311 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
312 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
313 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
327 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
328 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
329 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
330 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
331 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
332 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
333 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
334 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
335 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
338 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
339 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
340 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
341 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
342 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
345 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
346 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
347 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
348 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
349 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
350 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
351 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
352 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
353 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
354 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
355 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
356 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
357 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
358 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
359 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.75
Metatranscriptomes 2.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.99
Nodule 0
Rhizoplane 7.37
Rhizosphere 84.14
Stem 0
Stem Tuber 0
Unclassified 5.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373947_0444384 3300035725 Bacteria 878
2 JGI24735J21928_10024171 3300002067 Bacteria 1840
3 Ga0058862_12714637 3300004803 Bacteria 1201
4 Ga0070658_10263115 3300005327 Bacteria 1465
5 Ga0070658_10371624 3300005327 Unclassified 1226
6 Ga0070658_10613674 3300005327 Bacteria 943
7 Ga0070683_100047862 3300005329 Bacteria 3952
8 Ga0070683_100205907 3300005329 Bacteria 1868
9 Ga0070683_100213469 3300005329 Bacteria 1833
10 Ga0070683_100666617 3300005329 Bacteria 996
11 Ga0070683_100959580 3300005329 Bacteria 820
12 Ga0070683_101169594 3300005329 Bacteria 739
13 Ga0068869_100001554 3300005334 Bacteria 13635
14 Ga0070680_100001867 3300005336 Bacteria 15445
15 Ga0070680_101274945 3300005336 Bacteria 636
16 Ga0070682_100045519 3300005337 Bacteria 2720
17 Ga0070682_100151091 3300005337 Bacteria 1594
18 Ga0070682_100245335 3300005337 Bacteria 1288
19 Ga0070682_100544140 3300005337 Unclassified 907
20 Ga0070682_101006128 3300005337 Bacteria 692
21 Ga0070682_101117173 3300005337 Bacteria 661
22 Ga0068868_100093258 3300005338 Bacteria 2428
23 Ga0070660_100011287 3300005339 Bacteria 6342
24 Ga0070660_100120361 3300005339 Unclassified 2095
25 Ga0070660_100599326 3300005339 Bacteria 921
26 Ga0070660_100601240 3300005339 Bacteria 920
27 Ga0070689_100293701 3300005340 Bacteria 1351
28 Ga0070689_100672584 3300005340 Bacteria 902
29 Ga0070687_100040039 3300005343 Bacteria 2359
30 Ga0070687_100981032 3300005343 Bacteria 611
31 Ga0070687_101443203 3300005343 Bacteria 516
32 Ga0070661_100030413 3300005344 Bacteria 3901
33 Ga0070661_101421171 3300005344 Bacteria 584
34 Ga0070692_10015551 3300005345 Bacteria 3601
35 Ga0070692_10133882 3300005345 Bacteria 1396
36 Ga0070692_11035176 3300005345 Bacteria 576
37 Ga0070668_100265354 3300005347 Bacteria 1429
38 Ga0070668_100468647 3300005347 Bacteria 1086
39 Ga0070675_100000163 3300005354 Bacteria 40864
40 Ga0070675_101289621 3300005354 Bacteria 673
41 Ga0070671_100005469 3300005355 Bacteria 10138
42 Ga0070671_101658470 3300005355 Bacteria 567
43 Ga0070674_101458516 3300005356 Bacteria 614
44 Ga0070659_100004615 3300005366 Bacteria 9842
45 Ga0070659_100097869 3300005366 Bacteria 2358
46 Ga0070667_101911157 3300005367 Bacteria 559
47 Ga0070714_100037815 3300005435 Bacteria 4057
48 Ga0070714_100060867 3300005435 Bacteria 3241
49 Ga0070714_100141371 3300005435 Bacteria 2161
50 Ga0070714_100262517 3300005435 Unclassified 1599
51 Ga0070714_100777400 3300005435 Bacteria 926
52 Ga0070714_101453777 3300005435 Bacteria 669
53 Ga0070713_100574700 3300005436 Bacteria 1069
54 Ga0070713_102122991 3300005436 Bacteria 544
55 Ga0070713_102365586 3300005436 Bacteria 514
56 Ga0070710_10049710 3300005437 Bacteria 2347
57 Ga0070710_10199044 3300005437 Bacteria 1264
58 Ga0070711_100054761 3300005439 Bacteria 2753
59 Ga0070711_101853323 3300005439 Bacteria 530
60 Ga0070700_100456312 3300005441 Bacteria 974
61 Ga0070694_101056620 3300005444 Bacteria 676
62 Ga0070708_100109505 3300005445 Bacteria 2538
63 Ga0070708_101227672 3300005445 Bacteria 701
64 Ga0070663_100007709 3300005455 Bacteria 6574
65 Ga0070663_100660846 3300005455 Bacteria 885
66 Ga0070663_101045447 3300005455 Bacteria 712
67 Ga0070678_100028140 3300005456 Bacteria 3828
68 Ga0070678_101259473 3300005456 Bacteria 687
69 Ga0070681_10000019 3300005458 Bacteria 124774
70 Ga0070681_10025429 3300005458 Bacteria 5955
71 Ga0070681_10181600 3300005458 Bacteria 2025
72 Ga0070681_10258450 3300005458 Bacteria 1653
73 Ga0070681_10676124 3300005458 Bacteria 947
74 Ga0070681_11220633 3300005458 Bacteria 674
75 Ga0068867_100325718 3300005459 Bacteria 1274
76 Ga0068867_102295785 3300005459 Bacteria 513
77 Ga0070685_10071463 3300005466 Bacteria 2057
78 Ga0070685_10912354 3300005466 Bacteria 654
79 Ga0070706_100040926 3300005467 Bacteria 4279
80 Ga0070706_100054531 3300005467 Bacteria 3689
81 Ga0070706_100078167 3300005467 Bacteria 3063
82 Ga0070707_100372722 3300005468 Bacteria 1387
83 Ga0070698_100002905 3300005471 Bacteria 18860
84 Ga0070698_100194137 3300005471 Bacteria 1967
85 Ga0070698_102118452 3300005471 Bacteria 516
86 Ga0070699_100005379 3300005518 Bacteria 11231
87 Ga0070699_101069807 3300005518 Bacteria 740
88 Ga0070679_100000124 3300005530 Bacteria 61752
89 Ga0070679_100041440 3300005530 Bacteria 4582
90 Ga0070679_100176290 3300005530 Bacteria 2110
91 Ga0070679_100221259 3300005530 Bacteria 1854
92 Ga0070679_100702702 3300005530 Bacteria 954
93 Ga0070679_101003847 3300005530 Bacteria 779
94 Ga0070679_101508638 3300005530 Unclassified 619
95 Ga0070684_100010909 3300005535 Bacteria 7220
96 Ga0070684_100077885 3300005535 Bacteria 2929
97 Ga0070684_100154244 3300005535 Bacteria 2082
98 Ga0070684_100510177 3300005535 Bacteria 1114
99 Ga0070684_100722291 3300005535 Bacteria 929
100 Ga0070697_100080944 3300005536 Bacteria 2676
101 Ga0070697_100272103 3300005536 Bacteria 1452
102 Ga0068853_101001193 3300005539 Bacteria 804
103 Ga0070672_100331691 3300005543 Bacteria 1294
104 Ga0070672_101065367 3300005543 Bacteria 718
105 Ga0070693_100401754 3300005547 Bacteria 950
106 Ga0070693_100776615 3300005547 Bacteria 708
107 Ga0070665_100068784 3300005548 Bacteria 3550
108 Ga0070665_100451018 3300005548 Bacteria 1296
109 Ga0068855_100089927 3300005563 Bacteria 3544
110 Ga0068855_100090588 3300005563 Bacteria 3529
111 Ga0068855_100448487 3300005563 Bacteria 1408
112 Ga0068855_101097104 3300005563 Bacteria 832
113 Ga0068855_101302197 3300005563 Bacteria 752
114 Ga0068855_101432839 3300005563 Bacteria 711
115 Ga0070664_100000171 3300005564 Bacteria 45394
116 Ga0068857_100084914 3300005577 Bacteria 2829
117 Ga0068857_100158501 3300005577 Bacteria 2053
118 Ga0068856_100020469 3300005614 Bacteria 6426
119 Ga0068856_100110388 3300005614 Bacteria 2747
120 Ga0068856_100175856 3300005614 Bacteria 2153
121 Ga0068856_101174258 3300005614 Unclassified 784
122 Ga0068856_101969162 3300005614 Bacteria 595
123 Ga0068856_102229284 3300005614 Bacteria 556
124 Ga0070702_100142272 3300005615 Bacteria 1529
125 Ga0068852_100021312 3300005616 Bacteria 5172
126 Ga0068852_100538365 3300005616 Bacteria 1167
127 Ga0068852_100540607 3300005616 Bacteria 1164
128 Ga0068852_101378011 3300005616 Bacteria 727
129 Ga0068859_100838057 3300005617 Bacteria 1006
130 Ga0068864_100195901 3300005618 Bacteria 1854
131 Ga0068864_100226832 3300005618 Bacteria 1726
132 Ga0068864_101163706 3300005618 Bacteria 769
133 Ga0068861_100718899 3300005719 Bacteria 930
134 Ga0068863_100067102 3300005841 Bacteria 3394
135 Ga0068863_100322795 3300005841 Bacteria 1500
136 Ga0068858_100019719 3300005842 Bacteria 6305
137 Ga0068858_100128883 3300005842 Bacteria 2371
138 Ga0068858_100199220 3300005842 Bacteria 1893
139 Ga0068858_100325027 3300005842 Bacteria 1471
140 Ga0068858_100580916 3300005842 Bacteria 1086
141 Ga0068858_101939321 3300005842 Bacteria 582
142 Ga0068860_100412138 3300005843 Bacteria 1338
143 Ga0068862_100014187 3300005844 Bacteria 6606
144 Ga0068862_100402279 3300005844 Bacteria 1281
145 Ga0070717_11455546 3300006028 Bacteria 622
146 Ga0075365_10146603 3300006038 Bacteria 1640
147 Ga0075365_10257495 3300006038 Bacteria 1227
148 Ga0075365_10394936 3300006038 Bacteria 976
149 Ga0075365_11039747 3300006038 Bacteria 577
150 Ga0075368_10056645 3300006042 Bacteria 1564
151 Ga0075363_100006422 3300006048 Bacteria 5338
152 Ga0075363_100011220 3300006048 Bacteria 4285
153 Ga0075363_100028073 3300006048 Bacteria 2891
154 Ga0075363_100051550 3300006048 Bacteria 2195
155 Ga0075363_100150526 3300006048 Bacteria 1313
156 Ga0075363_100204311 3300006048 Bacteria 1129
157 Ga0075364_10022952 3300006051 Bacteria 3946
158 Ga0075364_10031412 3300006051 Bacteria 3412
159 Ga0075364_10039779 3300006051 Bacteria 3049
160 Ga0075364_10130191 3300006051 Bacteria 1688
161 Ga0075364_10298772 3300006051 Bacteria 1096
162 Ga0075364_10507836 3300006051 Bacteria 824
163 Ga0075364_10779268 3300006051 Bacteria 652
164 Ga0075432_10104125 3300006058 Bacteria 1051
165 Ga0070715_10031977 3300006163 Bacteria 2140
166 Ga0070716_100079421 3300006173 Bacteria 1953
167 Ga0070716_100434501 3300006173 Bacteria 953
168 Ga0070712_100046157 3300006175 Bacteria 3011
169 Ga0070712_100123152 3300006175 Bacteria 1954
170 Ga0070712_100303331 3300006175 Unclassified 1293
171 Ga0075362_10205276 3300006177 Bacteria 960
172 Ga0075367_10048622 3300006178 Bacteria 2499
173 Ga0075367_10143872 3300006178 Bacteria 1478
174 Ga0075367_10349617 3300006178 Bacteria 933
175 Ga0097621_100086655 3300006237 Bacteria 2614
176 Ga0075370_10016419 3300006353 Bacteria 3984
177 Ga0075370_10172145 3300006353 Bacteria 1273
178 Ga0075370_10228087 3300006353 Bacteria 1102
179 Ga0068871_100060341 3300006358 Bacteria 3094
180 Ga0075428_100042378 3300006844 Bacteria 5004
181 Ga0075430_100119419 3300006846 Bacteria 2198
182 Ga0075431_100002670 3300006847 Bacteria 17285
183 Ga0075431_101651978 3300006847 Bacteria 598
184 Ga0075433_10007067 3300006852 Bacteria 8893
185 Ga0075433_10024621 3300006852 Bacteria 5083
186 Ga0075433_10382194 3300006852 Bacteria 1243
187 Ga0075433_11473541 3300006852 Bacteria 588
188 Ga0075434_100012544 3300006871 Bacteria 8038
189 Ga0075434_100858122 3300006871 Bacteria 923
190 Ga0075434_101334180 3300006871 Unclassified 728
191 Ga0075434_102071826 3300006871 Bacteria 574
192 Ga0075429_100004553 3300006880 Bacteria 11917
193 Ga0075429_100110762 3300006880 Bacteria 2400
194 Ga0075429_101644568 3300006880 Bacteria 558
195 Ga0068865_100760026 3300006881 Bacteria 833
196 Ga0068865_100818261 3300006881 Bacteria 805
197 Ga0075436_100027754 3300006914 Bacteria 3897
198 Ga0097620_100838167 3300006931 Bacteria 1006
199 Ga0075435_100003474 3300007076 Bacteria 10689
200 Ga0075435_100500992 3300007076 Bacteria 1050
201 Ga0075435_101049455 3300007076 Unclassified 712
202 Ga0105240_11503053 3300009093 Bacteria 706
203 Ga0111539_10001751 3300009094 Bacteria 28833
204 Ga0111539_11011810 3300009094 Bacteria 966
205 Ga0111539_11543742 3300009094 Bacteria 770
206 Ga0111539_11582381 3300009094 Bacteria 760
207 Ga0105245_10002955 3300009098 Bacteria 15249
208 Ga0105245_10197788 3300009098 Bacteria 1929
209 Ga0105245_10356966 3300009098 Bacteria 1450
210 Ga0105245_11106599 3300009098 Bacteria 839
211 Ga0105247_10317136 3300009101 Bacteria 1086
212 Ga0114129_10057272 3300009147 Bacteria 5455
213 Ga0114129_11875355 3300009147 Bacteria 727
214 Ga0105243_10111905 3300009148 Bacteria 2286
215 Ga0105243_10627267 3300009148 Bacteria 1039
216 Ga0105243_10810588 3300009148 Bacteria 923
217 Ga0105241_10236196 3300009174 Bacteria 1543
218 Ga0105241_10646887 3300009174 Bacteria 960
219 Ga0105241_11958230 3300009174 Bacteria 576
220 Ga0105242_10224577 3300009176 Bacteria 1680
221 Ga0105248_10311745 3300009177 Bacteria 1772
222 Ga0105248_10446047 3300009177 Bacteria 1458
223 Ga0105237_10143711 3300009545 Bacteria 2380
224 Ga0105237_10194636 3300009545 Bacteria 2027
225 Ga0105238_10451081 3300009551 Bacteria 1283
226 Ga0105238_10460957 3300009551 Bacteria 1269
227 Ga0105238_11739317 3300009551 Bacteria 655
228 Ga0105249_11801863 3300009553 Bacteria 685
229 Ga0105249_12381174 3300009553 Bacteria 602
230 Ga0105239_10218567 3300010375 Bacteria 2137
231 Ga0105239_10251013 3300010375 Bacteria 1987
232 Ga0105239_10356485 3300010375 Bacteria 1651
233 Ga0105239_11180760 3300010375 Bacteria 882
234 Ga0105239_12001566 3300010375 Bacteria 672
235 Ga0105246_10962909 3300011119 Bacteria 770
236 Ga0157342_1023592 3300012507 Bacteria 732
237 Ga0157373_11485165 3300013100 Bacteria 517
238 Ga0157371_10594569 3300013102 Bacteria 823
239 Ga0157370_10020939 3300013104 Bacteria 6523
240 Ga0157370_10376907 3300013104 Bacteria 1307
241 Ga0157370_10596181 3300013104 Bacteria 1012
242 Ga0157369_10045424 3300013105 Bacteria 4777
243 Ga0157369_10054024 3300013105 Bacteria 4338
244 Ga0157369_10058761 3300013105 Bacteria 4147
245 Ga0157369_10131659 3300013105 Unclassified 2650
246 Ga0157369_10167890 3300013105 Bacteria 2313
247 Ga0157369_10190719 3300013105 Bacteria 2154
248 Ga0157369_10562851 3300013105 Bacteria 1178
249 Ga0157369_10816131 3300013105 Bacteria 958
250 Ga0157369_11370697 3300013105 Bacteria 720
251 Ga0157374_10060394 3300013296 Bacteria 3548
252 Ga0157374_10973117 3300013296 Bacteria 867
253 Ga0157374_12540409 3300013296 Unclassified 540
254 Ga0157378_10055114 3300013297 Bacteria 3541
255 Ga0157378_11110139 3300013297 Bacteria 828
256 Ga0157372_10326880 3300013307 Bacteria 1785
257 Ga0157372_10472995 3300013307 Bacteria 1461
258 Ga0157372_11005866 3300013307 Bacteria 965
259 Ga0157372_11242788 3300013307 Bacteria 860
260 Ga0157372_11651541 3300013307 Bacteria 737
261 Ga0157375_10159899 3300013308 Bacteria 2394
262 Ga0157375_11209523 3300013308 Bacteria 886
263 Ga0163163_10069981 3300014325 Bacteria 3494
264 Ga0163163_10402308 3300014325 Bacteria 1427
265 Ga0163163_12602186 3300014325 Unclassified 563
266 Ga0163163_12695753 3300014325 Bacteria 554
267 Ga0157380_10409294 3300014326 Bacteria 1289
268 Ga0157380_12411934 3300014326 Bacteria 591
269 Ga0157377_10080692 3300014745 Bacteria 1901
270 Ga0157377_10520896 3300014745 Bacteria 835
271 Ga0157379_10023819 3300014968 Bacteria 5434
272 Ga0157379_11425175 3300014968 Bacteria 672
273 Ga0157379_12379732 3300014968 Bacteria 528
274 Ga0157376_10098479 3300014969 Bacteria 2549
275 Ga0157376_11221997 3300014969 Bacteria 780
276 Ga0157376_13140474 3300014969 Bacteria 500
277 Ga0197907_10185622 3300020069 Bacteria 1346
278 Ga0206356_10273440 3300020070 Unclassified 902
279 Ga0206356_11096615 3300020070 Unclassified 658
280 Ga0206349_1888858 3300020075 Unclassified 603
281 Ga0206352_10678255 3300020078 Unclassified 507
282 Ga0206352_11272370 3300020078 Bacteria 937
283 Ga0206350_10568654 3300020080 Bacteria 840
284 Ga0206354_10143081 3300020081 Bacteria 1150
285 Ga0206354_10999526 3300020081 Bacteria 1638
286 Ga0206353_10004865 3300020082 Bacteria 1121
287 Ga0206353_10021613 3300020082 Bacteria 1805
288 Ga0206353_10268663 3300020082 Bacteria 890
289 Ga0206353_10442713 3300020082 Unclassified 1209
290 Ga0206353_11064297 3300020082 Bacteria 799
291 Ga0224712_10045486 3300022467 Bacteria 1680
292 Ga0224712_10086127 3300022467 Bacteria 1307
293 Ga0224712_10476916 3300022467 Bacteria 601
294 Ga0209051_1000011 3300025303 Bacteria 610828
295 Ga0207692_10026180 3300025898 Bacteria 2734
296 Ga0207692_10160576 3300025898 Bacteria 1295
297 Ga0207710_10540969 3300025900 Bacteria 606
298 Ga0207688_10007688 3300025901 Bacteria 5870
299 Ga0207688_10284501 3300025901 Bacteria 1008
300 Ga0207688_10662320 3300025901 Bacteria 659
301 Ga0207680_10397291 3300025903 Bacteria 974
302 Ga0207647_10006342 3300025904 Bacteria 8601
303 Ga0207685_10026105 3300025905 Bacteria 2026
304 Ga0207699_10087472 3300025906 Bacteria 1948
305 Ga0207645_10330045 3300025907 Bacteria 1019
306 Ga0207705_10085766 3300025909 Unclassified 2301
307 Ga0207705_10091991 3300025909 Bacteria 2222
308 Ga0207705_10197338 3300025909 Bacteria 1524
309 Ga0207705_10238956 3300025909 Bacteria 1383
310 Ga0207705_10508546 3300025909 Unclassified 936
311 Ga0207705_10517916 3300025909 Bacteria 927
312 Ga0207705_10569002 3300025909 Bacteria 881
313 Ga0207684_10021683 3300025910 Bacteria 5484
314 Ga0207684_10325185 3300025910 Bacteria 1325
315 Ga0207707_10000046 3300025912 Bacteria 119404
316 Ga0207707_10005997 3300025912 Bacteria 10637
317 Ga0207707_10091557 3300025912 Bacteria 2657
318 Ga0207707_10404959 3300025912 Bacteria 1171
319 Ga0207707_10682645 3300025912 Bacteria 863
320 Ga0207707_10777412 3300025912 Bacteria 799
321 Ga0207671_10135857 3300025914 Bacteria 1891
322 Ga0207671_10915126 3300025914 Bacteria 693
323 Ga0207693_10046041 3300025915 Bacteria 3427
324 Ga0207693_10078989 3300025915 Bacteria 2575
325 Ga0207693_10083973 3300025915 Bacteria 2495
326 Ga0207693_10618498 3300025915 Bacteria 842
327 Ga0207663_10053416 3300025916 Bacteria 2524
328 Ga0207663_11161170 3300025916 Unclassified 621
329 Ga0207660_10001152 3300025917 Bacteria 17644
330 Ga0207660_10131497 3300025917 Bacteria 1905
331 Ga0207662_10028380 3300025918 Bacteria 3234
332 Ga0207662_10877060 3300025918 Bacteria 635
333 Ga0207657_10015665 3300025919 Bacteria 7333
334 Ga0207657_10056923 3300025919 Bacteria 3372
335 Ga0207657_10095765 3300025919 Bacteria 2470
336 Ga0207657_10124780 3300025919 Unclassified 2115
337 Ga0207649_10019028 3300025920 Bacteria 3920
338 Ga0207649_11112124 3300025920 Bacteria 623
339 Ga0207652_10000545 3300025921 Bacteria 38095
340 Ga0207652_10012891 3300025921 Bacteria 6762
341 Ga0207652_10202630 3300025921 Bacteria 1786
342 Ga0207652_10218205 3300025921 Bacteria 1718
343 Ga0207652_10229545 3300025921 Bacteria 1673
344 Ga0207652_10749101 3300025921 Bacteria 869
345 Ga0207652_11834635 3300025921 Bacteria 511
346 Ga0207646_10240578 3300025922 Bacteria 1635
347 Ga0207694_10275302 3300025924 Bacteria 1381
348 Ga0207659_10000522 3300025926 Bacteria 23052
349 Ga0207659_10434370 3300025926 Bacteria 1103
350 Ga0207687_10036103 3300025927 Bacteria 3366
351 Ga0207687_10206236 3300025927 Bacteria 1539
352 Ga0207687_11758313 3300025927 Bacteria 531
353 Ga0207700_10289967 3300025928 Bacteria 1410
354 Ga0207700_10428374 3300025928 Bacteria 1163
355 Ga0207700_11165449 3300025928 Bacteria 688
356 Ga0207664_10017621 3300025929 Bacteria 5241
357 Ga0207664_10049665 3300025929 Bacteria 3304
358 Ga0207664_10051703 3300025929 Bacteria 3246
359 Ga0207664_10157553 3300025929 Bacteria 1934
360 Ga0207664_10176508 3300025929 Bacteria 1832
361 Ga0207664_10194866 3300025929 Bacteria 1746
362 Ga0207664_10215267 3300025929 Unclassified 1664
363 Ga0207664_10394131 3300025929 Bacteria 1231
364 Ga0207664_10641175 3300025929 Bacteria 955
365 Ga0207664_11946163 3300025929 Bacteria 511
366 Ga0207644_10012774 3300025931 Bacteria 5583
367 Ga0207690_10076418 3300025932 Bacteria 2325
368 Ga0207690_10751837 3300025932 Bacteria 804
369 Ga0207706_10050474 3300025933 Bacteria 3676
370 Ga0207706_10631894 3300025933 Bacteria 918
371 Ga0207709_10536477 3300025935 Bacteria 918
372 Ga0207709_11110303 3300025935 Bacteria 649
373 Ga0207709_11402224 3300025935 Bacteria 579
374 Ga0207670_10232208 3300025936 Bacteria 1417
375 Ga0207670_10457667 3300025936 Bacteria 1030
376 Ga0207670_10929298 3300025936 Bacteria 730
377 Ga0207665_10084797 3300025939 Bacteria 2187
378 Ga0207665_10700202 3300025939 Bacteria 796
379 Ga0207691_10446531 3300025940 Bacteria 1101
380 Ga0207711_10205312 3300025941 Bacteria 1799
381 Ga0207689_10004100 3300025942 Bacteria 13249
382 Ga0207689_10101269 3300025942 Bacteria 2366
383 Ga0207661_10012612 3300025944 Bacteria 6151
384 Ga0207661_10041702 3300025944 Bacteria 3614
385 Ga0207661_10256089 3300025944 Bacteria 1557
386 Ga0207661_10353954 3300025944 Bacteria 1325
387 Ga0207661_10517757 3300025944 Bacteria 1091
388 Ga0207661_10694241 3300025944 Bacteria 936
389 Ga0207661_11586861 3300025944 Bacteria 599
390 Ga0207661_11823775 3300025944 Bacteria 554
391 Ga0207679_10080503 3300025945 Bacteria 2487
392 Ga0207667_10981163 3300025949 Bacteria 833
393 Ga0207667_11805782 3300025949 Bacteria 575
394 Ga0207651_10677325 3300025960 Bacteria 907
395 Ga0207712_11371600 3300025961 Bacteria 632
396 Ga0207668_10765477 3300025972 Bacteria 853
397 Ga0207640_10195371 3300025981 Bacteria 1528
398 Ga0207658_10576567 3300025986 Bacteria 1009
399 Ga0207677_10005758 3300026023 Bacteria 6742
400 Ga0207677_10171449 3300026023 Bacteria 1697
401 Ga0207677_11318777 3300026023 Bacteria 663
402 Ga0207703_10063280 3300026035 Bacteria 3033
403 Ga0207703_10065090 3300026035 Bacteria 2995
404 Ga0207703_10103480 3300026035 Bacteria 2417
405 Ga0207703_10157876 3300026035 Bacteria 1984
406 Ga0207703_10776661 3300026035 Bacteria 914
407 Ga0207703_10800362 3300026035 Bacteria 900
408 Ga0207678_10000270 3300026067 Bacteria 47047
409 Ga0207678_10014105 3300026067 Bacteria 7028
410 Ga0207678_10034933 3300026067 Bacteria 4377
411 Ga0207678_10643891 3300026067 Bacteria 931
412 Ga0207678_10742274 3300026067 Bacteria 865
413 Ga0207708_10427068 3300026075 Bacteria 1100
414 Ga0207702_10115276 3300026078 Bacteria 2396
415 Ga0207702_10347333 3300026078 Bacteria 1418
416 Ga0207702_10607402 3300026078 Bacteria 1074
417 Ga0207702_11066310 3300026078 Unclassified 802
418 Ga0207641_10179708 3300026088 Bacteria 1937
419 Ga0207641_10249014 3300026088 Bacteria 1659
420 Ga0207648_10368625 3300026089 Bacteria 1297
421 Ga0207648_11171209 3300026089 Bacteria 722
422 Ga0207676_10245991 3300026095 Bacteria 1607
423 Ga0207676_10266277 3300026095 Bacteria 1550
424 Ga0207676_10981741 3300026095 Bacteria 832
425 Ga0207674_10098971 3300026116 Bacteria 2899
426 Ga0207674_10290433 3300026116 Bacteria 1584
427 Ga0207674_10403935 3300026116 Bacteria 1320
428 Ga0207674_11187794 3300026116 Bacteria 732
429 Ga0207675_100174401 3300026118 Bacteria 2057
430 Ga0207675_100407974 3300026118 Bacteria 1340
431 Ga0207683_10112959 3300026121 Bacteria 2433
432 Ga0207683_10354359 3300026121 Bacteria 1347
433 Ga0207698_10443815 3300026142 Bacteria 1251
434 Ga0207698_10569759 3300026142 Bacteria 1112
435 Ga0207698_10662059 3300026142 Bacteria 1035
436 Ga0207698_10665291 3300026142 Bacteria 1033
437 Ga0207698_11013209 3300026142 Bacteria 841
438 Ga0207698_11087231 3300026142 Bacteria 812
439 Ga0207698_11189043 3300026142 Bacteria 776
440 Ga0207698_11529103 3300026142 Bacteria 683
441 Ga0209813_10111501 3300027866 Bacteria 943
442 Ga0207428_10038487 3300027907 Bacteria 3888
443 Ga0207428_10323720 3300027907 Bacteria 1138
444 Ga0268266_10059549 3300028379 Bacteria 3291
445 Ga0268266_10194366 3300028379 Bacteria 1854
446 Ga0268266_11055210 3300028379 Bacteria 786
447 Ga0268265_10014096 3300028380 Bacteria 5448
448 Ga0268265_10597862 3300028380 Bacteria 1054
449 Ga0265337_1001081 3300028556 Bacteria 14056
450 Ga0265326_10008426 3300028558 Bacteria 3111
451 Ga0265319_1035243 3300028563 Bacteria 1717
452 Ga0265334_10011195 3300028573 Bacteria 3781
453 Ga0265323_10080550 3300028653 Bacteria 1100
454 Ga0265322_10042845 3300028654 Bacteria 1288
455 Ga0265336_10047115 3300028666 Bacteria 1308
456 Ga0265338_10005167 3300028800 Bacteria 17153
457 Ga0265338_10135362 3300028800 Unclassified 1938
458 Ga0265324_10005170 3300029957 Bacteria 5694
459 Ga0265332_10028568 3300031238 Bacteria 2440
460 Ga0265320_10062301 3300031240 Bacteria 1776
461 Ga0265325_10080785 3300031241 Bacteria 1616
462 Ga0265340_10031688 3300031247 Bacteria 2642
463 Ga0265339_10061251 3300031249 Bacteria 2026
464 Ga0265327_10001529 3300031251 Bacteria 28541
465 Ga0265327_10012095 3300031251 Bacteria 5858
466 Ga0265316_10354648 3300031344 Bacteria 1061
467 Ga0307408_100069291 3300031548 Bacteria 2601
468 Ga0265313_10065838 3300031595 Bacteria 1681
469 Ga0265314_10188715 3300031711 Bacteria 1228
470 Ga0265342_10057094 3300031712 Bacteria 2311
471 Ga0307405_10190644 3300031731 Unclassified 1480
472 Ga0307405_11560083 3300031731 Bacteria 582
473 Ga0307413_10388653 3300031824 Bacteria 1089
474 Ga0307413_10564091 3300031824 Bacteria 926
475 Ga0307413_11313093 3300031824 Bacteria 633
476 Ga0307413_11636764 3300031824 Bacteria 573
477 Ga0307410_10096689 3300031852 Bacteria 2108
478 Ga0307410_10189210 3300031852 Bacteria 1564
479 Ga0307406_10055554 3300031901 Bacteria 2532
480 Ga0307406_11539482 3300031901 Bacteria 586
481 Ga0307407_10024058 3300031903 Bacteria 3187
482 Ga0307412_10095744 3300031911 Unclassified 2088
483 Ga0307409_100218541 3300031995 Unclassified 1719
484 Ga0307409_100526256 3300031995 Bacteria 1156
485 Ga0307409_100611257 3300031995 Unclassified 1078
486 Ga0307409_100641587 3300031995 Bacteria 1055
487 Ga0307416_100215122 3300032002 Bacteria 1837
488 Ga0307416_101382125 3300032002 Unclassified 810
489 Ga0307414_10032345 3300032004 Bacteria 3443
490 Ga0307414_10430525 3300032004 Bacteria 1153
491 Ga0307411_10053987 3300032005 Bacteria 2636
492 Ga0307411_10231771 3300032005 Bacteria 1440
493 Ga0307415_100004477 3300032126 Bacteria 7255
494 Ga0307415_100104683 3300032126 Bacteria 2085
495 Ga0307415_100374374 3300032126 Bacteria 1207
496 Ga0373930_0002372 3300034816 Unclassified 2910
497 Ga0373928_0000685 3300035084 Bacteria 6648
498 Ga0373929_0004172 3300035085 Unclassified 2594
499 Ga0373929_0105290 3300035085 Bacteria 715
500 Ga0373923_0602636 3300035111 Bacteria 541
501 Ga0373932_0000052 3300035112 Bacteria 28410
502 Ga0373936_0124044 3300035113 Bacteria 1106
503 Ga0373945_0101227 3300035116 Bacteria 1128
504 Ga0373957_0184788 3300035120 Bacteria 865
505 Ga0373943_0254761 3300035170 Bacteria 987
506 Ga0373946_0500001 3300035171 Bacteria 623
507 Ga0373955_0697454 3300035172 Unclassified 623
508 Ga0373924_0495908 3300035410 Bacteria 549
509 Ga0373931_0000006 3300035691 Bacteria 437006
510 Ga0373931_0100955 3300035691 Bacteria 1623
511 Ga0373935_0325054 3300035692 Bacteria 1092
512 Ga0373935_0425986 3300035692 Bacteria 956
513 Ga0373927_0481890 3300035695 Bacteria 820
514 Ga0373933_1030300 3300035724 Bacteria 542
515 Ga0373947_0234687 3300035725 Bacteria 1209
516 Ga0373937_0682542 3300036401 Bacteria 973
517 Ga0373925_0921487 3300037068 Unclassified 720
518 Ga0395900_0096030 3300037418 Bacteria 3045
519 Ga0395900_0677479 3300037418 Bacteria 966
520 Ga0395898_0008302 3300037466 Bacteria 10978
521 Ga0395905_0030953 3300037471 Bacteria 5040
522 Ga0395905_0671853 3300037471 Bacteria 938
523 Ga0395901_0133605 3300038443 Bacteria 2608
524 Ga0395901_1214540 3300038443 Bacteria 719
525 Ga0395901_1687212 3300038443 Bacteria 585
526 Ga0436362_1038024 3300039453 Bacteria 1575
527 Ga0439466_0055784 3300041411 Bacteria 1283
528 Ga0439465_0065778 3300041413 Bacteria 1207
529 Ga0451793_0987011 3300041452 Bacteria 703
530 Ga0451793_1498796 3300041452 Unclassified 800
531 Ga0451797_0619213 3300041453 Unclassified 593
532 Ga0451797_1174252 3300041453 Bacteria 2671
533 Ga0451800_1312479 3300041459 Bacteria 739
534 Ga0451800_1450803 3300041459 Bacteria 573
535 Ga0451837_0398647 3300041494 Unclassified 758
536 Ga0451837_0483282 3300041494 Bacteria 1152
537 Ga0451847_0001171 3300041503 Unclassified 769
538 Ga0451843_1254936 3300041509 Bacteria 4377
539 Ga0451843_1507808 3300041509 Unclassified 651
540 Ga0451853_0449965 3300041512 Bacteria 650
541 Ga0451853_2409708 3300041512 Bacteria 1791
542 Ga0439431_0003720 3300041997 Bacteria 3371
543 Ga0439455_0127921 3300042012 Bacteria 715
544 Ga0439462_0190933 3300042015 Bacteria 582
545 Ga0450888_039048 3300042126 Bacteria 656
546 Ga0439434_0014998 3300042435 Bacteria 2308
547 Ga0451577_0001481 3300042876 Bacteria 31093
548 Ga0466972_0242794 3300044658 Bacteria 842
549 Ga0466972_0242901 3300044658 Bacteria 842
550 Ga0466965_0004254 3300044683 Bacteria 6366
551 Ga0466965_0170974 3300044683 Bacteria 1143
552 Ga0466965_0215856 3300044683 Bacteria 1021
553 Ga0466961_0141871 3300044693 Bacteria 1503
554 Ga0466963_0070725 3300044694 Bacteria 2347
555 Ga0466963_0135975 3300044694 Bacteria 1700
556 Ga0466963_0264015 3300044694 Bacteria 1209
557 Ga0466963_0288198 3300044694 Bacteria 1154
558 Ga0466963_0401193 3300044694 Bacteria 967
559 Ga0466963_0415778 3300044694 Bacteria 948
560 Ga0453684_0306225 3300044712 Bacteria 1804
561 Ga0466971_0192581 3300044719 Bacteria 961
562 Ga0466971_0371347 3300044719 Bacteria 694
563 Ga0466968_0000655 3300044735 Bacteria 11842
564 Ga0466970_0076831 3300044765 Bacteria 1799
565 Ga0466970_0296777 3300044765 Bacteria 911
566 Ga0466970_0549932 3300044765 Bacteria 667
567 Ga0466957_0027535 3300044842 Bacteria 3378
568 Ga0466957_0100307 3300044842 Bacteria 1824
569 Ga0466957_0180236 3300044842 Bacteria 1379
570 Ga0466957_0499238 3300044842 Bacteria 843
571 Ga0466957_0795179 3300044842 Bacteria 672
572 Ga0466957_0993404 3300044842 Bacteria 603
573 Ga0466960_0074798 3300044901 Bacteria 1693
574 Ga0466960_0400669 3300044901 Bacteria 790
575 Ga0466959_0032588 3300045049 Bacteria 3857
576 Ga0466959_0168896 3300045049 Bacteria 1535
577 Ga0466959_0794380 3300045049 Bacteria 633
578 Ga0466958_0067032 3300045836 Bacteria 2192
579 Ga0466958_0113101 3300045836 Bacteria 1695
580 Ga0466958_0234229 3300045836 Bacteria 1173
581 Ga0466958_0264964 3300045836 Bacteria 1100
582 Ga0466958_0508829 3300045836 Bacteria 781
583 Ga0466958_0945439 3300045836 Bacteria 562
584 Ga0466967_0074216 3300045976 Bacteria 3054
585 Ga0466967_0090812 3300045976 Bacteria 2775
586 Ga0466967_0138411 3300045976 Bacteria 2266
587 Ga0466967_0265361 3300045976 Bacteria 1643
588 Ga0466967_0383748 3300045976 Bacteria 1364
589 Ga0466967_0421446 3300045976 Bacteria 1301
590 Ga0466967_0470193 3300045976 Bacteria 1231
591 Ga0466967_0569720 3300045976 Bacteria 1116
592 Ga0466967_0643277 3300045976 Bacteria 1048
593 Ga0466967_0666620 3300045976 Bacteria 1029
594 Ga0466967_0965414 3300045976 Bacteria 848
595 Ga0466967_1778529 3300045976 Bacteria 613
596 Ga0466967_1897981 3300045976 Bacteria 592
597 Ga0495592_0021893 3300046454 Bacteria 4863
598 Ga0495603_0652689 3300046455 Bacteria 602
599 Ga0495629_0335348 3300046459 Bacteria 1033
600 Ga0495651_0000629 3300046462 Bacteria 27312
601 Ga0495653_0001785 3300046463 Bacteria 16960
602 Ga0495653_0336082 3300046463 Bacteria 975
603 Ga0495582_0098804 3300046473 Bacteria 1633
604 Ga0495662_0046545 3300046476 Bacteria 2095
605 Ga0495664_0011722 3300046477 Bacteria 4949
606 Ga0495664_0241643 3300046477 Bacteria 1092
607 Ga0495664_0268500 3300046477 Bacteria 1031
608 Ga0495664_0429905 3300046477 Bacteria 792
609 Ga0495608_0005666 3300046511 Bacteria 8915
610 Ga0495618_0012354 3300046514 Bacteria 5184
611 Ga0495618_0152834 3300046514 Bacteria 1474
612 Ga0495628_0008037 3300046516 Bacteria 9082
613 Ga0495628_0332029 3300046516 Bacteria 1120
614 Ga0495630_0010227 3300046517 Bacteria 6769
615 Ga0495652_0004825 3300046529 Bacteria 12822
616 Ga0495652_0109058 3300046529 Bacteria 2229
617 Ga0495652_0178968 3300046529 Bacteria 1630
618 Ga0495652_0733347 3300046529 Bacteria 662
619 Ga0495640_0007325 3300046533 Bacteria 8687
620 Ga0495586_0359667 3300046535 Bacteria 836
621 Ga0495587_0016580 3300046536 Bacteria 4583
622 Ga0495645_0003986 3300046543 Bacteria 10075
623 Ga0495645_0077954 3300046543 Bacteria 2382
624 Ga0495667_0000487 3300046559 Bacteria 25288
625 Ga0495667_0087674 3300046559 Bacteria 2018
626 Ga0495667_0370200 3300046559 Bacteria 904
627 Ga0495634_0019117 3300046642 Bacteria 4869
628 Ga0495635_0157549 3300046663 Bacteria 1545
629 Ga0495635_0295341 3300046663 Bacteria 1087
630 Ga0495635_0450914 3300046663 Bacteria 850
631 Ga0495657_0002166 3300046675 Bacteria 16662
632 Ga0495599_0000894 3300046678 Bacteria 16666
633 Ga0495599_0114062 3300046678 Bacteria 1682
634 Ga0495599_0244221 3300046678 Bacteria 1094
635 Ga0495623_0035010 3300046679 Bacteria 3219
636 Ga0495646_0015193 3300046680 Bacteria 4890
637 Ga0495646_0444157 3300046680 Bacteria 670
638 Ga0495658_0517002 3300046683 Bacteria 764
639 Ga0495613_0497079 3300046689 Bacteria 822
640 Ga0495600_0074302 3300046809 Bacteria 2219
641 Ga0495581_0352288 3300047315 Bacteria 859
642 Ga0495581_0426033 3300047315 Bacteria 773
643 Ga0495604_0026231 3300047317 Bacteria 4639
644 Ga0495674_0005002 3300047319 Bacteria 12750
645 Ga0495674_0005333 3300047319 Bacteria 12332
646 Ga0495674_0145980 3300047319 Bacteria 1986
647 Ga0495680_0001938 3300047322 Bacteria 21764
648 Ga0495680_0229079 3300047322 Bacteria 1324
649 Ga0495680_0522928 3300047322 Bacteria 803
650 Ga0495675_0020658 3300047444 Bacteria 4192
651 Ga0495684_0007645 3300047471 Bacteria 8363
652 Ga0495684_0338639 3300047471 Bacteria 1071
653 Ga0495602_0051783 3300048088 Bacteria 3653
654 Ga0495602_0441780 3300048088 Bacteria 920
655 Ga0495602_1104394 3300048088 Bacteria 520
656 Ga0495614_0291251 3300048089 Bacteria 753
657 Ga0496100_0042900 3300048903 Bacteria 2891
658 Ga0496100_0198158 3300048903 Bacteria 1462
659 Ga0496100_0866056 3300048903 Bacteria 709
660 Ga0496100_1237855 3300048903 Bacteria 589
661 Ga0496101_0192942 3300048904 Bacteria 1573
662 Ga0496102_0021211 3300048905 Bacteria 5745
663 Ga0496102_0232549 3300048905 Bacteria 1738
664 Ga0496103_0115954 3300048906 Bacteria 1704
665 Ga0496103_0358046 3300048906 Bacteria 938
666 Ga0496104_0028698 3300048907 Bacteria 5157
667 Ga0496104_0049942 3300048907 Bacteria 3946
668 Ga0496105_0079333 3300048908 Bacteria 2711
669 Ga0496105_0099608 3300048908 Bacteria 2400
670 Ga0496105_0859709 3300048908 Unclassified 686
671 Ga0496105_0983582 3300048908 Bacteria 632
672 Ga0496106_1027984 3300048909 Bacteria 647
673 Ga0496107_0420217 3300048910 Bacteria 994
674 Ga0496108_0073714 3300048911 Bacteria 2882
675 Ga0496108_0086438 3300048911 Bacteria 2662
676 Ga0496108_0227884 3300048911 Bacteria 1620
677 Ga0496108_0438795 3300048911 Bacteria 1140
678 Ga0496108_0461933 3300048911 Bacteria 1109
679 Ga0496109_0070477 3300048912 Unclassified 3208
680 Ga0496109_0087676 3300048912 Bacteria 2875
681 Ga0496109_0173964 3300048912 Bacteria 2021
682 Ga0496109_0244942 3300048912 Bacteria 1688
683 Ga0496109_0377455 3300048912 Bacteria 1339
684 Ga0496109_0607427 3300048912 Bacteria 1030
685 Ga0496109_1731427 3300048912 Bacteria 559
686 Ga0496110_0018855 3300048913 Bacteria 5796
687 Ga0496110_0056502 3300048913 Bacteria 3454
688 Ga0496110_0266591 3300048913 Bacteria 1559
689 Ga0496110_0485995 3300048913 Bacteria 1125
690 Ga0496110_1404712 3300048913 Bacteria 608
691 Ga0496111_0488152 3300048914 Bacteria 907
692 Ga0496112_0046454 3300048915 Bacteria 4259
693 Ga0496112_0470900 3300048915 Bacteria 1193
694 Ga0496112_0649737 3300048915 Bacteria 984
695 Ga0496113_0003886 3300048916 Bacteria 9048
696 Ga0496113_0027863 3300048916 Bacteria 4056
697 Ga0496113_0107809 3300048916 Bacteria 2165
698 Ga0496114_0001257 3300048917 Bacteria 19194
699 Ga0496114_0005559 3300048917 Bacteria 9879
700 Ga0496114_0049615 3300048917 Bacteria 3492
701 Ga0496114_0101098 3300048917 Bacteria 2461
702 Ga0496114_0145120 3300048917 Bacteria 2057
703 Ga0496114_0192686 3300048917 Bacteria 1784
704 Ga0496114_0359854 3300048917 Bacteria 1287
705 Ga0496114_0654236 3300048917 Bacteria 924
706 Ga0496114_1295874 3300048917 Bacteria 615
707 Ga0496115_0060444 3300048918 Bacteria 3053
708 Ga0496115_0128903 3300048918 Bacteria 2084
709 Ga0496115_0920874 3300048918 Bacteria 673
710 Ga0496120_0031799 3300048923 Bacteria 3190
711 Ga0496122_0007968 3300048925 Bacteria 11580
712 Ga0496123_0002184 3300048926 Bacteria 24910
713 Ga0496126_0004904 3300048929 Bacteria 15633
714 Ga0496126_0460715 3300048929 Bacteria 1022
715 Ga0501031_0021209 3300049568 Bacteria 4235
716 Ga0501032_0093019 3300049569 Bacteria 2000
717 Ga0501033_0030985 3300049570 Bacteria 4020
718 Ga0501036_0002982 3300049572 Bacteria 13453
719 Ga0501036_1553494 3300049572 Bacteria 535
720 Ga0501038_0016723 3300049574 Bacteria 6645
721 Ga0501039_0008000 3300049575 Bacteria 8057
722 Ga0501039_0575713 3300049575 Bacteria 883
723 Ga0501040_0020193 3300049576 Bacteria 4438
724 Ga0501041_0002110 3300049577 Bacteria 11209
725 Ga0501042_0172945 3300049578 Bacteria 1558
726 Ga0501043_1332594 3300049579 Bacteria 500
727 Ga0501046_0105645 3300049580 Bacteria 2156
728 Ga0501047_0000031 3300049581 Bacteria 215903
729 Ga0501048_0032523 3300049582 Bacteria 3769
730 Ga0501068_0386646 3300049584 Bacteria 901
731 Ga0501069_0115303 3300049585 Bacteria 1532
732 Ga0501069_0322957 3300049585 Bacteria 907
733 Ga0501070_0333434 3300049586 Bacteria 1233
734 Ga0501070_0423806 3300049586 Bacteria 1075
735 Ga0501072_0005231 3300049588 Bacteria 9879
736 Ga0501073_0077232 3300049589 Bacteria 2317
737 Ga0501073_0169786 3300049589 Bacteria 1510
738 Ga0501074_0269385 3300049590 Bacteria 1211
739 Ga0501074_0639199 3300049590 Bacteria 752
740 Ga0501075_0011436 3300049591 Bacteria 6282
741 Ga0501076_0013738 3300049592 Bacteria 6075
742 Ga0501077_0550255 3300049593 Bacteria 740
743 Ga0501079_0020323 3300049741 Bacteria 5074
744 Ga0501079_0128732 3300049741 Bacteria 1970
745 Ga0501080_0057411 3300049742 Bacteria 3624
746 Ga0501080_0667651 3300049742 Bacteria 919
747 Ga0501081_0023721 3300049743 Bacteria 4113
748 Ga0501045_0001680 3300049824 Bacteria 14897
749 nmdc:mga03683_135243_c1 3300050489 Bacteria 1105
750 nmdc:mga03683_649580_c1 3300050489 Bacteria 519
751 nmdc:mga03n38_120934_c1 3300050490 Archaea 1286
752 nmdc:mga03n38_418945_c1 3300050490 Bacteria 740
753 nmdc:mga03n38_44594_c1 3300050490 Bacteria 1949
754 nmdc:mga03n38_521307_c1 3300050490 Bacteria 669
755 nmdc:mga03n38_5797_c1 3300050490 Bacteria 4241
756 nmdc:mga03n38_7918_c1 3300050490 Bacteria 3782
757 nmdc:mga03n38_81354_c1 3300050490 Bacteria 1523
758 nmdc:mga00v17_113813_c1 3300050491 Bacteria 1718
759 nmdc:mga00v17_136079_c1 3300050491 Bacteria 1573
760 nmdc:mga00v17_17544_c1 3300050491 Bacteria 4054
761 nmdc:mga00v17_271239_c1 3300050491 Bacteria 1101
762 nmdc:mga00v17_340572_c1 3300050491 Bacteria 975
763 nmdc:mga00v17_60684_c1 3300050491 Bacteria 2323
764 nmdc:mga00v17_6998_c1 3300050491 Bacteria 6003
765 nmdc:mga0yw44_249836_c1 3300050492 Bacteria 1180
766 nmdc:mga0yw44_60626_c1 3300050492 Bacteria 2318
767 nmdc:mga0yw44_60954_c1 3300050492 Bacteria 2313
768 nmdc:mga0yw44_635800_c1 3300050492 Bacteria 725
769 nmdc:mga0yw44_71102_c1 3300050492 Bacteria 1863
770 nmdc:mga06z11_279041_c1 3300050494 Bacteria 989
771 nmdc:mga06z11_313449_c1 3300050494 Bacteria 935
772 nmdc:mga06z11_96306_c1 3300050494 Bacteria 1616
773 nmdc:mga04h51_141891_c1 3300050495 Bacteria 912
774 nmdc:mga07m45_114224_c1 3300050496 Bacteria 1557
775 nmdc:mga07m45_15915_c1 3300050496 Bacteria 4022
776 nmdc:mga07m45_259862_c1 3300050496 Bacteria 1010
777 nmdc:mga07m45_47175_c1 3300050496 Bacteria 2421
778 nmdc:mga05p37_105560_c1 3300050507 Bacteria 3466
779 nmdc:mga09592_138687_c1 3300050508 Bacteria 2095
780 nmdc:mga09592_9300_c1 3300050508 Bacteria 7989
781 nmdc:mga0qj67_93695_c1 3300050509 Bacteria 2415
782 nmdc:mga08y16_2138993_c1 3300050511 Bacteria 507
783 nmdc:mga08y16_221656_c1 3300050511 Bacteria 1958
784 nmdc:mga08y16_6100_c1 3300050511 Bacteria 12640
785 nmdc:mga0n895_110595_c1 3300050512 Bacteria 2764
786 nmdc:mga0rr50_7016_c1 3300050513 Bacteria 6914
787 nmdc:mga0rr50_908439_c1 3300050513 Unclassified 751
788 nmdc:mga0a205_11958_c1 3300050515 Bacteria 8016
789 nmdc:mga0a205_16179_c1 3300050515 Bacteria 6985
790 Ga0495601_0127463 3300053077 Bacteria 1656
791 Ga0495601_0505663 3300053077 Bacteria 779
792 Ga0495601_0700988 3300053077 Bacteria 646
793 Ga0495612_0234737 3300053078 Bacteria 814
794 Ga0495612_0239492 3300053078 Bacteria 806
795 Ga0495595_0004452 3300053084 Bacteria 5639
796 Ga0495595_0054662 3300053084 Bacteria 1857
797 Ga0495619_1070499 3300053085 Bacteria 537
798 Ga0501084_0179625 3300054114 Bacteria 1786
799 Ga0466962_0335166 3300061719 Bacteria 752
800 Ga0466962_0624104 3300061719 Bacteria 550
801 Ga0530510_0007328 3300061734 Bacteria 7677
802 Ga0373947_0444384
803 JGI24735J21928_10024171
804 Ga0058862_12714637
805 Ga0070658_10263115
806 Ga0070658_10371624
807 Ga0070658_10613674
808 Ga0070683_100047862
809 Ga0070683_100205907
810 Ga0070683_100213469
811 Ga0070683_100666617
812 Ga0070683_100959580
813 Ga0070683_101169594
814 Ga0068869_100001554
815 Ga0070680_100001867
816 Ga0070680_101274945
817 Ga0070682_100045519
818 Ga0070682_100151091
819 Ga0070682_100245335
820 Ga0070682_100544140
821 Ga0070682_101006128
822 Ga0070682_101117173
823 Ga0068868_100093258
824 Ga0070660_100011287
825 Ga0070660_100120361
826 Ga0070660_100599326
827 Ga0070660_100601240
828 Ga0070689_100293701
829 Ga0070689_100672584
830 Ga0070687_100040039
831 Ga0070687_100981032
832 Ga0070687_101443203
833 Ga0070661_100030413
834 Ga0070661_101421171
835 Ga0070692_10015551
836 Ga0070692_10133882
837 Ga0070692_11035176
838 Ga0070668_100265354
839 Ga0070668_100468647
840 Ga0070675_100000163
841 Ga0070675_101289621
842 Ga0070671_100005469
843 Ga0070671_101658470
844 Ga0070674_101458516
845 Ga0070659_100004615
846 Ga0070659_100097869
847 Ga0070667_101911157
848 Ga0070714_100037815
849 Ga0070714_100060867
850 Ga0070714_100141371
851 Ga0070714_100262517
852 Ga0070714_100777400
853 Ga0070714_101453777
854 Ga0070713_100574700
855 Ga0070713_102122991
856 Ga0070713_102365586
857 Ga0070710_10049710
858 Ga0070710_10199044
859 Ga0070711_100054761
860 Ga0070711_101853323
861 Ga0070700_100456312
862 Ga0070694_101056620
863 Ga0070708_100109505
864 Ga0070708_101227672
865 Ga0070663_100007709
866 Ga0070663_100660846
867 Ga0070663_101045447
868 Ga0070678_100028140
869 Ga0070678_101259473
870 Ga0070681_10000019
871 Ga0070681_10025429
872 Ga0070681_10181600
873 Ga0070681_10258450
874 Ga0070681_10676124
875 Ga0070681_11220633
876 Ga0068867_100325718
877 Ga0068867_102295785
878 Ga0070685_10071463
879 Ga0070685_10912354
880 Ga0070706_100040926
881 Ga0070706_100054531
882 Ga0070706_100078167
883 Ga0070707_100372722
884 Ga0070698_100002905
885 Ga0070698_100194137
886 Ga0070698_102118452
887 Ga0070699_100005379
888 Ga0070699_101069807
889 Ga0070679_100000124
890 Ga0070679_100041440
891 Ga0070679_100176290
892 Ga0070679_100221259
893 Ga0070679_100702702
894 Ga0070679_101003847
895 Ga0070679_101508638
896 Ga0070684_100010909
897 Ga0070684_100077885
898 Ga0070684_100154244
899 Ga0070684_100510177
900 Ga0070684_100722291
901 Ga0070697_100080944
902 Ga0070697_100272103
903 Ga0068853_101001193
904 Ga0070672_100331691
905 Ga0070672_101065367
906 Ga0070693_100401754
907 Ga0070693_100776615
908 Ga0070665_100068784
909 Ga0070665_100451018
910 Ga0068855_100089927
911 Ga0068855_100090588
912 Ga0068855_100448487
913 Ga0068855_101097104
914 Ga0068855_101302197
915 Ga0068855_101432839
916 Ga0070664_100000171
917 Ga0068857_100084914
918 Ga0068857_100158501
919 Ga0068856_100020469
920 Ga0068856_100110388
921 Ga0068856_100175856
922 Ga0068856_101174258
923 Ga0068856_101969162
924 Ga0068856_102229284
925 Ga0070702_100142272
926 Ga0068852_100021312
927 Ga0068852_100538365
928 Ga0068852_100540607
929 Ga0068852_101378011
930 Ga0068859_100838057
931 Ga0068864_100195901
932 Ga0068864_100226832
933 Ga0068864_101163706
934 Ga0068861_100718899
935 Ga0068863_100067102
936 Ga0068863_100322795
937 Ga0068858_100019719
938 Ga0068858_100128883
939 Ga0068858_100199220
940 Ga0068858_100325027
941 Ga0068858_100580916
942 Ga0068858_101939321
943 Ga0068860_100412138
944 Ga0068862_100014187
945 Ga0068862_100402279
946 Ga0070717_11455546
947 Ga0075365_10146603
948 Ga0075365_10257495
949 Ga0075365_10394936
950 Ga0075365_11039747
951 Ga0075368_10056645
952 Ga0075363_100006422
953 Ga0075363_100011220
954 Ga0075363_100028073
955 Ga0075363_100051550
956 Ga0075363_100150526
957 Ga0075363_100204311
958 Ga0075364_10022952
959 Ga0075364_10031412
960 Ga0075364_10039779
961 Ga0075364_10130191
962 Ga0075364_10298772
963 Ga0075364_10507836
964 Ga0075364_10779268
965 Ga0075432_10104125
966 Ga0070715_10031977
967 Ga0070716_100079421
968 Ga0070716_100434501
969 Ga0070712_100046157
970 Ga0070712_100123152
971 Ga0070712_100303331
972 Ga0075362_10205276
973 Ga0075367_10048622
974 Ga0075367_10143872
975 Ga0075367_10349617
976 Ga0097621_100086655
977 Ga0075370_10016419
978 Ga0075370_10172145
979 Ga0075370_10228087
980 Ga0068871_100060341
981 Ga0075428_100042378
982 Ga0075430_100119419
983 Ga0075431_100002670
984 Ga0075431_101651978
985 Ga0075433_10007067
986 Ga0075433_10024621
987 Ga0075433_10382194
988 Ga0075433_11473541
989 Ga0075434_100012544
990 Ga0075434_100858122
991 Ga0075434_101334180
992 Ga0075434_102071826
993 Ga0075429_100004553
994 Ga0075429_100110762
995 Ga0075429_101644568
996 Ga0068865_100760026
997 Ga0068865_100818261
998 Ga0075436_100027754
999 Ga0097620_100838167
1000 Ga0075435_100003474
1001 Ga0075435_100500992
1002 Ga0075435_101049455
1003 Ga0105240_11503053
1004 Ga0111539_10001751
1005 Ga0111539_11011810
1006 Ga0111539_11543742
1007 Ga0111539_11582381
1008 Ga0105245_10002955
1009 Ga0105245_10197788
1010 Ga0105245_10356966
1011 Ga0105245_11106599
1012 Ga0105247_10317136
1013 Ga0114129_10057272
1014 Ga0114129_11875355
1015 Ga0105243_10111905
1016 Ga0105243_10627267
1017 Ga0105243_10810588
1018 Ga0105241_10236196
1019 Ga0105241_10646887
1020 Ga0105241_11958230
1021 Ga0105242_10224577
1022 Ga0105248_10311745
1023 Ga0105248_10446047
1024 Ga0105237_10143711
1025 Ga0105237_10194636
1026 Ga0105238_10451081
1027 Ga0105238_10460957
1028 Ga0105238_11739317
1029 Ga0105249_11801863
1030 Ga0105249_12381174
1031 Ga0105239_10218567
1032 Ga0105239_10251013
1033 Ga0105239_10356485
1034 Ga0105239_11180760
1035 Ga0105239_12001566
1036 Ga0105246_10962909
1037 Ga0157342_1023592
1038 Ga0157373_11485165
1039 Ga0157371_10594569
1040 Ga0157370_10020939
1041 Ga0157370_10376907
1042 Ga0157370_10596181
1043 Ga0157369_10045424
1044 Ga0157369_10054024
1045 Ga0157369_10058761
1046 Ga0157369_10131659
1047 Ga0157369_10167890
1048 Ga0157369_10190719
1049 Ga0157369_10562851
1050 Ga0157369_10816131
1051 Ga0157369_11370697
1052 Ga0157374_10060394
1053 Ga0157374_10973117
1054 Ga0157374_12540409
1055 Ga0157378_10055114
1056 Ga0157378_11110139
1057 Ga0157372_10326880
1058 Ga0157372_10472995
1059 Ga0157372_11005866
1060 Ga0157372_11242788
1061 Ga0157372_11651541
1062 Ga0157375_10159899
1063 Ga0157375_11209523
1064 Ga0163163_10069981
1065 Ga0163163_10402308
1066 Ga0163163_12602186
1067 Ga0163163_12695753
1068 Ga0157380_10409294
1069 Ga0157380_12411934
1070 Ga0157377_10080692
1071 Ga0157377_10520896
1072 Ga0157379_10023819
1073 Ga0157379_11425175
1074 Ga0157379_12379732
1075 Ga0157376_10098479
1076 Ga0157376_11221997
1077 Ga0157376_13140474
1078 Ga0197907_10185622
1079 Ga0206356_10273440
1080 Ga0206356_11096615
1081 Ga0206349_1888858
1082 Ga0206352_10678255
1083 Ga0206352_11272370
1084 Ga0206350_10568654
1085 Ga0206354_10143081
1086 Ga0206354_10999526
1087 Ga0206353_10004865
1088 Ga0206353_10021613
1089 Ga0206353_10268663
1090 Ga0206353_10442713
1091 Ga0206353_11064297
1092 Ga0224712_10045486
1093 Ga0224712_10086127
1094 Ga0224712_10476916
1095 Ga0209051_1000011
1096 Ga0207692_10026180
1097 Ga0207692_10160576
1098 Ga0207710_10540969
1099 Ga0207688_10007688
1100 Ga0207688_10284501
1101 Ga0207688_10662320
1102 Ga0207680_10397291
1103 Ga0207647_10006342
1104 Ga0207685_10026105
1105 Ga0207699_10087472
1106 Ga0207645_10330045
1107 Ga0207705_10085766
1108 Ga0207705_10091991
1109 Ga0207705_10197338
1110 Ga0207705_10238956
1111 Ga0207705_10508546
1112 Ga0207705_10517916
1113 Ga0207705_10569002
1114 Ga0207684_10021683
1115 Ga0207684_10325185
1116 Ga0207707_10000046
1117 Ga0207707_10005997
1118 Ga0207707_10091557
1119 Ga0207707_10404959
1120 Ga0207707_10682645
1121 Ga0207707_10777412
1122 Ga0207671_10135857
1123 Ga0207671_10915126
1124 Ga0207693_10046041
1125 Ga0207693_10078989
1126 Ga0207693_10083973
1127 Ga0207693_10618498
1128 Ga0207663_10053416
1129 Ga0207663_11161170
1130 Ga0207660_10001152
1131 Ga0207660_10131497
1132 Ga0207662_10028380
1133 Ga0207662_10877060
1134 Ga0207657_10015665
1135 Ga0207657_10056923
1136 Ga0207657_10095765
1137 Ga0207657_10124780
1138 Ga0207649_10019028
1139 Ga0207649_11112124
1140 Ga0207652_10000545
1141 Ga0207652_10012891
1142 Ga0207652_10202630
1143 Ga0207652_10218205
1144 Ga0207652_10229545
1145 Ga0207652_10749101
1146 Ga0207652_11834635
1147 Ga0207646_10240578
1148 Ga0207694_10275302
1149 Ga0207659_10000522
1150 Ga0207659_10434370
1151 Ga0207687_10036103
1152 Ga0207687_10206236
1153 Ga0207687_11758313
1154 Ga0207700_10289967
1155 Ga0207700_10428374
1156 Ga0207700_11165449
1157 Ga0207664_10017621
1158 Ga0207664_10049665
1159 Ga0207664_10051703
1160 Ga0207664_10157553
1161 Ga0207664_10176508
1162 Ga0207664_10194866
1163 Ga0207664_10215267
1164 Ga0207664_10394131
1165 Ga0207664_10641175
1166 Ga0207664_11946163
1167 Ga0207644_10012774
1168 Ga0207690_10076418
1169 Ga0207690_10751837
1170 Ga0207706_10050474
1171 Ga0207706_10631894
1172 Ga0207709_10536477
1173 Ga0207709_11110303
1174 Ga0207709_11402224
1175 Ga0207670_10232208
1176 Ga0207670_10457667
1177 Ga0207670_10929298
1178 Ga0207665_10084797
1179 Ga0207665_10700202
1180 Ga0207691_10446531
1181 Ga0207711_10205312
1182 Ga0207689_10004100
1183 Ga0207689_10101269
1184 Ga0207661_10012612
1185 Ga0207661_10041702
1186 Ga0207661_10256089
1187 Ga0207661_10353954
1188 Ga0207661_10517757
1189 Ga0207661_10694241
1190 Ga0207661_11586861
1191 Ga0207661_11823775
1192 Ga0207679_10080503
1193 Ga0207667_10981163
1194 Ga0207667_11805782
1195 Ga0207651_10677325
1196 Ga0207712_11371600
1197 Ga0207668_10765477
1198 Ga0207640_10195371
1199 Ga0207658_10576567
1200 Ga0207677_10005758
1201 Ga0207677_10171449
1202 Ga0207677_11318777
1203 Ga0207703_10063280
1204 Ga0207703_10065090
1205 Ga0207703_10103480
1206 Ga0207703_10157876
1207 Ga0207703_10776661
1208 Ga0207703_10800362
1209 Ga0207678_10000270
1210 Ga0207678_10014105
1211 Ga0207678_10034933
1212 Ga0207678_10643891
1213 Ga0207678_10742274
1214 Ga0207708_10427068
1215 Ga0207702_10115276
1216 Ga0207702_10347333
1217 Ga0207702_10607402
1218 Ga0207702_11066310
1219 Ga0207641_10179708
1220 Ga0207641_10249014
1221 Ga0207648_10368625
1222 Ga0207648_11171209
1223 Ga0207676_10245991
1224 Ga0207676_10266277
1225 Ga0207676_10981741
1226 Ga0207674_10098971
1227 Ga0207674_10290433
1228 Ga0207674_10403935
1229 Ga0207674_11187794
1230 Ga0207675_100174401
1231 Ga0207675_100407974
1232 Ga0207683_10112959
1233 Ga0207683_10354359
1234 Ga0207698_10443815
1235 Ga0207698_10569759
1236 Ga0207698_10662059
1237 Ga0207698_10665291
1238 Ga0207698_11013209
1239 Ga0207698_11087231
1240 Ga0207698_11189043
1241 Ga0207698_11529103
1242 Ga0209813_10111501
1243 Ga0207428_10038487
1244 Ga0207428_10323720
1245 Ga0268266_10059549
1246 Ga0268266_10194366
1247 Ga0268266_11055210
1248 Ga0268265_10014096
1249 Ga0268265_10597862
1250 Ga0265337_1001081
1251 Ga0265326_10008426
1252 Ga0265319_1035243
1253 Ga0265334_10011195
1254 Ga0265323_10080550
1255 Ga0265322_10042845
1256 Ga0265336_10047115
1257 Ga0265338_10005167
1258 Ga0265338_10135362
1259 Ga0265324_10005170
1260 Ga0265332_10028568
1261 Ga0265320_10062301
1262 Ga0265325_10080785
1263 Ga0265340_10031688
1264 Ga0265339_10061251
1265 Ga0265327_10001529
1266 Ga0265327_10012095
1267 Ga0265316_10354648
1268 Ga0307408_100069291
1269 Ga0265313_10065838
1270 Ga0265314_10188715
1271 Ga0265342_10057094
1272 Ga0307405_10190644
1273 Ga0307405_11560083
1274 Ga0307413_10388653
1275 Ga0307413_10564091
1276 Ga0307413_11313093
1277 Ga0307413_11636764
1278 Ga0307410_10096689
1279 Ga0307410_10189210
1280 Ga0307406_10055554
1281 Ga0307406_11539482
1282 Ga0307407_10024058
1283 Ga0307412_10095744
1284 Ga0307409_100218541
1285 Ga0307409_100526256
1286 Ga0307409_100611257
1287 Ga0307409_100641587
1288 Ga0307416_100215122
1289 Ga0307416_101382125
1290 Ga0307414_10032345
1291 Ga0307414_10430525
1292 Ga0307411_10053987
1293 Ga0307411_10231771
1294 Ga0307415_100004477
1295 Ga0307415_100104683
1296 Ga0307415_100374374
1297 Ga0373930_0002372
1298 Ga0373928_0000685
1299 Ga0373929_0004172
1300 Ga0373929_0105290
1301 Ga0373923_0602636
1302 Ga0373932_0000052
1303 Ga0373936_0124044
1304 Ga0373945_0101227
1305 Ga0373957_0184788
1306 Ga0373943_0254761
1307 Ga0373946_0500001
1308 Ga0373955_0697454
1309 Ga0373924_0495908
1310 Ga0373931_0000006
1311 Ga0373931_0100955
1312 Ga0373935_0325054
1313 Ga0373935_0425986
1314 Ga0373927_0481890
1315 Ga0373933_1030300
1316 Ga0373947_0234687
1317 Ga0373937_0682542
1318 Ga0373925_0921487
1319 Ga0395900_0096030
1320 Ga0395900_0677479
1321 Ga0395898_0008302
1322 Ga0395905_0030953
1323 Ga0395905_0671853
1324 Ga0395901_0133605
1325 Ga0395901_1214540
1326 Ga0395901_1687212
1327 Ga0436362_1038024
1328 Ga0439466_0055784
1329 Ga0439465_0065778
1330 Ga0451793_0987011
1331 Ga0451793_1498796
1332 Ga0451797_0619213
1333 Ga0451797_1174252
1334 Ga0451800_1312479
1335 Ga0451800_1450803
1336 Ga0451837_0398647
1337 Ga0451837_0483282
1338 Ga0451847_0001171
1339 Ga0451843_1254936
1340 Ga0451843_1507808
1341 Ga0451853_0449965
1342 Ga0451853_2409708
1343 Ga0439431_0003720
1344 Ga0439455_0127921
1345 Ga0439462_0190933
1346 Ga0450888_039048
1347 Ga0439434_0014998
1348 Ga0451577_0001481
1349 Ga0466972_0242794
1350 Ga0466972_0242901
1351 Ga0466965_0004254
1352 Ga0466965_0170974
1353 Ga0466965_0215856
1354 Ga0466961_0141871
1355 Ga0466963_0070725
1356 Ga0466963_0135975
1357 Ga0466963_0264015
1358 Ga0466963_0288198
1359 Ga0466963_0401193
1360 Ga0466963_0415778
1361 Ga0453684_0306225
1362 Ga0466971_0192581
1363 Ga0466971_0371347
1364 Ga0466968_0000655
1365 Ga0466970_0076831
1366 Ga0466970_0296777
1367 Ga0466970_0549932
1368 Ga0466957_0027535
1369 Ga0466957_0100307
1370 Ga0466957_0180236
1371 Ga0466957_0499238
1372 Ga0466957_0795179
1373 Ga0466957_0993404
1374 Ga0466960_0074798
1375 Ga0466960_0400669
1376 Ga0466959_0032588
1377 Ga0466959_0168896
1378 Ga0466959_0794380
1379 Ga0466958_0067032
1380 Ga0466958_0113101
1381 Ga0466958_0234229
1382 Ga0466958_0264964
1383 Ga0466958_0508829
1384 Ga0466958_0945439
1385 Ga0466967_0074216
1386 Ga0466967_0090812
1387 Ga0466967_0138411
1388 Ga0466967_0265361
1389 Ga0466967_0383748
1390 Ga0466967_0421446
1391 Ga0466967_0470193
1392 Ga0466967_0569720
1393 Ga0466967_0643277
1394 Ga0466967_0666620
1395 Ga0466967_0965414
1396 Ga0466967_1778529
1397 Ga0466967_1897981
1398 Ga0495592_0021893
1399 Ga0495603_0652689
1400 Ga0495629_0335348
1401 Ga0495651_0000629
1402 Ga0495653_0001785
1403 Ga0495653_0336082
1404 Ga0495582_0098804
1405 Ga0495662_0046545
1406 Ga0495664_0011722
1407 Ga0495664_0241643
1408 Ga0495664_0268500
1409 Ga0495664_0429905
1410 Ga0495608_0005666
1411 Ga0495618_0012354
1412 Ga0495618_0152834
1413 Ga0495628_0008037
1414 Ga0495628_0332029
1415 Ga0495630_0010227
1416 Ga0495652_0004825
1417 Ga0495652_0109058
1418 Ga0495652_0178968
1419 Ga0495652_0733347
1420 Ga0495640_0007325
1421 Ga0495586_0359667
1422 Ga0495587_0016580
1423 Ga0495645_0003986
1424 Ga0495645_0077954
1425 Ga0495667_0000487
1426 Ga0495667_0087674
1427 Ga0495667_0370200
1428 Ga0495634_0019117
1429 Ga0495635_0157549
1430 Ga0495635_0295341
1431 Ga0495635_0450914
1432 Ga0495657_0002166
1433 Ga0495599_0000894
1434 Ga0495599_0114062
1435 Ga0495599_0244221
1436 Ga0495623_0035010
1437 Ga0495646_0015193
1438 Ga0495646_0444157
1439 Ga0495658_0517002
1440 Ga0495613_0497079
1441 Ga0495600_0074302
1442 Ga0495581_0352288
1443 Ga0495581_0426033
1444 Ga0495604_0026231
1445 Ga0495674_0005002
1446 Ga0495674_0005333
1447 Ga0495674_0145980
1448 Ga0495680_0001938
1449 Ga0495680_0229079
1450 Ga0495680_0522928
1451 Ga0495675_0020658
1452 Ga0495684_0007645
1453 Ga0495684_0338639
1454 Ga0495602_0051783
1455 Ga0495602_0441780
1456 Ga0495602_1104394
1457 Ga0495614_0291251
1458 Ga0496100_0042900
1459 Ga0496100_0198158
1460 Ga0496100_0866056
1461 Ga0496100_1237855
1462 Ga0496101_0192942
1463 Ga0496102_0021211
1464 Ga0496102_0232549
1465 Ga0496103_0115954
1466 Ga0496103_0358046
1467 Ga0496104_0028698
1468 Ga0496104_0049942
1469 Ga0496105_0079333
1470 Ga0496105_0099608
1471 Ga0496105_0859709
1472 Ga0496105_0983582
1473 Ga0496106_1027984
1474 Ga0496107_0420217
1475 Ga0496108_0073714
1476 Ga0496108_0086438
1477 Ga0496108_0227884
1478 Ga0496108_0438795
1479 Ga0496108_0461933
1480 Ga0496109_0070477
1481 Ga0496109_0087676
1482 Ga0496109_0173964
1483 Ga0496109_0244942
1484 Ga0496109_0377455
1485 Ga0496109_0607427
1486 Ga0496109_1731427
1487 Ga0496110_0018855
1488 Ga0496110_0056502
1489 Ga0496110_0266591
1490 Ga0496110_0485995
1491 Ga0496110_1404712
1492 Ga0496111_0488152
1493 Ga0496112_0046454
1494 Ga0496112_0470900
1495 Ga0496112_0649737
1496 Ga0496113_0003886
1497 Ga0496113_0027863
1498 Ga0496113_0107809
1499 Ga0496114_0001257
1500 Ga0496114_0005559
1501 Ga0496114_0049615
1502 Ga0496114_0101098
1503 Ga0496114_0145120
1504 Ga0496114_0192686
1505 Ga0496114_0359854
1506 Ga0496114_0654236
1507 Ga0496114_1295874
1508 Ga0496115_0060444
1509 Ga0496115_0128903
1510 Ga0496115_0920874
1511 Ga0496120_0031799
1512 Ga0496122_0007968
1513 Ga0496123_0002184
1514 Ga0496126_0004904
1515 Ga0496126_0460715
1516 Ga0501031_0021209
1517 Ga0501032_0093019
1518 Ga0501033_0030985
1519 Ga0501036_0002982
1520 Ga0501036_1553494
1521 Ga0501038_0016723
1522 Ga0501039_0008000
1523 Ga0501039_0575713
1524 Ga0501040_0020193
1525 Ga0501041_0002110
1526 Ga0501042_0172945
1527 Ga0501043_1332594
1528 Ga0501046_0105645
1529 Ga0501047_0000031
1530 Ga0501048_0032523
1531 Ga0501068_0386646
1532 Ga0501069_0115303
1533 Ga0501069_0322957
1534 Ga0501070_0333434
1535 Ga0501070_0423806
1536 Ga0501072_0005231
1537 Ga0501073_0077232
1538 Ga0501073_0169786
1539 Ga0501074_0269385
1540 Ga0501074_0639199
1541 Ga0501075_0011436
1542 Ga0501076_0013738
1543 Ga0501077_0550255
1544 Ga0501079_0020323
1545 Ga0501079_0128732
1546 Ga0501080_0057411
1547 Ga0501080_0667651
1548 Ga0501081_0023721
1549 Ga0501045_0001680
1550 nmdc:mga03683_135243_c1
1551 nmdc:mga03683_649580_c1
1552 nmdc:mga03n38_120934_c1
1553 nmdc:mga03n38_418945_c1
1554 nmdc:mga03n38_44594_c1
1555 nmdc:mga03n38_521307_c1
1556 nmdc:mga03n38_5797_c1
1557 nmdc:mga03n38_7918_c1
1558 nmdc:mga03n38_81354_c1
1559 nmdc:mga00v17_113813_c1
1560 nmdc:mga00v17_136079_c1
1561 nmdc:mga00v17_17544_c1
1562 nmdc:mga00v17_271239_c1
1563 nmdc:mga00v17_340572_c1
1564 nmdc:mga00v17_60684_c1
1565 nmdc:mga00v17_6998_c1
1566 nmdc:mga0yw44_249836_c1
1567 nmdc:mga0yw44_60626_c1
1568 nmdc:mga0yw44_60954_c1
1569 nmdc:mga0yw44_635800_c1
1570 nmdc:mga0yw44_71102_c1
1571 nmdc:mga06z11_279041_c1
1572 nmdc:mga06z11_313449_c1
1573 nmdc:mga06z11_96306_c1
1574 nmdc:mga04h51_141891_c1
1575 nmdc:mga07m45_114224_c1
1576 nmdc:mga07m45_15915_c1
1577 nmdc:mga07m45_259862_c1
1578 nmdc:mga07m45_47175_c1
1579 nmdc:mga05p37_105560_c1
1580 nmdc:mga09592_138687_c1
1581 nmdc:mga09592_9300_c1
1582 nmdc:mga0qj67_93695_c1
1583 nmdc:mga08y16_2138993_c1
1584 nmdc:mga08y16_221656_c1
1585 nmdc:mga08y16_6100_c1
1586 nmdc:mga0n895_110595_c1
1587 nmdc:mga0rr50_7016_c1
1588 nmdc:mga0rr50_908439_c1
1589 nmdc:mga0a205_11958_c1
1590 nmdc:mga0a205_16179_c1
1591 Ga0495601_0127463
1592 Ga0495601_0505663
1593 Ga0495601_0700988
1594 Ga0495612_0234737
1595 Ga0495612_0239492
1596 Ga0495595_0004452
1597 Ga0495595_0054662
1598 Ga0495619_1070499
1599 Ga0501084_0179625
1600 Ga0466962_0335166
1601 Ga0466962_0624104
1602 Ga0530510_0007328

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jx7-assembly1.cif.gz_E crystal structure of ychn protein from e.coli 0.8275 1 119
1jx7-assembly1.cif.gz_E crystal structure of ychn protein from e.coli 0.8213 1 119
3pnx-assembly2.cif.gz_E crystal structure of a putative sulfurtransferase dsre (swol_2425) from syntrophomonas wolfei str. goettingen at 1.92 a resolution 0.8097 1 119
2qs7-assembly2.cif.gz_D crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution 0.8076 1 119
3pnx-assembly2.cif.gz_E crystal structure of a putative sulfurtransferase dsre (swol_2425) from syntrophomonas wolfei str. goettingen at 1.92 a resolution 0.8033 1 119
ID Description Score Start End Superfamily
af_Q22181_1_272_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8875 2 38 3.40.50.2000
af_Q58170_143_270_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8781 2 115 3.40.1260.10
af_Q22180_1_276_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8458 1 38 3.40.50.2000
af_Q58396_1_114_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8423 3 119 3.40.1260.10
af_Q58170_143_270_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.838 2 115 3.40.1260.10
ID Description Score Start End GO Terms
AF-A1SLX6-F1-model_v4 Peroxiredoxins-like protein 0.9999 1 119
AF-A0A1I4ZLF0-F1-model_v4 Predicted peroxiredoxin 0.9989 1 119
AF-A0A850CJB2-F1-model_v4 Peroxiredoxin 0.9962 17 119
AF-Q0RSC7-F1-model_v4 Uncharacterized protein 0.9953 2 119
AF-A0A1H5MH28-F1-model_v4 Predicted peroxiredoxin 0.995 3 119

Map